>gi|26553599|ref|NP_757533.1| cell cycle protein MesJ [Mycoplasma penetrans HF-2] >gi|61216654|sp|Q8EWQ7|TILS_MYCPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|26453605|dbj|BAC43937.1| predicted cell cycle protein MesJ [Mycoplasma penetrans HF-2] (295 aa)
Score = 1266, Expect = 1.5e-137, Identities = 295/295 (100%), Positives = 295/295 (100%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKILYSIC 295
           MKHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKILYSIC
  S:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKILYSIC 295
>gi|13357633|ref|NP_077907.1| hypothetical protein UU077 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|61217428|sp|Q9PR68|TILS_UREPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|11356774|pir||A82937 conserved hypothetical UU077 [imported] - Ureaplasma urealyticum >gi|6899028|gb|AAF30482.1|AE002107_6 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (333 aa)
Score = 454, Expect = 2.5e-43, Identities = 114/288 (39%), Positives = 174/288 (60%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFL-NHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKIL 291
           KYL AVSGGPDSMA+LN  +  +  VCHVNYH RE SD D++IV D+C+K NL + + D  +    +Y  I+N QT  R IRYDFF++I ++  I+ + IAH  +DFLE+AYM   +  K LF GI+  +    +I+ RP+L   K++L++YC    I++ ID TN  D Y RN VRK+++ W       F   V  +N ++  F   +D  +  + K  +  +YF++  +  +  LIY FL +H  I P+ENKI  +I+F  K  N   K YR++EN ++ + + +++
  S:    19 KYLAAVSGGPDSMAMLNMYKRNIRVVCHVNYHKRESSDRDQQIVVDFCRKNNLIIEILDVDEKVYERYGHIDNFQTKARLIRYDFFKEIGKKYNIENLYIAHNFDDFLETAYMQRARQSKALFYGIKESNVINGIIVKRPVLFVRKQTLQRYCDENKIKYGIDETNELDIYERNRVRKIISSWSLNEVYDFKKFVIKYNKEHSSFANFIDLSYIEFKKNKYKYDYFIRQDDMVQYYLIYYFLIDHKIINPSENKIISLIKFFGKQINKE-KAYRVQENIYMHVNDDELI 306
>gi|144575199|gb|AAZ44022.2| conserved hypothetical protein [Mycoplasma synoviae 53] (291 aa)
Score = 379, Expect = 9.7e-35, Identities = 119/290 (41%), Positives = 170/290 (58%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNK-TKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNEN--KIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKI 290
           M+ KYLIAVSGG DSM LL+K +H    V HVNY+ R DS+ DE++VR+YC+K N+KL +   +K D  K     N Q W R+ RY FFEK+ ++    K+LIAH K DFLE+ YM    NK N F GI+++S    + + RP L K TKK + ++CR   I +  DY+NF  +Y+RN+VRK + + +       +LKV   N   +F  K +  KF N  + +F I  F   K  Y   LIYL+L+ + +  N N  KI  +  FI  +K    K+Y L++  +++ K  KI
  S:     1 METKYLIAVSGGADSMFLLDKYKHKNIIVAHVNYNQRNDSNFDEELVRNYCEKNNIKLEILSLNKQDFLK----GNFQDWARKARYSFFEKVYKKHNCNKLLIAHHKLDFLETYYMQKESNKMNFFYGIKKRSFIFDMHVYRPFLYKYTKKQICKFCRKNKIPYRDDYSNFESKYTRNIVRKSLLQKNLFLLNLTFLKVVLINFFKLFKYKKVTKKFENLKQHNFQIKDF---KGRYLNELIYLYLSELNLDLNINKHKILSVKSFILSDKTN--KEYLLEKKYYLQKKQNKI 284
>gi|71894625|ref|YP_278733.1| hypothetical protein MS53_0615 [Mycoplasma synoviae 53] (286 aa)
Score = 366, Expect = 3.9e-33, Identities = 115/285 (40%), Positives = 166/285 (58%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNK-TKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNEN--KIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKI 290
           +IAVSGG DSM LL+K +H    V HVNY+ R DS+ DE++VR+YC+K N+KL +   +K D  K     N Q W R+ RY FFEK+ ++    K+LIAH K DFLE+ YM    NK N F GI+++S    + + RP L K TKK + ++CR   I +  DY+NF  +Y+RN+VRK + + +       +LKV   N   +F  K +  KF N  + +F I  F   K  Y   LIYL+L+ + +  N N  KI  +  FI  +K    K+Y L++  +++ K  KI
  S:     1 MIAVSGGADSMFLLDKYKHKNIIVAHVNYNQRNDSNFDEELVRNYCEKNNIKLEILSLNKQDFLK----GNFQDWARKARYSFFEKVYKKHNCNKLLIAHHKLDFLETYYMQKESNKMNFFYGIKKRSFIFDMHVYRPFLYKYTKKQICKFCRKNKIPYRDDYSNFESKYTRNIVRKSLLQKNLFLLNLTFLKVVLINFFKLFKYKKVTKKFENLKQHNFQIKDF---KGRYLNELIYLYLSELNLDLNINKHKILSVKSFILSDKTN--KEYLLEKKYYLQKKQNKI 279
>gi|13507961|ref|NP_109910.1| PP-loop superfamily protein ATPase [Mycoplasma pneumoniae M129] >gi|2496288|sp|P75549|TILS_MYCPN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|1674311|gb|AAB96257.1| PP-loop superfamily ATPase/cell cycle protein MESJ-like protein [Mycoplasma pneumoniae M129] (289 aa)
Score = 342, Expect = 2.1e-30, Identities = 90/289 (31%), Positives = 149/289 (51%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKI 290
           K +Y+  VSGGPDSM LL      +  V HVNY+ R  +  D+K+V +YCK+  + L V    +D V K     N Q   R+IR++ F+K +    + K+L+AH ++DF+E A M L+  K+ ++ GI+ + +   + + RP +   K  +   C    + + ID TN    Y RN VR+ +A W K+  ++FY+ V   N      +  L  +   W+    D+    +     +  L+Y FL    I    +KI+ I++FI   +    K YRLK+  F+ IK++++
  S:     3 KTQYIAGVSGGPDSMLLLKLYHKKIACVVHVNYNKRTTALRDQKMVEEYCKQLKVPLIVHTVPEDTVWK----KNFQAQARKIRFEQFQKAASLYKVDKLLLAHHRDDFIEQAKMQLDARKRAMYYGIKTRGELYGMKVYRPFIKYWKNEILALCEEHKVPYGIDETNAQPIYKRNQVRQEIANWSKEEKEEFYIGVCAMNRVIGQKLFSLMKRAKQWLAHP-DVRELKRYPLPDQRQLVYSFLITHHIDVTGDKIDAILDFIQPFQQ---KHYRLKDEIFLSIKDERL 283
>gi|31544871|ref|NP_853449.1| hypothetical protein MGA_0507 [Mycoplasma gallisepticum R] >gi|61216586|sp|Q7NAI9|TILS_MYCGA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|31541717|gb|AAP57017.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (287 aa)
Score = 341, Expect = 3.1e-30, Identities = 95/282 (33%), Positives = 151/282 (53%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFI 283
           K +YLI VSGGPDS+ LL++ +  ++  CH+NY+ R  +  D+ IV DYC K  + L +          Y+   N Q   R+IRYDFF     +  + + LIAH K+DFLE+A M  +KN++ LF G+ ++S ++SL + RPLLN  K  +  Y     I + +D +NF   Y RN +R  +++  ++  Q         N KN    + +   F++W     D NY   I +    +L+YL+ +   IK ++ K E I+ F+ K  N   K++RLK   ++
  S:     6 KKQYLIGVSGGPDSIYLLDRYQDQIKVACHINYNKRPTALRDQLIVSDYCLKNKIPLEILSVS----PSYQYHKNFQDQARKIRYDFFLSTGLKYQVDQCLIAHHKDDFLETAIMQYDKNQELLFYGLHQESSYQSLKIFRPLLNLWKDEILSYLEQDKIVYGVDESNFLSTYQRNKIRTNLSKLSQEQKQARLDFFLELNKKNQVRYQSVKDFFSSW-----DCNYLDLINSLEYYNLLYLWFSKNNIKYSKQKAENILSFLQKKNN---KRFRLKAGVYL 275
>gi|12044936|ref|NP_072746.1| tRNA(Ile)-lysidine synthetase [Mycoplasma genitalium G37] >gi|1351480|sp|P47330|TILS_MYCGE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3844671|gb|AAC71302.1| tRNA(Ile)-lysidine synthetase [Mycoplasma genitalium G37] >gi|166078989|gb|ABY79607.1| tRNA(Ile)-lysidine synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (290 aa)
Score = 339, Expect = 4.8e-30, Identities = 94/287 (32%), Positives = 153/287 (53%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNK 288
           + +Y+  VSGG DSM +L   +  +  V HVNY+ R  S  D+K+V  YC+K N+ L V     D V K     N Q   R+IR+D F+K ++     K+L+AH ++DF+E A M L+  K+ ++ GI+ + +   L + RPL+   K  +   CR  +I + ID TN    Y RN VR  + +W K   ++FY+ +   N      + +L  K   W+ Q  D+    +     ++ LIY +L +  I  N  KI+ I++FI  ++    K+YRL+ + F+ +KN+
  S:     4 EKQYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVEQYCQKLNIPLVVHTVDPDLVWK----KNFQNQARKIRFDQFKKTAKLYQTNKLLLAHHRDDFIEQAKMQLDAKKRAVYYGIKTRCELYGLKIYRPLMKYWKDEIIALCRQDHIPYEIDETNKLPIYKRNEVRLEIEKWSKIEKEQFYIAICAMNKTIAQKLFVLMKKAKKWLLQP-DVRELKRFSIIDQKQLIYSYLIYHKINVNGEKIDAILDFIQPSQQ---KQYRLQNDIFLMVKNQ 282
>gi|144227507|gb|AAZ44292.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (297 aa)
Score = 306, Expect = 2.9e-26, Identities = 91/263 (34%), Positives = 144/263 (54%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLN-KTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFI 264
           K KYLI VSGG DSM LLNK ++    V H+NY+ R ++  +  +V  +C+KYNL+L +          +K   NLQ+  R  RY FFEKI +E    K+L+ H ++DFLE+ ++   + K   F GI +K+   ++ ++RP L  +TKK + Q C+ K I ++ D +NF  +Y RN +R ++ +    +    +L     N+  +  +K       NW K  ++IN+F KIK   K   +++  N   +K    KI +II FI
  S:     8 KEKYLIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILS-----FDSFKIKKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFLYWRTKKQIIQICQQKKIPYLDDQSNFTGKYQRNQIRFLLEKKSDFSLFFLFLFYYLINIFKLIILKNQKKILQNWQKTGYNINFFKKIKIKSKIIFLFVNQNFDNVKLTRGKINEIINFI 266
>gi|144575318|gb|AAZ53579.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (297 aa)
Score = 303, Expect = 7.1e-26, Identities = 90/263 (34%), Positives = 144/263 (54%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLN-KTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFI 264
           K KYLI VSGG DSM LLNK ++    V H+NY+ R ++  +  +V  +C+KYNL+L +          +K   NLQ+  R  RY FFEKI +E    K+L+ H ++DFLE+ ++   + K   F GI +K+   ++ ++RP L  +TKK + + C+ K I ++ D +NF  +Y RN +R ++ +    +    +L     N+  +  +K       NW K  ++IN+F KIK   K   +++  N   +K    KI +II FI
  S:     8 KEKYLIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILS-----FDSFKIKKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFLYWRTKKQIIRICQQKRIPYLDDQSNFTGKYQRNQIRFLLEKKSDFSLFFLFLFYYLINIFKLIILKNQKKILQNWQKTGYNINFFKKIKIKSKIIFLFVNQNFDNVKLTRGKINEIINFI 266
>gi|54020383|ref|YP_115689.1| hypothetical protein mhp176 [Mycoplasma hyopneumoniae 232] >gi|61216451|sp|Q601M6|TILS_MYCH2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|53987556|gb|AAV27757.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (297 aa)
Score = 303, Expect = 8.0e-26, Identities = 90/263 (34%), Positives = 144/263 (54%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLN-KTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFI 264
           K KYLI VSGG DSM LLNK ++    V H+NY+ R ++  +  +V  +C+KYNL+L +          +K   NLQ+  R  RY FFEKI +E    K+L+ H ++DFLE+ ++   + K   F GI +K+   ++ ++RP L  +TKK + + C+ K I ++ D +NF  +Y RN +R ++ +    +    +L     N+  +  +K       NW K  ++IN+F KIK   K   +++  N   +K    KI +II FI
  S:     8 KEKYLIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILS-----FDSFKIKKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFLYWRTKKQIIRICQQKKIPYLDDQSNFTGKYQRNQIRFLLEKKSDFSLFFLFLFYYLINIFKLIILKNQKKILQNWQKTGYNINFFKKIKIKSKIIFLFVNQNFDNVKLTRGKINEIINFI 266
>gi|15829251|ref|NP_326611.1| hypothetical protein MYPU_7800 [Mycoplasma pulmonis UAB CTIP] >gi|61216719|sp|Q98PE3|TILS_MYCPU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|14090195|emb|CAC13953.1| conserved hypothetical protein [Mycoplasma pulmonis] (286 aa)
Score = 296, Expect = 5.0e-25, Identities = 106/286 (37%), Positives = 166/286 (58%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKT-KKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK--FYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLN---HIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKIL 291
           LIAVSGGPDSM LL+  +H    V HVNY+ R  S  D+KIV DYC K N+KL +      +++ Y+   N   W R+ R+DFF+ + ++    +IL+AH K+DF+E+  +  N+ +K L+  I+ K+    + + RP ++K  K  + +   +K I F  D TN  + Y RN +R  +     K F K   Y+K+ + N   +  IK ++  FN W +Q+FD   FLK K  ++E+LI +F++   +  I  +  KI+QII+FIN  KN   +K  +   +F  +K KKI+
  S:     3 LIAVSGGPDSMLLLDVFKHHDIVVAHVNYNKRNSSKRDQKIVEDYCFKNNIKLEIL-----NLTDYEVKGNFHDWARKKRFDFFKLVYEKYNCDEILLAHHKDDFVETFLIQKNQKRKPLYWSIKSKNFNFGMNINRPFIHKYWKNQILKILDNKQIFFGQDETNKENIYLRNKIRNNLL---NKEFLKRLIYIKILFLNFFKLRKIKKIEQDFNKWKEQNFDKQNFLKSK--FQENLITIFISEKTNNSINLSRGKIQQIIKFINSEKN---EKKFILNKEFYLVKAKKII 281
>gi|71893557|ref|YP_279003.1| hypothetical protein MHJ_0201 [Mycoplasma hyopneumoniae J] (286 aa)
Score = 294, Expect = 8.0e-25, Identities = 87/259 (33%), Positives = 141/259 (54%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLN-KTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFI 264
           +I VSGG DSM LLNK ++    V H+NY+ R ++  +  +V  +C+KYNL+L +          +K   NLQ+  R  RY FFEKI +E    K+L+ H ++DFLE+ ++   + K   F GI +K+   ++ ++RP L  +TKK + Q C+ K I ++ D +NF  +Y RN +R ++ +    +    +L     N+  +  +K       NW K  ++IN+F KIK   K   +++  N   +K    KI +II FI
  S:     1 MIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILS-----FDSFKIKKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFLYWRTKKQIIQICQQKKIPYLDDQSNFTGKYQRNQIRFLLEKKSDFSLFFLFLFYYLINIFKLIILKNQKKILQNWQKTGYNINFFKKIKIKSKIIFLFVNQNFDNVKLTRGKINEIINFI 255
>gi|50365488|ref|YP_053913.1| lysidine synthetase [Mesoplasma florum L1] >gi|61216500|sp|Q6F0E4|TILS_MESFL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|50364044|gb|AAT76029.1| lysidine synthetase [Mesoplasma florum L1] (398 aa)
Score = 293, Expect = 1.1e-24, Identities = 84/200 (42%), Positives = 126/200 (63%)
  Q:     5 YLIAVSGGPDSMALLNK--KRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK 204
           YL+AVSGGPDSM +LN+  K ++ E  VCHVNY+ REDS  D+K+V D+C K NLKL     ++D  SK K+  N ++W R IRYDFF +IS++  I+ +LIAH +ND +E+  +  ++       G+ + S ++ + ++RP+LN  K  + +  + +NI FVID TN   +Y RN +R  ++E    TF  F   +K  N K
  S:    12 YLVAVSGGPDSMFMLNELIKMNIKEIVVCHVNYNFREDSWKDQKLVEDFCLKNNLKLEKLIINQD-YSKLKE--NFESWARNIRYDFFVEISKKYNIQNVLIAHNRNDLVETFLLQQDRKGYVKHYGLNKTSTYKEITIVRPMLNILKSEILKSLKEENIAFVIDSTNEDKKYKRNKIRANLSE---STFNDFEETIKKLNKK 208
>gi|72080544|ref|YP_287602.1| hypothetical protein MHP7448_0205 [Mycoplasma hyopneumoniae 7448] (286 aa)
Score = 291, Expect = 1.8e-24, Identities = 86/259 (33%), Positives = 141/259 (54%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLN-KTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFI 264
           +I VSGG DSM LLNK ++    V H+NY+ R ++  +  +V  +C+KYNL+L +          +K   NLQ+  R  RY FFEKI +E    K+L+ H ++DFLE+ ++   + K   F GI +K+   ++ ++RP L  +TKK + + C+ K I ++ D +NF  +Y RN +R ++ +    +    +L     N+  +  +K       NW K  ++IN+F KIK   K   +++  N   +K    KI +II FI
  S:     1 MIGVSGGSDSMFLLNKYKNQDVIVAHINYNLRPEAIFETLLVSKFCQKYNLELKILS-----FDSFKIKKNLQSGLRLGRYQFFEKIYKEFNCTKLLVGHHRDDFLETVFLQKKQKKIVTFWGIHKKNNLFNMEILRPFLYWRTKKQIIRICQQKRIPYLDDQSNFTGKYQRNQIRFLLEKKSDFSLFFLFLFYYLINIFKLIILKNQKKILQNWQKTGYNINFFKKIKIKSKIIFLFVNQNFDNVKLTRGKINEIINFI 255
>gi|148378008|ref|YP_001256884.1| hypothetical protein MAG7460 [Mycoplasma agalactiae PG2] >gi|148292054|emb|CAL59446.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] (286 aa)
Score = 279, Expect = 5.0e-23, Identities = 88/287 (30%), Positives = 151/287 (52%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKT-KKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFI-NKNKNGSVKKYRLKENQFIEIKNKKILY 292
           L+ +SGGPDSM LL+    +     V  VNY+ R+DS  D +IVR +C+   +     +  +    K     N + W RE R+ FF+KI ++   + + +AH K+DFLES +M     ++  F GI+ ++    + ++RPL+ K  K  + +   +K I++  DYTN    Y+RN +R  +         K +  V+  N +     K    ++  W K  F  + FL + N  + +  ++  N++ IK +  KI+ II FI +KN+ G   +Y +K N FI+ K+ K+++
  S:     3 LLGISGGPDSMYLLDLISSQRSDIVVATVNYNVRQDSAYDVEIVRKFCEDKGIIFECLEIDQKACFK----GNFEKWAREQRFAFFKKIYEKYNCEALYLAHHKDDFLESYFMQKESKRQPDFFGIKTENYIYGMKVVRPLVGKVFKNEILEALHNKKIKYANDYTNDLPIYTRNRIRIWLKSLSNSQKSKIFDDVQKENNELAELEKETVLEYEQWKKTQFSQDEFLNLNNKERLAYKFVHENYVDIKLSNGKIKSIIGFILSKNRTG---QYLIKNNVFIQKKHGKLVF 286
>gi|83319710|ref|YP_424013.1| hypothetical protein MCAP_0014 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283596|gb|ABC01528.1| conserved hypothetical protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (401 aa)
Score = 273, Expect = 2.4e-22, Identities = 74/182 (40%), Positives = 117/182 (64%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA----VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           KYL+A+SGGPDS+ LL     ++++    VCHVNY+ R DS ND+KIV + CKK++LKL + + +KD  S  K+  N ++W R  RYDFF KI+++  I  +L+AH  ND +E+  + L +N    + G++  S ++ L++ RPLL+  K  +  Y ++  I + ID TN   +Y RN +R ++ E
  S:    11 KYLLAISGGPDSVFLLCNIVKIIDSKNLVVCHVNYNFRSDSINDQKIVINLCKKFDLKLEILNINKD-YSLLKE--NFESWARFQRYDFFNKIAKKYQIYNLLVAHNFNDLIETYLLQLQRNNLVDYYGLKTVSHYKDLVVYRPLLDIKKSEILDYLKTNQISYAIDSTNTDIKYQRNKIRSIIDE 193
>gi|42560602|ref|NP_975053.1| hypothetical protein MSC_0042 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61216536|sp|Q6MUI9|TILS_MYCMS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|42492098|emb|CAE76695.1| Conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (401 aa)
Score = 271, Expect = 3.6e-22, Identities = 75/182 (41%), Positives = 110/182 (60%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           KYLIAVSGGPDS+ LL     LV+     VCHVNY+ R DS+ND+ IV + CK+ NLKL + + +KD  S  K   N ++W R  RYDFF  I+ +  I  +L+AH  ND +E+  + L +N    + G++  S ++ L++ RPLL+  K  +  Y  +  I + +D TN   +Y RN +R  + E
  S:    11 KYLIAVSGGPDSVFLLCNIVKLVDPNDLVVCHVNYNFRSDSNNDQMIVTNLCKQLNLKLEILNINKD-YSLLK--QNFESWARAQRYDFFNMIASKYQIYNLLVAHNLNDLIETYLLQLQRNNLVDYYGLKPVSHYKDLVVYRPLLDIKKSQILNYLNTNKISYAVDSTNSDIKYQRNKIRATLNE 193
>gi|56961886|ref|YP_173608.1| cell-cycle protein [Bacillus clausii KSM-K16] >gi|61216430|sp|Q5WAE0|TILS_BACSK tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56908120|dbj|BAD62647.1| cell-cycle protein [Bacillus clausii KSM-K16] (469 aa)
Score = 258, Expect = 1.1e-20, Identities = 70/186 (37%), Positives = 106/186 (56%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLF-LGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEW 186
           M+   L+AVSGGPDSMALL    +L E         HVN+  R E+S+ D ++V+ +  +  +   V D    DV+ +K  +++  Q   R +RY  F+   + +    +L AH  +D +E+A+M L +    L  LGI     F + +L RPLL +TK+S+  YC  K I + ID +NF D Y+RN  R  MA +
  S:    17 METNVLVAVSGGPDSMALLAIMANLREKWKLNLFGVHVNHRLRGEESNKDAELVQSFSARLGVPCNVKDV---DVAAFKAEHHVGTQQAARALRYQVFQGEMERVHATVLLTAHHGDDEVETAFMKLTRGTTPLTKLGIAATRPFANGVLARPLLEETKRSIVAYCHEKAIPYRIDQSNFSDAYTRNRFRMNMAPY 209
>gi|29347003|ref|NP_810506.1| putative cell-cycle protein [Bacteroides thetaiotaomicron VPI-5482] >gi|61216643|sp|Q8A7D1|TILS_BACTN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29338901|gb|AAO76700.1| putative cell-cycle protein [Bacteroides thetaiotaomicron VPI-5482] (426 aa)
Score = 251, Expect = 7.8e-20, Identities = 66/177 (37%), Positives = 105/177 (59%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVC---HVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+A+SGG DS+ALL +  H     C   H N+H R E+S+ DE+ VR  C+KY ++L + D +    +  K I+ ++   RE+RY++FEKI +E G   I +AH ++D +E+   +L +       LGIR     R+  ++RPLL   ++ + +Y +    +FV D TN  D Y+RN +R
  S:    21 KLLVALSGGADSVALL-RVLHTAGYQCEAAHCNFHLRGEESNRDERFVRQLCQKYGIRLHITDFNTTQYATEKRIS-IEMAARELRYNWFEKIKEECGAHVIAVAHHQDDSVETMLFNLIRGTGITGLLGIRP----RNGAIVRPLLCINREEIIRYLQQIGQDFVTDSTNLEDEYTRNKIR 196
>gi|52078562|ref|YP_077353.1| tRNA(Ile)-lysidine synthetase [Bacillus licheniformis ATCC 14580] >gi|52783924|ref|YP_089753.1| YacA [Bacillus licheniformis ATCC 14580] >gi|61216472|sp|Q65PF4|TILS_BACLD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|52001773|gb|AAU21715.1| tRNA(Ile)-lysidine synthetase [Bacillus licheniformis ATCC 14580] >gi|52346426|gb|AAU39060.1| YacA [Bacillus licheniformis DSM 13] (476 aa)
Score = 240, Expect = 1.4e-18, Identities = 79/243 (32%), Positives = 127/243 (52%)
  Q:     6 LIA-VSGGPDSMALLNKKRHLVEA-----VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK----TFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQ------DFDINYFLKIKNNYKESLIYLFLNHI 248
           LIA VSGGPDSMALL+   H V A       HV++  R E+S+ D + V+DYC+   ++    +  + DV  +   NNL  Q   RE RY FF+++ +    + +++ H  +D +E+  M + K    + L GI+ K +F S  L+RP L  +K  L  YC+   I F  D +N  D Y+RN  R  +  + KK      ++F    ++     ++   L   K N  I        +  I   L +    +   ++L LN++
  S:    20 LIAGVSGGPDSMALLHALHHTVPASATLIAAHVDHMFRGEESERDMRFVQDYCEAEGIQC---EAVQIDVLAFAAENNLNKQAAARECRYAFFQELMKRHRAEYLVLGHHGDDQVETMLMKMAKGTVGIGLAGIQPKRRFDSGWLLRPFLKLSKDDLLAYCKENRIPFRTDPSNSEDDYTRNRFRHHVLPFLKKESEDVHKRFQSVSEFLTEDELYLQALTKDKMNTVITSKSSSGVEISIERLLALPMPLQRRGVHLILNYL 279
>gi|16799328|ref|NP_469596.1| hypothetical protein lin0251 [Listeria innocua Clip11262] >gi|61216704|sp|Q92F56|TILS_LISIN Bifunctional protein tilS/hprT [Includes: tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase); Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase)] >gi|16412680|emb|CAC95484.1| fusion protein, N-terminal part similar to B. subtilis YacA protein, C-terminal part similar to hypoxanthine-guanine phosphoribosyltransferase [Listeria innocua] (648 aa)
Score = 238, Expect = 2.7e-18, Identities = 86/268 (32%), Positives = 138/268 (51%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYRE----IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINY---------FLKIKNNYKESLIYLFL----NHIGIKPNENKIEQIIEFINKNKNGS 271
           K L+AVSGGPDS ALL+     +LV     AV H+N+H RE+++ ++  V+ +C++ ++  F+     ++V   K    LQ    E    +RYDFFEK+  E  I K+++AH  +D +E+  M L +   ++ + GI+ K + R    IRP L  TK  + +Y     + + ID +N    Y+RN  R  +  +  K     Y   K F+ +     + L+   +N +K++   N          F    N  +   I+L L    N  G     N I QII+ I      S
  S:    23 KLLVAVSGGPDSFALLHFLWSANLVPKEAIAVAHLNHHLRENAEKEQLAVQTFCEERDIPFFI-----EEVDVKKRAEKLQKGIEETARIVRYDFFEKVMAENNINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKREVRGGYAIRPFLPITKAEIIEYATKHALPYEIDESNTSQEYTRNRYRTQLLPFLSKENPAVYEHFKRFSEETSEDFQFLEELASNLLKKNLIQNGKQSTLLLSDFKNEANPLQRRAIHLLLMYLYNDDGRVITVNHIYQIIQMIQSENPSS 309
>gi|110003919|emb|CAK98259.1| hypothetical protein mesj of the pp-loop superfamily [Spiroplasma citri] (434 aa)
Score = 237, Expect = 3.4e-18, Identities = 69/177 (38%), Positives = 107/177 (60%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE-----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYK-DINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLIL------IRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           KY+I VSGGPDSM LL+   +         VC VNY  R+DSD DE+IV +YC+K N+K+ V      D  +Y+ + +N Q   RE+RYDFF +IS++   + +LIAH   D +E+  +   +N    + G+ + S + S +L       R +L  +++ + +Y   K I + ID TN    Y+RN++R
  S:    11 KYVIGVSGGPDSMFLLDNIYNSELDINNFIVCLVNYQKRKDSDYDEEIVVEYCQKRNIKICVKKVTASDYEQYQVNSHNFQAVARELRYDFFLQISEKYHCQGVLIAHNLTDHIETYILQKQRNGIVEYYGLNKTSYYYSQLLDKKLKIFRIMLKISREEIIEYLFHKQINYAIDSTNILAIYNRNIIR 199
>gi|47093161|ref|ZP_00230936.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b H7858] >gi|153200654|ref|ZP_01942761.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes HPB2262] >gi|21667249|gb|AAM74001.1|AF467001_2 YacA/HprT-like protein [Listeria monocytogenes] >gi|47018468|gb|EAL09226.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b H7858] >gi|133736602|gb|EBA38300.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes HPB2262] (648 aa)
Score = 231, Expect = 1.7e-17, Identities = 69/238 (28%), Positives = 129/238 (54%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLI 241
           K L+AVSGGPDS+ALL+     +LV     +V H+N+H RE++ N++ +V  +C+   +  ++ +   D  S+ + +   ++   R +RYDFFEK+  E  I K+ +AH  +D +E+  M L +   ++ + GI+ K + +    IRP L  TK  +  Y +   + + ID +N    Y+RN  R  +  + K+     Y   + F+ +     + L++  ++ +K++        IKN  + +L+
  S:    23 KLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHINHHLRENAANEQNVVEAFCESQGIPFYIEEV--DVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEALASDLLKKNL-------IKNGKRTTLL 259
>gi|46906451|ref|YP_012840.1| hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b F2365] >gi|61216556|sp|Q724J4|TILS_LISMF Bifunctional protein tilS/hprT [Includes: tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase); Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase)] >gi|46879715|gb|AAT03017.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 4b F2365] (648 aa)
Score = 229, Expect = 2.4e-17, Identities = 69/238 (28%), Positives = 129/238 (54%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLI 241
           K L+AVSGGPDS+ALL+     +LV     +V H+N+H RE++ N++ +V  +C+   +  ++ +   D  S+ + +   ++   R +RYDFFEK+  E  I K+ +AH  +D +E+  M L +   ++ + GI+ K + +    IRP L  TK  +  Y +   + + ID +N    Y+RN  R  +  + K+     Y   + F+ +     + L++  ++ +K++        IKN  + +L+
  S:    23 KLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHHLRENAANEQNVVETFCESQGIPFYIEEV--DVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEALASDLLKKNL-------IKNGKRTTLL 259
>gi|153165181|ref|ZP_01926199.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N1-017] >gi|133728500|gb|EBA30198.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N1-017] (648 aa)
Score = 229, Expect = 2.7e-17, Identities = 69/238 (28%), Positives = 129/238 (54%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLI 241
           K L+AVSGGPDS+ALL+     +LV     +V H+N+H RE++ N++ +V  +C+   +  ++ +   D  S+ + +   ++   R +RYDFFEK+  E  I K+ +AH  +D +E+  M L +   ++ + GI+ K + +    IRP L  TK  +  Y +   + + ID +N    Y+RN  R  +  + K+     Y   + F+ +     + L++  ++ +K++        IKN  + +L+
  S:    23 KLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHHLRENAANEQNVVEAFCESQGIPFYIEEV--DVKSRAESLQKGIEETARIVRYDFFEKVMAEKKINKLALAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEALASDLLKKNL-------IKNGKRTTLL 259
>gi|153808575|ref|ZP_01961243.1| hypothetical protein BACCAC_02871 [Bacteroides caccae ATCC 43185] >gi|149128897|gb|EDM20114.1| hypothetical protein BACCAC_02871 [Bacteroides caccae ATCC 43185] (426 aa)
Score = 229, Expect = 3.1e-17, Identities = 65/177 (36%), Positives = 103/177 (58%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVC---HVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+A+SGG DS+ALL +  H     C   H N+H R E+S+ DE  VR  C KYN++L   D +    +  K I+ ++   RE+RY++FE+I  +     I +AH ++D +E+  ++L +       LGIR     R+  ++RPLL   +K + QY ++   ++V D TN  D Y+RN +R
  S:    21 KILVALSGGADSVALL-RILHTAGYHCEAAHCNFHLRGEESNRDESFVRQLCLKYNIRLHTTDFNTTQYAAEKHIS-IEMAARELRYNWFEEIKNKYRADVIAVAHHQDDSIETMLLNLIRGTGITGLLGIRP----RNGAIVRPLLCVNRKEIIQYLQNIEQDYVTDSTNLEDEYTRNKIR 196
>gi|153172864|ref|ZP_01928838.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N3-165] >gi|133731388|gb|EBA33086.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes FSL N3-165] (648 aa)
Score = 227, Expect = 4.3e-17, Identities = 68/238 (28%), Positives = 130/238 (54%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLI 241
           K L+AVSGGPDS+ALL+     +LV     +V H+N+  RE++  ++++V  +C++  +  ++ +   D  S+ + +   L+   R +RYDFFEK+  E  I K+++AH  +D +E+  M L +   ++ + GI+ K + +    IRP L  TK  +  Y +   + + ID +N    Y+RN  R  +  + K+     Y   + F+ +     + L++  ++ +K++        IKN  + +L+
  S:    23 KLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEV--DIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEALASDLLKKNL-------IKNGKQTTLL 259
>gi|28209970|ref|NP_780914.1| cell cycle protein mesJ [Clostridium tetani E88] >gi|61216641|sp|Q899H5|TILS_CLOTE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|28202405|gb|AAO34851.1| cell cycle protein mesJ [Clostridium tetani E88] (467 aa)
Score = 227, Expect = 4.4e-17, Identities = 65/190 (34%), Positives = 104/190 (54%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           K ++ VSGGPDSM LL+       + +L     H+N+  R +D+DNDEK V ++CKKY++  +        ++K ++I+  +   RE RYDFF K+  +    KI +AH  ND  E+  M + +       G+      R  I IRP++  ++K +E YC    +E  ID TN    Y+RN VR  +  + ++ F +
  S:    20 KIIVGVSGGPDSMCLLHILYRLRDEYNLNIIAAHINHCLRGKDADNDEKYVENFCKKYDIDFYSTKIDVGKLAKKENIS-FEVAGRECRYDFFNKLKLKFNCDKIALAHNSNDQCETILMRIMRGTG--IEGLAGIKAIRDNIYIRPIIEASRKQIEDYCEEHELEARIDKTNLESIYARNKVRLELIPYIQENFNQ 213
>gi|16802265|ref|NP_463750.1| hypothetical protein lmo0219 [Listeria monocytogenes EGD-e] >gi|47097258|ref|ZP_00234818.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 1/2a F6854] >gi|153177873|ref|ZP_01931638.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes F6900] >gi|153186159|ref|ZP_01936543.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J0161] >gi|153189386|ref|ZP_01937061.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J2818] >gi|61216688|sp|Q8YAC7|TILS_LISMO Bifunctional protein tilS/hprT [Includes: tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase); Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) (HGPRTase)] >gi|16409584|emb|CAD00746.1| fusion protein, N-terminal part similar to B. subtilis YacA protein, C-terminal part similar to hypoxanthine-guanine phosphoribosyltransferase [Listeria monocytogenes] >gi|47014358|gb|EAL05331.1| conserved hypothetical protein/hypoxanthine phosphoribosyltransferase, fusion [Listeria monocytogenes str. 1/2a F6854] >gi|126941298|gb|EBA19187.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J0161] >gi|127766822|gb|EBA27147.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes J2818] >gi|133733948|gb|EBA35646.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes F6900] (648 aa)
Score = 227, Expect = 5.0e-17, Identities = 68/238 (28%), Positives = 130/238 (54%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLI 241
           K L+AVSGGPDS+ALL+     +LV     +V H+N+  RE++  ++++V  +C++  +  ++ +   D  S+ + +   L+   R +RYDFFEK+  E  I K+++AH  +D +E+  M L +   ++ + GI+ K + +    IRP L  TK  +  Y +   + + ID +N    Y+RN  R  +  + K+     Y   + F+ +     + L++  ++ +K++        IKN  + +L+
  S:    23 KLLVAVSGGPDSLALLHFLWNSNLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEV--DIKSRAQSLQKGLEETARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEALASDLLKKNL-------IKNGKQTTLL 259
>gi|15643345|ref|NP_228389.1| hypothetical protein TM0579 [Thermotoga maritima MSB8] >gi|8928511|sp|Q9WZ48|TILS_THEMA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|4981097|gb|AAD35664.1|AE001733_1 conserved hypothetical protein [Thermotoga maritima MSB8] (414 aa)
Score = 226, Expect = 6.3e-17, Identities = 62/175 (35%), Positives = 97/175 (55%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDV-SKYKDI-NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGG DSM LL   R             H+++  RE S  D + V   C+++N+ +   +T + DV S +KD    L+   RE+RYDF ++ ++++G  KI +AH KND LE+    L +    L L      +      IRP L   +  +E+Y R  N+ +V+D TN+  +Y+RN +R
  S:     9 LVAVSGGIDSMTLLYVLRKFSPLLKIKITAAHLDHRIRESSRRDREFVERICRQWNIPV---ETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLETVVHRLIRGTGPLGLACISPKREE---FIRPFLVFKRSEIEEYARKNNVPYVVDETNYNVKYTRNFIR 185
>gi|153198228|ref|ZP_01942347.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes 10403S] >gi|127632140|gb|EBA21850.1| tRNA(Ile)-lysidine synthetase [Listeria monocytogenes 10403S] (648 aa)
Score = 225, Expect = 7.6e-17, Identities = 68/238 (28%), Positives = 129/238 (54%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLI 241
           K L+AVSGGPDS+ALL+      LV     +V H+N+  RE++  ++++V  +C++  +  ++ +   D  S+ + +   L+   R +RYDFFEK+  E  I K+++AH  +D +E+  M L +   ++ + GI+ K + +    IRP L  TK  +  Y +   + + ID +N    Y+RN  R  +  + K+     Y   + F+ +     + L++  ++ +K++        IKN  + +L+
  S:    23 KLLVAVSGGPDSLALLHFLWNSDLVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEV--DIKSRAQSLQKGLEETARIVRYDFFEKVMTEKNINKLVLAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGGQAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSHFERFSEETSEDFQFLEALASDLLKKNL-------IKNGKQTTLL 259
>gi|148269484|ref|YP_001243944.1| tRNA(Ile)-lysidine synthetase [Thermotoga petrophila RKU-1] >gi|147735028|gb|ABQ46368.1| tRNA(Ile)-lysidine synthetase [Thermotoga petrophila RKU-1] (419 aa)
Score = 222, Expect = 1.6e-16, Identities = 63/175 (36%), Positives = 99/175 (56%)
  Q:     6 LIAVSGGPDSMALL---NKKRHLVE---AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDV-SKYKDI-NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGG DSM LL    K   L++      H+++  RE S  D + V   C+++N+ +   +T + DV S +KD    L+   RE+RYDF  + ++++G  KI +AH KND LE+    L +    L L      +      IRP L   +  +E+Y R K + +V+D TN+  +Y+RN +R
  S:    14 LVAVSGGIDSMTLLYVLKKFSPLLKIKITAAHLDHRIRESSRRDREFVERICRQWNVPV---ETSEVDVPSLWKDSGKTLEEIARELRYDFLRRTAKKVGATKIALAHHKNDLLETVVHRLIRGTGPLGLACISPKREE---FIRPFLVFKRSEIEEYAREKGVPYVVDETNYDVKYTRNFIR 190
>gi|83588977|ref|YP_428986.1| tRNA(Ile)-lysidine synthetase-like [Moorella thermoacetica ATCC 39073] >gi|83571891|gb|ABC18443.1| tRNA(Ile)-lysidine synthetase-like [Moorella thermoacetica ATCC 39073] (455 aa)
Score = 221, Expect = 2.2e-16, Identities = 60/180 (33%), Positives = 96/180 (53%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           K ++ VSGGPDS+ALL+    L E       V H+N+  R ++  D + VRD    + L + V    + DV  Y+  ++L  +   RE+RY+FF++++  +G  +I + HQ  D  E+  ++L +      L      + R   LIRPLL  T+  +E YCR   +    D+TN    Y RN +R  +
  S:    20 KVVVGVSGGPDSLALLHSLMTLQEEYGYTLQVAHLNHGLRPEAAADAEYVRDLATGWGLPVTV---AQRDVLAYRQEHHLSIEAAAREVRYNFFQEVAAAVGATRIAVGHQAEDQAETVLLNLLRGSGLTGLKAMLPRRGR---LIRPLLFVTRAEIEAYCRDNGLHPRRDFTNEDPAYRRNKIRHQL 201
>gi|154490240|ref|ZP_02030501.1| hypothetical protein PARMER_00472 [Parabacteroides merdae ATCC 43184] >gi|154089132|gb|EDN88176.1| hypothetical protein PARMER_00472 [Parabacteroides merdae ATCC 43184] (444 aa)
Score = 221, Expect = 2.6e-16, Identities = 61/175 (34%), Positives = 101/175 (57%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA-----VCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS--KFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+ VSGG DS+ALL     LVE+       H N+H R D S  DE+ VR+Y +K ++   +  FDT K    ++  I   +   RE+RY +FE+     G + + +AH ++D +E+  M+L +       GIR  S  + R+  ++RPLL  +++ + ++   + + +V D TN  D Y+RN +R
  S:    22 LVGVSGGADSIALLTI---LVESGYSCIAAHCNFHLRGDESLRDEQFVREYARKLDVPFLMTDFDTRKYAADRHLSI---EMAARELRYGWFEEQRAATGAQAVAVAHHRDDSVETLLMNLVRGT-----GIRGMSGIRPRNGFVVRPLLAVSREDILEWLAGRGLTYVTDSTNLSDAYTRNFIR 195
>gi|154684586|ref|YP_001419747.1| YacA [Bacillus amyloliquefaciens FZB42] >gi|154350437|gb|ABS72516.1| YacA [Bacillus amyloliquefaciens FZB42] (472 aa)
Score = 220, Expect = 3.0e-16, Identities = 70/188 (37%), Positives = 104/188 (55%)
  Q:     6 LIAVSGGPDSMALLNK-KRHL----VEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDK-------KTFQK 193
           +  VSGGPDSMALL+   +H     V    HV++  R  +S+ D K V+ YC+  ++   + +T + DVS Y   N L  Q   R+ RY FFE +  +   K + +AH  +D +E+  M L K      L G++   +F S  LIRP L   K  + +YCR + + +  D +N  D Y+RN  RK +  + K       K FQK
  S:    21 IAGVSGGPDSMALLSMLNKHFGHSSVIIAAHVDHQFRGPESEEDMKFVQSYCEAEHI---LCETVQIDVSAYAKKNKLNKQAAARDCRYQFFEDLMTKHQAKFLALAHHGDDQVETMLMRLAKGTLGAGLAGMQPVREFASGWLIRPFLYAAKDEILEYCRQEGLSYRTDESNAKDDYTRNRFRKTVLPFLKHESPDVHKMFQK 221
>gi|104773521|ref|YP_618501.1| hypothetical protein Ldb0367 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513516|ref|YP_812422.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422602|emb|CAI97205.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092831|gb|ABJ57984.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (431 aa)
Score = 220, Expect = 3.0e-16, Identities = 62/189 (32%), Positives = 105/189 (55%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEA----VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRK-------SKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           ++  +L+A SGGPDSMALL+  R L         H+++  R DS  + +++R YC KY L L+     K   S + + + L+   R+ RY+F  ++++++    +L AH  +D LE+  + L ++      GI R+       S+   + L+RPLL   K  L  Y + + +E+V D TNF    +RN +R+ +    KK
  S:    18 LEGNFLVAASGGPDSMALLDLMRRLPGGFQLYAAHLDHQLRADSQKESQVLRAYCHKYQLPLYESVWPK---SLHPE-SGLEAAARDYRYNFLFEVARQVKADYLLTAHHGDDLLENILLKLVRS------GIPREMNSLKPVSQRGQVKLVRPLLAVGKADLLAYAKKQGLEYVEDETNFTGITARNRLRQEVVPLLKK 207
>gi|116871602|ref|YP_848383.1| hypothetical protein lwe0182 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740480|emb|CAK19600.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (648 aa)
Score = 220, Expect = 3.4e-16, Identities = 61/180 (33%), Positives = 103/180 (57%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVE----AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI--NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           K L+AVSGGPDS ALL+      LV     +V H+N+  RE ++ ++ +V+ +C+++++  FV      D+ K+ +     ++   R +RY FFEK+  E  I K+++AH  +D +E+  M L +   ++ + GI+ K K      IRP L  TK  + QY    ++ + ID +N    Y+RN  R  +
  S:    23 KLLVAVSGGPDSFALLHFLWSSKLVPKESISVAHLNHCLREGAEKEQLVVQTFCEEHHIPFFV---EAVDIKKHAETIQKGIEETARIVRYKFFEKVMTENDINKLVLAHHADDQIETILMRLVRGSSSIGWSGIQPKRKVTKGYAIRPFLPITKAEIIQYASKHDLPYEIDESNVSQEYTRNRYRTQL 208
>gi|58336616|ref|YP_193201.1| putative cell cycle [Lactobacillus acidophilus NCFM] >gi|58253933|gb|AAV42170.1| putative cell cycle [Lactobacillus acidophilus NCFM] (423 aa)
Score = 218, Expect = 5.7e-16, Identities = 65/214 (30%), Positives = 108/214 (50%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMS-LNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFN 217
           K L+A SGGPDSMALL+      KK+       H N+  R DS+ + +I++DYC+K  + LFV    K++  K    + ++   RE+RY+F  KI++      +L AH  +D +E+  +  +          ++       + L+RPLL+ +K+ +  Y + + I F++D TN  D   RN +R  +    KK           F+ K      ++D K N
  S:    23 KLLVAASGGPDSMALLDMLKDLQKKQKFELIAAHFNHQLRSDSEEETRILKDYCQKNEIPLFVAKWAKNEQPK----SGIEAAAREVRYNFLTKIAKNETADYLLTAHHGDDLIENILLKFIRSGNPEEMNSLQAVGVMHGVTLLRPLLSSSKQEILAYDKERGISFIVDSTNKEDDTMRNRMRHHVVPILKKENPALIQNALRFSHKMSDLTNVVDEKIN 239
>gi|29374904|ref|NP_814057.1| hypothetical protein EF0263 [Enterococcus faecalis V583] >gi|61216623|sp|Q839B3|TILS_ENTFA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29342362|gb|AAO80128.1| conserved domain protein [Enterococcus faecalis V583] (462 aa)
Score = 216, Expect = 9.6e-16, Identities = 75/267 (28%), Positives = 135/267 (50%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFD---------INYFLKIKNNYKESLIYLFLNH----IGIKPNENKIEQIIEFINKNK--NGSV 272
           ++AVSGG DSMALL       +K  L   V HVN+  RE S  + + +  YC++  L  +  +T  +D  K +   NL+   R  RY+FF+++ +  G   ++ AH  +D  E+  M L +    +   GI+ +  F +  LIRPLL   K+ L Q+ + +   +  D TN  + Y RN +R  +    K+   +F  ++  F+ +  F  + +  +    + +  +         +   LK    Y+   +  F       +G+  N+ ++ QI++ +N  +   GSV
  S:    22 VVAVSGGVDSMALLTLMEQVAEKEQLQLVVAHVNHQLREASAQEAQYLATYCQQRELTYY--ETRWEDPEKQR---NLEAKARTFRYEFFKEVMEIEGAAVLMTAHHLDDQAETILMKLIRGTNFSHSAGIKERRPFATGELIRPLLIYPKEELYQFAQRQAFVYFEDETNQTNEYLRNRLRNQVLPLLKQENPQFLDQIASFSNEQRFAQEFIQEQIEPQLSEAVEPTKQGWRIPLKRLLKETPAYQHFFLTAFFQKTLVPLGVSLNQRQMTQILKVLNDERQPQGSV 305
>gi|20808759|ref|NP_623930.1| ATPase [Thermoanaerobacter tengcongensis MB4] >gi|61217386|sp|Q8R7K9|TILS_THETN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|20517403|gb|AAM25534.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Thermoanaerobacter tengcongensis MB4] (467 aa)
Score = 213, Expect = 1.8e-15, Identities = 64/189 (33%), Positives = 107/189 (56%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI--------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           K ++ +SGGPDS+ +L+       K +L   V HVN+  R ED+  D + V   CK  +L  F+F+ +   ++K   ++  Q   R +RY  FE+  + +G  KI +AH KND  E+           + L I R +  R LI        +IRPL+   ++ +E+Y + KN+   ID+TN+ D Y+RN +R  +  + ++ F+
  S:    29 KIVMGISGGPDSLCMLDVLFNLKGKFNLKLYVVHVNHMIRGEDAKKDAEFVEKLCKDLDLPFFLFEENIPYLAKKMGLSEEQAG-RYVRYKAFEETLKRVGGNKIAVAHNKNDVAET-----------VLLNILRGTGLRGLIGIKPVNGNIIRPLIEIERREIEKYLKDKNLHPRIDHTNYEDLYTRNKIRLKVIPYIEEVFK 220
>gi|16077135|ref|NP_387948.1| hypothetical protein BSU00670 [Bacillus subtilis subsp. subtilis str. 168] >gi|8039814|sp|P37563|TILS_BACSU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|2632334|emb|CAB11843.1| yacA [Bacillus subtilis subsp. subtilis str. 168] (472 aa)
Score = 213, Expect = 2.0e-15, Identities = 67/188 (35%), Positives = 102/188 (54%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVC---------HVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDK-------KTFQK 193
           ++ VSGGPDSMALL    H +  +C         HV++  R  +S+ D + V+ YCK   L   V +T + +V+ Y     L  Q   R+ RY FFE+I  +     + +AH  +D +E+  M L K      L G++   +F +  +IRP L  TK+ +  YC    + +  D +N  D Y+RN  RK +  + K       K FQK
  S:    21 IVGVSGGPDSMALL----HALHTLCGRSANVIAAHVDHRFRGAESEEDMRFVQAYCKAEQL---VCETAQINVTAYAQEKGLNKQAAARDCRYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIRPFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVHKRFQK 221
>gi|467456|dbj|BAA05302.1| unknown [Bacillus subtilis] (486 aa)
Score = 213, Expect = 2.0e-15, Identities = 67/188 (35%), Positives = 102/188 (54%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVC---------HVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDK-------KTFQK 193
           ++ VSGGPDSMALL    H +  +C         HV++  R  +S+ D + V+ YCK   L   V +T + +V+ Y     L  Q   R+ RY FFE+I  +     + +AH  +D +E+  M L K      L G++   +F +  +IRP L  TK+ +  YC    + +  D +N  D Y+RN  RK +  + K       K FQK
  S:    35 IVGVSGGPDSMALL----HALHTLCGRSANVIAAHVDHRFRGAESEEDMRFVQAYCKAEQL---VCETAQINVTAYAQEKGLNKQAAARDCRYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIRPFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVHKRFQK 235
>gi|150005405|ref|YP_001300149.1| putative cell-cycle protein [Bacteroides vulgatus ATCC 8482] >gi|149933829|gb|ABR40527.1| putative cell-cycle protein [Bacteroides vulgatus ATCC 8482] (417 aa)
Score = 212, Expect = 2.9e-15, Identities = 65/180 (36%), Positives = 102/180 (56%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKR---HLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS-KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           M  K L+A+SGG DS+ALL       +  EA  H N+H R E+SD DE+ V + CK   + L V  TH D V+   +   +++   RE+RYD+FE++ +E G+  I +AH ++D +E+  ++L +       G++  S     I +RPLL  +++ +  Y R     +V D TN  D Y RN +R
  S:     1 MHDKVLVALSGGADSVALLRVLLVLGYHCEAA-HCNFHLRGEESDRDERFVNELCKGLGVTLHV--THFDTVTYASRHHVSIEMAAREMRYDWFEQLRKERGMAVIAVAHHRDDSVETFLLNLIRGAG--INGLKGISPHNGCI-VRPLLEVSRQDILDYLRCLRQGYVTDSTNLQDEYMRNKIR 179
>gi|125974740|ref|YP_001038650.1| tRNA(Ile)-lysidine synthetase [Clostridium thermocellum ATCC 27405] >gi|125714965|gb|ABN53457.1| tRNA(Ile)-lysidine synthetase [Clostridium thermocellum ATCC 27405] (470 aa)
Score = 211, Expect = 3.3e-15, Identities = 66/190 (34%), Positives = 103/190 (54%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           K K ++ VSGGPDS+ LL+    L E++       HVN+  R D +  DE  V + CKK N++L         ++K + ++ L+   R  RY  FE+++   G ++I +AH KND  E+  M++ +       G+R     R  I IRPLL   +  +E YCR  N+   ID TN  + Y+RN +R  +  + +K F
  S:    18 KDKIVVGVSGGPDSVCLLHILCKLRESMDLGLVAVHVNHMLRGDEASGDEAFVENLCKKLNVELVTRRIDIKKLAKERRLS-LEETGRIERYRLFEEVADNFGAQRIAVAHNKNDQAETVLMNIIRGTG--LDGLRGMDYIRGRI-IRPLLGVERTEIENYCRIHNLNPRIDSTNLENIYTRNKIRLDLIPYIEKLF 210
>gi|13899157|gb|AAG12421.1| MesJ [Chlorobium tepidum] (351 aa)
Score = 211, Expect = 3.6e-15, Identities = 65/175 (37%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGI----RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGGPDSMALL+         H    V H N+  R D SD DE  VRD C +  +   V  FDT     +  K I       R +RYDFF ++ +E    +I   H  +D  E+          NLF G      R  + R   +IRPLL  T++ +  Y   K + +  D+TN    Y RN +R
  S:    45 LLAVSGGPDSMALLHLFASVASVLHCRLGVAHCNFMLRGDASDADESFVRDACAELGIDFHVRRFDTASVSSAWKKSIEETA---RLLRYDFFGELCREASYTRIATGHHSDDNAETVLF-------NLFRGAGISGLRGIRVRHGAIIRPLLPFTRREIVAYLEEKRVVWRDDHTNEGIEYDRNFIR 222
>gi|21674432|ref|NP_662497.1| MesJ protein [Chlorobium tepidum TLS] >gi|61216669|sp|Q8KC15|TILS_CHLTE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|21647616|gb|AAM72839.1| tRNA(Ile)-lysidine synthetase [Chlorobium tepidum TLS] (331 aa)
Score = 211, Expect = 3.6e-15, Identities = 65/175 (37%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGI----RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGGPDSMALL+         H    V H N+  R D SD DE  VRD C +  +   V  FDT     +  K I       R +RYDFF ++ +E    +I   H  +D  E+          NLF G      R  + R   +IRPLL  T++ +  Y   K + +  D+TN    Y RN +R
  S:    25 LLAVSGGPDSMALLHLFASVASVLHCRLGVAHCNFMLRGDASDADESFVRDACAELGIDFHVRRFDTASVSSAWKKSIEETA---RLLRYDFFGELCREASYTRIATGHHSDDNAETVLF-------NLFRGAGISGLRGIRVRHGAIIRPLLPFTRREIVAYLEEKRVVWRDDHTNEGIEYDRNFIR 202
>gi|146296231|ref|YP_001180002.1| tRNA(Ile)-lysidine synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409807|gb|ABP66811.1| tRNA(Ile)-lysidine synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] (455 aa)
Score = 211, Expect = 3.8e-15, Identities = 79/229 (34%), Positives = 124/229 (54%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF-----QKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKI 232
           K LI  SGG DSM LL+       +  L   V H+N+  R+++  DE  V D CK+YN+K     T   DV K K+   L  +   R  RY+FF ++   LG+ KIL+ H KND +E+ +++L +       G+      R  I+ RPL+  +++ +E+Y     I++VID TNF  +Y RNVVR  +    ++ F        +  +     +N+   +L+D  F   +K++ DI Y L I
  S:    22 KVLIGCSGGIDSMVLLDCIYRLKDEYELDITVAHLNHMLRQEAIEDELFVIDTCKRYNIKCI---TRSIDVRKIKEERKLSEEEAGRLARYNFFYELVNSLGLSKILLGHNKNDVVETFFLNLFRGSG--LDGLASIPPVRD-IVARPLIYMSREEIEEYAEENGIKYVIDKTNFSSKYKRNVVRNQILPVIREKFGDGVIDTIFRTINLIRDENLQINELIDDIFKRCVKKE-DIYYVLDI 256
>gi|110798778|ref|YP_697160.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens ATCC 13124] >gi|123049568|sp|Q0TMI0|TILS_CLOP1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|110673425|gb|ABG82412.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens ATCC 13124] (456 aa)
Score = 210, Expect = 4.1e-15, Identities = 71/177 (40%), Positives = 99/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+A+SGGPDS+ LL+    L E +       HVN+  R E +  DE  V + CK  N+K FV    + D++K  +  N+ T    RE RY FFE++  E  + KI IAH  ND  E+  M +L        +GI+     R  I IRP+L   +K +E+YC   N+   ID TN  + YSRN +R
  S:     7 KVLVALSGGPDSVCLLHILSELRELLHIEVYAAHVNHCLRGESALKDEAYVEELCKNLNIKCFV---KRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIMRALRGTGIEGLVGIK---PVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 187
>gi|89100508|ref|ZP_01173369.1| Cell cycle protein MesJ [Bacillus sp. NRRL B-14911] >gi|89084774|gb|EAR63914.1| Cell cycle protein MesJ [Bacillus sp. NRRL B-14911] (462 aa)
Score = 210, Expect = 4.5e-15, Identities = 62/178 (34%), Positives = 97/178 (54%)
  Q:     4 KYLIAVSGGPDSMALLN---KKRHL---VEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKY--KDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K L+ VSGGPDS+ALL+   KKR +     A  H ++  R E+S  + + V+ +C++ N+    F+  ++DVS Y  +   + QT  RE RY FFE+  +  G   + + H  +D +E+  M L +        GI     F    +IRP L   +  +E+YC S  ++   D +N  D YSRN  R+
  S:    21 KVLVGVSGGPDSLALLHLLWKKRKVWGAEPAAIHFDHMFRGEESYQEARFVQSFCEERNIP---FEMRREDVSAYMKESGKSSQTAARECRYRFFEEAMKASGASYLALGHHGDDQMETILMRLTRGSTGEARSGIPFSRPFGGGEIIRPFLCLERGEIEEYCLSNELDPRRDPSNEKDVYSRNRFRR 205
>gi|126653286|ref|ZP_01725397.1| hypothetical protein BB14905_08928 [Bacillus sp. B14905] >gi|126589960|gb|EAZ84089.1| hypothetical protein BB14905_08928 [Bacillus sp. B14905] (468 aa)
Score = 210, Expect = 4.7e-15, Identities = 79/228 (34%), Positives = 117/228 (51%)
  Q:     6 LIAVSGGPDSMALLN----KKRHL---VEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRN-----VVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIK 233
           LIAVSGG DSMALL+     + H    VEAV HV++  R E S  D   V+ YC + ++ L         +   ++  N Q   R  RY +F+++  +    K++ AH  +D LES  M+L KN   N   GIR +  F    LIRP L  TK  + +Y   K + +  D +N  D Y RN     VV  + AE  + T Q  +   +     N F + L +  F+  IK+  +  Y ++I+
  S:    24 LIAVSGGVDSMALLHYFVQTQEHWNIRVEAV-HVDHMLRGEASAEDRAFVQKYCDENDVYLHATAISIPTILALEN-GNTQLICRRERYRYFKEVLYKTNANKLVTAHHADDQLESVLMALTKNATMNSMQGIRPQRYFEGKSLIRPFLTVTKTEIGEYLLRKGLNYREDVSNSKDTYVRNRFRHHVVPLLEAENPRVTEQVTHFTSQ-LQEDNTFLMTLAEDVFSKTIKRSNENTYSMEIE 262
>gi|118443998|ref|YP_877128.1| cell cycle protein MesJ, putative [Clostridium novyi NT] >gi|118134454|gb|ABK61498.1| Cell cycle protein MesJ, putative [Clostridium novyi NT] (464 aa)
Score = 210, Expect = 4.9e-15, Identities = 68/195 (34%), Positives = 107/195 (54%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMS-LNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKV 198
           K ++A+SGGPDS+ LL+    L + +       HVN+  R E +DNDE  V+  C++  ++ FV       +SK + I+  +   RE+RY FFE++  ++   KI IAH  ND  E+  M  L        +GIR     R  I +RP++N T+  +E YC    +   ID TNF + Y+RN +R  +  + +K F    ++V
  S:    20 KVVVALSGGPDSICLLHILHTLKDEINISIVAAHVNHCLRGEAADNDEMYVKKICEELGIQCFVKREDVHRISKERGIS-CEMAGREVRYQFFEEVLHKINGNKIAIAHNANDQAETVLMRILRGTGLEGLVGIR---PVRDNIFVRPIINLTRDEIENYCDINKLNPRIDKTNFENIYTRNKIRLELIPYIQKNFNSDVIEV 218
>gi|150392226|ref|YP_001322275.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus metalliredigens QYMF] >gi|149952088|gb|ABR50616.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus metalliredigens QYMF] (467 aa)
Score = 209, Expect = 5.4e-15, Identities = 64/188 (34%), Positives = 102/188 (54%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           K ++A+SGGPDS+ LL+    L  A        H+N++ R  D+  D + V ++C++ N+  FV      DV  Y + N L +    R +RY+FFE+I Q++G  KI +AH +ND  E+  M L +      L   R  + +   +IRPLL   +  +E YC +  +   ID TN    Y RN +R  +  + K+ +
  S:    20 KVVVAISGGPDSVCLLHVLSRLKAAYKLEIYGAHLNHNFRGMDAQMDAQYVANFCEQLNILCFV---KSMDVLGYAEKNGLSSEEAGRVLRYEFFEEIGQKVGASKIAVAHNQNDQAETVLMRLLRGTGIQGLTAIRHKRDK---IIRPLLETDRGKIEDYCETYELSPRIDQTNSQPIYHRNKIRLELIPYLKENY 210
>gi|148543503|ref|YP_001270873.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri F275] >gi|148530537|gb|ABQ82536.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri F275] (464 aa)
Score = 209, Expect = 5.5e-15, Identities = 64/179 (35%), Positives = 99/179 (55%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTH-KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + K ++AVS G DSM LL+  +HL         V H+N+  R+ S  +E+ +R YCK+ +LKL V  TH   D+     I N     R+ RY FF K+ ++     +L AH +ND  E+  M + +  + +  +GIR +  F S  LIRPLL  +K+ L++Y    ++++  D TN      RN  R
  S:    21 QDKVVVAVSTGVDSMVLLDLLQHLSSKNRPQIIVAHMNHELRKQSQLEERFIRQYCKQNDLKLAV--THWPQDLHPQTGIENAA---RQARYQFFRKVMKDNRASILLTAHHQNDLAETMLMKMTRGGQLSQLVGIRDRRPFASGTLIRPLLPFSKQQLKKYALQHHLKWYEDKTNKDLNIQRNRFR 202
>gi|194335822|ref|YP_002017616.1| tRNA(Ile)-lysidine synthetase [Pelodictyon phaeoclathratiforme BU-1] >gi|194308299|gb|ACF42999.1| tRNA(Ile)-lysidine synthetase [Pelodictyon phaeoclathratiforme BU-1] (328 aa)
Score = 209, Expect = 5.5e-15, Identities = 64/177 (36%), Positives = 98/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLN---KKRHLVEA---VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIR----RKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L+AVSGGPDSMA+L+     R L+ A   V H N+  R  +SD DE  V D+C+  +L+ FV  FDT +    ++K   +++   R +RY FF ++ ++ G  KI   H  ND  E+          NLF G+     R  +  +  +IRP+L   K  +  Y + K I    D +N+ + Y RN +R
  S:    23 RVLVAVSGGPDSMAMLSLFCAVRPLLRAELAVAHCNFQLRGAESDGDESFVLDHCRSLDLECFVDHFDTLRF-AGEWK--RSVEESARILRYTFFRQVMEQKGFSKIATGHHVNDNAETILF-------NLFRGVSLPGLRGIRALNGKIIRPMLLFHKADMVAYLKEKGITSRTDTSNYANDYDRNFIR 202
>gi|18311454|ref|NP_563388.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens str. 13] >gi|61216685|sp|Q8XHL1|TILS_CLOPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|18146138|dbj|BAB82178.1| probable cell-cycle protein [Clostridium perfringens str. 13] (469 aa)
Score = 209, Expect = 5.9e-15, Identities = 71/177 (40%), Positives = 99/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+A+SGGPDS+ LL+    L E +       HVN+  R E +  DE  V + CK  N+K FV    + D++K  +  N+ T    RE RY FFE++  E  + KI IAH  ND  E+  M +L        +GI+     R  I IRP+L   +K +E+YC   N+   ID TN  + YSRN +R
  S:    20 KVLVALSGGPDSVCLLHILSELRELLHIEVYAAHVNHCLRGESALKDEAYVEELCKNLNIKCFV---KRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIMRALRGTGIEGLVGIK---PVRDGIFIRPILILRRKEIEEYCEINNLNPRIDETNLEEIYSRNKIR 200
>gi|28377429|ref|NP_784321.1| cell cycle protein MesJ [Lactobacillus plantarum WCFS1] >gi|61216640|sp|Q88Z33|TILS_LACPL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|28270261|emb|CAD63162.1| cell cycle protein MesJ [Lactobacillus plantarum WCFS1] (448 aa)
Score = 209, Expect = 6.1e-15, Identities = 60/175 (34%), Positives = 89/175 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL+  + L  A      V HVN+H RE S  +   +R YC++ NLKL + D       K    + ++   R+ RY  F K+ +E     +L AH  ND +E+  M L +    +   GI     F +  LIRPLL  +K  L  Y   +++ +  D TN     +RN +R
  S:    24 VVAVSTGVDSMVLLHLLQRLPAAERPRVVVAHVNHHLREQSQMEADYLRQYCQQQNLKLVMADWLPAAHPK----SGIEAAGRQFRYHVFAKVMRENRATAVLTAHHANDQVETYLMKLARGGDISQLTGIATSRPFATGRLIRPLLTWSKDQLRNYAAEQHVVYFEDVTNQDVALTRNRIR 201
>gi|34541632|ref|NP_906111.1| hypothetical protein PG2046 [Porphyromonas gingivalis W83] >gi|61216584|sp|Q7MTC4|TILS_PORGI tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|34397950|gb|AAQ67010.1| conserved hypothetical protein [Porphyromonas gingivalis W83] (454 aa)
Score = 207, Expect = 8.6e-15, Identities = 58/175 (33%), Positives = 96/175 (54%)
  Q:     6 LIAVSGGPDSMALLNKKRHL-VEAVC-HVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A+SGG DS+ALL   R L  E V  H N+H R  +SD D   V   C+  ++ L   D      ++ + I+ ++   RE+RY++F ++ +EL I+ + +AH  +D  E+  M LN  +     G+      R+  ++RPLL+ T+  +E Y   + I +  D +N   R+ RN+VR
  S:    27 LVALSGGADSVALLCVLRELGYETVAAHCNFHLRGVESDEDAAFVERLCRDLDVPLHRIDFDTVRYARERSIS-IEMAARELRYEWFGQLRKELAIEYVAVAHHADDNAET--MVLNLCRGTGISGLCGMPYKRNDGIVRPLLDATRDEIEAYLLDQKITYRTDSSNEDTRFRRNLVR 201
>gi|110802414|ref|YP_699728.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens SM101] >gi|110682915|gb|ABG86285.1| tRNA(Ile)-lysidine synthetase [Clostridium perfringens SM101] (469 aa)
Score = 207, Expect = 1.0e-14, Identities = 71/177 (40%), Positives = 99/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+A+SGGPDS+ LL+    L E +       HVN+  R E +  DE  V + CK  N+K FV    + D++K  +  N+ T    RE RY FFE++  E  + KI IAH  ND  E+  M +L        +GI+     R  I IRP+L   +K +E+YC   N+   ID TN  + YSRN +R
  S:    20 KVLVALSGGPDSVCLLHILSELKELLHIEVYAAHVNHCLRGESALKDEAYVEELCKNLNIKCFV---KRVDINKISEEQNISTEMAGREERYKFFEELKNEYSLDKIAIAHNANDQAETLIMRALRGTGIEGLVGIK---PVRDGIFIRPILILRRKEIEEYCEINNLTPRIDETNLEEIYSRNKIR 200
>gi|147676532|ref|YP_001210747.1| ATPase [Pelotomaculum thermopropionicum SI] >gi|146272629|dbj|BAF58378.1| predicted ATPase [Pelotomaculum thermopropionicum SI] (473 aa)
Score = 206, Expect = 1.3e-14, Identities = 58/177 (32%), Positives = 93/177 (52%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+AVSGGPDS+ALL+    L E       V H+N+  R  +S+ +   V D  ++Y L   V      DV  Y+  + L  Q   RE+R+ FF + + + G  ++ +AH  +D  E+  ++  +       G++  S  R    IRPLL   +  +E+YC+   + +  D +N    Y+RN VR
  S:    22 KVLVAVSGGPDSVALLHALYLLKEELEISLHVAHLNHMFRGAESEAEALFVADMARRYGLPATV---EARDVPAYQKQSGLSAQAAAREVRFRFFSEAAGKAGASRVALAHHADDQAETILINFLRGAG--ITGLKGISPVREGFYIRPLLTVRRAEIERYCKEMKLPYCRDSSNLKAVYTRNRVR 202
>gi|148381467|ref|YP_001256008.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153932046|ref|YP_001385842.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153936096|ref|YP_001389249.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. Hall] >gi|148290951|emb|CAL85087.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC 3502] >gi|152928090|gb|ABS33590.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152932010|gb|ABS37509.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum A str. Hall] (468 aa)
Score = 206, Expect = 1.3e-14, Identities = 69/190 (36%), Positives = 103/190 (54%)
  Q:     4 KYLIAVSGGPDSMALL-------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           K ++ VSGGPDSM LL       N+ R     V H+N+  R  +SD DEK V ++C   NL  F    + D ++K K I++ ++  RE RYDFF  + +ELG +KI  AH  ND  E+  M + +       G+   +  R  + IRPL+N  ++ +E YC    +   ID TN    Y+RN +R  +  + K  F +
  S:    20 KIIVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYTNNLGFFSKTINMDKIAKEKGISS-ESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRIMRGTG--LQGLIGINPIRDDLYIRPLINVLREDIENYCDKYELNPRIDKTNLQSIYTRNRIRLELIPYIKDNFNE 214
>gi|15896451|ref|NP_349800.1| cell cycle protein MesJ-like protein [Clostridium acetobutylicum ATCC 824] >gi|61216713|sp|Q97EB0|TILS_CLOAB tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15026275|gb|AAK81140.1|AE007816_4 Cell cycle protein MesJ ortholog, ATPase of the PP-loop superamily [Clostridium acetobutylicum ATCC 824] (461 aa)
Score = 206, Expect = 1.4e-14, Identities = 64/190 (33%), Positives = 105/190 (55%)
  Q:     4 KYLIAVSGGPDSMALLN----KKRHLVEAVC--HVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           + ++AVSGGPDS+ LL+     K     ++C  HVN+  R E +D DE+ V+ +C+K +++ +V     + ++  K I++ +   REIRY FFE++ +     KI IAH  ND  E+  M + +       GI+     R    IRPL+   + S+E+YC  + +   ID TN    Y+RN +R  +  +  K F +
  S:    20 RIVVAVSGGPDSICLLHILFKLKDKFNTSICAAHVNHCIRGEAADKDEEYVKKFCEKLDIQFYVKRVDVNKIAHEKKISS-EMAGREIRYAFFEEVKERFKANKIAIAHNANDQAETIMMRIIRGTGTE--GIKGIRPVRDGYYIRPLIEIRRSSIEKYCEDEKLMPRIDATNLERDYNRNKIRLDLIPYIVKNFNE 213
>gi|75761780|ref|ZP_00741716.1| tRNA(Ile)-lysidine synthetase TilS [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490730|gb|EAO54010.1| tRNA(Ile)-lysidine synthetase TilS [Bacillus thuringiensis serovar israelensis ATCC 35646] (480 aa)
Score = 205, Expect = 1.5e-14, Identities = 80/263 (30%), Positives = 138/263 (52%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL        ++ L   V HV++  R D S  D + V+D C++  +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC   N+   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    30 VVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGDESHEDLQFVQDLCEELGI---ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMHEKFQKFSVQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 314
>gi|153939118|ref|YP_001392881.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum F str. Langeland] >gi|152935014|gb|ABS40512.1| tRNA(Ile)-lysidine synthetase [Clostridium botulinum F str. Langeland] (468 aa)
Score = 205, Expect = 1.5e-14, Identities = 69/190 (36%), Positives = 103/190 (54%)
  Q:     4 KYLIAVSGGPDSMALL-------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           K ++ VSGGPDSM LL       N+ R     V H+N+  R  +SD DEK V ++C   NL  F    + D ++K K I++ ++  RE RYDFF  + +ELG +KI  AH  ND  E+  M + +       G+   +  R  + IRPL+N  ++ +E YC    +   ID TN    Y+RN +R  +  + K  F +
  S:    20 KIIVGVSGGPDSMCLLHMLCLLKNQLRIKDIYVAHINHGVRGAESDADEKYVENFCYMNNLGFFSKTINMDKIAKEKGISS-ESAGREARYDFFNYLRKELGAQKIATAHNANDQAETVLMRIMRGTG--LQGLIGINPIRDDLYIRPLINVLREDIENYCDKYELNPRIDKTNLQSIYTRNRIRLELIPYIKDNFNE 214
>gi|134298004|ref|YP_001111500.1| tRNA(Ile)-lysidine synthetase [Desulfotomaculum reducens MI-1] >gi|134050704|gb|ABO48675.1| tRNA(Ile)-lysidine synthetase [Desulfotomaculum reducens MI-1] (472 aa)
Score = 204, Expect = 2.1e-14, Identities = 60/178 (33%), Positives = 91/178 (51%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           L+ VSGG DS+ LL+    L E       V H+N+  R E++  D   V++ C  + +   V    K +V  Y     L +    RE+RY F++ + +E G  KI +AH  ND  ES  M++ +       GI   +  R  + IRPLL   +  +EQY + K + F ID +N    Y RN +R  +
  S:    24 LVGVSGGLDSVVLLHILNCLKEELGISLHVAHLNHMFRGEEATEDALFVQELCSNWGIPCTV---EKRNVPAYAQARGLSSELAAREVRYQFYDDVREETGGHKIALAHHANDQAESVLMNMLRGSG--LKGISGIAPVRDNLYIRPLLKLLRSEIEQYGQRKGLTFRIDSSNLEVVYRRNKLRHQL 205
>gi|150014990|ref|YP_001307244.1| tRNA(Ile)-lysidine synthetase [Clostridium beijerinckii NCIMB 8052] >gi|149901455|gb|ABR32288.1| tRNA(Ile)-lysidine synthetase [Clostridium beijerinckii NCIMB 8052] (468 aa)
Score = 203, Expect = 2.9e-14, Identities = 81/235 (34%), Positives = 124/235 (52%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKV-----KWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKE 238
           K LIA+SGGPDS+ LLN      +K ++  A  H+N+  R ED+  DE+ V + C    +K FV    + D++ Y   + L +    R  RYDFF++I ++ G  KI  AH  ND  E+    L +      LG  R S  R   +IRP+L  +++ +E Y + KN+   ID TNF   Y+RN +R  +  + K+ F +  ++            N F  KL    +N +  +  D  YF+  K  +KE
  S:    20 KILIALSGGPDSICLLNVLFELREKLNISIAAAHLNHLLRGEDAFEDERYVINTCNDMGIKCFV---KRVDINAYSKESKLSSEMAGRNARYDFFDEILEKEGFNKIATAHNANDQAETVLFRLMRGTGLEGLGGIRAS--RDDKIIRPILCLSREEVENYVKLKNLNPRIDKTNFEKIYNRNKIRLDILPYMKENFNEDIVQTLNRMSTLLQKDNEFLEKLSAGLYNKYCMECND--YFIIKKEIFKE 261
>gi|158319482|ref|YP_001511989.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus oremlandii OhILAs] >gi|158139681|gb|ABW17993.1| tRNA(Ile)-lysidine synthetase [Alkaliphilus oremlandii OhILAs] (463 aa)
Score = 202, Expect = 4.2e-14, Identities = 58/177 (32%), Positives = 99/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + ++A+SGGPDS+ LL+    L E         H+N++ R  D+  D + V + C++ N+  F+        +K K +++ +   R +RY+FF++I++++G  KI +AH +ND  E+  M L +      L     ++ R   +IRPLL   +KS+E+YC    +   ID TN    Y RN +R
  S:    20 RIIVAISGGPDSVCLLHNLYQLREEYNLELYGAHLNHNFRGIDAQVDAQYVANLCEELNILCFIKSMDVPQYAKEKGLSSEEAG-RILRYEFFDEIAEQVGANKIAVAHNENDQAETVLMRLLRGTGLQGLTAIHINRGR---IIRPLLGVDRKSIEEYCEKYQLSPRIDKTNLESIYKRNKIR 199
>gi|145220203|ref|YP_001130912.1| tRNA(Ile)-lysidine synthetase [Prosthecochloris vibrioformis DSM 265] >gi|145206367|gb|ABP37410.1| tRNA(Ile)-lysidine synthetase [Prosthecochloris vibrioformis DSM 265] (329 aa)
Score = 201, Expect = 4.5e-14, Identities = 62/175 (35%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS----KFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGGPDSMALL+         H    V H N+  R  DS  DE  VR+ C++  L+ FV  FDT   ++   +   +++   R +RYD+F ++ +  G  K+   H   D  E+          NLF G  + S    + R   +IRP+L   K  +  Y R K + + ID +N  D + RN +R
  S:    25 LVAVSGGPDSMALLSLFLAVQPVLHCRLGVAHCNFGLRGPDSLADEAFVREACRRLGLECFVARFDT---ELYCREHRLSIEESARTLRYDYFGRLMKSEGFTKVATGHHVADNAETILF-------NLFRGTSQPSLRGIRSRHGSIIRPMLLLHKADILGYLREKGMRYRIDRSNESDSHDRNFIR 202
>gi|78187463|ref|YP_375506.1| MesJ protein [Pelodictyon luteolum DSM 273] >gi|78167365|gb|ABB24463.1| MesJ protein [Pelodictyon luteolum DSM 273] (332 aa)
Score = 201, Expect = 4.7e-14, Identities = 64/193 (33%), Positives = 95/193 (49%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIR----RKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYL 196
           + L+AVSGG DSMALL              AV H N+  R  +SD DE  VR+  +   L  FV  FDT    V+  + +   +   R +RY +F++I +  G  K+   H   D  E+          NLF G+     R  + R   +IRPLL   +  +E+Y + +   +  D TN  DRY RN +R  +    ++ F   +L
  S:    29 RVLVAVSGGADSMALLTLFIAVQAALGCTLAVVHCNFGLRGAESDADEAFVRECARLMGLPCFVRQFDTLASSVAARRSV---EEEARVLRYGYFQEIIEREGYTKVATGHHVGDNAETMLF-------NLFRGVTLPSLRGIRSRRGHIIRPLLFMHRAEIEEYLKQQGTGYRTDATNADDRYDRNFIRNRVIPLVEERFHGRFL 224
>gi|53712709|ref|YP_098701.1| putative cell-cycle protein [Bacteroides fragilis YCH46] >gi|61216469|sp|Q64WF9|TILS_BACFR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|52215574|dbj|BAD48167.1| putative cell-cycle protein [Bacteroides fragilis YCH46] (435 aa)
Score = 201, Expect = 5.2e-14, Identities = 62/180 (34%), Positives = 101/180 (56%)
  Q:     1 MKHKYLIAVSGGPDSMALLN---KKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  K L+ +SGG DS+ALL       +  EA  H N+H R+ +SD DE  VR  C +  + L +  FDT +    K+  I   +   RE+RY++FE + ++     I  AH K+D +E+  ++L +    N  LGIR     R+  ++RPLL  +++ +  Y +  + ++V D TN  D Y+RN +R
  S:    18 LNDKVLVTLSGGADSVALLRLLLSMGYTCEAA-HCNFHLRDKESDRDEAFVRRLCHESGVLLHIEHFDTTQYATKKHISI---EMAARELRYEWFETLRKQREASVIATAHHKDDSVETVLLNLIRGTGINGLLGIRP----RNGNIVRPLLCLSREEIIAYLQYIDQDYVTDSTNLLDEYTRNKIR 196
>gi|78043578|ref|YP_359085.1| tRNA(Ile)-lysidine synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|77995693|gb|ABB14592.1| tRNA(Ile)-lysidine synthetase [Carboxydothermus hydrogenoformans Z-2901] (449 aa)
Score = 201, Expect = 5.4e-14, Identities = 63/177 (35%), Positives = 98/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLN---KKRHLVE---AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++ VSGGPDSMALL    K R  V+    V HVN+  R  +SD DE++V D+ +KY +   V     DD+   ++  NLQ   R+ RY+FF ++ ++ G  KI +AH  +D  E+  M++ +      L      + R   +IRPL    ++ +  +   KNI + +D +N   +Y RN VR
  S:    23 KVVVGVSGGPDSMALLFCLLKYREEVDFSLEVVHVNHGLRGRESDLDEELVLDFTRKYGINFHV--KKLDDLKDLRE--NLQAVARQKRYEFFYEVLEKTGADKIALAHTASDVAETVMMNILRGAGTEGLCGIWPVRDR---IIRPLYTVFRREVMSFVERKNIPYRVDSSNLVPKYLRNKVR 199
>gi|60680868|ref|YP_211012.1| putative ATP-binding PP-loop protein [Bacteroides fragilis NCTC 9343] >gi|60492302|emb|CAH07067.1| putative ATP-binding PP-loop protein [Bacteroides fragilis NCTC 9343] (435 aa)
Score = 201, Expect = 5.4e-14, Identities = 62/180 (34%), Positives = 101/180 (56%)
  Q:     1 MKHKYLIAVSGGPDSMALLN---KKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  K L+ +SGG DS+ALL       +  EA  H N+H R+ +SD DE  VR  C +  + L +  FDT +    K+  I   +   RE+RY++FE + ++     I  AH K+D +E+  ++L +    N  LGIR     R+  ++RPLL  +++ +  Y +  + ++V D TN  D Y+RN +R
  S:    18 LNDKVLVTLSGGADSVALLRLLLSMGYTCEAA-HCNFHLRDKESDRDEAFVRRLCHESGVLLHIEHFDTTQYAAKKHISI---EMAARELRYEWFETLRRQREASVIATAHHKDDSVETVLLNLIRGTGINGLLGIRP----RNGNIVRPLLCLSREEIIAYLQYIDQDYVTDSTNLLDEYTRNKIR 196
>gi|42779142|ref|NP_976389.1| hypothetical protein BCE_0061 [Bacillus cereus ATCC 10987] >gi|61216566|sp|Q73FE5|TILS_BACC1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|42735057|gb|AAS38997.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] (476 aa)
Score = 200, Expect = 6.5e-14, Identities = 80/263 (30%), Positives = 135/263 (51%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK+  +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    26 VVGVSGGPDSVALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKELGV---ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCHKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|49476703|ref|YP_034416.1| cell cycle protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166997011|ref|ZP_02263470.1| cell cycle protein [Bacillus cereus AH820] >gi|196036405|ref|ZP_03103802.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus W] >gi|196041776|ref|ZP_03109066.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus NVH0597-99] >gi|196047393|ref|ZP_03114606.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus 03BB108] >gi|61216513|sp|Q6HPV4|TILS_BACHK tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|49328259|gb|AAT58905.1| cell cycle protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195991035|gb|EDX55006.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus W] >gi|196021795|gb|EDX60489.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus 03BB108] >gi|196027396|gb|EDX66013.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus NVH0597-99] (476 aa)
Score = 200, Expect = 7.0e-14, Identities = 80/263 (30%), Positives = 134/263 (50%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK   +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV---ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|118475834|ref|YP_892985.1| cell cycle protein [Bacillus thuringiensis str. Al Hakam] >gi|118415059|gb|ABK83478.1| cell cycle protein [Bacillus thuringiensis str. Al Hakam] (480 aa)
Score = 200, Expect = 7.1e-14, Identities = 80/263 (30%), Positives = 134/263 (50%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK   +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    30 VVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV---ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 314
>gi|30260254|ref|NP_842631.1| hypothetical protein BA0062 [Bacillus anthracis str. Ames] >gi|47525316|ref|YP_016665.1| hypothetical protein GBAA0062 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183097|ref|YP_026349.1| hypothetical protein BAS0062 [Bacillus anthracis str. Sterne] >gi|165872559|ref|ZP_02217191.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0488] >gi|167635086|ref|ZP_02393403.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0442] >gi|167641508|ref|ZP_02399756.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0193] >gi|170688892|ref|ZP_02880094.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0465] >gi|170707562|ref|ZP_02898015.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0389] >gi|177655625|ref|ZP_02936988.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0174] >gi|190569013|ref|ZP_03021914.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis Tsiankovskii-I] >gi|61216616|sp|Q81VX7|TILS_BACAN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|30253575|gb|AAP24117.1| conserved hypothetical protein [Bacillus anthracis str. Ames] >gi|47500464|gb|AAT29140.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177024|gb|AAT52400.1| conserved hypothetical protein [Bacillus anthracis str. Sterne] >gi|164711687|gb|EDR17232.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0488] >gi|167510493|gb|EDR85891.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0193] >gi|167529560|gb|EDR92310.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0442] >gi|170127558|gb|EDS96432.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0389] >gi|170667116|gb|EDT17877.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0465] >gi|172080036|gb|EDT65135.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis str. A0174] >gi|190559937|gb|EDV13921.1| tRNA(Ile)-lysidine synthetase [Bacillus anthracis Tsiankovskii-I] (476 aa)
Score = 200, Expect = 7.1e-14, Identities = 80/263 (30%), Positives = 134/263 (50%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK   +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV---ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPTFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|52145153|ref|YP_081675.1| cell cycle protein [Bacillus cereus E33L] >gi|61216463|sp|Q63HD6|TILS_BACCZ tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51978622|gb|AAU20172.1| cell cycle protein [Bacillus cereus E33L] (476 aa)
Score = 199, Expect = 7.3e-14, Identities = 80/263 (30%), Positives = 134/263 (50%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK   +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV---ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|194467678|ref|ZP_03073665.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri 100-23] >gi|194454714|gb|EDX43611.1| tRNA(Ile)-lysidine synthetase [Lactobacillus reuteri 100-23] (464 aa)
Score = 199, Expect = 7.6e-14, Identities = 58/179 (32%), Positives = 98/179 (54%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + K ++AVS G DSM LL+  +HL         V H+N+  R+ S  +E+ +R YCK+ +LKL V    +D          ++   R+ RY FF ++ ++   + ++ AH +ND  E+  M + +  + +  +GIR +  F S  LIRPLL  +K+ L++Y    ++++  D TN      RN  R
  S:    21 QDKVVVAVSTGVDSMVLLDLLQHLPSKNRPQIIVAHMNHQLRKQSQLEERFIRQYCKRNDLKLAVAHWPQD----LHPQTGVENAARQARYHFFREVMKDNQARILITAHHQNDLAETMLMKMTRGGQLSQLVGIRDRRPFASGTLIRPLLPFSKQQLKKYALQHHLKWYEDKTNKDLNIQRNRFR 202
>gi|78189702|ref|YP_380040.1| MesJ protein [Chlorobium chlorochromatii CaD3] >gi|78171901|gb|ABB28997.1| MesJ protein [Chlorobium chlorochromatii CaD3] (354 aa)
Score = 199, Expect = 8.1e-14, Identities = 63/177 (35%), Positives = 99/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLN---KKRHLVE---AVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+AVSGGPDSMALL+     +  ++   A+ H N+  R+ +SD+DE  V++     NL  FV  F+T ++  + +K   +L+   R +RY FFE++ Q  G  K+   H  ND  E+   +L +    L L GIR +       +IRP+L   K ++  Y   + I + +D +N    Y RN +R
  S:    52 KVLLAVSGGPDSMALLSLFCAVQPFLQCSLALAHCNFQLRDSESDSDEAFVQEQATARNLPCFVERFET-RNVAATWK--KSLEESARLLRYAFFERLMQVHGFHKVATGHHVNDNAETILFNLVRGTSLLGLRGIRAQHG----TIIRPMLLLHKPAITTYLHEQQIPYRVDSSNEGTEYDRNFIR 231
>gi|65317524|ref|ZP_00390483.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Bacillus anthracis str. A2012] (480 aa)
Score = 199, Expect = 8.3e-14, Identities = 80/263 (30%), Positives = 134/263 (50%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK   +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    30 VVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV---ICETIRINVSQYQKQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPTFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 314
>gi|153952817|ref|YP_001393582.1| TilS [Clostridium kluyveri DSM 555] >gi|146345698|gb|EDK32234.1| TilS [Clostridium kluyveri DSM 555] (462 aa)
Score = 198, Expect = 1.0e-13, Identities = 68/220 (30%), Positives = 121/220 (55%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQD 223
           K ++AVSGGPDS+ LL+       +  +     HVN+  R E+ D DE+ V+ +C+  +++     T  + ++K K I+  ++  RE+RY FFE++ ++L  +KI IAH  ND  E+  M + +       G+   +  R  + +RPL+  T+  +E+YC + N+   ID TN    YSRN +R  +  + +  F +  + V    L  +  I  +D+ + N+I ++
  S:    20 KVIVAVSGGPDSICLLHMLYVLQNRLDITLYAAHVNHCLRGEEGDKDEEYVKKFCESLSVEFKSLKTDVNYIAKEKRIS-CESAGREVRYKFFEELKKKLKAEKIAIAHNANDQAETVLMRIMRGAG--LQGLTGINPVRDNVFVRPLIRITRDEIEKYCDNNNLHPRIDKTNLETIYSRNKIRLELIPYIQNNFNRDIVAV----LNRLSDIIKIDNDYLNYISRE 239
>gi|62185345|ref|YP_220130.1| hypothetical protein CAB732 [Chlamydophila abortus S26/3] >gi|62148412|emb|CAH64179.1| conserved hypothetical protein [Chlamydophila abortus S26/3] (317 aa)
Score = 198, Expect = 1.0e-13, Identities = 64/193 (33%), Positives = 97/193 (50%)
  Q:     1 MKHKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDV-SKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMS-LNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           MK  YL+A+SGG DS+ LL   K R +     HV+Y  RE S  + + ++  C++  + L V     D V SKY    + +   R  RY  F KI +E  +  I +AH  ND  E+     L         G+   + +  + L+RPLL+  K+ L Q   ++NI +V D TN  +RY R  +R  +  W ++ F K
  S:    21 MKKSYLLALSGGSDSLFLLYLLKSRGVSFTAVHVDYGWRESSYREAEELKLRCQEEGVPLIV-----DHVPSKYTTSKDPENTARRYRYALFCKICREDNLAGIFLAHHANDQAETVLKRVLEGASLGNLKGMTSGASYNRIPLLRPLLHIPKQVLMQTLDAENIAYVHDVTNTDERYLRARMRNKIFPWLEEIFAK 212
>gi|15612646|ref|NP_240949.1| cell-cycle protein [Bacillus halodurans C-125] >gi|61216744|sp|Q9KGH8|TILS_BACHD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|10172695|dbj|BAB03802.1| cell-cycle protein [Bacillus halodurans C-125] (462 aa)
Score = 198, Expect = 1.0e-13, Identities = 54/175 (30%), Positives = 95/175 (54%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL----GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVSGGPDSMALL+      ++  +     H N+  R+++D +E  V  +C  + +   +F + +  V +  +++   +Q   RE+RY + E  +++ G   I   H  +D +E+  M   K  +  F     GI  + +   ++++RP L  TK  +E YC+  NIE   D +N    Y+RN  R
  S:    22 IVAVSGGPDSMALLHFLFSHREQLGITVMAAHGNHQLRQEADEEETFVHQFCLSHGI---LFTSARLPVKERMEMSGEGVQVTARELRYKWLEAEAKKHGAAFIATGHHGDDQIETILM---KQVRGTFPLSRGGIPVRREVGDVLIVRPFLGITKGQIEHYCKEVNIEPKRDPSNNASSYTRNRFR 202
>gi|163938071|ref|YP_001642955.1| tRNA(Ile)-lysidine synthetase [Bacillus weihenstephanensis KBAB4] >gi|163860268|gb|ABY41327.1| tRNA(Ile)-lysidine synthetase [Bacillus weihenstephanensis KBAB4] (476 aa)
Score = 198, Expect = 1.1e-13, Identities = 78/261 (29%), Positives = 136/261 (52%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINK 266
           ++ VSGGPDS+ALL        ++ L   V HV++  R  +S  D + V+  CK+  +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    +   ID +N  + Y+RN +RK +  + K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  +
  S:    26 VVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGNESYEDLQFVQGLCKELGV---ICETLRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRSFHNGYLIRPLLGVTKEEIVDYCNKLKVIPRIDPSNKKEVYTRNRLRKYVLPYLKEENPQMHEKFQKFSVQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKR 308
>gi|47570187|ref|ZP_00240841.1| cell cycle protein mesJ [Bacillus cereus G9241] >gi|47553131|gb|EAL11528.1| cell cycle protein mesJ [Bacillus cereus G9241] (476 aa)
Score = 198, Expect = 1.2e-13, Identities = 80/263 (30%), Positives = 134/263 (50%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL         +     V HV++  R D S  D + V+D CK   +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGV---ICETIRINVSQYQQQYGMNAQVAARECRYVFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVHEKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKVIEFFKRTQ 310
>gi|30018334|ref|NP_829965.1| cell cycle protein MesJ [Bacillus cereus ATCC 14579] >gi|61216614|sp|Q81J84|TILS_BACCR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29893874|gb|AAP07166.1| Cell cycle protein MesJ [Bacillus cereus ATCC 14579] (476 aa)
Score = 196, Expect = 1.8e-13, Identities = 79/263 (30%), Positives = 137/263 (52%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK----NMFFIKLLDSKFNNWIKQDFDINYFLKI-----------KNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNK 268
           ++ VSGGPDS+ALL        ++ L   V HV++  R D S  D + V+  C++  +   + +T + +VS+Y+     N Q   RE RY F E+I ++   + + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC   N+   ID +N  + Y+RN +RK +    K+   + + K + F+++      +  +L   K N  I +  D    L I           +   +  L YL+   I    +   I+++IEF  + +
  S:    26 VVGVSGGPDSLALLYYLLEKRAEKQLEIVVAHVDHMFRGDESYEDLQFVQGLCEELGI---ICETIRINVSQYQQQYGMNAQVAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFHNGYLIRPLLGVTKEEIVDYCNKLNLMPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMHEKFQKFSVQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLILNYLYEYKIPSSLSSIHIDKLIEFFKRTQ 310
>gi|167036726|ref|YP_001664304.1| tRNA(Ile)-lysidine synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855560|gb|ABY93968.1| tRNA(Ile)-lysidine synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] (458 aa)
Score = 195, Expect = 2.4e-13, Identities = 60/189 (31%), Positives = 109/189 (57%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           K ++ VSGGPDS+ +L+   +L +       + HVN+  R E +  D + V D C+K  L  F+F+     ++K    +  +   R +RY  FE++ +E+   KI +AH KND +E+ +++L +       +GI+  +      +IRPL+   ++ +E+Y + K+++  ID+TN+ D Y RN VR  +  +  +TF+
  S:    20 KIVMGVSGGPDSLCMLDILYNLKDLFNLKLYIVHVNHMIRGEAAKRDAQFVEDMCRKLKLPFFLFEKDVKKIAKEMGYSEEEAG-RYVRYQAFEEVLKEVKGNKIAVAHNKNDVVETVFLNLIRGSGMAGLIGIKPVNGN----IIRPLIEIEREEIEKYLKEKDLKPAIDFTNYEDLYKRNKVRLKLIPFINETFE 211
>gi|194333384|ref|YP_002015244.1| tRNA(Ile)-lysidine synthetase [Prosthecochloris aestuarii DSM 271] >gi|194311202|gb|ACF45597.1| tRNA(Ile)-lysidine synthetase [Prosthecochloris aestuarii DSM 271] (336 aa)
Score = 195, Expect = 2.7e-13, Identities = 64/187 (34%), Positives = 93/187 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAV------------CHVNYHDREDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           L AVSGGPDSMAL+    HL+++             CH    DRE SD DE +V +   +  L+  +  FDT +D  S  K I       R  RY FF ++ +  G  ++   H  ND  E+   +L +      L GIR         LIRP+L   ++ +  Y  +KNI +  D +NF     RN +R  +    ++ FQ
  S:    29 LAAVSGGPDSMALM----HLLQSARPVLHFSLEIAHCHFGLRDRE-SDLDESLVAEEAARLGLRCHIRHFDTRRDAGSWKKSIEETA---RIERYGFFSELQRTCGFDRVATGHHVNDNAETILFNLFRGTSVPGLKGIRAHHG----TLIRPMLLMRREDVMSYIDAKNIAYRTDASNFGIEPDRNFIRHRVIPVIEERFQ 218
>gi|57241883|ref|ZP_00369823.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195] >gi|57017075|gb|EAL53856.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195] (322 aa)
Score = 194, Expect = 3.2e-13, Identities = 60/192 (31%), Positives = 105/192 (54%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           + K L+A S G DS AL  L ++ +++  +  +NY  R++SD +E+  R   K+++ ++F+         ++K   N +   R+ RY FFEKI  E G + +++AHQ ND  E   M L+K    +  LG+    K  +  LIRPLLN TK+ +  + R   +++  D +N   ++ RN +R+  ++   + F K
  S:    12 ERKNLLAFSYGSDSTALFYLLERENVIFDMALINYKTRQNSDLEEEEARLLAKRFHKQIFI-----QTAPRFK--GNFEKNARDFRYAFFEKICIEEGYENLILAHQLNDLFEWFLMQLSKGAGAMELLGMSAFEKRENYTLIRPLLNVTKEQILAFLRENKLKYFDDESNKDLKFKRNFIREHFSDEFLRHFSK 199
>gi|86131835|ref|ZP_01050432.1| putative ATP-binding PP-loop protein [Cellulophaga sp. MED134] >gi|85817657|gb|EAQ38831.1| putative ATP-binding PP-loop protein [Dokdonia donghaensis MED134] (435 aa)
Score = 194, Expect = 3.5e-13, Identities = 62/180 (34%), Positives = 100/180 (55%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRH--LVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDI--NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  K L+ VSGG DSM LL   R   L   V H N++ R  +SD D+  V  YCK +N+ +++  FDT     S Y  I   + Q   RE+RY +F+++S   G+  IL AH  ND LE+  ++L +       G++  +    +   ++RPLL  ++K +++Y   + + +  D +N  D Y RN +R
  S:    17 LDSKILVTVSGGLDSMLLLLLCRQAGLTIRVAHCNFNLRGVESDGDQAFVESYCKLHNIPIYIKSFDT-----SAYAKIEKTSTQIAARELRYQWFKELSATEGLDYILTAHHLNDELETFLINLGRGT-----GVKGLTGIPEINERVVRPLLPFSRKRIKEYALQEKLAWREDSSNATDNYVRNHLR 195
>gi|126646938|ref|ZP_01719448.1| putative cell-cycle protein [Algoriphagus sp. PR1] >gi|126576986|gb|EAZ81234.1| putative cell-cycle protein [Algoriphagus sp. PR1] (439 aa)
Score = 192, Expect = 5.4e-13, Identities = 58/180 (32%), Positives = 102/180 (56%)
  Q:     1 MKHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  KYL+A SGG DS+ L  L  +      V HVN+H RE +SD DE  V++  +++N     F  H+ D   + + + + T    R+IRY++FE+I +E  +  IL+AH ++D LE+ +++L +    + L+    ++ K     LIRPLL  ++  + ++  +  + +  D +N    Y RN +R
  S:    17 LDKKYLLACSGGLDSVCLGTLLHQSGFSFEVAHVNFHLREKESDGDELFVKNLAEQWNAP---FHVHQADTYSFVEDHKVSTQMAARDIRYEWFEQIRKERNLAGILLAHHEDDQLETIFLNLLRGTGIEGLYGMAEKRGK-----LIRPLLPFSRAEILEFATAMELAWREDSSNKSTDYKRNKLR 195
>gi|69245448|ref|ZP_00603443.1| PP-loop [Enterococcus faecium DO] >gi|68195830|gb|EAN10266.1| PP-loop [Enterococcus faecium DO] (481 aa)
Score = 192, Expect = 5.9e-13, Identities = 72/259 (27%), Positives = 133/259 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDK-------KTFQKFYLKVKWFN-LKNMFFIKLLDSKFNNWIKQ-DFDINYFLKIKNNYKESLIYLFLN----HIGIKPNENKIEQIIE 262
           + L AVSGG DSM LL+    +         + H+N+  RE+S  +   +R YC++ NL L+V  +  +D +K    + ++T  R  RY  F ++ +E     ++ AH  +D +E+  M + +  + N F GI+    F +  LIRPLL+ +K+ L  Y     + +  D TN      RN +R ++    K       + FQ+F  +++W + +   +  +L++ +   W +Q  F      ++ +  +    Y F +      GI   E ++E I++
  S:    32 RILAAVSGGVDSMVLLHLLLQVQRQIGFSLGIVHINHQLREESAEEAAYLRSYCEEKNLPLYV--SIWEDPAK----SAIETEARNFRYQEFTRVMEEGQYDTLMTAHHGDDQIETVLMKIVRGGQLNTFSGIKEVQPFATGRLIRPLLSFSKEDLYTYAAESQLVYFEDQTNQLLDIQRNRLRHLVVPQLKQENTQALRHFQQFSQQIQWADQVIQKYMGQLIEKEVEQWEEQFRFSAEMIEEMTDAERYYFFYSFFDKAFSKTGIILKEQQMESILD 304
>gi|149194101|ref|ZP_01871199.1| hypothetical protein CMTB2_03413 [Caminibacter mediatlanticus TB-2] >gi|149136054|gb|EDM24532.1| hypothetical protein CMTB2_03413 [Caminibacter mediatlanticus TB-2] (323 aa)
Score = 191, Expect = 7.3e-13, Identities = 70/212 (33%), Positives = 114/212 (53%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILI-RPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK--------MMAEWDKKTFQ------KFYLKVKWFNLKNMFFIKLLDSKFN 217
           L+A SGG DS AL     ++++   +  VNYH RE SD + +  +   KKYN K+F+ D +    S+ K         R+ RY FFE+I ++ G   +++ HQ ND  E   M L+K      L    K + R    I RP  N +++ + +Y    NI++ ID +NF  +Y RN++RK        M  +  KK+F+      K  + + W  +K+++  K  + K +
  S:     4 LLAFSGGIDSSALFFWLMEKNIDFDIAIVNYHTRETSDEEVEYAKYLAKKYNKKIFIKDCYLKKFSEKKA--------RDCRYTFFEEIIKKYGYSTLILGHQLNDRFEWFLMQLSKGAGLKELIAMEKWEEREFYKIYRPFYNLSRREIIEYLHKHNIKYFIDKSNFDIKYKRNLIRKEFSNKFIEMFEKGVKKSFEFLEEDKKLLINLNWKKIKDLYIFKKTNPKLD 224
>gi|152973911|ref|YP_001373428.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022663|gb|ABS20433.1| tRNA(Ile)-lysidine synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] (476 aa)
Score = 191, Expect = 7.7e-13, Identities = 65/189 (34%), Positives = 105/189 (55%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKT-------FQKF 194
           ++ VSGGPDS+ALL       + ++L   V HV++  R D S  D + V + C +  +   + +T + +V +Y+  +  N Q   RE RY F E+I ++     + + H  +D +E+  M L + +    + GI  K  F +  LIRPLL  TK+ +  YC    I   ID +N  + Y+RN +RK +  + K+        FQKF
  S:    26 VVGVSGGPDSLALLYYLLEKREAKNLTIVVAHVDHMFRGDESYEDLQFVENLCHELGI---LCETIRINVLQYQQQHGMNAQVAARECRYAFLERIMRKYDAGYVALGHHGDDQVETILMRLVRGSTPQGYAGIAVKRPFHNGYLIRPLLAVTKEEILDYCDQLGIMPRIDSSNKKEVYTRNRLRKYVLPYLKEENPQVHEHFQKF 228
>gi|89892946|ref|YP_516433.1| hypothetical protein DSY0200 [Desulfitobacterium hafniense Y51] >gi|89332394|dbj|BAE81989.1| hypothetical protein [Desulfitobacterium hafniense Y51] (472 aa)
Score = 190, Expect = 9.2e-13, Identities = 54/177 (30%), Positives = 97/177 (54%)
  Q:     4 KYLIAVSGGPDSMALLN---------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKY-KDI-NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L AVSGGPDS+AL +         +++ +   + HV++  RE+SD++EK+V++  + + +   +   H+ D   Y K +  + QT  RE RY  +++  ++     +  AH   D  E+    L +      L      K +   LIRPLL  TK+ + +YCR++ + + +D++N    Y RN +R
  S:    19 RILAAVSGGPDSVALAHILWRYIQDKQEQKITLVITHVHHGVREESDDEEKMVQNMARDWEIPCLI---HRFDSKNYAKSVGKSFQTAAREWRYACWQEDMRKENCTLLATAHHLGDQAETVLYRLLRGSGTAGLAGIYPQKGK---LIRPLLTVTKEDILEYCRNEKLPYALDHSNEEPVYVRNKIR 200
>gi|157827938|ref|YP_001494180.1| cell cycle protein MesJ [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932627|ref|YP_001649416.1| tRNA(Ile)-lysidine synthetase [Rickettsia rickettsii str. Iowa] >gi|166988066|sp|A8GQJ7|TILS_RICRS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|189035969|sp|B0BVY4|TILS_RICRO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157800419|gb|ABV75672.1| cell cycle protein MesJ [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907714|gb|ABY72010.1| tRNA(Ile)-lysidine synthetase [Rickettsia rickettsii str. Iowa] (478 aa)
Score = 190, Expect = 9.3e-13, Identities = 61/182 (33%), Positives = 99/182 (54%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD-THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K  IAVSGG DS+ALL       +K ++   V  V+++ RE S  +   +++     N K +     H+++ S      NLQ   RE RYD    +  EL I  +L AH ++D++E+  + L +N     L     + + ++ +IRPL N  K  L +Y  S NI++  D +N  D+Y RNV+R+ +A+
  S:    21 KISIAVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS------NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIHIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNVIRQKLAK 203
>gi|109647742|ref|ZP_01371645.1| tRNA(Ile)-lysidine synthetase [Desulfitobacterium hafniense DCB-2] >gi|109640832|gb|EAT50387.1| tRNA(Ile)-lysidine synthetase [Desulfitobacterium hafniense DCB-2] (472 aa)
Score = 189, Expect = 1.1e-12, Identities = 54/177 (30%), Positives = 97/177 (54%)
  Q:     4 KYLIAVSGGPDSMALLN---------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKY-KDI-NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L AVSGGPDS+AL +         +++ +   + HV++  RE+SD++EK+V++  + + +   +   H+ D   Y K +  + QT  RE RY  +++  ++     +  AH   D  E+    L +      L      K +   LIRPLL  TK+ + +YCR++ + + +D++N    Y RN +R
  S:    19 RILAAVSGGPDSVALAHILWRYIQDKQEQKITLVITHVHHGVREESDDEEKMVQNMARDWEIPCLI---HRFDSKNYAKSVGKSFQTAAREWRYACWQEDMRKENCTLLATAHHLGDQAETVLYRLLRGSGTAGLAGIYPQKGK---LIRPLLTVTKEDILEYCRNEKLPYALDHSNEEPIYVRNKIR 200
>gi|90962327|ref|YP_536243.1| tRNA(Ile)-lysidine synthase TilS [Lactobacillus salivarius UCC118] >gi|90821521|gb|ABE00160.1| tRNA(Ile)-lysidine synthase TilS [Lactobacillus salivarius UCC118] (452 aa)
Score = 189, Expect = 1.2e-12, Identities = 75/270 (27%), Positives = 138/270 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRS-LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK---NMFFIK-LLDSKFNNWIKQD-FDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVK 273
           K L+AVS G DSM LL+    L +       + ++++  RE S  + K ++++C   N+ L+V+   K++      + +++   RE+RY+FFEK+ +E  I+ ++ AH  +D  E+  M L +         I+    FR    ++RP+L   KK +  Y +   I++  D TN  D Y RN +R  +    K    +F   V  +  +   N+  I+ + D K N   K++    + F+K    ++  L+  +L   G++  E +++QI+  +N  K    K
  S:    25 KVLLAVSTGVDSMVLLSGMLKLSKVLDVEINIAYIDHQLREQSKEETKFIKEFCFARNIPLYVYRWEKEE----HPVQSIEAAAREVRYNFFEKVLKENNIEYLVTAHHGDDQAETFLMKLIRGGNIQQLQAIQSVRIFREDYQIVRPMLIFNKKEIYDYAKQLGIKYYEDETNKSDDYQRNRLRHHIIPVLKAENPEFLKHVLGYTQQLTNNLQAIQEVADVKLNKISKEETLGYDKFVKESPLWQRILLERYLEVKGLEIKETQVQQILAMLNDKKKPQAK 303
>gi|55981511|ref|YP_144808.1| cell cycle protein MesJ [Thermus thermophilus HB8] >gi|61217197|sp|Q5SI38|TILS_THET8 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|55772924|dbj|BAD71365.1| probable cell cycle protein MesJ [Thermus thermophilus HB8] (507 aa)
Score = 189, Expect = 1.3e-12, Identities = 58/179 (32%), Positives = 93/179 (51%)
  Q:     2 KHKYLIAVSGGPDS--MALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI--NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K   ++AVSGG DS  +ALL K+      V H+++  R +S  D+  VR   ++     F F T + +V++       NL+   RE+RY F  ++++E+G + IL AH  +D  E+  + L +       GIR     R  I++RPLL  T++ L  Y R++   +  D TN      RN +R
  S:    16 KDPLVLAVSGGGDSVALALLVKEAGRQAVVAHLDHGLRPESPLDQAFVRALAERLG---FPFFTERVEVARIAQARGENLEAVAREVRYAFLHRVAREVGARAILTAHTLDDQAETVLLQLLQGTARA-TGIRE----REGIVVRPLLAHTREELRAYLRARGEAWREDPTNQDPALDRNFLR 190
>gi|46199478|ref|YP_005145.1| putative cell cycle protein mesJ-like protein [Thermus thermophilus HB27] >gi|61217297|sp|Q72IF6|TILS_THET2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|46197104|gb|AAS81518.1| putative cell cycle protein mesJ-like protein [Thermus thermophilus HB27] (507 aa)
Score = 189, Expect = 1.3e-12, Identities = 58/179 (32%), Positives = 93/179 (51%)
  Q:     2 KHKYLIAVSGGPDS--MALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI--NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K   ++AVSGG DS  +ALL K+      V H+++  R +S  D+  VR   ++     F F T + +V++       NL+   RE+RY F  ++++E+G + IL AH  +D  E+  + L +       GIR     R  I++RPLL  T++ L  Y R++   +  D TN      RN +R
  S:    16 KDPLVLAVSGGGDSVALALLVKEAGRQAVVAHLDHGLRPESPLDQAFVRALAERLG---FPFFTERVEVARIAQARGENLEAVAREVRYAFLHRVAREVGARAILTAHTLDDQAETVLLQLLQGTARA-TGIRE----REGIVVRPLLAHTREELRAYLRARGEAWREDPTNQDPALDRNFLR 190
>gi|110597047|ref|ZP_01385336.1| tRNA(Ile)-lysidine synthetase-like [Chlorobium ferrooxidans DSM 13031] >gi|110341238|gb|EAT59703.1| tRNA(Ile)-lysidine synthetase-like [Chlorobium ferrooxidans DSM 13031] (337 aa)
Score = 188, Expect = 1.6e-12, Identities = 67/177 (37%), Positives = 99/177 (55%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L+A+SGGPDSMA+L+         HL  AV H N+  R  +SD DE  VR+   +  ++ FV  FDT +   S+ K   +L+   R +RY FF+K+ +E G  K+  AH  +D  E+   +L +      L GIR     R+  +IRP+L   K  ++ Y + K I   ID +N  D Y RN +R
  S:    23 RILVALSGGPDSMAMLSLFTALRPVLHLQLAVAHCNFLLRGRESDGDEDFVREAALRLGMECFVERFDT-RHHASQLK--KSLEETARILRYGFFDKVLEEQGFSKVATAHHVSDNAETILFNLFRGASLPALKGIRA----RNDRIIRPMLLLHKAEIKGYLKEKGIASRIDSSNSSDDYDRNFIR 202
>gi|67458532|ref|YP_246156.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia felis URRWXCal2] >gi|75537001|sp|Q4UN67|TILS_RICFE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|67004065|gb|AAY60991.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia felis URRWXCal2] (430 aa)
Score = 187, Expect = 2.1e-12, Identities = 67/213 (31%), Positives = 112/213 (52%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD-THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKF 216
           K   AVSGG DS+ALL       +K ++  +V  V+++ RE S  +   +++     N K +     H+++ S      NLQ   RE RYD    +  EL I  +L AH ++D++E+  + L +N     L     + + ++ +IRPL N  K  L +Y  S NI++  D +N  D+Y RN++R+ +A+ +       Y+K     L+ +    LLD+KF
  S:    21 KIAAAVSGGSDSVALLYLANIWAEKNNIELSVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS------NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNIIRQKLAKGED------YIKADII-LQQLKINDLLDNKF 227
>gi|34580975|ref|ZP_00142455.1| cell cycle protein MesJ [Rickettsia sibirica 246] >gi|28262360|gb|EAA25864.1| cell cycle protein MesJ [Rickettsia sibirica 246] (478 aa)
Score = 186, Expect = 2.4e-12, Identities = 60/182 (32%), Positives = 98/182 (53%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD-THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K  IAVSGG DS+ALL       +K ++   V  V+++ RE S  +   +++     N K +     H+++ S      NLQ   RE RYD    +  EL I  +L AH ++D++E+  + L +N     L     + + ++ +IRPL N  K  L +Y    NI++  D +N  D+Y RNV+R+ +A+
  S:    21 KISIAVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS------NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVRHNIKWFEDESNSSDKYRRNVIRQKLAK 203
>gi|110639392|ref|YP_679602.1| tRNA(Ile)-lysidine synthetase [Cytophaga hutchinsonii ATCC 33406] >gi|110282073|gb|ABG60259.1| tRNA(Ile)-lysidine synthetase [Cytophaga hutchinsonii ATCC 33406] (450 aa)
Score = 186, Expect = 2.5e-12, Identities = 58/177 (32%), Positives = 95/177 (53%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+ VSGG DS+ L +   K      V H N+  R  +SD DE+ V D   K  + + V    + D S +   N L  Q   RE+RY +F++++++ G   I  AHQ ND +E+  ++L++      L GI  K+      +IRPLL   +  +  Y    N+++  D +N  ++Y+RN++R
  S:    20 KILLTVSGGIDSIVLFDLFVKAGFSFGVAHCNFSLRGSESDGDEQFVSDLAIKQGISIHV---KRFDTSAFASNNALSIQMAARELRYTWFKELARQYGYAAIATAHQLNDIIETTLINLSRGTGIAGLHGIPEKNG----EIIRPLLFAGRDKIRSYAEENNLKWREDSSNMEEKYARNLIR 195
>gi|15891990|ref|NP_359704.1| cell cycle protein MesJ [Rickettsia conorii str. Malish 7] >gi|20140671|sp|Q92JK0|TILS_RICCN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15619104|gb|AAL02605.1| cell cycle protein MesJ [Rickettsia conorii str. Malish 7] (478 aa)
Score = 186, Expect = 2.6e-12, Identities = 60/182 (32%), Positives = 98/182 (53%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD-THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K  IAVSGG DS+ALL       +K ++   V  V+++ RE S  +   +++     N K +     H+++ S      NLQ   RE RYD    +  EL I  +L AH ++D++E+  + L +N     L     + + ++ +IRPL N  K  L +Y    NI++  D +N  D+Y RNV+R+ +A+
  S:    21 KISIAVSGGSDSVALLYLANIWAEKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYSLSFDHQNNFS------NLQERAREGRYDLMTNLCLELDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVRHNIKWFEDESNSSDKYRRNVIRQKLAK 203
>gi|189346163|ref|YP_001942692.1| tRNA(Ile)-lysidine synthetase [Chlorobium limicola DSM 245] >gi|189340310|gb|ACD89713.1| tRNA(Ile)-lysidine synthetase [Chlorobium limicola DSM 245] (325 aa)
Score = 186, Expect = 2.6e-12, Identities = 64/187 (34%), Positives = 92/187 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           L+AVSGGPDSMALL     +        +V H N+  R E+SD+DE+ V + C+   ++ F   FDT     S  K +       R  RY +FE + QE  + KI   H  +D  E+   +L +    L L   R    R   +IRPLL   K  +  Y + K I F  D +N    Y RN +R  +    ++ F+
  S:    25 LVAVSGGPDSMALLYLLCAVASVVRCRISVAHCNFQLRGEESDSDERFVMEQCRLLGVECFSRQFDTAAVSASWKKSVEETA---RLQRYSWFETLLQEREMTKIATGHHVSDNAETILFNLFRGTSLLGLKGIRAMHGR---VIRPLLLLHKSDILGYLQEKEIPFRTDASNESIDYDRNFIRNRVIPLIEERFE 214
>gi|29840521|ref|NP_829627.1| MesJ/Ycf62 family protein [Chlamydophila caviae GPIC] >gi|61216617|sp|Q822B9|TILS_CHLCV tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29834870|gb|AAP05505.1| MesJ/Ycf62 family protein [Chlamydophila caviae GPIC] (317 aa)
Score = 186, Expect = 2.8e-12, Identities = 59/193 (30%), Positives = 99/193 (51%)
  Q:     1 MKHKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS-KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSL--NKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           MK  YL+A+SGG DS+ LL   K R +     HV++  RE S  + + ++  C++  + + +     D V  +Y+   + +   R  RY  F K+ +E  +  I +AH  ND  E+    L    +  NL  G+  K+ +  + L RPLL+  K+ +     ++N+  V D TN  +RY R  +RK +  W ++ F K
  S:    21 MKKSYLLALSGGSDSLFLLYLLKSRGVAFTAVHVDHGWRESSYREAEELKIRCEEEGIPILI-----DHVPPEYRTSRDPENAARRYRYTLFHKVCKEQNLAGIFLAHHANDQAETVLKRLLEGASLSNL-KGMSPKTSYEDIPLFRPLLHIPKQIIINVLDAENVPCVQDITNTDERYLRARMRKKIFPWLEEIFGK 212
>gi|189499568|ref|YP_001959038.1| tRNA(Ile)-lysidine synthetase [Chlorobium phaeobacteroides BS1] >gi|189495009|gb|ACE03557.1| tRNA(Ile)-lysidine synthetase [Chlorobium phaeobacteroides BS1] (334 aa)
Score = 186, Expect = 2.9e-12, Identities = 66/195 (33%), Positives = 99/195 (50%)
  Q:     2 KHKYLIAVSGGPDSMALLN---KKRHLVE---AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYL 196
           +   L AVSGGPDSMALL      R +++   +V H N+  R E+S+ DE+ VR  C+K  L+ FV  FDT KD     K I       R  RY FF ++  + G  ++   H  +D  E+   +L +      L GIR +       +IRPLL   K+ + +Y   K I + +D +N      RN +R  +    ++ F   +L
  S:    25 REHVLAAVSGGPDSMALLYLLCAVRSVLKVRISVAHCNFQLRGEESELDEEFVRSECEKLGLECFVRRFDTQKDARRLKKSIEETA---RIERYGFFHELIAKDGFDRVATGHHVSDNAETVLFNLIRGSSISGLKGIRSEHGH----VIRPLLLMQKRDITRYIGEKEISYRVDSSNIGIEPDRNFIRNKIIPLIEERFNNKFL 222
>gi|154505539|ref|ZP_02042277.1| hypothetical protein RUMGNA_03076 [Ruminococcus gnavus ATCC 29149] >gi|153794197|gb|EDN76617.1| hypothetical protein RUMGNA_03076 [Ruminococcus gnavus ATCC 29149] (469 aa)
Score = 185, Expect = 3.4e-12, Identities = 55/177 (31%), Positives = 94/177 (53%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K +  +SGG DS+ LL     L E +       HVN+  R E++  DE+    +C++ N+   V+  +  +++  K ++ ++   R +R   FE++    G  KI +AH +ND  E+  ++L +       GIR  S  R +   +IRPLL   +K +E Y +   + +  D TN  D Y+RN +R
  S:    20 KVIAGISGGADSICLLFVLLRLQEKIGFDVIAVHVNHGLRGENAKRDERFTETFCRERNVPCIVYHENVKEIAAQKKLS-VEEAGRLVRRKAFEEVRIRYGGTKIALAHHQNDNAETMLLNLARGT-----GIRGLSGIRPVNGYMIRPLLGINRKEIEYYLKEHQLSYCEDETNAGDEYTRNRIR 199
>gi|154248857|ref|YP_001409682.1| tRNA(Ile)-lysidine synthetase [Fervidobacterium nodosum Rt17-B1] >gi|154152793|gb|ABS60025.1| tRNA(Ile)-lysidine synthetase [Fervidobacterium nodosum Rt17-B1] (457 aa)
Score = 184, Expect = 4.1e-12, Identities = 60/175 (34%), Positives = 95/175 (54%)
  Q:     6 LIAVSGGPDSMALLN-----KKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGG DS+ +L+     K   L+   V   N+  R ++D++   V+ +C+   +  F  +    DV  Y + N L  +   R +RY+F ++ ++E G   I  AH  ND LE+  +   K      L      K  + I IRPL+  T+K +E+Y + + +E+VID TNF   Y+RN VR
  S:    39 LLAVSGGVDSIVMLDLFNRAKDELLINIGVATFNHKLRTEADDEVIFVQKFCEGLGIPFFPGEA---DVKMYCEQNKLSIEEGARILRYEFLKRTAKENGYSFIATAHNANDLLETIILRQIKGTGPFGLA---AIKPINGIFIRPLIFFTRKEIEEYAKERKLEYVIDRTNFDIEYNRNFVR 215
>gi|126663890|ref|ZP_01734885.1| tRNA(Ile)-lysidine synthetase [Flavobacteria bacterium BAL38] >gi|126624154|gb|EAZ94847.1| tRNA(Ile)-lysidine synthetase [Flavobacteria bacterium BAL38] (219 aa)
Score = 184, Expect = 4.5e-12, Identities = 57/179 (31%), Positives = 104/179 (58%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEA--VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + K+ IAVSGG DSM LL+  +H   +  V H N+  R E+SD D + + DYC++ N++L +     + ++K     ++Q   R++RY++F +  +E  ++ +  AH  +D LE+  ++L++       GI   +    +   +IRPLL  +++ +EQY +  NI++  D +N   +Y RN +R
  S:    18 RDKFYIAVSGGIDSMVLLHLFQHFQFSFGVLHCNFKLRGEESDADMRFIHDYCEENNIQLRIGFFETEMIAKELK-ESIQVTARKLRYNWFYEQMEENDVQFVATAHHLDDSLETFLINLSRGT-----GIDGLTGIPEINDQIIRPLLPFSREEIEQYAKVNNIQWREDASNATTKYLRNKLR 195
>gi|57240790|ref|ZP_00368738.1| conserved hypothetical protein [Campylobacter lari RM2100] >gi|57018409|gb|EAL55183.1| conserved hypothetical protein [Campylobacter lari RM2100] (318 aa)
Score = 183, Expect = 5.4e-12, Identities = 60/181 (33%), Positives = 100/181 (55%)
  Q:     4 KYLIAVSGGPDSMAL----LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
           K L+A S G DS AL    LNK      A+  +NY  R++SD +E+  ++  KKYN K+FV    K +        N +   R +RY+FF++I ++   + +++AH  ND  E   M  +K    +  LG +   K  + I++RPL+N +K  +  + + +NI++  D +N  ++Y RN +RK  A
  S:    11 KNLLAFSHGSDSSALFFMLLNKNIDFDLAL--INYKTRKNSDKEEQSAKELAKKYNKKIFVKIATKIE-------KNFEANARAVRYEFFDEICKKYKYENLILAHNLNDKFEWFLMQFSKGAGFVELLGFKAVEKKENFIIVRPLINTSKDEILNFLKKENIKYFYDESNDDEKYFRNFIRKNFA 187
>gi|23097532|ref|NP_690998.1| cell-cycle protein [Oceanobacillus iheyensis HTE831] >gi|61216653|sp|Q8EU18|TILS_OCEIH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|22775755|dbj|BAC12033.1| cell-cycle protein [Oceanobacillus iheyensis HTE831] (466 aa)
Score = 183, Expect = 5.5e-12, Identities = 59/196 (30%), Positives = 101/196 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           K ++ VSGG DSMALL+  ++L E          +N+  R EDS  D+K V  +C   +++      H+ DV +Y+    +  +   R +RY+ +E   ++ G   + + H  +D +E+ +M L +    N F GI  K  F S  LIRP L   K+ +  Y +   + F  D TN  ++Y+RN  R  +     K  ++ ++  +
  S:    20 KIIVGVSGGSDSMALLHFLKNLQEQWEIEVIALTINHQLRGEDSTADQKFVEQWCFHSDIRCI---AHQVDVGEYQRQYRVSEELAARRLRYEIYEAEMRKQGADYLALGHHGDDQVETLFMRLTRVATSNAFEGIPVKRSFASGQLIRPFLCVNKQLILNYVKENEVPFREDQTNKDNKYTRNYYRNEIIPLLTKNNERLFITAQ 222
>gi|89898057|ref|YP_515167.1| PP-loop superfamily ATPase [Chlamydophila felis Fe/C-56] >gi|89331429|dbj|BAE81022.1| PP-loop superfamily ATPase [Chlamydophila felis Fe/C-56] (317 aa)
Score = 183, Expect = 5.8e-12, Identities = 62/193 (32%), Positives = 98/193 (50%)
  Q:     1 MKHKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS-KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKND--------FLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           MK  YL+A+SGG DS+ LL   K R +     HV+Y  RE S  + + +   C+   + + V     D V  +Y+   + +   R  RY  F K+ Q+  +  I +AH  ND         LE A++S  K       G+R +  +  + ++RPLL+  K  L +   + NI +V D TN  +RY R  +R  +  W ++ F K
  S:    21 MKKSYLLALSGGSDSLFLLYLLKSRGVSFIAVHVDYGWRESSYREAEELELRCQAEGVPIIV-----DHVPPEYRTSRDQENAARRYRYALFHKVCQKKNLSGIFLAHHANDQAETVLKRVLEGAHLSNLK-------GMRGEVYYEGIPILRPLLHIPKIVLSRTLDAANIHYVHDITNTDERYLRARMRNKIFPWLEEIFGK 212
>gi|119356415|ref|YP_911059.1| tRNA(Ile)-lysidine synthetase [Chlorobium phaeobacteroides DSM 266] >gi|119353764|gb|ABL64635.1| tRNA(Ile)-lysidine synthetase [Chlorobium phaeobacteroides DSM 266] (325 aa)
Score = 183, Expect = 6.0e-12, Identities = 65/175 (37%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGG DSMALL+    +  AV       H N+  R E+SD DE+ V++ C    +  +   FDT K    ++K   +++   R +RY +F+ +  E G+K +   H  ND  E+  M  N  +    LG+R     R  I IRPLL   K  +  Y   K+I F ID TNF     RN +R
  S:    25 LLAVSGGSDSMALLHLFCAIRRAVPCRISAVHCNFRLRAEESDEDERFVQEACLALGVTCYTVGFDTLKM-AGEWK--TSIEETARILRYRYFDTLLSEHGMKVVATGHHVNDNAET--MLFNLFRGTSLLGLRGIRAKRGKI-IRPLLLVHKVEILGYIDEKHIAFRIDATNFGIDPDRNFIR 202
>gi|148264776|ref|YP_001231482.1| tRNA(Ile)-lysidine synthetase [Geobacter uraniireducens Rf4] >gi|146398276|gb|ABQ26909.1| tRNA(Ile)-lysidine synthetase [Geobacter uraniireducens Rf4] (459 aa)
Score = 182, Expect = 7.9e-12, Identities = 55/175 (31%), Positives = 90/175 (51%)
  Q:     6 LIAVSGGPDSMALLN-----KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVSGG DS+ALL+         L   V H+N+  R  +SD DE  VR+   KY +          D+SK + ++ L+   R  RY FF +I+     + +++AH  +D  E+  M L +       G+   +   + + +RPLL+ T+  +E Y R + + F  D +N    + RN VR
  S:    22 VVAVSGGADSVALLDVLAGFSSLRLRLIVVHLNHCLRGAESDADEAFVRELAGKYGVTFVTQAVDVQDLSKREKLS-LEEAGRAARYRFFSEIAASCKARAVVLAHHADDQAETVLMRLLRGAGGS--GLCAMAAKSAGMYVRPLLSVTRFEIEAYLRERGLVFRTDSSNADVNFLRNRVR 199
>gi|157803229|ref|YP_001491778.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia canadensis str. McKiel] >gi|157784492|gb|ABV72993.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia canadensis str. McKiel] (432 aa)
Score = 182, Expect = 8.2e-12, Identities = 68/210 (32%), Positives = 112/210 (53%)
  Q:     7 IAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLF--VFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKF 216
           +AVSGG DS+ALL       KK ++   V  V+++ RE S  +   +++     N K +   FD H+++ S      NLQ   RE RY+    +  EL I  +L AH ++D++E+  + L +N     L     +   ++ +IRPL N  K  L +Y  + NI++  D +N  D+Y RN+VR+ +A+      ++ Y+K     L+ +    LLD KF
  S:    26 VAVSGGSDSVALLYLTNVWAKKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYNLSFD-HQNNFS------NLQERAREGRYNLMTNLCLELDILALLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWHNNIQIIRPLYNIPKSELVEYLVNHNIKWFEDESNLSDKYKRNLVRQKLAK------EEDYIKADII-LQQLKINNLLDDKF 229
>gi|83816193|ref|YP_445830.1| tRNA(Ile)-lysidine synthetase [Salinibacter ruber DSM 13855] >gi|83757587|gb|ABC45700.1| tRNA(Ile)-lysidine synthetase [Salinibacter ruber DSM 13855] (468 aa)
Score = 182, Expect = 8.3e-12, Identities = 57/175 (32%), Positives = 89/175 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHL---VEAVCHVNYHDREDSDNDEKIVRDYCKKYN----LKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK-KNLFLGIRRKSKFR---SLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DSM  L+  R L   V A+ HVNY  R  +D DE +VR +C + +    L +   D      S+ +   +LQ   R +RYD     + E+G   +   H ++D  E+  ++L +        G+R         S+ L+RPLL+  + ++E Y  S  + +  D TN    Y R V+R
  S:    25 LVAASGGVDSMTCLSVLRRLDVDVHAL-HVNYGLRAGADGDEALVRRWCHEQSPAVPLSVVALDAEARAASEDE---SLQAAARRLRYDALAAAAAEIGAPVVATGHHRDDQAETLLLNLVRGSGPEGVAGMRPARPLEADPSVSLVRPLLDARRDAIEAYAESMGLPWRTDPTNQRHDYDRGVIR 206
>gi|157825192|ref|YP_001492912.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia akari str. Hartford] >gi|166988063|sp|A8GLX9|TILS_RICAH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157799150|gb|ABV74404.1| tRNA(Ile)-lysidine synthetase TilS [Rickettsia akari str. Hartford] (430 aa)
Score = 181, Expect = 9.2e-12, Identities = 58/182 (31%), Positives = 98/182 (53%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD-THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K  +AVSGG DS+ALL       +K ++  +V  V+++ RE S  +   V++     N K +     H+++ S      NLQ   R  RYD    +  E  I  +L AH ++D++E+  + L +N     L     + + ++ +IRPL N  K  L +Y  S NI++  D +N  D+Y RN++R+ +A+
  S:    21 KIAVAVSGGSDSVALLYLANIWAEKNNIELSVISVDHNLREQSKQETYYVQNISNSLNRKHYSLSFDHQNNFS------NLQERARAGRYDLMTNLCLEFDILVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWYNNIQIIRPLYNIPKSELVEYLVSHNIKWFEDESNSSDKYRRNIIRQKLAK 203
>gi|150008036|ref|YP_001302779.1| putative cell-cycle protein [Parabacteroides distasonis ATCC 8503] >gi|149936460|gb|ABR43157.1| putative cell-cycle protein [Parabacteroides distasonis ATCC 8503] (438 aa)
Score = 181, Expect = 9.5e-12, Identities = 51/175 (29%), Positives = 94/175 (53%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA--VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS--KFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+ +SGG DS+ALL     L       H N+H R E+SD DE    ++ +   +     D      +  + ++ ++   RE+RY +FE++ + LG +   +AH ++D +E+  M+L +       GIR  S  + R+  ++RPLL  +++ +  +   +   +++D TN  D Y+RN +R
  S:    22 LVGLSGGADSVALLGVLVRLGYPCIALHCNFHLRGEESDRDEAFACEFAESLEVPFHKIDFDTISYAGERHLS-IEMAARELRYAWFEEMRERLGGQATAVAHHRDDNVETVLMNLIRGT-----GIRGMSGIRPRNGFIVRPLLCVSREDILAWLADQGYAYMVDSTNLSDAYTRNFIR 195
>gi|85859371|ref|YP_461573.1| tRNA(Ile)-lysidine synthetase [Syntrophus aciditrophicus SB] >gi|85722462|gb|ABC77405.1| tRNA(Ile)-lysidine synthetase [Syntrophus aciditrophicus SB] (476 aa)
Score = 181, Expect = 1.0e-11, Identities = 52/178 (29%), Positives = 98/178 (55%)
  Q:     6 LIAVSGGPDSMALLNK------KRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN----NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           + AVSGGPDS+ALL+       +  L  +V H+N+  R  +SD +E++VR   K+  +   V    + D+   +  +    +L+   R+ RY+FF  ++ E+G  +I + H + D  E+  M+  +       G++     R    IRPLL  +++ +  + +++++ F+ D +N  D + RN +R  M
  S:    22 IAAVSGGPDSVALLHVLISLACEYELTLSVAHLNHGLRGSESDAEEQLVRQLSKERGISCSV---KRIDLQALRKCDRRKCSLEDIGRQERYEFFTALAAEIGASRIALGHHREDQAETVLMNFIRGSG--LEGLKGIRPVRDGCFIRPLLEVSRRDILDFLQAEHLPFLEDSSNSEDHFLRNRIRHHM 205
>gi|15834848|ref|NP_296607.1| MesJ/Ycf62 family protein [Chlamydia muridarum Nigg] >gi|61216745|sp|Q9PL79|TILS_CHLMU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|7190268|gb|AAF39100.1| MesJ/Ycf62 family protein [Chlamydia muridarum Nigg] (321 aa)
Score = 181, Expect = 1.1e-11, Identities = 54/192 (28%), Positives = 103/192 (53%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK--NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           K KYL+A+SGG DS+ L  L + R +     HV+Y  RE S  +   +   C++  +  F+ D  + +V+   D ++++   R+ RY+ F ++ +E     + + H  +D  E+    + +     NL  G+ R   ++ + L+RPLL+ TK+ + +   +  IE+V D TN  +R+ R  +R+ +  + ++ F K
  S:    22 KKKYLLALSGGSDSLLLMYLLRSRGISFTAVHVDYGWRETSYQEACDLASLCEREQIP-FILD--RQEVANPMDFSDIENIARQYRYELFYRLCKERLFAGVFLGHHADDQAETILKRVFEGAHLGNL-KGMARYGTYKGITLLRPLLHITKRQIVEALDNYRIEYVQDATNADERFLRARMREQLFPYLQEIFGK 213
>gi|57239569|ref|YP_180705.1| hypothetical protein Erum8420 [Ehrlichia ruminantium str. Welgevonden] >gi|58579557|ref|YP_197769.1| hypothetical protein ERWE_CDS_08930 [Ehrlichia ruminantium str. Welgevonden] >gi|57161648|emb|CAH58577.1| conserved hypothetical protein [Ehrlichia ruminantium str. Welgevonden] >gi|58418183|emb|CAI27387.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Welgevonden] (442 aa)
Score = 180, Expect = 1.5e-11, Identities = 55/183 (30%), Positives = 94/183 (51%)
  Q:     5 YLIAVSGGPDSMALLNK----KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWD 187
           Y IAVSGG DSM LL+            +  VN+  R ++  +   V  + +  NLK  + + H +     K  +N+Q+  R+IRY    +   +  I  +++AHQKND  E+  M L +    +   G++  +    + ++RPLL  +++ L  Y  +KNI +V D +N   +Y R + R ++ E D
  S:    26 YAIAVSGGIDSMVLLHLSAICNTKFTPTILTVNHGLRSEAAQEALFVYQHSQNLNLKCHILNWHGE-----KPQSNIQSSARQIRYSLLLQWCNQNQINYLMVAHQKNDQAETIMMRLERGSGLDGLAGMQECTYLNGICILRPLLAISREELIHYADTKNITWVHDISNDNKKYKRTLYRNILKEVD 208
>gi|15618905|ref|NP_225191.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae CWL029] >gi|15836528|ref|NP_301052.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae J138] >gi|16752030|ref|NP_445396.1| MesJ/Ycf62 family protein [Chlamydophila pneumoniae AR39] >gi|33242366|ref|NP_877307.1| putative p-loop ATPase [Chlamydophila pneumoniae TW-183] >gi|61216756|sp|Q9Z6R2|TILS_CHLPN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|4377326|gb|AAD19134.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae CWL029] >gi|7189770|gb|AAF38647.1| MesJ/Ycf62 family protein [Chlamydophila pneumoniae AR39] >gi|8979370|dbj|BAA99204.1| PP-loop superfamily ATPase [Chlamydophila pneumoniae J138] >gi|33236877|gb|AAP98964.1| putative p-loop ATPase [Chlamydophila pneumoniae TW-183] (319 aa)
Score = 179, Expect = 1.6e-11, Identities = 59/193 (30%), Positives = 102/193 (52%)
  Q:     1 MKHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKND--------FLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           +K +YL+A+SGG DS+ L  L K+R +     H+++  R  S  + K + + C +  +  FV  T   +    KD+ N     R+ RY F  +  ++L    I +AH  ND         LESA+++  K        +  +S    ++L+RPLL+  K SL++   ++ I ++ D +N  +RY R  +RK +  W ++ F K
  S:    23 VKKRYLLALSGGSDSLFLFYLLKERGVSFTAVHIDHGWRSTSAQEAKELEELCAREGVP-FVLYTLTAEEQGDKDLENQA---RKKRYAFLYESYRQLDAGGIFLAHHANDQAETVLKRLLESAHLTNLK-------AMAERSYVEDVLLLRPLLHIPKSSLKEALDARGISYLQDPSNEDERYLRARMRKKLFPWLEEVFGK 214
>gi|58617611|ref|YP_196810.1| hypothetical protein ERGA_CDS_08840 [Ehrlichia ruminantium str. Gardel] >gi|58417223|emb|CAI28336.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel] (442 aa)
Score = 178, Expect = 2.1e-11, Identities = 54/183 (29%), Positives = 94/183 (51%)
  Q:     5 YLIAVSGGPDSMALLNK----KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWD 187
           Y IAVSGG DSM LL+            +  VN+  R ++  +   V  + +  NLK  + + H +     K  +N+Q+  R+IRY    +   +  +  +++AHQKND  E+  M L +    +   G++  +    + ++RPLL  +++ L  Y  +KNI +V D +N   +Y R + R ++ E D
  S:    26 YAIAVSGGIDSMVLLHLSAICNTKFTPTILTVNHGLRSEAAQEALFVYQHSQNLNLKCHILNWHGE-----KPQSNIQSSARQIRYSLLLQWCNQNQVNYLMVAHQKNDQAETIMMRLERGSGLDGLAGMQECTYLNGICILRPLLAISREELIHYADTKNITWVHDISNDNKKYKRTLYRNILKEVD 208
>gi|73667491|ref|YP_303507.1| cell cycle protein MesJ [Ehrlichia canis str. Jake] >gi|72394632|gb|AAZ68909.1| cell cycle protein MesJ [Ehrlichia canis str. Jake] (433 aa)
Score = 178, Expect = 2.3e-11, Identities = 54/187 (28%), Positives = 96/187 (51%)
  Q:     1 MKHKYLIAVSGGPDSMALLN----KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWD 187
           +   Y +AVSGG DSM LL+     + H    +  VN+  R+++  +   V  + +  NLK  + + H     K  + +N+Q+  R+IRY    +   E  I  +++AHQKND  E+  + L +    +   G++  +    + ++RPLL+ ++  L QY    NI ++ D +N   +Y R + R M+   D
  S:    15 LNSAYAVAVSGGIDSMVLLHLSAQHRNHNTPIILTVNHGLRQEAKQEALFVFQHSQNLNLKCHILNWH----GKLPE-SNIQSSARQIRYGLLLQWCNENRINYLMVAHQKNDQAETIMIRLERGSGLDGLAGMQECTYLNGICILRPLLSVSRTELLQYASQNNIPWINDPSNNNKKYKRTLYRNMLETTD 201
>gi|118475434|ref|YP_892513.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter fetus subsp. fetus 82-40] >gi|118414660|gb|ABK83080.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter fetus subsp. fetus 82-40] (336 aa)
Score = 178, Expect = 2.4e-11, Identities = 62/194 (31%), Positives = 110/194 (56%)
  Q:     4 KYLIAVSGGPDSMAL---LNKKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIR----RKSKF----RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLK 197
           K L+A S G DS AL   LN+K   +E  C  +NY  R  SD +E   ++ C K+N  +++    K      ++ +N +   R+IR+ FF++I  +     +++AHQ ND LE  +M L+K    + L G+     + ++F    + + +IRPL+N ++  +  Y + KNI +  D +NF  ++ RN +R   ++   + F+K  +K
  S:    13 KCLLAFSYGTDSTALFHILNEKN--IEFDCAFINYKTRVQSDEEEVSAKELCLKFNKNIYI----KIAPLNLENGSNFEKKARDIRHKFFDEICIKFNYDTLILAHQLNDCLEWLFMQLSKGSGTVQLCGLEPTNTKIAEFENIKKQISVIRPLINVSRNEIISYLKQKNINYFTDISNFDFKFKRNFIRANFSDAFIEKFEKGVIK 213
>gi|81429211|ref|YP_396212.1| ATPase [Lactobacillus sakei subsp. sakei 23K] >gi|78610854|emb|CAI55906.1| Putative ATPase of the PP-loop superfamily, cell cycle protein [Lactobacillus sakei subsp. sakei 23K] (459 aa)
Score = 178, Expect = 2.4e-11, Identities = 59/186 (31%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFV----FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++A S G DSM LL   + L  A      V HVN+  R +S  +E  +R +C + +L L V       H            ++   RE RY FFE +        ++ AH  +D LE+  M   ++ + +   GI+ +  F    LIRPLL   K+ L  Y  + NI    D TN+     RN VR  +  + K+
  S:    21 KVIVATSTGVDSMVLLTLLQRLPTALKPQLIVAHVNHELRTESVAEEAYLRQFCLENDLSLQVAHWPLQQHPQ--------TGIEAAAREFRYQFFEHLMTAEKADYLVTAHHGDDQLETLMMKFIRSGELHEMRGIQSQRPFADGTLIRPLLPFAKQDLRDYALANNITSFEDQTNYETTVLRNRVRHTLVPFLKQ 209
>gi|42526849|ref|NP_971947.1| hypothetical protein TDE1341 [Treponema denticola ATCC 35405] >gi|61217302|sp|Q73N15|TILS_TREDE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|41817164|gb|AAS11858.1| conserved hypothetical protein [Treponema denticola ATCC 35405] (460 aa)
Score = 178, Expect = 2.4e-11, Identities = 65/177 (36%), Positives = 94/177 (53%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDN--DEKIVRDYCKKYNL-------KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSL-NKNKKNLFLGIR-RKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L+AVSGG DSMA+L+    L         V  VN++ R + +   D + V D+C            K  VFD  K+  +  +D        R +RY+ FEK +  L    IL AH KND  E+  M L   ++    +GI  R+ +F     IRP+LN ++  +E+Y + KNI +  D TN    Y RN VR
  S:    31 RLLLAVSGGADSMAMLSAFLELKSDINAEIFVLTVNHNIRPEKETLGDAQFVLDFCNDKCPCILAEIPKNTVFDEAKNRKTGIEDAA------RFLRYNEFEKAADSLNADYILTAHNKNDNYETVLMRLFQGSEPEALMGISPRRGRF-----IRPMLNISRSEIEEYLKEKNIPWREDATNLEASYLRNKVR 213
>gi|153815236|ref|ZP_01967904.1| hypothetical protein RUMTOR_01470 [Ruminococcus torques ATCC 27756] >gi|145847495|gb|EDK24413.1| hypothetical protein RUMTOR_01470 [Ruminococcus torques ATCC 27756] (488 aa)
Score = 178, Expect = 2.6e-11, Identities = 59/175 (33%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI--------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  VSGG DS+ LL       +K      VCHVN+  R   +D DE+ V+  C +  ++  VF    + +++ K   + +   RE+R + FE++  E G  KI  AH ++D  E+           + L I R +  R L          IRPLL+ T+  +E Y R + I + +D TN  D Y+RN +R
  S:    30 IAGVSGGADSVCLLLTLCSLREKFGFEVKVCHVNHCLRGAAADADEEYVKKLCGELGVECRVFRKEVELIAE-KRKQSCEEAGREVRREAFEQMCAENGGTKIATAHHRDDQAET-----------VLLNIARGTGIRGLCGIVPVRDNRIRPLLSLTRDRIESYLRERGIVWRVDATNEEDDYTRNRIR 207
>gi|56417150|ref|YP_154224.1| cell cycle protein [Anaplasma marginale str. St. Maries] >gi|56388382|gb|AAV86969.1| cell cycle protein [Anaplasma marginale str. St. Maries] (501 aa)
Score = 177, Expect = 2.6e-11, Identities = 54/181 (29%), Positives = 89/181 (49%)
  Q:     5 YLIAVSGGPDSMALLN--KKRHLVEA-----VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           Y +AVSGG DS+ LLN     H  +A     V   N+  R ++D++ + V+       L   +   ++   S     +  Q   REIRY    +   E  +K +L AH K+D  E+  M L +    +   G+  +S F  + + RPLL  T++ + +Y   K + +V D +N   +Y R   R ++AE
  S:    72 YAVAVSGGVDSITLLNLVAALHKTQATSRPVVLTGNHGFRAEADHETRFVQKRAVALGLDCEILRWNRHRTS-----SKSQETAREIRYSLLHQWCTEHSVKFLLTAHNKSDQAETVLMHLERGSGIDGLSGMHERSVFGDITIYRPLLGFTRQEILEYATQKQLSWVEDPSNQDPKYRRTFFRNLIAE 255
>gi|61216416|sp|Q5P9R1|TILS_ANAMM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (466 aa)
Score = 177, Expect = 2.6e-11, Identities = 54/181 (29%), Positives = 89/181 (49%)
  Q:     5 YLIAVSGGPDSMALLN--KKRHLVEA-----VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           Y +AVSGG DS+ LLN     H  +A     V   N+  R ++D++ + V+       L   +   ++   S     +  Q   REIRY    +   E  +K +L AH K+D  E+  M L +    +   G+  +S F  + + RPLL  T++ + +Y   K + +V D +N   +Y R   R ++AE
  S:    37 YAVAVSGGVDSITLLNLVAALHKTQATSRPVVLTGNHGFRAEADHETRFVQKRAVALGLDCEILRWNRHRTS-----SKSQETAREIRYSLLHQWCTEHSVKFLLTAHNKSDQAETVLMHLERGSGIDGLSGMHERSVFGDITIYRPLLGFTRQEILEYATQKQLSWVEDPSNQDPKYRRTFFRNLIAE 220
>gi|114565668|ref|YP_752822.1| tRNA(Ile)-lysidine synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336603|gb|ABI67451.1| tRNA(Ile)-lysidine synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (454 aa)
Score = 177, Expect = 2.9e-11, Identities = 55/188 (29%), Positives = 99/188 (52%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS--KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           K L+ VSGGPDSMALL+    L        AV H+N+  R ++  +E+ VR++C+ + +  +   + + D+     ++   L+   R+ RY +F +  +EL    I  AH ++D  E+  + L +    K L   + RK +     L+RPLL  +K  +  Y     I + +D +N   ++ RN +R  +  + +K +
  S:    20 KVLLGVSGGPDSMALLHIMHKLTTEMDLGLAVLHLNHGLRPEAAAEEEFVREHCRNWGIDFY---SRQADIRALALQEKKTLEEAGRDCRYRYFFEQLEELQADYIATAHHQDDQAETVLLHLLRGSGLKGLRGIMPRKGQ-----LLRPLLALSKAEIIHYLDENQIPYCLDQSNNDLKFLRNRIRCELIPYLQKAY 209
>gi|157827822|ref|YP_001496886.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii OSU 85-389] >gi|166988064|sp|A8GY99|TILS_RICB8 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|157803126|gb|ABV79849.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii OSU 85-389] (430 aa)
Score = 177, Expect = 3.0e-11, Identities = 57/182 (31%), Positives = 97/182 (53%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLF-VFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K  IAVSGG DS+ALL       KK ++   V  V+++ R+ S  + + +++      LK + +F  H+++ S      NLQ   R+ RYD    + Q+L I  +L AH ++D++E+  + L +      L     +   +  +IRPL N  K  L  Y  + NI++  D +N   +Y RN +R+ +A+
  S:    21 KIAIAVSGGSDSVALLYLANIWAKKNNIELFVLSVDHNLRDQSKQEIEYIQNTANDLGLKFYSLFFDHQNNFS------NLQERARKGRYDLMTSLCQKLDILVLLTAHHEDDYIENFCLRLERKSGVFGLSSSSVNWHNNTQIIRPLFNIPKSELVNYLATNNIKWFEDQSNLSTKYRRNTIRQKLAK 203
>gi|91206209|ref|YP_538564.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii RML369-C] >gi|122425129|sp|Q1RGN9|TILS_RICBR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|91069753|gb|ABE05475.1| tRNA(Ile)-lysidine synthetase [Rickettsia bellii RML369-C] (430 aa)
Score = 176, Expect = 3.5e-11, Identities = 57/182 (31%), Positives = 97/182 (53%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLF-VFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K  IAVSGG DS+ALL       KK ++   V  V+++ R+ S  + + +++      LK + +F  H+++ S      NLQ   R+ RYD    + Q+L I  +L AH ++D++E+  + L +      L     +   +  +IRPL N  K  L  Y  + NI++  D +N   +Y RN +R+ +A+
  S:    21 KIAIAVSGGSDSVALLYLANIWAKKNNIELFVLSVDHNLRDQSKQEIEYIQNTANDLGLKFYSLFFDHQNNFS------NLQERARKGRYDLMTSLCQKLDILVLLTAHHEDDYIENFCLRLERKSGVFGLSSSSVNWHNNTQIIRPLFNIPKSELVNYLATNNIKWFEDQSNLSTKYRRNTIRQKLAK 203
>gi|149197877|ref|ZP_01874926.1| hypothetical protein LNTAR_05301 [Lentisphaera araneosa HTCC2155] >gi|149139098|gb|EDM27502.1| hypothetical protein LNTAR_05301 [Lentisphaera araneosa HTCC2155] (417 aa)
Score = 176, Expect = 3.9e-11, Identities = 73/259 (28%), Positives = 124/259 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL--VEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF-WDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIK--PNENKIEQIIE 262
           K L+  SGG DSMALL+  + L  ++ V H N++ R +DS  DE+  R+YC+   L+L V +    D+ K +  N   +   R +R  F E          I +AH  +D  ES +M ++     +    +RR+ K  +L LIRPLL+ +++ L  Y +  N+ +  D +N   D   RN VR  +     +  +     +K     + +    L S     + Q F    FL +    K  ++  FL + G+   P +  I ++++
  S:    11 KRLVLFSGGADSMALLHLMQSLGELDIVLHFNHNLRGDDSKQDEQFCRNYCEDNGLELIVVNL---DLDKERHANEGDEQLARRLRLQFLE---DHYCGWNIYLAHHLDDVKESFFMRAMRGANSSGLCALRRERKLGTLTLIRPLLDYSREQLRSYLKENNLTWREDSSNQDADYCDRNYVRNELMPKLSRLGKGLQHTLKHIAEDDDY----LQSAAEKELMQGFTSKLFLNLHAALKARVLRFFLENQGLAYVPTQASINRLLK 267
>gi|120436499|ref|YP_862185.1| PP-loop family protein [Gramella forsetii KT0803] >gi|117578649|emb|CAL67118.1| PP-loop family protein [Gramella forsetii KT0803] (437 aa)
Score = 175, Expect = 4.4e-11, Identities = 60/177 (33%), Positives = 97/177 (54%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+AVSGG DS+ L  L     L   + H N++ R D SD+DEK V D      ++++   T   +  K+ + N  ++Q   RE+RY++F ++S  +     L AH  ND LE+  ++L +      L   +K K     ++RPLL  T+  +E + R KN+++  D +N  D+Y RN +R
  S:    20 KLLLAVSGGVDSVVLAHLCLSAKLDFTIAHCNFNLRGDESDDDEKFVVDLADFLEVEVY---TESFNTLKFAENNKISVQMAARELRYEWFAELSNSVQFDYTLTAHHANDNLETFLINLIRGTGPEGLTGIKKEKNE---IVRPLLPFTRSEIEDFARKKNLKWREDSSNASDKYMRNKIR 195
>gi|154175317|ref|YP_001408589.1| PP-loop family protein [Campylobacter curvus 525.92] >gi|112803929|gb|EAU01273.1| PP-loop family [Campylobacter curvus 525.92] (330 aa)
Score = 175, Expect = 5.3e-11, Identities = 55/182 (30%), Positives = 94/182 (51%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           K L+A S G DS AL        +   +  V+Y++R  S ++    R    K++ K F   T   ++S+    +N +   R+ RY+FF +I  + G K +++AHQ +D  E   M L K    N  LG+    + +   ++RPLL   K  LE + + + +++ ID TNF  ++ RN +R+  +E
  S:    17 KNLLAFSHGVDSTALFYILNDAGVGFDIAIVDYNERAQSKDEVASARALAAKFDKKCF---TKSVNLSR----SNFECTARKARYEFFAEICAKNGYKNLILAHQLDDRFEWFLMQLAKGAGLNELLGMSDFERRKDYDILRPLLKFKKSQLEAFLKERGLKYFIDETNFSHKFRRNFMRQNFSE 194
>gi|15602154|ref|NP_245226.1| hypothetical protein PM0289 [Pasteurella multocida subsp. multocida str. Pm70] >gi|61216731|sp|Q9CNY2|TILS_PASMU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|12720522|gb|AAK02373.1| MesJ [Pasteurella multocida subsp. multocida str. Pm70] (431 aa)
Score = 175, Expect = 5.4e-11, Identities = 76/278 (27%), Positives = 138/278 (49%)
  Q:     2 KHKYLIAVSGGPDSMALL-------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFV----FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-----KMMAEWD------KKTFQKFYLKVKWFN-LKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIK-PNENKIEQIIEFINKNKNGSVKKYRLKE 279
           +H++LI  SGG DS ALL        K+ HL+    H+++    ++D      +  C++  + L V     D HK           ++   RE RY   + I Q L   ++   AH + D  E+ +++L +      LG ++RKS    L + RPLL  T++ L  Y +     +V D +N   RY RN +R     ++   W       +++ Q  + + +  N L +  F +  D     +  +DF     LK     + +L+ L+L   G+  P++ ++ Q+I+ +   K+ S  +++L E
  S:    17 QHQFLIGFSGGLDSTALLLLFAKLREKQPHLMLRAIHIHHGLSANADAWVTHCQQICQQVAIPLIVEQVKIDQHK----------GIEAGAREARY---QAIRQHLLPNEMFATAHHQQDQTETFFLALKRGSGLAGLGAMQRKSTLYCLPICRPLLTFTRQMLLDYVKQAGCPWVEDESNTDSRYERNFLRHEVLPRLRQRWPHFDNAVQRSAQHCFEQQQLLNELLHAEFAQHFDKTERTFQLRDFATRSQLK-----QNALLRLWLAQCGLSMPSKVQLTQLIQDVILAKSDSQPQFQLGE 302
>gi|150020112|ref|YP_001305466.1| tRNA(Ile)-lysidine synthetase [Thermosipho melanesiensis BI429] >gi|149792633|gb|ABR30081.1| tRNA(Ile)-lysidine synthetase [Thermosipho melanesiensis BI429] (423 aa)
Score = 174, Expect = 7.3e-11, Identities = 71/257 (27%), Positives = 138/257 (53%)
  Q:     4 KYLIAVSGGPDSMALL---NKKRHL--VEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFI-KLLDSKFNNWIKQDFDINYFLKIKNNY--KESLIYLFLNHIGIKPNENKIEQI 260
           K LI VSGG DSM LL   N  + +  ++ VC  V++  R++S  +  +V+++ +  ++     +      SK K ++ ++   R++RY+FF +I +++G  KI +AH  ND +E+    L++       GI      +  I IRPLL  T++ +E +  +  I + +D +NF  +Y+RN +R  +    K+    F   V  F ++N++ +   +++  N    + FD  YF   ++ Y   E +    +  +GI P++ K++++
  S:    22 KILIGVSGGVDSMTLLYLLNGVKDILNIDIVCVTVDHGLRKESKEEINLVKEFSRSLDVPCISGEIDVLGYSKEKKLS-IEEAARKLRYEFFYRIKEKVGASKIAVAHNLNDLVENVLFRLSRGAGP--FGIYGMKPVKGNI-IRPLLFFTREDIEDFAGNNKIPYAVDKSNFDTKYTRNFIRHNIIPKFKELNPSFERAVFRF-VENLWELDDFMENTINVKHVKIFDGVYFKVPEDEYVLVEFVRRQTIEQLGIAPDKEKLDRL 282
>gi|153854745|ref|ZP_01995979.1| hypothetical protein DORLON_01977 [Dorea longicatena DSM 13814] >gi|149752652|gb|EDM62583.1| hypothetical protein DORLON_01977 [Dorea longicatena DSM 13814] (473 aa)
Score = 173, Expect = 8.0e-11, Identities = 56/179 (31%), Positives = 92/179 (51%)
  Q:     2 KHKYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K   +  VSGG DS+ LL       K+      V H+++  R E +D DE  VR  C+K +++L  F    +DV +Y       L+   R +R   FE++       +I +AH +ND  E+   +L++       G++       +    IRPLL   ++ +E+Y +  NI++  D TN  D Y+RN +R
  S:    29 KDHVIAGVSGGADSVCLLFMLVKLQKEMRFGLTVVHIHHGLRGESADVDENYVRALCEKLDVELLAF---HEDVGRYAKEQKLTLEEAGRNVRRHIFEEVCHRKNGTRIALAHHQNDNAETLLWNLSRG-----CGLKGIGGISPVDGKYIRPLLGVRRQEIEEYLKENNIDYCTDETNLEDHYTRNRLR 210
>gi|148322418|gb|EDK87668.1| PP loop family cell cycle protein MesJ [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (448 aa)
Score = 173, Expect = 9.4e-11, Identities = 87/284 (30%), Positives = 148/284 (52%)
  Q:     6 LIAVSGGPDSMAL---LNKKRHLVE---AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLK----IKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSV---KKYRL-KENQFIEIKNKK 289
           ++  SGGPDS+ L   L K +H       + H+N+  R ED+D+DE    +Y KK NL++F+      +++K      L+   RE RY FF +I +++   KI  AH K+D +E+    L +      L      K ++  +IRP+    KK + +Y     I++ ID TNF + ++RN +R  +  + ++ +     K K F+L         ++  N     D +    L+    + N  K++L+ LFLN   I+ N NKI++I   I  N    +   K YR+ K+  ++ I++KK
  S:    24 VVGFSGGPDSVFLVEMLKKLQHFFNFKIYLVHINHLLRGEDADSDENFSFEYAKKNNLEIFIKRIPVKEIAKEIG-KTLEEVGREERYKFFSEIYEKVRATKIATAHNKDDQIETFLFRLIRGTS---LQGLEGIKIKNNNVIRPISEIYKKDILEYLNKNEIQYKIDKTNFENEFTRNSIRLDLIPFIEERYN-IKFKDKIFSLIKEIRENNQNNSLNLSDYTDSENRIILEKTKFLSNFDKKNLLSLFLNKKNIEVNRNKIDEISSLIKSNGTKKIDLDKSYRIVKDYTYLYIEDKK 317
>gi|172056094|ref|YP_001812554.1| tRNA(Ile)-lysidine synthetase [Exiguobacterium sibiricum 255-15] >gi|171988615|gb|ACB59537.1| tRNA(Ile)-lysidine synthetase [Exiguobacterium sibiricum 255-15] (414 aa)
Score = 172, Expect = 1.0e-10, Identities = 53/179 (29%), Positives = 95/179 (53%)
  Q:     2 KHKYLIAVSGGPDSMAL---LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYC--KKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K   L+AVSGG DSM L   L +  H +  + HV++  R++SD + + VR +   ++  +++   +      S        Q   R  RY FF+++  E G + +++AH ++D LE+  + L + +  +  GI R   F +  + RPLL  +K+ L  Y +++ + +  D TN   +Y RN +R
  S:     9 KEPLLVAVSGGCDSMVLAHLLYEANHDL-MIVHVHHGLRKESDEEAEAVRAWAEARRVGIRMTRLEWEGQAPS--------QAACRTRRYAFFQEVMAETGRRHLVLAHHRDDQLETLLIQLIRGEAGVD-GIPRIRSFATGQIHRPLLPYSKQQLYDYAKARQVVWHEDETNAGTKYLRNQMR 182
>gi|121535066|ref|ZP_01666883.1| tRNA(Ile)-lysidine synthetase [Thermosinus carboxydivorans Nor1] >gi|121306316|gb|EAX47241.1| tRNA(Ile)-lysidine synthetase [Thermosinus carboxydivorans Nor1] (468 aa)
Score = 172, Expect = 1.1e-10, Identities = 52/177 (29%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + ++A SGGPDS+AL++    L  A      V HV++  R  +S  + + VR +C++  L   V       V   +   + Q   R +RY F  +++  LG  KI   H ++D  E+  ++  +       G  R  +  +  +IRPLL+ T++ +E YC ++ +   +D +N    Y RN VR
  S:    21 RVVVACSGGPDSLALVHLLHRLQPAYGFDMVVAHVDHMLRGAESAREAEFVRAFCRRLGLDCQVAAIDVPGVLAERG-GSTQEVARTLRYAFLRRVADSLGGAKIATGHHRDDQAETVLINFLRGAGP---GGLRGMQPAAGGIIRPLLSVTRQEIEDYCAAEGLTPCLDSSNLHTDYLRNRVR 200
>gi|78223098|ref|YP_384845.1| tRNA(Ile)-lysidine synthetase-like [Geobacter metallireducens GS-15] >gi|78194353|gb|ABB32120.1| tRNA(Ile)-lysidine synthetase-like [Geobacter metallireducens GS-15] (468 aa)
Score = 172, Expect = 1.2e-10, Identities = 53/175 (30%), Positives = 89/175 (50%)
  Q:     6 LIAVSGGPDSMALLN-----KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS--KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVSGG DS+ALL+         L   V H+N+  R  +SD DE+ V D      L    F   K DV     ++  +L+   R  RY+FF++++ + G + + +AH  +D  E+  + L +       G+   +  R    +RPLL  ++  +E Y   + + F ID +N    + RN +R
  S:    25 VVAVSGGADSVALLDILISLSDLRLNLVVAHLNHSLRGAESDGDERFVADLAASRGLP---FAGEKADVRALSIRERLSLEDAGRRARYEFFDRVATQYGARSVALAHHADDQAETLLLRLLRGAG--VTGLSAMAPRRDGRFVRPLLTLSRSEIEGYLHGRGLRFRIDSSNADTAFLRNRIR 202
>gi|19705273|ref|NP_602768.1| cell cycle protein MesJ [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|61216676|sp|Q8RHN5|TILS_FUSNN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|19713236|gb|AAL94067.1| Cell cycle protein MesJ [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (448 aa)
Score = 171, Expect = 1.4e-10, Identities = 86/289 (29%), Positives = 149/289 (51%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLK----IKNNYKESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSV---KKYRL-KENQFIEIKNKKILYSI 294
           ++  SGGPDS+ L+   + L         + H+N+  R ED+D+DE    +Y KK NL++F+      +++K      L+   RE RY FF +I +++G  KI  AH K+D +E+    L +      L      K ++  +IRP+    KK + +Y     I++ ID TNF + ++RN +R  +  + ++ +     K K F+L         ++  N     D +    L+    + +  K++L+ LFLN   I+ N NKI++I   I  N    +   K YR+ K+   + I+ KK  ++I
  S:    24 VVGFSGGPDSVFLVEMLKKLQYFFNFKIYLVHINHLLRGEDADSDENFSFEYAKKNNLEIFIKRIPVKEIAKEVG-KTLEEVGREERYKFFSEIYEKVGANKIATAHNKDDQIETFLFRLIRGTS---LQGLEGIKIKNNNIIRPISEIYKKDILEYLNKNEIQYKIDKTNFENEFTRNSIRLNLIPFIEERYN-IKFKDKIFSLIEEIRENNQNNSLNLSNYTDSENRIILEKIKFLSDFDKKNLLSLFLNQKNIEVNRNKIDEINSLIKSNGTKKIDLDKSYRIVKDYTHLYIEEKKENFTI 322
>gi|123430775|ref|XP_001307953.1| PP-loop family protein [Trichomonas vaginalis G3] >gi|121889608|gb|EAX95023.1| PP-loop family protein [Trichomonas vaginalis G3] (444 aa)
Score = 171, Expect = 1.4e-10, Identities = 56/177 (31%), Positives = 96/177 (54%)
  Q:     4 KYLIAVSGGPDSMAL------LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K  + VSGG DSM L      L +  +L   VCH+N+  RE +  DE+ V+  C+ Y +K      + D+ ++ K  ++ +   R +RY+FF + SQ    +KIL AH  ND +E+   ++ +       G++  S    +   + RPL+N  ++ +E Y     +++  D TNF + Y+RN +R
  S:    20 KLSLGVSGGADSMYLFYNFMDLKEDWNLDIIVCHLNHGIRETAKRDEEFVKKSCQAYGIKFISKTVNMDEFAREKKFSSEEAG-RILRYEFFRENSQG---RKILTAHNANDRVETVLFNIMRGT-----GLKGLSGITHVNGDIYRPLINIKREEIEDYLHKNKLQYFDDETNFEEIYTRNKIR 195
>gi|149183227|ref|ZP_01861672.1| hypothetical protein BSG1_17246 [Bacillus sp. SG-1] >gi|148849060|gb|EDL63265.1| hypothetical protein BSG1_17246 [Bacillus sp. SG-1] (467 aa)
Score = 170, Expect = 1.7e-10, Identities = 60/197 (30%), Positives = 98/197 (49%)
  Q:     6 LIAVSGGPDSMALL---NKKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLF-LGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFN 202
           L AVSGGPDS++LL   NK R+L    V AVC  +    E S  +   V+  C++ ++  F     + +V    D     LQ   R  RY  F ++ ++ G  K+   H  +D +E+  M L +       +GI  +  F    +IRPLL  +K+ + +YC    ++   D +N    Y+RN  R+ +  + K      +LK + F+
  S:    25 LAAVSGGPDSLSLLHFLNKYRNLWNVKVAAVCVDHMFRGEQSYEELLFVKKTCEEMDIPFF---GERLNVQGMLDDQKAGLQEGARNARYHLFARLIKDEGFTKLAFGHHGDDQVETILMQLTRGSSGRAKIGIPVQRDFYGARIIRPLLCLSKEEILKYCSETGLQPKFDPSNEKKDYTRNRFRQEVLPFLKGENPLVHLKFQQFS 228
>gi|68171364|ref|ZP_00544759.1| PP-loop [Ehrlichia chaffeensis str. Sapulpa] >gi|67999214|gb|EAM85869.1| PP-loop [Ehrlichia chaffeensis str. Sapulpa] (442 aa)
Score = 170, Expect = 1.7e-10, Identities = 56/183 (30%), Positives = 94/183 (51%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEAVCH--------VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +   + IAVSGG DSM LL    HL    C+        VN+  R ++  +   V  + +  NLK  + + H     K  + +N+Q+  R IRY    +   E  IK +++AHQKND  E+  + L +    +   G++  +    + ++RPLL+ ++  L QY    NI ++ D +N   +Y R + R M+
  S:    23 LNDNFAIAVSGGIDSMTLL----HLSARYCNKNTPIVLTVNHGLRPEAAQEALFVFQHSQNLNLKCHILNWH----GKLPE-SNIQSSARRIRYKLLLQWCNENRIKYLMVAHQKNDQAETIMIRLERGSGLDGLAGMQEYTYLNGICILRPLLSASRTELLQYANKNNITWINDTSNNNKKYKRTLYRNML 205
>gi|88657904|ref|YP_507881.1| tRNA(Ile)-lysidine synthetase [Ehrlichia chaffeensis str. Arkansas] >gi|88599361|gb|ABD44830.1| tRNA(Ile)-lysidine synthetase [Ehrlichia chaffeensis str. Arkansas] (434 aa)
Score = 170, Expect = 1.9e-10, Identities = 56/183 (30%), Positives = 94/183 (51%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEAVCH--------VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +   + IAVSGG DSM LL    HL    C+        VN+  R ++  +   V  + +  NLK  + + H     K  + +N+Q+  R IRY    +   E  IK +++AHQKND  E+  + L +    +   G++  +    + ++RPLL+ ++  L QY    NI ++ D +N   +Y R + R M+
  S:    15 LNDNFAIAVSGGIDSMTLL----HLSARYCNKNTPIVLTVNHGLRPEAAQEALFVFQHSQNLNLKCHILNWH----GKLPE-SNIQSSARRIRYKLLLQWCNENRIKYLMVAHQKNDQAETIMIRLERGSGLDGLAGMQEYTYLNGICILRPLLSASRTELLQYANKNNITWINDTSNNNKKYKRTLYRNML 197
>gi|124006425|ref|ZP_01691259.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Microscilla marina ATCC 23134] >gi|123988082|gb|EAY27753.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Microscilla marina ATCC 23134] (450 aa)
Score = 170, Expect = 2.0e-10, Identities = 56/175 (32%), Positives = 96/175 (54%)
  Q:     6 LIAVSGGPDSMALLNK----KRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGG DS+ L +     K H   A+ H N+  R   S+ DE+ V+   + Y +  FV  FDT+    ++   I   Q   R +RY +FE++  + G   +  AH +ND +E+  ++L +      L GI+ K       +IRP+L  +++ +E Y + K +++  D +N  ++Y RN +R
  S:    22 LLAVSGGIDSVVLTDLFAQIKSHGQVAIAHCNFQLRGVASEEDEEFVKQLAQHYGIPCFVTRFDTYTLAQAQKGSI---QMIARNLRYAWFEQLRTKEGYHYLATAHHQNDMVETVLLNLVRGTGIAGLHGIKVKQGH----IIRPMLFASREEIEAYAQEKGLKWCEDASNQDNKYYRNRLR 197
>gi|146299894|ref|YP_001194485.1| tRNA(Ile)-lysidine synthetase [Flavobacterium johnsoniae UW101] >gi|146154312|gb|ABQ05166.1| tRNA(Ile)-lysidine synthetase [Flavobacterium johnsoniae UW101] (436 aa)
Score = 169, Expect = 2.6e-10, Identities = 58/179 (32%), Positives = 101/179 (56%)
  Q:     2 KHKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + K  +AVSGG DSM LL+  K+ +    V H N+  R  +S  D++ +++YC K N+K  +F T  D  +  +D   ++Q   RE+RY +F ++ +E     +L AH  +D LE+  ++L +    +   GI  ++      +IRPLL  +++ + +Y +  NIE+  D +N   +Y RN +R
  S:    18 QKKLFLAVSGGLDSMVLLHLFKQLNYEITVLHCNFQLRGLESFGDQEFIQNYCDKNNIK--IFTTQFDTQAFAEDYKLSIQVAARELRYSWFYELLEEKHFDYLLTAHHADDNLETFIINLTRGTGLDGLTGIPEQND----KIIRPLLPFSREEILKYAQENNIEWREDSSNASTKYVRNKIR 195
>gi|56418595|ref|YP_145913.1| hypothetical protein GK0060 [Geobacillus kaustophilus HTA426] >gi|61216398|sp|Q5L3T3|TILS_GEOKA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56378437|dbj|BAD74345.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (464 aa)
Score = 168, Expect = 3.2e-10, Identities = 52/175 (29%), Positives = 90/175 (51%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ VSGGPDS+ALL+       +  L     HV++  R  +S+ + + V+ +C +   +  + +T + DV  ++    L  Q   R  RY FF ++ ++     + + H  +D +E+  M L +   +  + GI  K  F    LIRP L  ++  +E YCR   +    D +N  D Y+RN  R
  S:    22 IVGVSGGPDSLALLHVFLSLRDEWKLQVIAAHVDHMFRGRESEEEMEFVKRFCVE---RRILCETAQIDVPAFQRSAGLGAQEAARICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGGYLIRPFLAVSRAEIEAYCRQMGLSPRCDPSNEKDDYTRNRFR 203
>gi|125716899|ref|YP_001034032.1| PP family ATPase [Streptococcus sanguinis SK36] >gi|166988067|sp|A3CJX7|TILS_STRSV tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|125496816|gb|ABN43482.1| Cell cycle control ATPase, PP-loop superfamily, putative [Streptococcus sanguinis SK36] (425 aa)
Score = 168, Expect = 3.4e-10, Identities = 61/179 (34%), Positives = 92/179 (51%)
  Q:     4 KYLIAVSGGPDSMALL-----NKKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
           K LIAVSGG DSM LL     ++K   +E A+ HVN+  R +SD +EK +    ++  +K+F         S +   N  +   R+ RYDFF K+ QE     ++ AH  +D  E+ +M L +  +   L G++    F    LIRPLL   K          +I+   D +NF + Y RN +R +
  S:    21 KVLIAVSGGLDSMTLLQLLIVSQKELAIELAIAHVNHKQRPESDQEEKALVKIAEQLGVKIFT--------SSFSG-NFSENAARQFRYDFFGKVMQEGHYTALVTAHHADDQAETVFMRLLRGARLRHLSGMKAVQPFACGELIRPLLTFHKSDF------PDIQHFEDSSNFQNDYLRNRIRNL 191
>gi|160878299|ref|YP_001557267.1| tRNA(Ile)-lysidine synthetase [Clostridium phytofermentans ISDg] >gi|160426965|gb|ABX40528.1| tRNA(Ile)-lysidine synthetase [Clostridium phytofermentans ISDg] (492 aa)
Score = 167, Expect = 3.9e-10, Identities = 55/175 (31%), Positives = 94/175 (53%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ VSGG DS+ LL       ++ HL     HVN+  R  ++D DE  V+  C   ++ L      ++DV +  +++   ++   R +RY  FE+  + +   KI +AH +ND  E+    L +       G+    K R  I IRPLL  T++ +E +  +++I + ID TN  + Y+RN +R
  S:    22 IVGVSGGADSICLLTCLHRLREQYHLNLYAVHVNHMLRGMEADEDEAFVQSMCNSLSIPLHCV---REDVKRIAELSGTTIEEAGRNLRYLSFEQECERVKAHKIAVAHNRNDNAETVLFHLFRGTG--LTGMTGIPKKRGQI-IRPLLCVTREEIETFLFNEHIFYRIDSTNLSNDYTRNKIR 199
>gi|94496969|ref|ZP_01303543.1| ATPase [Sphingomonas sp. SKA58] >gi|94423645|gb|EAT08672.1| ATPase [Sphingomonas sp. SKA58] (314 aa)
Score = 167, Expect = 4.0e-10, Identities = 55/183 (30%), Positives = 87/183 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE---AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI--LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM--AEW 186
           ++ IAVSGGPDSMALL           A   V++  R +S ++  +V  +C  + ++      H    +      N+Q W R  RY   E       I  I+ AH  +D LE+  M LN+       GI   +  R++   +IRPLL + K  L+ +   + + +V D +N   R+ R  +R  +  A W
  S:    29 RFGIAVSGGPDSMALLCLAASAFPGRVAAVTVDHGLRRESADEAALVARWCVAHGIE------HVTLPADATVTGNVQAWARTTRYRLMEAWRASHAIDWIMTAHHADDQLETLVMRLNRGS-----GIGGLAGVRAVSGRVIRPLLGERKAMLQAFVDREGLPYVQDPSNRDRRFDRATLRMALSGATW 207
>gi|116493275|ref|YP_805010.1| tRNA(Ile)-lysidine synthetase, MesJ [Pediococcus pentosaceus ATCC 25745] >gi|116103425|gb|ABJ68568.1| tRNA(Ile)-lysidine synthetase, MesJ [Pediococcus pentosaceus ATCC 25745] (456 aa)
Score = 167, Expect = 4.5e-10, Identities = 67/269 (24%), Positives = 127/269 (47%)
  Q:     2 KHKYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK-KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDS----KFNNWIK-QDFDINYFLKIKNNYKESLIYLFLNHIG--IKPNENKIEQIIEFINKNKNG 270
           + K ++AVS G DS  L+N      K +H    V HVN+  RE S  +E+ +  +C+++ +     D  K    ++     ++   RE RY FF+++  +   + +L AH  ++  E+  M + +    N   GI  +  F    LIRP L  TK+ L +  +   + +  D TN    + RN VR  +    +K   +    ++ +  + +    L+D     K     + + FD+    K    +++ +I   +  +   I  NENK+++++  +N  K  
  S:    18 QFKIVVAVSTGVDSTVLINALINSTKIKHQQLIVAHVNHQLREQSIEEERFLHKWCRQHQITFMETDWPKSQHPQH----GVEAAAREFRYTFFKQVMHDQHAQVLLTAHNADEQAENFVMQVIRGGWLNQLNGIPERRTFAQGWLIRPFLKFTKQFLIETAQENKLRWFEDQTNRTTEFLRNRVRNEIIPAFRKENPRVVEHIQHYQDQLLEQSNLVDQVVLEKLTKLQRDESFDLLALRKESLPWQKKIILKIITEVNAEIAINENKLDELVRLVNNTKQA 296
>gi|154149315|ref|YP_001406091.1| tRNA(Ile)-lysidine synthase [Campylobacter hominis ATCC BAA-381] >gi|153805324|gb|ABS52331.1| tRNA(Ile)-lysidine synthase [Campylobacter hominis ATCC BAA-381] (331 aa)
Score = 167, Expect = 4.8e-10, Identities = 61/191 (31%), Positives = 94/191 (49%)
  Q:     4 KYLIAVSGGPDSMALLNK--KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           + ++A S G DS AL +     +L   V  VNY  RE+SD +    R+ C+K NLK     +      K+    N +   R+IR+ FFEK+  + G   ++ AHQ ND  E   M L+K    +  L      K  +  ++RPLLN  K  +  + R  N++F  D +N   ++ RN +R   AE+  K   K+
  S:    20 RAILAFSHGSDSTALFHTLLDLNLKFDVAFVNYKTRENSDLEMVCARELCEKNNLKFHCLISPL----KFNLNGNFENEARKIRWSFFEKLCVQNGYNVVITAHQLNDKFEWFLMQLSKGSGLVNLLSPEMVEKRENFTVLRPLLNTGKDEILNFLRINNLKFFNDISNQNLKFKRNFIR---AEFSDKFVSKY 206
>gi|34763208|ref|ZP_00144172.1| Cell cycle protein MesJ [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887118|gb|EAA24225.1| Cell cycle protein MesJ [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (446 aa)
Score = 166, Expect = 6.1e-10, Identities = 85/284 (29%), Positives = 146/284 (51%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMF---FIKLLDSKFNNWIKQDFDINYFLKIKNNY-KESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSV---KKYRL-KENQFIEIKNKK 289
           ++  SGGPDS+ L+   + L   +       H+N+  R ED+D+DEK   +Y KK NL++F+      ++SK      L+   RE RY FF +I +++   KI  AH K+D +E+    L +      L      K ++  +IRP+    KK + +Y     I++ ID TNF + ++RN +R  +  + ++ +     K K F+L             +  +  + ++  I   +K  +N+ K++L+ LFLN   I  N NKI++I      N    +   K YR+ K+   + I+ KK
  S:    24 VVGFSGGPDSVFLVEMLKKLKNFINFKIYLVHINHLLRGEDADSDEKFSIEYAKKNNLEIFIKRIPVKEISKEVG-KTLEEVGREERYKFFSEIYKKVEANKIATAHNKDDQIETFLFKLIRGTS---LQGLEGIKVKNNNIIRPISEIYKKDILEYLNKNKIQYKIDKTNFENEFTRNSIRLDLIPFIEERYN-IKFKDKIFSLIEEIRENNQNNSLNLSDYTVSENKIILEKIKFLSNFNKKNLLCLFLNQKNITVNRNKIDEINSLTKSNGTKKIDLNKTYRIVKDYTHLYIEEKK 317
>gi|154499603|ref|ZP_02037641.1| hypothetical protein BACCAP_03259 [Bacteroides capillosus ATCC 29799] >gi|150271681|gb|EDM98925.1| hypothetical protein BACCAP_03259 [Bacteroides capillosus ATCC 29799] (458 aa)
Score = 165, Expect = 6.6e-10, Identities = 57/178 (32%), Positives = 93/178 (52%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDR-EDSDNDEKIVRDYCKKY-------------NLKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI--------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           L AVSGG DS+ LL++   L + +       H N+  R E+SD DE  VRD+  K+              L        + DV+   +     L+   R++RY F    +Q LG  +I  AH  +D           N + L L + R +  + +         L+RP+L  T++ +E+Y    +I  V D +N   R++RN +R+ +
  S:    22 LCAVSGGADSVYLLHRLWLLRDILGFNLIAAHYNHCLRGEESDRDEAFVRDFVAKWCGPQRFDGPEGEHTLPAVELVVGRGDVAAEAERQGRGLEETARDMRYAFLRDTAQRLGCDRIATAHTADD-----------NAETLLLHLIRGTGLQGMAGIAPRRGDLVRPMLTTTRREVEEYLELYSIPHVEDSSNSDQRFTRNRIRRQV 218
>gi|91201108|emb|CAJ74167.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (482 aa)
Score = 165, Expect = 6.6e-10, Identities = 62/225 (27%), Positives = 110/225 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA---------VCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG---IRRK-SKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA-----EWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFL 230
           ++ VSGGPDS+ALL K  H + A         V H+N+  R D S+ DE+ V+D   K +L       +   ++    ++ L+   R+ RY F+ + SQ   +  +   H  +D  E+    + +      LG   I+R  S     ++IRPLL   KK + +Y      ++ +D +N+   Y+RN +R  +      +++           +   + N + +   +S F N I ++ D  Y L
  S:    27 IVGVSGGPDSVALL-KTLHFLNAAKNLRLRLYVAHLNHQLRGDFSEEDEQFVQDLANKLSLPFISKRVNIGKIASETKLS-LEEMARKERYTFYSEASQNYNVSHVATGHNADDNAETILHRIIRGTGAPGLGGIPIKRLLSPGTPQLIIRPLLFAWKKEILEYLNKDKTKYRVDASNYEKEYTRNRIRHELIPLLEHKYNPNIKNALSRLSQILTINNEYLLAACESVFENAIVKEPDNAYVL 268
>gi|116617526|ref|YP_817897.1| tRNA(Ile)-lysidine synthetase, MesJ [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096373|gb|ABJ61524.1| tRNA(Ile)-lysidine synthetase, MesJ [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (430 aa)
Score = 165, Expect = 6.7e-10, Identities = 55/175 (31%), Positives = 96/175 (54%)
  Q:     6 LIAVSGGPDSM----ALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYS-RNVVR 180
           ++AVSGG DS+    AL   K +LV  + HVNY  RE+SD+D   VR    +      +F+   + V ++   + ++   R+ RYDFFE+++Q+     I +AH  +D  E+  + + +  +   +G  +    +   +IRP L+ TK+ L  Y +  ++ +  D TNF   Y+ RN++R
  S:    19 IVAVSGGVDSVVLVHALSKTKANLV--IAHVNYRLREESDDDADFVRQLATQTGA---IFE---EQVWQHIPDHAVEKAARQFRYDFFEELAQKYHTNTIAVAHHADDQAETVLLKMIRGGRLQQMGGMQTKNHK---VIRPFLSITKQELITYAQDNHLGWRQDKTNFDVDYTPRNLLR 187
>gi|160902337|ref|YP_001567918.1| tRNA(Ile)-lysidine synthetase [Petrotoga mobilis SJ95] >gi|189035968|sp|A9BJK2|TILS_PETMO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|160359981|gb|ABX31595.1| tRNA(Ile)-lysidine synthetase [Petrotoga mobilis SJ95] (311 aa)
Score = 165, Expect = 7.1e-10, Identities = 83/271 (30%), Positives = 134/271 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILI-----RPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMF--FIKLLDSKFNNWIKQDFDINYFLKIKNNY--KESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKK 274
           K L+ VSGG DSM+LL+    L +      +V H+N+  RE++DNDE  VR  C K  +  F   + K DV  Y   N   ++   R++RY+FF +  + L   KI  AH  +D  E+    + +      LG         LI I     +P+L    + ++ Y    NIE+V D  N+   Y+RN +R  +    KK   ++  K  +F L  +   + + +  KF    +   D +  L+++N++   E +   FL      PN  + E+II    K + G V+K
  S:    25 KILLGVSGGKDSMSLLHVMSKLSKTMGFEISVAHLNHCMREEADNDEAFVRQACWKLKIPFF---SKKVDVFTYSKKNKVGVEVAGRKLRYEFFYETLRRLSYNKIATAHHMDDLFETMIYRILRGTGIYGLG--------GLIPIEEEITKPMLCVDLEEIKNYVTINNIEYVEDKYNYSLDYARNKIRYEITPLFKKINPRY--KESFFRLAKIIWSYREEVKRKFEERSEISKD-SLKLRLENDFFDGEIIRIAFLKFGKYPPNMEETEKII----KMRKGGVRK 294
>gi|83857097|ref|ZP_00950625.1| putative cell-cycle protein [Croceibacter atlanticus HTCC2559] >gi|83848464|gb|EAP86333.1| putative cell-cycle protein [Croceibacter atlanticus HTCC2559] (436 aa)
Score = 165, Expect = 7.1e-10, Identities = 58/178 (32%), Positives = 98/178 (55%)
  Q:     3 HKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +K L+AVSGG DSM LL+  K   L  A+ H N++ R ++SD D  +V++   +  +   V   H +  S   DI  ++Q   RE+RY +F+++ +E     +L AH  ND +E+  ++L +       G+    K  + I IRPLL  +++ +  Y  ++ I +  D +N  D+Y RN +R
  S:    19 NKLLLAVSGGLDSMVLLHLCKASGLNIAIAHCNFNLRGKESDADTLLVKEEADRLQITCHV--EHFNTESYAADIKVSIQIAARELRYQWFDEVIKEFDYNYVLTAHHLNDDVETFIINLTRGTG--LDGLSGIPKVNNTI-IRPLLPFSREEIHTYALAEKIIWREDASNASDKYLRNSIR 195
>gi|70727501|ref|YP_254417.1| hypothetical protein SH2502 [Staphylococcus haemolyticus JCSC1435] >gi|68448227|dbj|BAE05811.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (431 aa)
Score = 165, Expect = 8.1e-10, Identities = 53/178 (29%), Positives = 92/178 (51%)
  Q:     6 LIAVSGGPDSMALLNK-----KRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +IAVS G DSM+L +       R   +  C HVN+  RE S  +E  +  +CK+Y +  +V   +  DV       ++Q   R++RY++F+++ + L    +L AH  +D LE+ +  L   +     LGI  +S      + RPLL  +K+ +  Y     + +  D +N  ++Y RN +R  +
  S:    16 VIAVSTGVDSMSLFHNLLSQSSRTYKQLTCLHVNHGLREASHKEEAFIEAFCKQYEITCYVKHLNLTDVVAQG--KSIQADARQLRYEWFDEMMKRLDADVLLTAHHLDDQLETIFYRLFTGRSTRSTLGIDVQSIRNHYTICRPLLEVSKEDIRDYQHKYQVPYYEDSSNSDNKYVRNDIRNRL 198
>gi|125622900|ref|YP_001031383.1| cell cycle protein mesJ [Lactococcus lactis subsp. cremoris MG1363] >gi|124491708|emb|CAL96627.1| cell cycle protein mesJ [Lactococcus lactis subsp. cremoris MG1363] (422 aa)
Score = 164, Expect = 8.7e-10, Identities = 81/284 (28%), Positives = 128/284 (45%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKE----SLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKN 287
           K L+A+SGG DSM L N       K H+   + H+N+  R +SD +E+ +R       + +FV D    + ++ K         RE RY FFEKI        +L AH + D +E+  M  +         GI     F    LIRPLL  TK+ L+         F  D TN    Y RN +R  +     K   +F   +   + +    + +++ K +     D  I+Y  K  +  KE     L   F  +  IK ++ K E+I+  I + +  S +    K+ QF++ K+
  S:    23 KILLALSGGKDSMTLFNWLYELRAKLHIELGIAHINHGLRPESDFEEQALRKMASDLEIPIFV-DRFTGEFTEQKA--------REFRYHFFEKIMIAENYDVLLTAHHQGDVVETVLMRQITGRPLRSLQGIADCQPFAKGQLIRPLLKFTKEELDAAV------FYEDSTNQGVDYFRNRIRNQLIPELTKENPQFSQAISDLSSEIKMALTVINQKISELEIVDEKISYH-KFISQTKELQHFILQAFFAQYPEIKVSKKKFEEILHIIRRPQQYSAQLN--KDFQFVKTKD 299
>gi|15605575|ref|NP_220361.1| PP-loop superfamily ATPase [Chlamydia trachomatis D/UW-3/CX] >gi|61216368|sp|O84847|TILS_CHLTR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3329312|gb|AAC68437.1| PP-loop superfamily ATPase [Chlamydia trachomatis D/UW-3/CX] (321 aa)
Score = 164, Expect = 9.7e-10, Identities = 53/192 (27%), Positives = 93/192 (48%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK--NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           K KYL+A+SGG DS+ L  L K R +     HV+Y  RE S  +   +   C++  +   +      D    +DI N     R  RY+ F ++ +E     + + H  +D  E+    + +     NL  G+  +  +R + L+RPLL+  K  + +   S  +++V D TN  +R+ R  +R+ +  + +  F K
  S:    22 KKKYLLALSGGSDSLFLMYLLKSRAIFFTAVHVDYGWRETSYQEASDLAALCEQEQIPFILDRPEATDPMDSRDIENAA---RRYRYELFYRLCKEKCFSGVFLGHHADDQAETILKRVFEGAHLGNL-KGMSAQVMYRDVALLRPLLHIPKHKIVEALDSHQVQYVQDITNCNERFLRARMRERLFPYLQDVFGK 213
>gi|76789585|ref|YP_328671.1| TilS [Chlamydia trachomatis A/HAR-13] >gi|76168115|gb|AAX51123.1| TilS [Chlamydia trachomatis A/HAR-13] (321 aa)
Score = 164, Expect = 1.0e-09, Identities = 53/192 (27%), Positives = 93/192 (48%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK--NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           K KYL+A+SGG DS+ L  L K R +     HV+Y  RE S  +   +   C++  +   +      D    +DI N     R  RY+ F ++ +E     + + H  +D  E+    + +     NL  G+  +  +R + L+RPLL+  K  + +   S  +++V D TN  +R+ R  +R+ +  + +  F K
  S:    22 KKKYLLALSGGSDSLFLMYLLKSRAIFFTAVHVDYGWRETSYQEASDLAALCEQEQIPFILDRPEATDPMDSRDIENAA---RRYRYELFYRLCKEKCFSGVFLGHHADDQAETILKRVFEGAHLGNL-KGMSAQVMYRDVALLRPLLHIPKHKIVEALDSHQVQYVQDITNCNERFLRARMRERLFPYLQDVFGK 213
>gi|157165572|ref|YP_001467030.1| ATP/GTP hydrolase [Campylobacter concisus 13826] >gi|112800063|gb|EAT97407.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter concisus 13826] (330 aa)
Score = 164, Expect = 1.1e-09, Identities = 58/180 (32%), Positives = 92/180 (51%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN----NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           L+A S G DS AL    K+  +   +  V+++ RE S  + +  ++   K+  K++V           K +N    N +   RE RY+FF +I Q+ G + +++AHQ +D  E   M L K    K LF G+    K     L+RPLLN  KK L+ Y   + + + +D TN   +  R+ VR   +E
  S:    16 LLAFSHGIDSTALFYILKETGVKFDLVIVDHNVREQSKFEVESAKELASKFGKKIYV-----------KSVNLAGSNFEKNAREARYEFFSEICQKFGYENLILAHQFDDKFEWFLMQLGKGAGLKELF-GMSELEKREHFWLVRPLLNLRKKELQNYLDERGLRYFVDETNLEGKLKRSFVRLNFSE 191
>gi|57238476|ref|YP_179607.1| PP-loop family protein [Campylobacter jejuni RM1221] >gi|61216392|sp|Q5HSX8|TILS_CAMJR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|57167280|gb|AAW36059.1| PP-loop family protein [Campylobacter jejuni RM1221] (321 aa)
Score = 163, Expect = 1.1e-09, Identities = 57/180 (31%), Positives = 94/180 (52%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K K L+A S G DS AL  L  +  +   +  +NY  R++SD +E   ++   K++ K+F+    K         +N +   R+ RYDFFEKI  E     +++AH  ND  E   M L++       LG++   K ++  L+RPLL  +K  +  + + K+I +  D +N  ++Y RN +RK
  S:    13 KGKNLLAFSYGSDSSALFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPKFQ-------SNFEKKARDFRYDFFEKICLEQDYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRQNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK 188
>gi|86151954|ref|ZP_01070167.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841062|gb|EAQ58311.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 260.94] (321 aa)
Score = 163, Expect = 1.1e-09, Identities = 56/180 (31%), Positives = 93/180 (51%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           + K L+A S G DS  L  L  +  +   +  +NY  R++SD +E   ++   K++ K+F+    K         +N +   R+ RYDFFEKI  E G   +++AH  ND  E   M L++       LG++   K  +  L+RPLL  +K  +  + + K+I +  D +N  ++Y RN +RK
  S:    13 RGKNLLAFSYGSDSSVLFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPKFQ-------SNFEKKARDFRYDFFEKICLEQGYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK 188
>gi|121613548|ref|YP_001001102.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|148925625|ref|ZP_01809313.1| hypothetical protein Cj8486_1491c [Campylobacter jejuni subsp. jejuni CG8486] >gi|157415678|ref|YP_001482934.1| hypothetical protein C8J_1359 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005997|ref|ZP_02271755.1| hypothetical protein Cjejjejuni_07600 [Campylobacter jejuni subsp. jejuni 81-176] >gi|87249823|gb|EAQ72782.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|145845635|gb|EDK22726.1| hypothetical protein Cj8486_1491c [Campylobacter jejuni subsp. jejuni CG8486] >gi|157386642|gb|ABV52957.1| hypothetical protein C8J_1359 [Campylobacter jejuni subsp. jejuni 81116] (321 aa)
Score = 163, Expect = 1.2e-09, Identities = 56/180 (31%), Positives = 93/180 (51%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           + K L+A S G DS  L  L  +  +   +  +NY  R++SD +E   ++   K++ K+F+    K         +N +   R+ RYDFFEKI  E G   +++AH  ND  E   M L++       LG++   K  +  L+RPLL  +K  +  + + K+I +  D +N  ++Y RN +RK
  S:    13 RGKNLLAFSYGSDSSVLFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPKFQ-------SNFEKKARDFRYDFFEKICLEQGYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK 188
>gi|27469192|ref|NP_765829.1| hypothetical protein SE2274 [Staphylococcus epidermidis ATCC 12228] >gi|57866063|ref|YP_187744.1| MesJ/Ycf62 family protein [Staphylococcus epidermidis RP62A] >gi|61217168|sp|Q5HRP5|TILS_STAEQ tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217351|sp|Q8CQV3|TILS_STAES tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|27316741|gb|AAO05916.1|AE016751_211 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57636721|gb|AAW53509.1| MesJ/Ycf62 family protein [Staphylococcus epidermidis RP62A] (432 aa)
Score = 163, Expect = 1.3e-09, Identities = 56/180 (31%), Positives = 96/180 (53%)
  Q:     2 KHKYLIAVSGGPDSMALL----NKKRHLVEAV--CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSL--NKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K   ++AVS G DSM+LL    N  +H    +   HVN+  RE S  +E  +R+YC ++++ +++      D+    D N++Q   R+ RY++F  I  +L    +L AH  +D  E+    L   ++ +N  LG+  +S F    + RP+LN  K  +  Y  +  I +  D +N   +Y RN +R+
  S:    11 KAHIVVAVSTGIDSMSLLYSLLNDYQHTYRKLTCVHVNHGLREQSYEEEAFLREYCHQHHIDIYIKRLDLSDI--VADGNSIQQEARQRRYEWFGDIIAQLRADVLLTAHHLDDQFETIIYRLFTGRSTRN-SLGMTYESYFNQYKVYRPMLNLKKTEILAYQYANQIPYYEDMSNQDRKYVRNDIRQ 195
>gi|15792770|ref|NP_282593.1| hypothetical protein Cj1453c [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149480|ref|ZP_01067711.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88596817|ref|ZP_01100054.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|61216748|sp|Q9PMK7|TILS_CAMJE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|85840262|gb|EAQ57520.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88191658|gb|EAQ95630.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360762|emb|CAL35561.1| putative tRNA(Ile)-lysidine synthase [Campylobacter jejuni subsp. jejuni NCTC 11168] (321 aa)
Score = 163, Expect = 1.3e-09, Identities = 56/180 (31%), Positives = 93/180 (51%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           + K L+A S G DS  L  L  +  +   +  +NY  R++SD +E   ++   K++ K+F+    K         +N +   R+ RYDFFEKI  E G   +++AH  ND  E   M L++       LG++   K  +  L+RPLL  +K  +  + + K+I +  D +N  ++Y RN +RK
  S:    13 RGKNLLAFSYGSDSSVLFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFIKHAPKFQ-------SNFEKKARDFRYDFFEKICLEQGYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK 188
>gi|88805526|ref|ZP_01121045.1| putative cell-cycle protein [Robiginitalea biformata HTCC2501] >gi|88784344|gb|EAR15514.1| putative cell-cycle protein [Robiginitalea biformata HTCC2501] (439 aa)
Score = 163, Expect = 1.4e-09, Identities = 59/180 (32%), Positives = 98/180 (54%)
  Q:     1 MKHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKIS-QELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           M   +L+A SGG DSM L  L K   L   + H N++ R E S++D++ VR+   K  +K  +  FDT       Y + N  ++Q   R +RY++F++++  E  ++ I+ AH  +D LE+  ++L +        GI      R+  + RPLL  +++ LE Y  +  I +  D +N   RY RN +R
  S:    17 MGSSFLLACSGGLDSMVLAHLCKDAGLEFELAHCNFNLRGEASESDQEFVRETADKLRIKTHIKSFDT-----IGYANQNKVSIQMAARALRYEWFDQLTASENHLRYIVTAHHADDALETFLINLGRGSGLEGLCGI----PARTANIRRPLLAFSREDLEAYAETARIAWREDASNSETRYLRNRLR 196
>gi|145634599|ref|ZP_01790308.1| pyridoxine kinase [Haemophilus influenzae PittAA] >gi|145268144|gb|EDK08139.1| pyridoxine kinase [Haemophilus influenzae PittAA] (430 aa)
Score = 162, Expect = 1.5e-09, Identities = 57/195 (29%), Positives = 109/195 (55%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    V A+ H+++    ++D+  K  +D C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++ +   + ++RPLL+ T+  LE Y + +N+ +V D +N  +R+ RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAI-HIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKYLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQKEGQLFGMSILRPLLSFTRNELEDYIQQENLSWVEDESNGDNRFDRNFLRNEILPELRERWAYFDLAVQ 216
>gi|15603921|ref|NP_220436.1| cell cycle protein MESJ (mesJ) [Rickettsia prowazekii str. Madrid E] >gi|6226316|sp|Q9ZEA3|TILS_RICPR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3860612|emb|CAA14513.1| CELL CYCLE PROTEIN MESJ (mesJ) [Rickettsia prowazekii] (430 aa)
Score = 162, Expect = 1.7e-09, Identities = 56/180 (31%), Positives = 94/180 (52%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLF--VFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           K  IAVSGG DS++LL       +K ++   V  V+++ R  S  +   +       N K +   FD H+++ S      NLQ   RE RYD    +  EL +  +L AH ++D++E+  + L +N     L       + ++ +IRPL N  K  L +Y  +  I++  D +N  D+Y RN++R+ +
  S:    21 KIAIAVSGGSDSISLLYLANIWARKNNIELFVISVDHNLRPQSKQENYYIHTISSNLNRKYYNLSFD-HQNNFS------NLQERAREGRYDLMTNLCLELDVLVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNIHWYNNIQIIRPLYNIPKSELVEYLVNHKIKWFEDESNLSDKYRRNIIRQKL 201
>gi|15606915|ref|NP_214296.1| cell cycle protein MesJ [Aquifex aeolicus VF5] >gi|6016543|sp|O67728|TILS_AQUAE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|66360363|pdb|1WY5|A Chain A, Crystal Structure Of Isoluecyl-Trna Lysidine Synthetase >gi|66360364|pdb|1WY5|B Chain B, Crystal Structure Of Isoluecyl-Trna Lysidine Synthetase >gi|160285466|pdb|2E21|A Chain A, Crystal Structure Of Tils In A Complex With Amppnp From Aquifex Aeolicus. >gi|160285467|pdb|2E21|B Chain B, Crystal Structure Of Tils In A Complex With Amppnp From Aquifex Aeolicus. >gi|160285468|pdb|2E21|C Chain C, Crystal Structure Of Tils In A Complex With Amppnp From Aquifex Aeolicus. >gi|160285469|pdb|2E21|D Chain D, Crystal Structure Of Tils In A Complex With Amppnp From Aquifex Aeolicus. >gi|160285496|pdb|2E89|A Chain A, Crystal Structure Of Aquifex Aeolicus Tils In A Complex With Atp, Magnesium Ion, And L-Lysine >gi|160285498|pdb|2E89|C Chain C, Crystal Structure Of Aquifex Aeolicus Tils In A Complex With Atp, Magnesium Ion, And L-Lysine >gi|160285499|pdb|2E89|D Chain D, Crystal Structure Of Aquifex Aeolicus Tils In A Complex With Atp, Magnesium Ion, And L-Lysine >gi|2984151|gb|AAC07685.1| cell cycle protein MesJ [Aquifex aeolicus VF5] (317 aa)
Score = 162, Expect = 1.8e-09, Identities = 55/179 (30%), Positives = 95/179 (53%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVE-------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + LIA SGG DS+ L +    L         A+ H N+  RE ++ DE+  +++ K+ N+K+FV    K+DV  +   N  +L+   R +RY F ++I +  G   I  AH  ND LE++ +   +    +  +G   K +    ++ RPL    +  +E+Y + K + +V D TN+     RN +R
  S:    24 ERRVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALAHFNHMLRESAERDEEFCKEFAKERNMKIFV---GKEDVRAFAKENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLLETSLLFFTRGTGLDGLIGFLPKEE----VIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIR 205
>gi|51473299|ref|YP_067056.1| cell cycle ATPase MesJ [Rickettsia typhi str. Wilmington] >gi|61216485|sp|Q68XR8|TILS_RICTY tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51459611|gb|AAU03574.1| probable cell cycle ATPase MesJ [Rickettsia typhi str. Wilmington] (430 aa)
Score = 161, Expect = 1.9e-09, Identities = 54/180 (30%), Positives = 94/180 (52%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           K  IAVSGG DS+ALL       +K ++   +  V+++ R  S  +   ++      NLK   ++   D  + +   +NLQ   RE RYD    +  EL +  +L AH ++D++E+  + L +N     L       + ++ +IRPL N  K  L +Y  +  I++  D +N  D+Y RN++R+ +
  S:    21 KIAIAVSGGSDSVALLYLANIWAEKNNIELFIISVDHNLRAQSKQENYYIQSISN--NLKRKYYNLSFDHQNNF---SNLQARAREGRYDLMTNLCLELDVLVLLTAHHEDDYVENFCLRLERNSGIFGLSSSNIHWYNNIQIIRPLYNIPKSELVKYLVTNKIKWFEDESNLSDKYRRNIIRQKL 201
>gi|148825315|ref|YP_001290068.1| pyridoxine kinase [Haemophilus influenzae PittEE] >gi|148715475|gb|ABQ97685.1| pyridoxine kinase [Haemophilus influenzae PittEE] (430 aa)
Score = 161, Expect = 1.9e-09, Identities = 57/195 (29%), Positives = 107/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    V A+ H+++    ++D+  K  +D C ++ + L +     D        N ++   RE RY   + I + L  ++IL+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +R+ RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAI-HIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEILVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNGDNRFDRNFLRNEILPKLRERWAYFDLAVQ 216
>gi|89891402|ref|ZP_01202908.1| tRNA(Ile)-lysidine synthase [Flavobacteria bacterium BBFL7] >gi|89516433|gb|EAS19094.1| tRNA(Ile)-lysidine synthase [Flavobacteria bacterium BBFL7] (443 aa)
Score = 161, Expect = 1.9e-09, Identities = 53/182 (29%), Positives = 98/182 (53%)
  Q:     2 KHKYLIAVSGGPDSMAL----LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +++ LIA+SGG DS+ L     N    +  A C+ N  D E SD DE+ VR+   ++ +   V    + + S+Y   + + T    RE+RYDFF  + ++     IL AH  +D +E+ +++LN+       G++   +    + IRPLL  +++ + +Y  +  + +  D +N  ++Y RN +R  +
  S:    18 ENRLLIAISGGLDSVVLTHLLFNAGYDITLAHCNFNLRDSE-SDQDEQFVRELADRFKIDCHV---TQFETSQYASDHGVSTQMAARELRYDFFNDLCKDHNYDFILTAHHLDDQIETFFINLNRGAG--LKGLQGIPQLNGNV-IRPLLPFSREQIMEYAMNSQVLWREDSSNRSNKYQRNQLRNQI 198
>gi|16272353|ref|NP_438566.1| cell cycle protein [Haemophilus influenzae Rd KW20] >gi|1175240|sp|P44689|TILS_HAEIN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|1573375|gb|AAC22063.1| cell cycle protein (mesJ) [Haemophilus influenzae Rd KW20] (430 aa)
Score = 161, Expect = 1.9e-09, Identities = 56/195 (28%), Positives = 107/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    + A+ H+++    ++D+  K  +D C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLCQKQPHLPPLSIRAI-HIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKYLQTQEMLVTAHHLNDQTETFFLALKRGSGLKGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAHFDLAVQ 216
>gi|86152849|ref|ZP_01071054.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843734|gb|EAQ60944.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Campylobacter jejuni subsp. jejuni HB93-13] (321 aa)
Score = 161, Expect = 2.0e-09, Identities = 56/180 (31%), Positives = 94/180 (52%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K K L+A S G DS AL  L  +  +   +  +NY  R++SD +E   ++   +++ K+F+    K         +N +   R+ RYDFFEKI  E     +++AH  ND  E   M L++       LG++   K ++  L+RPLL  +K  +  + + K+I +  D +N  ++Y RN +RK
  S:    13 KGKNLLAFSYGSDSSALFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALRFHKKIFIKHAPKFQ-------SNFEKKARDFRYDFFEKICLEQDYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQECEKRQNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK 188
>gi|94967093|ref|YP_589141.1| tRNA(Ile)-lysidine synthetase-like [Acidobacteria bacterium Ellin345] >gi|94549143|gb|ABF39067.1| tRNA(Ile)-lysidine synthetase-like [Acidobacteria bacterium Ellin345] (464 aa)
Score = 161, Expect = 2.1e-09, Identities = 54/174 (31%), Positives = 95/174 (54%)
  Q:     7 IAVSGGPDSMALLNKKRHLVE---------AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKY--KDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG----IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +AVSGG DS+ALL   R L+E         +V H+++  R  ++D DE+ V D   +++L L +    + DV  +  ++  +L+T  R++RY FF ++ +     K+  AH  +D  E+  + + +      L      R  S   +  ++RPLL   +  +E Y +S N  +  D TN   ++ RN +R
  S:    23 VAVSGGADSVALL---RGLLELRSELGIALSVVHLHHGIRGAEADADEQFVADLAGQFDLSLHL---ERVDVPSHSSQEKLSLETAARDLRYAFFRRLLESSACDKVATAHTLDDQAETVLLRILRGTGTRGLAAIPPFRDASPELAACIVRPLLGTERTEVETYLKSLNQPWREDSTNTDPKHLRNRIR 206
>gi|116510859|ref|YP_808075.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactococcus lactis subsp. cremoris SK11] >gi|116106513|gb|ABJ71653.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactococcus lactis subsp. cremoris SK11] (422 aa)
Score = 161, Expect = 2.3e-09, Identities = 80/284 (28%), Positives = 128/284 (45%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKE----SLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKN 287
           K L+A+SGG DSM L N       K H+   + H+N+  R +SD +E+ +R       + +FV D    + ++ K         RE RY FFEKI        +L AH + D +E+  M  +         GI     F    LIRPLL  TK+ L+         F  D TN    Y RN +R  +     K   +F   +   + +    + +++ + +     D  I+Y  K  +  KE     L   F  +  IK ++ K E+I+  I + +  S +    K+ QF++ K+
  S:    23 KILLALSGGKDSMTLFNWLYELRAKLHIELGIAHINHGLRPESDFEEQSLRKMASDLEIPIFV-DRFSGEFTEQKA--------REFRYHFFEKIMIAENYDVLLTAHHQGDVVETVLMRQITGRPLRSLQGIADCQPFAKGQLIRPLLKFTKEELDAAV------FYEDSTNQGVDYFRNRIRNQLIPELTKENPQFSQAISDLSSEIKMALTVINQRISELEIIDEKISYH-KFISQTKELQHFILQAFFAQYPEIKVSKKKFEEILHIIRRPQQYSAQLN--KDFQFVKTKD 299
>gi|150025676|ref|YP_001296502.1| tRNA(Ile)-lysidine synthase [Flavobacterium psychrophilum JIP02/86] >gi|149772217|emb|CAL43693.1| tRNA(Ile)-lysidine synthase [Flavobacterium psychrophilum JIP02/86] (434 aa)
Score = 160, Expect = 2.6e-09, Identities = 58/179 (32%), Positives = 101/179 (56%)
  Q:     2 KHKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + K L+A SGG DSM +L+  +K +   A+ H N+  R  +S  D++ V++Y  K  +  FV  TH D  +  KD   + Q   RE+RY++F ++ +      IL AH  +D LE+  ++L +    +   GI  +++     +IRPLL  ++  +E+Y +  +I++  D +N  D+Y RN +R
  S:    18 EKKLLLATSGGIDSMVMLHLFQKLNYNIAIAHCNFQLRGLESFGDQQFVQEYASKNKIPAFV--THFDTENFAKDYKLSTQIAARELRYNWFYELLETENFDFILTAHHADDNLETFIINLTRGTGLDGLTGIPEQNE----QIIRPLLPFSRSEIEEYTKENSIQWREDSSNASDKYLRNKIR 195
>gi|148285169|ref|YP_001249259.1| tRNA(Ile)-lysidine synthetase [Orientia tsutsugamushi str. Boryong] >gi|166988062|sp|A5CFP2|TILS_ORITB tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|146740608|emb|CAM81262.1| tRNA(Ile)-lysidine synthetase [Orientia tsutsugamushi Boryong] (441 aa)
Score = 160, Expect = 3.1e-09, Identities = 59/217 (27%), Positives = 101/217 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKV--KWFNLKNMFFIKLLDSKFNNWI 220
           K  IAVSGG DS+AL+   +H  E       V  +++H R +S ++   V   C+   L+          ++      N+Q   R+ RY       QE  I  ++  H  +D +E+ ++ L +      L         ++ +IRPL N TK+ L++Y   +NI+++ D +N  ++Y R  VR ++          F +++  K   L  M   + LDS  N  I
  S:    22 KLAIAVSGGTDSLALMLLVKHWNEKVKGEITVLTIDHHLRSESTSEADYVSSICQNIKLQHVTLHWIHKGIT-----GNIQAQARKARYHLLTNYCQEHDILHLITGHHADDIVENFFIRLLRGAGLAGLSSHNIFFVNNVRIIRPLFNITKQDLKKYLEQQNIKWINDPSNNSNKYLRTQVRDLLKSMLISFQNNFTVELLKKRIMLSQMHLTRALDSVNNEII 241
>gi|89211108|ref|ZP_01189485.1| PP-loop [Halothermothrix orenii H 168] >gi|89159267|gb|EAR78938.1| PP-loop [Halothermothrix orenii H 168] (468 aa)
Score = 159, Expect = 3.2e-09, Identities = 51/175 (29%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+ VSGGPDS+ LL+       +  L   V H+++  R+++  + + V +    Y LK  +    + DV    +   L  +   R++R++   K    L + KI +AH K+D +E+ ++ + +        GI   S+   + +I PLLN  ++ +  YC+ +N+  V D TN    Y+RN +R
  S:    24 LVGVSGGPDSLTLLDMLVRVKDEYGLKLVVFHLDHKFRQEAAREARYVSNITNNYGLKCII---EEFDVPGLMNDEGLSPEEAARKVRFNLMIKWVNSLNLNKIAVAHNKDDLVETVFLHMFRGTGLKGLTGIDPVSRIGGVEVIHPLLNIYRQEIMDYCQRRNLNPVYDPTNQETIYTRNKIR 204
>gi|145619725|ref|ZP_01775771.1| tRNA(Ile)-lysidine synthetase [Geobacter bemidjiensis Bem] >gi|144943975|gb|EDJ79054.1| tRNA(Ile)-lysidine synthetase [Geobacter bemidjiensis Bem] >gi|197088377|gb|ACH39648.1| tRNA(Ile)-lysidine synthetase [Geobacter bemidjiensis Bem] (457 aa)
Score = 159, Expect = 3.5e-09, Identities = 51/175 (29%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLV----EAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVSGG DS+ALL+    L       V H+N+  R  +SD D+  V      Y+L          D+++ + ++ L+   R  RY F E+ +++ G   I +AH ++D  E+  + L +       G+   +      L RPLL  ++  LEQY + + + +  D TN      RN +R
  S:    21 VVAVSGGADSVALLDIMTRLECGLRLVVAHLNHCLRGAESDADQAFVASLADNYHLPFVSQSCDVADLARRERLS-LEDAGRRARYAFLEQTAEQYGAFSIALAHHQDDQAETVLIRLLRGSGGT--GLSAMAGTAGDKLKRPLLQVSRVKLEQYLKQRELSYRTDSTNADTAILRNSIR 197
>gi|145628768|ref|ZP_01784568.1| DNA mismatch repair protein [Haemophilus influenzae 22.1-21] >gi|144979238|gb|EDJ88924.1| DNA mismatch repair protein [Haemophilus influenzae 22.1-21] (397 aa)
Score = 159, Expect = 3.5e-09, Identities = 56/195 (28%), Positives = 106/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +L+A+SGG DS  LL+       K+ HL    V A+ H+++    ++D+  K  +D C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + + RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLVALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAI-HIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPIFRPLLGFTRPQLEDYAQKEKLNWITDESNEDNRYDRNFLRNEILPKLRERWAYFDLAVQ 216
>gi|118726056|ref|ZP_01574689.1| tRNA(Ile)-lysidine synthetase [Clostridium cellulolyticum H10] >gi|118664612|gb|EAV71241.1| tRNA(Ile)-lysidine synthetase [Clostridium cellulolyticum H10] (474 aa)
Score = 159, Expect = 3.6e-09, Identities = 53/175 (30%), Positives = 89/175 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDREDSD-NDEKIVRDYCKKYNLKLFVFDTHKDDVSKYK-DINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ +SGG DS+ LL+    +   +       HVN+  R D    DE  V+ +C    L++++   H D   K K +  +L+   R  RY+ F  ++ E G  KI +AH +ND  E+  M + +      L   R  +++   +IRPLL+  +  +E+Y     +E V D +N    Y RN +R
  S:    23 VVGISGGYDSVCLLHILYSISNELGIKIYPVHVNHMLRGDEALRDENFVKSFCSSLGLEVYI--KHIDIAKKAKTEKISLEEAGRNARYEVFSLVAGERGASKIAVAHSRNDQAETILMRICRGTG---LEGLRGMEYKRDNIIRPLLDADRSQIEEYVNGIGVEAVTDSSNLHTDYFRNRIR 200
>gi|116495973|ref|YP_807707.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus casei ATCC 334] >gi|116106123|gb|ABJ71265.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus casei ATCC 334] (436 aa)
Score = 159, Expect = 4.0e-09, Identities = 51/201 (25%), Positives = 88/201 (43%)
  Q:     4 KYLIAVSGGPDSMALLN---KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKN-KKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLK 204
           + L+AVSGG DSM LLN   K   L   V   ++  R +S  ++  V    ++  + +      + D          +   R+ RY F    + E   + ++ AH  +D LE+    L ++      +GIR    +    L+RPLL  +K  +  Y    N+ F  D +N    Y+RN +R  +    KK   +    ++ F ++
  S:    16 RVLVAVSGGVDSMVLLNLAVKAADLDVVVATFDHRLRPESQQEQAFVVAAAQQLQVPVVTGQWRRSDGQPTS-----EAAARQARYAFLAATAAEQHAEVVMTAHHADDQLETILFRLARSGDPAALIGIRADRAWHGRRLVRPLLPYSKAMIRSYADQHNVRFCEDSSNADPHYARNQLRHQVIPAFKKQNTQLLAHIQTFTME 215
>gi|57168991|ref|ZP_00368120.1| conserved hypothetical protein [Campylobacter coli RM2228] >gi|57019657|gb|EAL56346.1| conserved hypothetical protein [Campylobacter coli RM2228] (321 aa)
Score = 158, Expect = 4.5e-09, Identities = 55/180 (30%), Positives = 94/180 (52%)
  Q:     2 KHKYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K + L+A S G DS AL +   ++ +   +  +NY  R++SD +E+  ++   +++ K+F+        S      N +   R+ RYDFFEKI  E     +++AH  ND LE   M L++       LG++   K  +  L+RPLL  +K  +  Y +  +I +  D +N  ++Y RN +RK
  S:    13 KGRNLLAFSYGSDSSALFHFLVQKKIDFDLVMINYKTRKNSDLEEQKSKELALEFHKKIFI-------KSAPVIKGNFEKEARDFRYDFFEKICLEQNYSNLILAHHLNDQLEWFLMQLSRGAGLAEILGMQECEKRSNYTLLRPLLFMSKDEILSYLKENDIFYFQDESNENEKYFRNYIRK 188
>gi|77407669|ref|ZP_00784424.1| MesJ/Ycf62 family protein [Streptococcus agalactiae COH1] >gi|77173668|gb|EAO76782.1| MesJ/Ycf62 family protein [Streptococcus agalactiae COH1] (424 aa)
Score = 158, Expect = 4.9e-09, Identities = 55/180 (30%), Positives = 97/180 (53%)
  Q:     3 HKYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
            K LIAVSGG DS+ LL       K+  +   + H+N+  R++S+ +E+ +R + + +++ +F+        S ++ I + +   R  RY+FF K+ +E G   ++ AH  +D  E+ +M + +  +  +L GI++ S F +  LIRP L   K+ L       NI    D +N    Y RN +R +
  S:    19 QKVLIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQRKESEKEEEYIRQWGQIHDVPVFI--------SYFQGIFS-EDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPYKKELL------PNIFHFEDASNASSDYLRNRIRNI 190
>gi|108805006|ref|YP_644943.1| tRNA(Ile)-lysidine synthetase-like protein [Rubrobacter xylanophilus DSM 9941] >gi|108766249|gb|ABG05131.1| tRNA(Ile)-lysidine synthetase-like protein [Rubrobacter xylanophilus DSM 9941] (444 aa)
Score = 158, Expect = 5.0e-09, Identities = 57/175 (32%), Positives = 84/175 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLV-----EAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILI--------RPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L  VSGGPDS+ALL   R LV      AV HV++  R E+S  D + VR+ C+   L+  V     +  +       LQ   R  RY    +++  LG   + + H  +D  E+           L L + R S  R L  I        RPL+ +T+  +  Y  +    + +D TN   +Y+RN VR
  S:    25 LALVSGGPDSVALL---RALVGLGYEPAVLHVDHGLRGEESRGDAEFVRELCRGLGLRCEVRSLRLEGRA------GLQERARRERYRIAGEVAGRLGASAVAVGHNADDVAET-----------LLLNLARGSGLRGLSGIPPVRGRVCRPLIERTRAEILGYLEALGQGYRVDSTNLLPKYARNRVR 193
>gi|76788050|ref|YP_328740.1| tRNA(Ile)-lysidine synthetase [Streptococcus agalactiae A909] >gi|77405606|ref|ZP_00782695.1| MesJ/Ycf62 family protein [Streptococcus agalactiae H36B] >gi|76563107|gb|ABA45691.1| tRNA(Ile)-lysidine synthetase [Streptococcus agalactiae A909] >gi|77175750|gb|EAO78530.1| MesJ/Ycf62 family protein [Streptococcus agalactiae H36B] (424 aa)
Score = 158, Expect = 5.0e-09, Identities = 55/180 (30%), Positives = 97/180 (53%)
  Q:     3 HKYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
            K LIAVSGG DS+ LL       K+  +   + H+N+  R++S+ +E+ +R + + +++ +F+        S ++ I + +   R  RY+FF K+ +E G   ++ AH  +D  E+ +M + +  +  +L GI++ S F +  LIRP L   K+ L       NI    D +N    Y RN +R +
  S:    19 QKVLIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQRKESEKEEEYIRQWGQIHDVPVFI--------SYFQGIFS-EDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPYKKELL------PNIFHFEDASNASSDYLRNRIRNV 190
>gi|22536199|ref|NP_687050.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 2603V/R] >gi|25010088|ref|NP_734483.1| hypothetical protein gbs0013 [Streptococcus agalactiae NEM316] >gi|76797982|ref|ZP_00780241.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 18RS21] >gi|77414471|ref|ZP_00790621.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 515] >gi|61217360|sp|Q8E2H4|TILS_STRA5 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217362|sp|Q8E7Y2|TILS_STRA3 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|22533016|gb|AAM98922.1|AE014191_14 MesJ/Ycf62 family protein [Streptococcus agalactiae 2603V/R] >gi|23094439|emb|CAD45658.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586662|gb|EAO63161.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 18RS21] >gi|77159481|gb|EAO70642.1| MesJ/Ycf62 family protein [Streptococcus agalactiae 515] (424 aa)
Score = 158, Expect = 5.1e-09, Identities = 55/180 (30%), Positives = 97/180 (53%)
  Q:     3 HKYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
            K LIAVSGG DS+ LL       K+  +   + H+N+  R++S+ +E+ +R + + +++ +F+        S ++ I + +   R  RY+FF K+ +E G   ++ AH  +D  E+ +M + +  +  +L GI++ S F +  LIRP L   K+ L       NI    D +N    Y RN +R +
  S:    19 QKVLIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQRKESEKEEEYIRQWGQIHDVPVFI--------SYFQGIFS-EDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPYKKELL------PNIFHFEDASNASSDYLRNRIRNV 190
>gi|145640364|ref|ZP_01795948.1| DNA mismatch repair protein [Haemophilus influenzae R3021] >gi|145274950|gb|EDK14812.1| DNA mismatch repair protein [Haemophilus influenzae 22.4-21] (430 aa)
Score = 157, Expect = 5.5e-09, Identities = 56/195 (28%), Positives = 106/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    + A+ H+++    ++D+  K  +D C +  + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSIRAI-HIHHGLSPNADSWAKHCQDLCDQLQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAHFDLAVQ 216
>gi|91214572|ref|ZP_01251545.1| putative cell-cycle protein [Psychroflexus torquis ATCC 700755] >gi|91186999|gb|EAS73369.1| putative cell-cycle protein [Psychroflexus torquis ATCC 700755] (437 aa)
Score = 157, Expect = 5.6e-09, Identities = 53/176 (30%), Positives = 95/176 (53%)
  Q:     5 YLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +LIA+SGG DS+ L  L    HL   + H N+  R  DS  DE+ V +       + F+     + ++K +  +++Q   R++RYD+F+++ +      +L AH  ND LE+  ++L+++       GI +++      ++RPLL  +K  L++Y    NI +  D +N   +Y RN +R
  S:    21 FLIAISGGLDSVVLAHLCNSLHLDFGLSHCNFQLRGLDSTRDEEFVENLSISLKCEFFIKTFQTESIAK-ESKSSIQLTARKLRYDWFQELIETTSHNYLLTAHHLNDDLETFIINLSRSTGLKGLTGIPQRNSH----ILRPLLKFSKAELKEYAIKHNIYWREDQSNASTKYLRNEIR 195
>gi|68249007|ref|YP_248119.1| putative cell cycle protein MesJ [Haemophilus influenzae 86-028NP] >gi|68057206|gb|AAX87459.1| putative cell cycle protein MesJ [Haemophilus influenzae 86-028NP] (430 aa)
Score = 157, Expect = 5.9e-09, Identities = 57/195 (29%), Positives = 106/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    V A+ H+++    ++D+  K  ++ C ++ + L +     D        N ++   RE RY   + I + L I+++L+ AH  ND  E+ +++L +      L  ++++S    + + RPLL  T+  LE Y + + + +V D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLCQKQPHLPPLSVRAI-HIHHGLSPNADSWAKHCQNLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQIQEMLVTAHHLNDQTETFFLALKRGSGLQGLSAMQQQSVLFGMPIFRPLLGFTRPQLEDYAQQEKLNWVTDESNEDNRYDRNFLRNEILPKLRERWAHFDLAVQ 216
>gi|77411309|ref|ZP_00787658.1| MesJ/Ycf62 family protein [Streptococcus agalactiae CJB111] >gi|77162645|gb|EAO73607.1| MesJ/Ycf62 family protein [Streptococcus agalactiae CJB111] (424 aa)
Score = 157, Expect = 6.0e-09, Identities = 55/180 (30%), Positives = 97/180 (53%)
  Q:     3 HKYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
            K LIAVSGG DS+ LL       K+  +   + H+N+  R++S+ +E+ +R + + +++ +F+        S ++ I + +   R  RY+FF K+ +E G   ++ AH  +D  E+ +M + +  +  +L GI++ S F +  LIRP L   K+ L       NI    D +N    Y RN +R +
  S:    19 QKVLIAVSGGIDSINLLQFLYQYQKELSISIGIAHINHGQRKESEKEEEYIRQWGQIHDVPVFI--------SYFQGIFS-EDRARNHRYNFFSKVMREEGYTALVTAHHADDQAETVFMRILRGSRLRYLSGIKQVSAFANGQLIRPFLPYKKELL------PNIFHFEDASNASSDYLRNRIRNV 190
>gi|73663556|ref|YP_302337.1| hypothetical protein SSP2247 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72496071|dbj|BAE19392.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (431 aa)
Score = 157, Expect = 6.5e-09, Identities = 51/175 (29%), Positives = 93/175 (53%)
  Q:     6 LIAVSGGPDSMALLNK-----KRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESA-YMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL++     K    +  C HVN++ R  +  +E  ++ +CK ++++L+V   H D     +  N+++   R  RY +F+++  EL    +L AH ++D +E+  Y  +        LG+  ++   S  + +PLL+ TK  +  Y     + +  D TN  + Y RN +R
  S:    17 VLAVSTGVDSMVLLHELITRLKDSYAKLTCLHVNHNIRPIAKEEEYFLKQFCKAHHVELYV--RHLDLSDVIEKGNSIENDARVARYQWFDEMMYELKADILLTAHHQDDQIETIFYRVMTGRSTRSSLGMAYQTTRASYQICKPLLSTTKNEIRDYQVMHRVPYYEDETNTQNHYVRNDIR 196
>gi|145632651|ref|ZP_01788385.1| DNA mismatch repair protein [Haemophilus influenzae 3655] >gi|144986846|gb|EDJ93398.1| DNA mismatch repair protein [Haemophilus influenzae 3655] (430 aa)
Score = 157, Expect = 6.8e-09, Identities = 53/176 (30%), Positives = 98/176 (55%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +LIA+SGG DS  LL+       K+ HL    V A+ H+++    ++D+  K  +D C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + + RPLL  T+  LE Y + + + ++ D +N  +R+ RN +R
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKRPHLPPLSVRAI-HIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEMLVTAHHLNDQTETFFLALKRGSGLKGLGAMQQQSVLFGMPIFRPLLGFTRPQLEDYAKKEKLNWITDESNEDNRFDRNFLR 197
>gi|53732991|ref|ZP_00349623.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R2846] (430 aa)
Score = 156, Expect = 7.6e-09, Identities = 55/195 (28%), Positives = 107/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    V A+ H+++    ++++  +  +D C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSVRAI-HIHHGLSPNAESWVQHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQRSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAHFDLAVQ 216
>gi|118580663|ref|YP_901913.1| tRNA(Ile)-lysidine synthetase [Pelobacter propionicus DSM 2379] >gi|118503373|gb|ABK99855.1| tRNA(Ile)-lysidine synthetase [Pelobacter propionicus DSM 2379] (485 aa)
Score = 156, Expect = 8.1e-09, Identities = 53/175 (30%), Positives = 85/175 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE-----AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKY--KDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++A+SGG DS  LL+    L E      + H+N+  R  +SD DE   R   ++Y L    F +   DV+    +   NL+   R  R +F E +++      I +AH  +D  E+  M L +       G+R  S       IRPLLN  +  ++ Y R++ +E   D +N    + RN +R
  S:    27 ILALSGGADSCVLLDILAGLTEFSPCLVIAHLNHQLRGAESDGDELFCRSLAERYGLP---FRSRSLDVAALARRQGLNLEDAGRRARLEFLEDVARSFHATAIALAHHADDQAETVLMRLLRGSG--MTGLRGMSFRGPGGRIRPLLNSRRCEIDAYLRARGLEHREDASNRDTAFLRNRIR 204
>gi|126701186|ref|YP_001090083.1| putative ATPase [Clostridium difficile 630] >gi|145952358|ref|ZP_01801368.1| hypothetical protein CdifQ_04004104 [Clostridium difficile QCD-32g58] >gi|168697423|ref|ZP_02729700.1| putative ATPase [Clostridium difficile QCD-37x79] >gi|168723564|ref|ZP_02755841.1| putative ATPase [Clostridium difficile QCD-76w55] >gi|168732016|ref|ZP_02764293.1| putative ATPase [Clostridium difficile QCD-97b34] >gi|196127358|ref|ZP_03119107.1| putative ATPase [Clostridium difficile ATCC 43255] >gi|196162195|ref|ZP_03122756.1| putative ATPase [Clostridium difficile CIP 107932] >gi|122973554|sp|Q181G3|TILS_CLOD6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|115252623|emb|CAJ70466.1| putative ATPase [Clostridium difficile 630] (462 aa)
Score = 155, Expect = 1.0e-08, Identities = 57/188 (30%), Positives = 97/188 (51%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRHLVEA-VCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           K ++ +SGGPDS+ LL+     KK   +E    H+N+  R  ++  D   V   C+   +  FV      +V KY +    +L+   R++RY+ F +I  ++   KI I H  ND  E+  M + +       G++     R   +IRP+L+  +  +E+YC + N+   ID TN  + Y+RN +R  +  + K  F
  S:    21 KIVLGLSGGPDSVCLLHVLNRLKKDFNIEIYAAHLNHQIRGIEAQKDALYVSKLCEDMGIIFFV---KSINVPKYCENEGLSLEEGARKLRYEMFYEIKDKIKANKIAIGHNLNDQAETVMMRIMRGTG--LKGLKGIDYIRDNCIIRPILDVERNEIEEYCEAYNLNPRIDKTNLENIYTRNKIRLDLLPYMKDNF 212
>gi|145630423|ref|ZP_01786204.1| pyridoxine kinase [Haemophilus influenzae 22.4-21] >gi|144984158|gb|EDJ91595.1| pyridoxine kinase [Haemophilus influenzae R3021] (430 aa)
Score = 155, Expect = 1.0e-08, Identities = 56/195 (28%), Positives = 106/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    + A+ H+++    ++D+  K  +D C +  + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLQPLSIRAI-HIHHGLSPNADSWAKHCQDLCDQLQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKYLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQRSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPELRERWAYFDLAVQ 216
>gi|39938615|ref|NP_950381.1| hypothetical protein PAM129 [Onion yellows phytoplasma OY-M] >gi|61216552|sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39721724|dbj|BAD04214.1| conserved hypothetical protein [Onion yellows phytoplasma OY-M] (436 aa)
Score = 155, Expect = 1.1e-08, Identities = 68/261 (26%), Positives = 118/261 (45%)
  Q:     5 YLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK---------TFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIKPNENKIEQIIEFIN 265
           Y+IAVSGG DSMALL+    + +   V H N+  R +   D+++V+ YC + +L    F+ +           N Q   R +R     +I+ +     IL AH  +D  E+    + ++   L + G++ ++ ++  I ++P L   K  +  Y     I F+ DYTN    Y RN +R  +  + K           +Q+  L+   F  K         +  +      F +  FL +    ++ +I L L    I  +   I+ II+ IN
  S:    16 YIIAVSGGVDSMALLHCLVAQKIKLQVVHFNHLARPNVWKDKELVQSYCLQNSLCFHYFELNCPQ-------KNFQAQARLLRQQKLMQIATKHQTPFILTAHHLDDLAETILQKITRSSTLLGYSGMQIQTSWQDFIFLKPFLYVPKAKIISYAAFYQIPFLEDYTNQNFTYQRNQIRHQVIPYLKTQTSFLQNIPKYQQTLLQAYNFIRKQTLLFLTKHTNHSCNPPNSFALAPFLNLDLVIQKDIILLLLEQQNITKSFIFIQNIIKGIN 281
>gi|15639364|ref|NP_218813.1| hypothetical protein TP0373 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025606|ref|YP_001933378.1| hypothetical protein TPASS_0373 [Treponema pallidum subsp. pallidum SS14] >gi|6136519|sp|O83388|TILS_TREPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3322651|gb|AAC65358.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018181|gb|ACD70799.1| hypothetical protein TPASS_0373 [Treponema pallidum subsp. pallidum SS14] (477 aa)
Score = 154, Expect = 1.2e-08, Identities = 52/175 (29%), Positives = 88/175 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE--AVCH----VNYHDR-EDSDNDEKIVRDYCKKYN--LKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGG DS+ALL     L     VC     V++  R ++   D + VR  C +++  L  FV       V     I    +Q   R +RY  F+ ++   G + +L AH ++D  E+  M L +      L   R ++ R    +RPLL  ++  +E + +++ + +  D +N   +Y RN +R
  S:    32 LVAVSGGADSLALLYAAHELAPDFGVCACAVTVDHSLRAQEGALDARFVRALCARFSPPLPCFVQQISAGAVHACAKIRGRGVQDAARALRYKVFDHVAARCGAQVVLTAHTRDDQYETLLMRLFQGAAASALQGIRAARGR---YVRPLLKVSRTCVEDFLQTRGVRWREDASNTCRKYVRNRIR 214
>gi|145636327|ref|ZP_01791996.1| putative cell cycle protein MesJ [Haemophilus influenzae PittHH] >gi|145270492|gb|EDK10426.1| putative cell cycle protein MesJ [Haemophilus influenzae PittHH] (301 aa)
Score = 154, Expect = 1.3e-08, Identities = 53/182 (29%), Positives = 102/182 (56%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-----KMMAEW 186
           +LIA+SGG DS  LL+       K+ HL    + A+ H+++    ++D+  K  ++ C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + + RPLL  T+  LE Y + + + ++ D +N  +R+ RN +R     ++ A W
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLQILSLRAI-HIHHGLSPNADSWAKHCQNLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEVLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPIFRPLLGFTRPQLEDYAKKEKLNWITDESNEDNRFDRNFLRNEILPELRARW 208
>gi|148827606|ref|YP_001292359.1| cell cycle protein [Haemophilus influenzae PittGG] >gi|148718848|gb|ABQ99975.1| cell cycle protein [Haemophilus influenzae PittGG] (430 aa)
Score = 154, Expect = 1.3e-08, Identities = 52/176 (29%), Positives = 99/176 (56%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +LIA+SGG DS  LL+       K+ HL    + A+ H+++    ++D+  K  +D C ++ + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +R+ RN +R
  S:    19 FLIALSGGLDSTVLLSLFAKLCQKQPHLQILSLRAI-HIHHGLSPNADSWAKHCQDLCDQFQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMQILRPLLGFTRPQLEDYAQKEKLNWITDESNKDNRFDRNFLR 197
>gi|153092409|gb|EDN73472.1| possible PP-loop superfamily ATPase [Mannheimia haemolytica PHL213] (421 aa)
Score = 154, Expect = 1.3e-08, Identities = 71/269 (26%), Positives = 131/269 (48%)
  Q:     5 YLIAVSGGPDSMALLN---KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF-RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKV----KWFNLKNMFFIKLLDSKFNNWI--KQDFDINYFLKIKNNYKESLIYLFLNHIGIK-PNENKIEQIIE---FINKNKNGSVK 273
           +LI +SGG DS+ LL+   +    V A+ +V++    ++D+       YCK+ N+  F+    + D S     N ++   RE RY   + I Q+L   ++   AH  +D  E+  ++L +      L   +   F ++  + RPLL  TK  L  Y     + ++ D +N  +RY RN +R  +     + +Q F   V    +    +     +LL ++  +    KQ  +IN F +     ++ L  L+L   G++ P++ +++ +I    F   +KN  VK
  S:    21 FLIGLSGGVDSVVLLHLFARTSFHVRAI-YVHHGLSPNADDWAAFCEQYCKRLNIP-FILQKVRVDSS-----NGVENGAREARY---QAIQQQLKPNEVFATAHHLDDQAETFLLALKRGSGVKGLSAMQAVTFLQNFTVFRPLLTFTKSDLMGYAVQHQLGWIEDESNADNRYDRNFLRNSILPLLNQRWQHFSQMVARSAQHCAEQQALIEELLSNELKSRTGEKQQLNINGFGQFSLAKQQQLSRLWLEQNGVRMPSQAQLQAVISELIFAKADKNPQVK 294
>gi|114706794|ref|ZP_01439694.1| PP-loop family protein [Fulvimarina pelagi HTCC2506] >gi|114537742|gb|EAU40866.1| PP-loop family protein [Fulvimarina pelagi HTCC2506] (458 aa)
Score = 153, Expect = 1.6e-08, Identities = 56/182 (30%), Positives = 88/182 (48%)
  Q:     3 HKYLIAVSGGPDSMALL---NKKRHLVEAV--CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFR-SLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
            + LIAVSGGPDS+ALL   ++  +LV AV    VN+  R ++D +   V +  ++  +          D S      NLQ   RE RY    + ++ +G   IL AH + D +E+   +L + +++N   G+R        L L+RP L    + L        I  V D +N   R++R   R  +A
  S:    38 QRLLIAVSGGPDSLALLVLASRLPNLVFAVHAATVNHGLRREADMEAAHVAEVSQRLGVPHETLTWEGWDGS-----GNLQAAAREARYRLLAEEARRIGASAILTAHHRGDQIETVLQALERGDRENRLAGMRASRDLEPRLTLVRPFLEIPAEQLWAVLAEAGIASVDDPSNADRRFTRVRHRHAIA 221
>gi|39996909|ref|NP_952860.1| cell cycle protein MesJ, putative [Geobacter sulfurreducens PCA] >gi|61216575|sp|Q74C65|TILS_GEOSL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39983797|gb|AAR35187.1| cell cycle protein MesJ, putative [Geobacter sulfurreducens PCA] (471 aa)
Score = 153, Expect = 1.6e-08, Identities = 53/183 (28%), Positives = 89/183 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE-----AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYR--------EIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG----IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEW 186
           + ++AVSGG DS+AL++    L E      V H+N+  R   SD DE+ V    + Y L           VS+ + +  L  W R          RY FF+ ++   G + + +AH  +D  E+  M L +    L L     +    K+     +RPLL   ++ +E Y  ++ + F  D +N    + RN +R  +  +
  S:    29 RVVVAVSGGADSVALVDILVSLNELRLDLVVAHLNHKLRGAASDEDERFVEQCAQTYALPF---------VSRGEQVKALAEWERLSLEDAGRRARYAFFDDVAAACGARTVALAHHADDQAETLLMRLVRGAGGLGLSAMQPVGAGGKY-----VRPLLALGRQEIEAYLDARGLAFRQDQSNTDVAFLRNRIRHELVPY 215
>gi|145638685|ref|ZP_01794294.1| pyridoxine kinase [Haemophilus influenzae PittII] >gi|145272280|gb|EDK12188.1| pyridoxine kinase [Haemophilus influenzae PittII] (430 aa)
Score = 153, Expect = 1.9e-08, Identities = 56/195 (28%), Positives = 106/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    + A+ H+++   +++D   K  +D C +  + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLRQKQPHLPPLSIRAI-HIHHGLSQNADCWAKHCQDLCDQLQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKYLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQQSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPKLRERWAYFDLAVQ 216
>gi|153951323|ref|YP_001398742.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. doylei 269.97] >gi|152938769|gb|ABS43510.1| tRNA(Ile)-lysidine synthetase [Campylobacter jejuni subsp. doylei 269.97] (321 aa)
Score = 152, Expect = 2.3e-08, Identities = 56/180 (31%), Positives = 94/180 (52%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKD--INNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           + K L+A S G DS AL  L  +  +   +  +NY  R++SD +E   ++   K++ K+F+         KY     +N +   R+ RYDFFEKI  E     +++AH  ND  E   M L++       LG++   +  +  L+RPLL  +K  +  + + K+I +  D +N  ++Y RN +RK
  S:    13 RGKNLLAFSYGSDSSALFYLLMQEKIDFDLVMINYKTRKNSDLEELKAKELALKFHKKIFI---------KYAPEFQSNFEKKARDFRYDFFEKICLEQDYDHLILAHHLNDQFEWFLMQLSRGAGLAEILGMQEYEQRSNYTLLRPLLFISKDEISSFLKEKDIFYFHDESNENEKYFRNYIRK 188
>gi|138893739|ref|YP_001124192.1| cell cycle protein MesJ [Geobacillus thermodenitrificans NG80-2] >gi|134265252|gb|ABO65447.1| Cell cycle protein MesJ [Geobacillus thermodenitrificans NG80-2] (464 aa)
Score = 152, Expect = 2.3e-08, Identities = 53/175 (30%), Positives = 94/175 (53%)
  Q:     6 LIAVSGGPDSMALLNK--------KRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNL--QTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ VSGGPDS+ALL+         K  LV A  HV++  R  +S+ + + V+ +C ++ +   + +  + DV  ++    L  Q   R  RY FF ++ ++   + + + H  +D +E+  M L +   +  + GI  K  F    LIRP L  ++  +E YC+ + +    D +N  D Y+RN  R
  S:    22 IVGVSGGPDSLALLHLLSSLRDEWKLQLVAA--HVDHMFRGRESEEEMEFVKHFCAEHRI---LCEAVQIDVPAFQRRTGLGAQEAARNCRYHFFAELVKKYQAQYVALGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGSYLIRPFLAVSRAEIEDYCKKEGLTPRRDPSNEKDDYTRNRFR 203
>gi|88713485|ref|ZP_01107567.1| putative cell-cycle protein [Flavobacteriales bacterium HTCC2170] >gi|88707995|gb|EAR00233.1| putative cell-cycle protein [Flavobacteriales bacterium HTCC2170] (434 aa)
Score = 152, Expect = 2.3e-08, Identities = 50/180 (27%), Positives = 100/180 (55%)
  Q:     1 MKHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ ++L+A SGG DS+ L  L  +  L  ++ H N+  R+ +SD DE+ V++  +   +  FV      + +  + ++ +Q   R++RY++F+ + ++  IK ++ AH  +D +E+  ++L++        GI  K+   S    RPLL  ++  + +Y +  NIE+  D +N   +Y RN +R
  S:    17 LQSRFLLACSGGLDSVVLAHLCSELGLDFSLAHCNFKLRDIESDKDERFVKELAEILKVPCFVICFDTLEYANEQGVS-IQMAARKMRYEWFKSLKKQHSIKTLVTAHHADDNIETFLINLSRGTGIKGLTGIPSKTNEIS----RPLLAFSRLQIMEYAKQSNIEWREDQSNKETKYLRNKIR 195
>gi|152993772|ref|YP_001359493.1| tRNA-lysidine synthase [Sulfurovum sp. NBC37-1] >gi|151425633|dbj|BAF73136.1| tRNA-lysidine synthase [Sulfurovum sp. NBC37-1] (323 aa)
Score = 152, Expect = 2.5e-08, Identities = 56/178 (31%), Positives = 88/178 (49%)
  Q:     8 AVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNL-----KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           A S G DS AL  L  + ++   +  V+Y+ RE S N+    +   K++ L     +  +FDTH             ++  R+ RY FFE + Q  G   ++ AHQ ND LE   M L K    +  +G+   +   +  L+RPLL  +K  L  Y +  N  + ID +N   +Y RN+ RK  ++
  S:    16 AFSAGVDSSALFFLLIENNIRFDIAIVDYNIREQSKNELAHAKALAKEHKLFCHTIQAPMFDTH------------FESKARKFRYKFFESLIQTEGYDNLITAHQLNDQLEWLLMRLTKGAGVSELIGLEPVTHRENYTLVRPLLEYSKDELLIYLKENNHPYFIDESNIDVKYERNLFRKQFSD 189
>gi|15806226|ref|NP_294931.1| cell cycle protein MesJ, putative/cytosine deaminase-related protein [Deinococcus radiodurans R1] >gi|84039866|gb|AAF10777.2|AE001969_6 cell cycle protein MesJ, putative/cytosine deaminase-related protein [Deinococcus radiodurans R1] (600 aa)
Score = 151, Expect = 2.8e-08, Identities = 48/178 (26%), Positives = 86/178 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL--VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           + L+ VSGG DS+ LL     +  + AV H+++  R +S +D   V D C +  +   V       V+  ++ N L+   R +RYD   + ++  G + IL AH + D  E+  M L + +  +     ++ + R     RP LN  +  +E Y R    ++  D +N   R++R  +R+
  S:    57 QVLVGVSGGADSVGLLRALLAVGALPAVAHLDHALRPESVDDAAWVSDLCARLGVPCEVTRIDVGAVAARRNWN-LEBAARRLRYDVLSRAAKHSGAEVILTAHTRRDQAETVLMELLRGEGRIRGIPPQRGRVR-----RPWLNVGRAEIETYLRGLGQDWREDASNADPRFTRAWLRR 230
>gi|152978797|ref|YP_001344426.1| tRNA(Ile)-lysidine synthetase [Actinobacillus succinogenes 130Z] >gi|150840520|gb|ABR74491.1| tRNA(Ile)-lysidine synthetase [Actinobacillus succinogenes 130Z] (427 aa)
Score = 151, Expect = 2.9e-08, Identities = 74/288 (25%), Positives = 140/288 (48%)
  Q:     4 KYLIAVSGGPDSMALL-------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFE--KISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKV----KWFNLKNMFFIKLLDSKF-NNWIKQD--FDINYFLKIKNNYKESLIYLFLNHIGIK-PNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKIL 291
           +YLIA SGG DS ALL         + HL     H+++     +++     R  C+K  + L +    + +++K   I   +   RE RY      + + E+    +  AH   D  E+  ++L +      LG ++R+S+   + + RPLL   K  LE Y R+++++++ D +N  +RY RN +R  +    ++ +  F L V    +    +     +LL   F  N+ K D  F ++ F     N + +L+ ++L    +  P + ++ Q+I  +   K  +V ++ L E      +N+  L
  S:    15 RYLIAFSGGADSTALLALFAKSRQNRPHLQLRAIHIHHGLNVAANDWAAHCRRICEKLEVPLII---ERVEINKKSGI---EQGAREARYAAIRCHRHADEI----VATAHHLQDQTETFLLALKRGSGIKGLGAMQRESRLYGMPIFRPLLPFGKTELENYLRAQSLDWIEDDSNADNRYDRNFLRNRILPVLRRRWTDFDLAVSRSAQHCYEQERLIRELLTPAFEKNYRKTDRTFALSDFAGYSPNKQNALLRMWLTACRVPMPEKMQLAQLIRDVVFAKPDAVPQFVLGEQVIRRYQNRLYL 310
>gi|149280296|ref|ZP_01886418.1| tRNA(Ile)-lysidine synthetase [Pedobacter sp. BAL39] >gi|149228985|gb|EDM34382.1| tRNA(Ile)-lysidine synthetase [Pedobacter sp. BAL39] (461 aa)
Score = 150, Expect = 3.6e-08, Identities = 57/177 (32%), Positives = 96/177 (54%)
  Q:     4 KYLIAVSGGPDS--MALLNKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GI--RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+AVSGG DS  MA L K       + H N++ R E+S  DE  V+      ++ ++V  TH D  +  K    + Q   R +RY++FE++  E G + I +A  ++D +E+  ++L +      L GI  RR +      LIRPL+  +++ ++    + +++FV D +N    Y RN +R
  S:    22 KILLAVSGGKDSVLMAHLFKASGHPFGIAHCNFNLRGEESVRDEHFVKMLGLMLDVPVYV--THFDTKAYAKQHGVSTQMAARTLRYEWFEQLRIERGYQVIALAQHQDDAMETVLLNLTRGTGISGLHGIFPRRGN------LIRPLMFLSRQEIDDLVVAHHLDFVEDSSNLSSNYIRNKIR 197
>gi|53733246|ref|ZP_00349670.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R2866] (430 aa)
Score = 150, Expect = 4.0e-08, Identities = 55/195 (28%), Positives = 106/195 (54%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHL----VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVK 199
           +LIA+SGG DS  LL+       K+ HL    V A+ H+++    ++++  +  +D C +  + L +     D        N ++   RE RY   + I + L  +++L+ AH  ND  E+ +++L +      LG ++++S    + ++RPLL  T+  LE Y + + + ++ D +N  +RY RN +R  +    ++ +  F L V+
  S:    19 FLIALSGGLDSTVLLSLFAKLCQKQPHLPPLSVRAI-HIHHGLSPNAESWVQHCQDLCDQLQIPLIIERVQVDKT------NGIEAGAREARY---QAIKKHLQTQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQQRSVLFGMPILRPLLGFTRTQLENYAQKEKLNWITDESNEDNRYDRNFLRNEILPKLRERWAYFDLAVQ 216
>gi|116333183|ref|YP_794710.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus brevis ATCC 367] >gi|116098530|gb|ABJ63679.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus brevis ATCC 367] (450 aa)
Score = 149, Expect = 4.6e-08, Identities = 52/178 (29%), Positives = 85/178 (47%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           L+AVS G DSM LL     L         V HVN+  R+ S  +   ++ +C  + + L    T K  + ++   + ++   R  RYDFF +   +     +  AHQ ++ +E+  + L +  +   L G+          +IRPLL  TK+ L+ Y R + + +  D TN     SRN VR  +
  S:    24 LVAVSTGVDSMVLLQLLMTLPVTMRPKLTVVHVNHQLRQQSQTEAAFLKKWCAAHQISLV---TTKWPIDQHPS-HGVEAAARAFRYDFFAQQLHQQKADWVATAHQADEQVETILLKLIRGGQLAQLTGMAASRPLAGGRVIRPLLPFTKERLKAYAREQQVPWYEDATNQELIASRNRVRHQL 204
>gi|52424859|ref|YP_087996.1| MesJ protein [Mannheimia succiniciproducens MBEL55E] >gi|61216475|sp|Q65UE9|TILS_MANSM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|52306911|gb|AAU37411.1| MesJ protein [Mannheimia succiniciproducens MBEL55E] (426 aa)
Score = 149, Expect = 4.6e-08, Identities = 76/287 (26%), Positives = 135/287 (47%)
  Q:     4 KYLIAVSGGPDSMALL-------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-----KMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNY-----KESLIYLFLNHIGIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEIKNKKI 290
           K LIA SGG DS ALL         + H      H+++    ++D       + C+++++ L V     D        N ++   RE RY     I+  L I ++L  AH  ND  E+  ++L +      L  ++++S   +L + RPLL  T+  LE Y +S+ I ++ D +N  + Y RN +R     KM   W     Q  Y   +    +     +LL+ +F    +++ D    +K+ + Y     K  L           P++ ++EQ+I  +   K  ++ +++L  NQ I    +K+
  S:    16 KILIAFSGGLDSTALLALCKKLQENRPHFQFRAIHIHHGLSPNADKWALHCENICRQFSIPLIVEKVRVDKS------NGIEAGAREARY---HAIANHLNIDEVLATAHHLNDQTETFLLALKRGSGVQGLSAMQKESVVFNLPIFRPLLQFTRAQLEDYVKSQKINWIEDESNEDNSYDRNFLRNIILPKMKTRWAHFD-QAVYRAAQHCFEQTQLVNELLEDEFQKIFEKN-DRTLSVKLFDRYSYIKQKALLRLWLARLQLAMPSQKQLEQLIRDVIFAKPDAIPQFKLA-NQVIRRYQQKL 309
>gi|58698494|ref|ZP_00373399.1| cell cycle protein MesJ [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534988|gb|EAL59082.1| cell cycle protein MesJ [Wolbachia endosymbiont of Drosophila ananassae] (431 aa)
Score = 148, Expect = 6.0e-08, Identities = 48/183 (26%), Positives = 92/183 (50%)
  Q:     7 IAVSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLK-LFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           +AVSGG DS+ LL+       K +  +     VN+  R +S  +   V  Y K+   K  F+ +  K ++       N+Q   R+ RY    +  +   +K +L+AH K+D  E+  + L +    +    +  KS    + + RPLLN ++  +E+Y +   ++++ D +N+  +Y R + R ++   D +
  S:    23 VAVSGGVDSIVLLHLMTNWAKKNKLSLPTALTVNHGLRPESQKEADFVVSYAKELGAKESFILNWEKQNIK-----GNIQLQARKARYKLLAEWCKNNNVKYLLVAHHKDDQAETFLLRLERGSGVDGLSSMDYKSFLNGIYIFRPLLNFSRSEIEKYAKLHRLKWIEDRSNYDLKYRRTLYRNLLKASDNQ 209
>gi|151572365|gb|EDN38019.1| hypothetical protein FTDG_00820 [Francisella tularensis subsp. novicida GA99-3548] (398 aa)
Score = 148, Expect = 6.3e-08, Identities = 63/242 (26%), Positives = 119/242 (49%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK----MMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFD--INYFLKIKNNYKESLIYLFLNH 247
           +I  SGG DS  LLN  K+  +     ++N++   DS   +   +  C+KYNL+   F +H  D  K     + + W  + R  FF+KI Q+     +L+ H ++D  E+  +   +      L GI    + +   ++RPLL  +K  +E++ +  NI ++ D +N   +Y RN++R     ++ + +    Q            N    KLL  +  + I QD +  I+  +K+ ++ ++SL++L+   
  S:    21 IIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQICQKYNLQ---FISHSLD--KVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPYYKELQHGGVLRPLLKYSKIEIEEFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLTERLQS-ISQDTNLIISELIKLDDDIQKSLLHLWFKQ 265
>gi|88606751|ref|YP_505718.1| tRNA(Ile)-lysidine synthetase [Anaplasma phagocytophilum HZ] >gi|88597814|gb|ABD43284.1| tRNA(Ile)-lysidine synthetase [Anaplasma phagocytophilum HZ] (447 aa)
Score = 148, Expect = 7.5e-08, Identities = 51/180 (28%), Positives = 86/180 (47%)
  Q:     4 KYLIAVSGGPDSM------ALLNKKRHLVEA--VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +Y +AVSGG DSM      AL +K    V +  +  VN+  R ++ N+   V        L+  +   H ++  + K     Q   R IRY    +      +K +L AH KND  E+  + L +    +   GIR +S    + +IRPLL+ T++ +++Y       ++ D +N   +Y R   R  +
  S:     9 QYAVAVSGGVDSMTLMRLVALFHKSSASVGSPTILTVNHGFRPEARNEVSFVHKQATMLGLECHML--HWENPIRKKS----QVVARNIRYQLLLQWCSAHNVKVLLTAHTKNDQAETVLIRLERGSGIDGLAGIRERSVIGDVTIIRPLLDFTRREIQEYAIQHQQPWIEDPSNSDPKYRRTFYRNFI 191
>gi|34558077|ref|NP_907892.1| hypothetical protein WS1770 [Wolinella succinogenes DSM 1740] >gi|61217316|sp|Q7MR31|TILS_WOLSU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|34483795|emb|CAE10792.1| conserved hypothetical protein-Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Wolinella succinogenes] (326 aa)
Score = 147, Expect = 8.3e-08, Identities = 52/179 (29%), Positives = 80/179 (44%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
           K L+  SGG DS AL  L  +R +   +  VNYH R  +  +E   ++   ++  + F        +S     +N +   R  RY FFE +  + G  ++L+AH   D LE   M L +    +  LG   +       LIRPL   TK++L  Y     I +  D +N   +  RN  R +
  S:    17 KNLLGFSGGVDSTALFFLLLEREIPFDIALVNYHQRAQAKEEESYAKELAHRHQKRCFT-------LSCPLGPSNFEHQARLERYRFFESLIHQEGYARLLLAHHLGDRLEWLLMRLAQGSSLSTLLGFSSREIRLGYELIRPLGEITKEALYDYLHQHQIRYFEDESNRDPKPLRNRFRPL 191
>gi|170717655|ref|YP_001784732.1| tRNA(Ile)-lysidine synthetase [Haemophilus somnus 2336] >gi|168825784|gb|ACA31155.1| tRNA(Ile)-lysidine synthetase [Haemophilus somnus 2336] (427 aa)
Score = 147, Expect = 8.8e-08, Identities = 55/177 (31%), Positives = 96/177 (54%)
  Q:     4 KYLIAVSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+  SGG DS  LL+       K+ HL     H+++   +++DN     R  C++ ++    F   K  ++  K I   +   RE RY   + I+  L   +IL+ AH + D  E+  ++L +      LG ++ +S   +L + RPLL+ TK+ LEQY +++ + ++ D +N  +RY RN +R
  S:    19 KLLLGFSGGLDSTVLLSLLAKLRKKQPHLSLRAIHIHHGLSQNADNWAIHCRQICQQLDIS---FLCEKVTINPRKGI---EADAREARY---QAIANHLQDNEILVTAHHQQDQTETFLLALKRGSGLQGLGAMQIQSVVFNLPIFRPLLHCTKQQLEQYAKTEKLSWIEDESNADNRYERNFLR 195
>gi|51894334|ref|YP_077025.1| cell cycle protein [Symbiobacterium thermophilum IAM 14863] >gi|61217236|sp|Q67JG9|TILS_SYMTH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51858023|dbj|BAD42181.1| cell cycle protein [Symbiobacterium thermophilum IAM 14863] (482 aa)
Score = 147, Expect = 8.9e-08, Identities = 50/177 (28%), Positives = 88/177 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + ++AVSGGPDS+AL +    L  A      + H+++  R E S  D   V D  ++ +L L        ++   +   +L+   R  RY    +++  +G ++    H +ND  E+  M L +   +  L GI    +   L +IRPLL  +++ +  YCR+  +   +D TN    + RN +R
  S:    22 RVIVAVSGGPDSLALTHVLYRLAPAWRLSLHLFHLDHGLRGEASRADAAFVADLARELSLPLTTVTLRPGELEAMR--GSLEDNARRRRYAEMARLAAAIGAQRAATGHNRNDQAETVLMRLLRGSGSTGLAGIPPVRREGGLTIIRPLLGASRQEILAYCRAHGLTPRMDATNLQGDFERNRIR 204
>gi|149174369|ref|ZP_01852996.1| hypothetical protein PM8797T_03444 [Planctomyces maris DSM 8797] >gi|148846914|gb|EDL61250.1| hypothetical protein PM8797T_03444 [Planctomyces maris DSM 8797] (354 aa)
Score = 147, Expect = 9.0e-08, Identities = 54/189 (28%), Positives = 96/189 (50%)
  Q:     3 HKYLIAVSGGPDSMALLNKKRHLVEA-----------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFR----SLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
            + LIAVSGG DSMALL   + L ++           + H+N+  R   SD D + ++  C++ +L      T K ++++  D + L+   R  RY F  +++      +I +AH  +D  E+    + +       G+R   + R     L LIRPLL  +++ + ++      E+  D +N    ++RN +R  +    KK F
  S:    38 QRTLIAVSGGADSMALLRALKCLAQSSESLIPPDGLVIAHLNHGLRGTASDEDAEWLKQECRRLSLPCV---TEKQELNQGPD-SGLEEQCRTARYGFLTRVAIAEQCTQIAVAHTLDDQAETVLHHIIRGTG--ITGLRGIPQTRVLQQGLHLIRPLLQISREEVVEFLNVCGQEYRNDESNADTSFTRNRIRHQLLPLLKKEF 236
>gi|57651385|ref|YP_185441.1| hypothetical protein SACOL0553 [Staphylococcus aureus subsp. aureus COL] >gi|87161906|ref|YP_493196.1| hypothetical protein SAUSA300_0487 [Staphylococcus aureus subsp. aureus USA300] >gi|88194269|ref|YP_499061.1| hypothetical protein SAOUHSC_00484 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220683|ref|YP_001331505.1| hypothetical protein NWMN_0471 [Staphylococcus aureus subsp. aureus str. Newman] >gi|161508749|ref|YP_001574408.1| hypothetical protein USA300HOU_0503 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728153|ref|ZP_02760430.1| cell cycle control ATP-binding protein MesJ [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|61216391|sp|Q5HIG6|TILS_STAAC tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|57285571|gb|AAW37665.1| tRNA(Ile)-lysidine synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87127880|gb|ABD22394.1| MesJ/Ycf62 family protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201827|gb|ABD29637.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373483|dbj|BAF66743.1| isoleusyl-tRNA-2-lysl-cytidine synthase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160367558|gb|ABX28529.1| cell cycle control ATP-binding protein MesJ [Staphylococcus aureus subsp. aureus USA300_TCH1516] (431 aa)
Score = 146, Expect = 1.0e-07, Identities = 57/175 (32%), Positives = 93/175 (53%)
  Q:     6 LIAVSGGPDSMALL-----NKKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLES-AYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL     + K    +  C HVN+  R  S  + + +  YC+++++ L +    K D+S   D NN +Q   R  RY++F+++   L    +L AH  +D LE+  Y   N       LG    SK +   + RPLL  +KK ++Q+    +I +  D +N  ++Y RN +R
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEARFLEAYCERHHIDLHI---KKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIR 194
>gi|88857960|ref|ZP_01132602.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Pseudoalteromonas tunicata D2] >gi|88819577|gb|EAR29390.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Pseudoalteromonas tunicata D2] (428 aa)
Score = 146, Expect = 1.1e-07, Identities = 48/174 (27%), Positives = 89/174 (51%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAVCHVN-------YHDREDSDNDEKIVRDYCKKYNLKLFV-FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +A+SGG DS+ LL    HLV     +N        H            +D+C++   +L + F+     + K K+  +L+   RE+RY     ++Q   +  IL+   ++D +E+ ++ L +    +    +   S+F   IL+RPLL  ++ S+E +C+  N+  + D +N   +Y RN +R
  S:    23 VALSGGVDSVVLL----HLVATYQALNPDVKVQAVHVNHGISPHAHAWQDFCQRLCAELTIPFNAISVTIDK-KNRQSLEAVARELRYQALVSVTQVQDV--ILLGQHQDDQVETFFLQLKRGSGLSGLSAMANTSEFEGRILVRPLLETSRASIEAFCQQFNLSHIEDESNSDVKYDRNYLR 198
>gi|85057872|ref|YP_456788.1| cell cycle protein MesJ [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518068|sp|Q2NIN4|TILS_AYWBP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|84789977|gb|ABC65709.1| cell cycle protein MesJ [Aster yellows witches'-broom phytoplasma AYWB] (436 aa)
Score = 146, Expect = 1.2e-07, Identities = 50/184 (27%), Positives = 90/184 (48%)
  Q:     5 YLIAVSGGPDSMALLNK--KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDK 188
           Y+IAVSGG DSMALL+    + +   V H N+    ++  ++++V++YC + +L    F+ +           N Q   R +R     +I+ +     IL AH  +D  E+    ++++   L + G++ ++ +   I ++P L   K  +  Y     I F+ DYTN    Y RN +R  +  + K
  S:    16 YIIAVSGGVDSMALLHYLVAQKIKLQVVHFNHLTNSNTWKNKELVKNYCLQNSLGFHYFELNCPQ-------KNFQAQARLLRQQKLMQIAAKHRTPFILTAHHLDDLAETILQKISRSSTLLGYSGMQIQTSWTDFIFLKPFLYIPKAKIISYAAFYKIPFLEDYTNQKLTYQRNQIRHQVIPYLK 195
>gi|3929907|emb|CAA10333.1| hypothetical protein [Wolinella succinogenes] (210 aa)
Score = 146, Expect = 1.2e-07, Identities = 52/179 (29%), Positives = 80/179 (44%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
           K L+  SGG DS AL  L  +R +   +  VNYH R  +  +E   ++   ++  + F        +S     +N +   R  RY FFE +  + G  ++L+AH   D LE   M L +    +  LG   +       LIRPL   TK++L  Y     I +  D +N   +  RN  R +
  S:    17 KNLLGFSGGVDSTALFFLLLEREIPFDIALVNYHQRAQAKEEESYAKELAHRHQKRCFT-------LSCPLGPSNFEHQARLERYRFFESLIHQEGYARLLLAHHLGDRLEWLLMRLAQGSSLSTLLGFSSREIRLGYELIRPLGEITKEALYDYLHQHQIRYFEDESNRDPKPLRNRFRPL 191
>gi|21282193|ref|NP_645281.1| hypothetical protein MW0464 [Staphylococcus aureus subsp. aureus MW2] >gi|49485373|ref|YP_042594.1| hypothetical protein SAS0466 [Staphylococcus aureus subsp. aureus MSSA476] >gi|61217254|sp|Q6GBX9|TILS_STAAS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217380|sp|Q8NXZ4|TILS_STAAW tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|21203629|dbj|BAB94329.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49243816|emb|CAG42241.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] (431 aa)
Score = 145, Expect = 1.4e-07, Identities = 57/175 (32%), Positives = 93/175 (53%)
  Q:     6 LIAVSGGPDSMALL-----NKKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLES-AYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL     + K    +  C HVN+  R  S  + + +  YC+++++ L +    K D+S   D NN +Q   R  RY++F+++   L    +L AH  +D LE+  Y   N       LG    SK +   + RPLL  +KK ++Q+    +I +  D +N  ++Y RN +R
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEARFLEVYCERHHIDLHI---KKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIR 194
>gi|15923499|ref|NP_371033.1| hypothetical protein SAV0509 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926186|ref|NP_373719.1| hypothetical protein SA0467 [Staphylococcus aureus subsp. aureus N315] >gi|148266968|ref|YP_001245911.1| hypothetical protein SaurJH9_0531 [Staphylococcus aureus subsp. aureus JH9] >gi|150393014|ref|YP_001315689.1| hypothetical protein SaurJH1_0544 [Staphylococcus aureus subsp. aureus JH1] >gi|156978837|ref|YP_001441096.1| hypothetical protein SAHV_0506 [Staphylococcus aureus subsp. aureus Mu3] >gi|61216721|sp|Q99W94|TILS_STAAM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217307|sp|Q7A7A6|TILS_STAAN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|13700399|dbj|BAB41697.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14246277|dbj|BAB56671.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|147740037|gb|ABQ48335.1| tRNA(Ile)-lysidine synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|149945466|gb|ABR51402.1| tRNA(Ile)-lysidine synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|156720972|dbj|BAF77389.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (431 aa)
Score = 145, Expect = 1.5e-07, Identities = 57/175 (32%), Positives = 93/175 (53%)
  Q:     6 LIAVSGGPDSMALL-----NKKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLES-AYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL     + K    +  C HVN+  R  S  + + +  YC+++++ L +    K D+S   D NN +Q   R  RY++F+++   L    +L AH  +D LE+  Y   N       LG    SK +   + RPLL  +KK ++Q+    +I +  D +N  ++Y RN +R
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEARFLEAYCERHHIDLHI---KKLDLSHSLDRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYIRNDIR 194
>gi|145589046|ref|YP_001155643.1| tRNA(Ile)-lysidine synthetase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047452|gb|ABP34079.1| tRNA(Ile)-lysidine synthetase [Polynucleobacter sp. QLW-P1DMWA-1] (442 aa)
Score = 145, Expect = 1.5e-07, Identities = 49/177 (27%), Positives = 93/177 (52%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAVC----------------HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKF----RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +A+SGG DS+ LL       + VC                H+++  ++ +D+         KKY +    FD     +++  D  N++   R  RY+   ++  E GI  +L+AH +ND  E+  + L +      L G+  + +       + L RPLLN+++  LE Y ++  ++++ D +N   ++ RN +RK +
  S:    19 VALSGGLDSVVLL-------DTVCKAQTTYKDSPTEIWAFHIHHGLQKPADDWLIFCEKLAKKYKIG---FDFRLLHLAQDTDQGNVEARARAGRYEALAELCVEYGIGDLLLAHHQNDQAETVLLQLLRGAGVAGLSGMPHERELTHDQSRITLWRPLLNQSRAELEVYAKANKLKWIEDPSNQKTQFRRNAIRKQI 206
>gi|118497835|ref|YP_898885.1| ATPase [Francisella tularensis subsp. novicida U112] >gi|194323808|ref|ZP_03057584.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella tularensis subsp. novicida FTE] >gi|166988059|sp|A0Q7B6|TILS_FRATN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|118423741|gb|ABK90131.1| predicted ATPase of the PP-loop superfamily [Francisella tularensis subsp. novicida U112] >gi|194322172|gb|EDX19654.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella tularensis subsp. novicida FTE] (398 aa)
Score = 145, Expect = 1.6e-07, Identities = 62/242 (25%), Positives = 117/242 (48%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK----MMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFD--INYFLKIKNNYKESLIYLFLNH 247
           +I  SGG DS  LLN  K+  +     ++N++   DS   +   +  C++YNL+   F +H  D  K     + + W  + R  FF+KI Q      +L+ H ++D  E+  +   +      L GI    +     ++RPLL  +K  +E++ +  NI ++ D +N   +Y RN++R     ++ + +    Q            N    KLL  +  + I QD +  I+  +K+ ++ ++SL++L+   
  S:    21 IIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQRYNLQ---FISHSLD--KVPKGESFEAWASKQRMAFFQKIMQPYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKIEIEEFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNIGQTLSRSANICAESNNILQKLLTERLQS-ISQDTNLIISELIKLDDDIQKSLLHLWFKQ 265
>gi|113461077|ref|YP_719145.1| cell-cycle protein [Haemophilus somnus 129PT] >gi|112823120|gb|ABI25209.1| cell-cycle protein [Haemophilus somnus 129PT] (427 aa)
Score = 145, Expect = 1.6e-07, Identities = 54/177 (30%), Positives = 96/177 (54%)
  Q:     4 KYLIAVSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+  SGG DS  LL+       K+ HL     H+++   +++DN     R  C++ ++    F   K  ++  K I   +   RE RY   + I+  L   +IL+ AH + D  E+  ++L +      LG ++ +S   +L + RPLL+ T++ LEQY +++ + ++ D +N  +RY RN +R
  S:    19 KLLLGFSGGLDSTVLLSLLAKLRKKQPHLSLRAIHIHHGLSQNADNWAIHCRQICQQLDIS---FLCEKVTINPRKGI---EADAREARY---QAIANHLQDNEILVTAHHQQDQTETFLLALKRGSGLQGLGAMQIQSVVFNLPIFRPLLHCTRQQLEQYAKTEKLSWIEDESNADNRYDRNFLR 195
>gi|99034626|ref|ZP_01314580.1| hypothetical protein Wendoof_01000607 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (407 aa)
Score = 144, Expect = 1.7e-07, Identities = 48/181 (26%), Positives = 90/181 (49%)
  Q:     9 VSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLK-LFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           VSGG DS+ LL+       K + L+     VN+  R +S  +   V  Y K+   K  F+ +  K ++       N+Q   R+ RY    +  +   +K +L+AH K+D  E+  + L +    +    +  KS    + + RPLLN ++  +E+Y +   ++++ D +N   +Y R + R ++   D +
  S:     1 VSGGVDSVVLLHLMTNWAKKNKLLLPIALTVNHGLRPESQKEADFVVSYAKELGAKESFILNWEKQNIK-----GNIQLQARKARYKLLAEWCKNNNVKYLLVAHHKDDQAETFLLRLERGSGVDGLSSMDYKSFLNGIYIFRPLLNFSRSEIEKYAKLHRLKWIEDRSNHDLKYRRTLYRNLLKSSDNQ 185
>gi|118587144|ref|ZP_01544573.1| cell cycle protein [Oenococcus oeni ATCC BAA-1163] >gi|118432423|gb|EAV39160.1| cell cycle protein [Oenococcus oeni ATCC BAA-1163] (299 aa)
Score = 144, Expect = 2.1e-07, Identities = 52/182 (28%), Positives = 96/182 (52%)
  Q:     2 KHKYLIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK----NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRY-SRNVVRKMM 183
           + K L+A+SGG DS  L         N + HL  A  HV++  R DS N+ K++ D      L +F    H+    +    + ++   R+ RYDF+++++ ++G +KI++A   +D  E+  + + +       +     R   K   + ++RPLLN  K  +  Y    +++++ D TN    Y SRN +R ++
  S:    21 RQKLLLAISGGVDSTVLADLLFKYESNPRSHLFLA--HVDHQLRADSANETKLIDDQFANRGLCVF----HEKWPLEKHPHSGIEDAARKFRYDFYKRMALKVGARKIILAQHADDQAETTLLKIIRGADWQTVSAMEWSRPLEKDSPIEVVRPLLNVEKSEIYDYAEKNHLKWIEDSTNKDPDYTSRNQIRNVV 209
>gi|55820113|ref|YP_138555.1| cell-cycle protein MesJ/Ycf62 family [Streptococcus thermophilus LMG 18311] >gi|55822003|ref|YP_140444.1| cell-cycle protein MesJ/Ycf62 family [Streptococcus thermophilus CNRZ1066] >gi|61217175|sp|Q5M217|TILS_STRT1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217177|sp|Q5M6K9|TILS_STRT2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|55736098|gb|AAV59740.1| putative cell-cycle protein, MesJ/Ycf62 family [Streptococcus thermophilus LMG 18311] >gi|55737988|gb|AAV61629.1| putative cell-cycle protein, MesJ/Ycf62 family [Streptococcus thermophilus CNRZ1066] (421 aa)
Score = 144, Expect = 2.2e-07, Identities = 47/149 (31%), Positives = 77/149 (51%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSL 152
           K L+AVSGG DSM+LL+      K   +   + HVN+  R++S+ +E  +R + K++ +  F +       S        +   R  RYDFF++I +E     ++ AH  +D  E+ +M L +  +   L GI     F +  +IRP L+  K  L
  S:    20 KVLVAVSGGADSMSLLHFLYNHQKDLDIQLGIAHVNHKQRQESEYEENYLRHWAKEHKVP-FHYSAFSGKFS--------ENAARTFRYDFFKRIMKEADYSALVTAHHADDQAETIFMRLLRGSRLRHLSGICDVRSFGTGQIIRPFLHIPKDQL 166
>gi|116626984|ref|YP_819603.1| putative cell-cycle protein, MesJ/Ycf62 family [Streptococcus thermophilus LMD-9] >gi|116100261|gb|ABJ65407.1| tRNA(Ile)-lysidine synthetase, MesJ [Streptococcus thermophilus LMD-9] (421 aa)
Score = 143, Expect = 2.3e-07, Identities = 47/149 (31%), Positives = 77/149 (51%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSL 152
           K L+AVSGG DSM+LL+      K   +   + HVN+  R++S+ +E  +R + K++ +  F +       S        +   R  RYDFF++I +E     ++ AH  +D  E+ +M L +  +   L GI     F +  +IRP L+  K  L
  S:    20 KVLVAVSGGADSMSLLHFLYNHQKDLDIQLGIAHVNHKQRQESEYEENYLRHWAKEHKVP-FHYSAFSGKFS--------ENAARTFRYDFFKRIMKEADYSALVTAHHADDQAETIFMRLLRGSRLRHLSGICDVRSFGTGQIIRPFLHIPKDQL 166
>gi|32474937|ref|NP_867931.1| cell cycle protein homolog mesJ [Rhodopirellula baltica SH 1] >gi|61216595|sp|Q7UNE1|TILS_RHOBA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|32445477|emb|CAD75478.1| cell cycle protein homolog mesJ [Rhodopirellula baltica SH 1] (397 aa)
Score = 143, Expect = 2.3e-07, Identities = 55/175 (31%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMAL--------------LNKKRHLVE------AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILI-RPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+  SGG DS+AL              LN     V        V H N+  R E+S+ DE  VR  C +  L L +      + S      + +   R+IR DFFE+ +++ G + + +AH  +D  E+      +    L L GI   S+  + I++ RPLL   + +L    R     +  D +N    Y+RN +R
  S:    40 LVGCSGGADSVALICLLAELWAEESNGLNPANETVTKPVAPLVVAHCNHGLRGEESNADEAFVRQICDQLQLPLVIHHVPPLNNSATSGPVSDERTLRQIRRDFFERAAKQHGCRYVAVAHSADDQAETMLHHFIRGTGPLGLAGIAEASELDTDIVVRRPLLQVRRDTLRDGLREIGQPWREDASNRHTIYTRNWIR 237
>gi|152991221|ref|YP_001356943.1| tRNA-lysidine synthase [Nitratiruptor sp. SB155-2] >gi|151423082|dbj|BAF70586.1| tRNA-lysidine synthase [Nitratiruptor sp. SB155-2] (329 aa)
Score = 143, Expect = 2.6e-07, Identities = 37/99 (37%), Positives = 53/99 (53%)
  Q:    82 REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           R +RY FF++I Q+ G   +L AHQ ND LE   M L K       +G+   +  +   ++RPLL   K  L+ Y  +K I + ID +N  D Y RN +R
  S:    86 RNVRYQFFDEIIQQEGYHNLLTAHQLNDQLEWFLMQLGKGAGLCELVGMDIVTNRKGYKIVRPLLFVQKSELKSYLETKKIPYYIDESNLQDSYFRNYIR 185
>gi|42521051|ref|NP_966966.1| cell cycle protein MesJ, putative [Wolbachia endosymbiont of Drosophila melanogaster] >gi|61217299|sp|Q73FR9|TILS_WOLPM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|42410792|gb|AAS14900.1| cell cycle protein MesJ, putative [Wolbachia endosymbiont of Drosophila melanogaster] (431 aa)
Score = 143, Expect = 2.6e-07, Identities = 48/183 (26%), Positives = 91/183 (49%)
  Q:     7 IAVSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLK-LFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           +AVSGG DS+ LL+       K +  +     VN+  R +S  +   V  Y K+   K  F+ +  K ++       N+Q   R+ RY    +  +   +K +L+AH K+D  E+  + L +    +    +  KS    + + RPLLN ++  +E+Y +   ++++ D +N   +Y R + R ++   D +
  S:    23 VAVSGGVDSIVLLHLMTNWAKKNKLSLPIALTVNHGLRPESQKEADFVVSYAKELGAKESFILNWEKQNIK-----GNIQLQARKARYKLLAEWCKNNNVKYLLVAHHKDDQAETFLLRLERGSGVDGLSSMDYKSFLNGIDIFRPLLNFSRSEIEKYAKLHRLKWIEDRSNHDLKYRRTLYRNLLKASDNQ 209
>gi|56708293|ref|YP_170189.1| PP-loop family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670764|ref|YP_667321.1| PP-loop family protein [Francisella tularensis subsp. tularensis FSC198] >gi|134301750|ref|YP_001121718.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. tularensis WY96-3418] >gi|123359434|sp|Q14H05|TILS_FRAT1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|166988060|sp|A4IXE6|TILS_FRATW tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61216407|sp|Q5NFK3|TILS_FRATT tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|54113183|gb|AAV29225.1| NT02FT1257 [synthetic construct] >gi|56604785|emb|CAG45864.1| PP-loop family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321097|emb|CAL09247.1| PP-loop family protein [Francisella tularensis subsp. tularensis FSC 198] >gi|134049527|gb|ABO46598.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. tularensis WY96-3418] >gi|151569020|gb|EDN34674.1| hypothetical protein FTBG_00586 [Francisella tularensis subsp. tularensis FSC033] >gi|157122056|gb|EDO66196.1| PP-loop family protein [Francisella tularensis subsp. holarctica FSC022] (398 aa)
Score = 143, Expect = 2.7e-07, Identities = 62/242 (25%), Positives = 117/242 (48%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK----MMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFD--INYFLKIKNNYKESLIYLFLNH 247
           +I  SGG DS  LLN  K+  +     ++N++   DS   +   +  C+KYNL+   F +H  D  K     + + W  + R  FF+KI Q+     +L+ H ++D  E+  +   +      L GI    +     ++RPLL  +K  +E + +  NI ++ D +N   +Y RN++R     ++ + +    Q            N    KLL  +  + I QD +  I+  +K+ ++ +++L++L+   
  S:    21 IIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQKYNLQ---FISHSLD--KVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPHYKELHHGGVLRPLLKYSKIEIEGFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLTERLQS-ISQDTNLIISELIKLDDDIQKNLLHLWFKQ 265
>gi|146338275|ref|YP_001203323.1| tRNA(Ile)-lysidine synthase [Bradyrhizobium sp. ORS278] >gi|146191081|emb|CAL75086.1| tRNA(Ile)-lysidine synthase [Bradyrhizobium sp. ORS278] (367 aa)
Score = 143, Expect = 2.9e-07, Identities = 51/178 (28%), Positives = 86/178 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVCH--------VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKD-DVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS-LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           ++AVSGGPDSMALL       +A+          V++  R ++  +  +V+ + ++  +      +H+    ++ K    +    R  RY    + +++ G   +L AH ++D  E+  M L +    + L        R  L+L RPLL  +K  L    RS  IEF  D TN    Y+R  +R +M
  S:    37 VLAVSGGPDSMALLWLAARWRQALADGPRLVAITVDHGLRPEARREAAMVKRFARQLEV------SHRMLRWTEPKPTTGIPEAARLARYRLLARAARQAGASHVLTAHTRDDQAETVLMRLLRGSGIVGLAAMAPVSARDGLLLARPLLEISKARLVATLRSAGIEFADDPTNHDPAYTRPRLRALM 218
>gi|61216750|sp|Q9RV23|TILS_DEIRA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (582 aa)
Score = 143, Expect = 2.9e-07, Identities = 48/178 (26%), Positives = 86/178 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL--VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           + L+ VSGG DS+ LL     +  + AV H+++  R +S +D   V D C +  +   V       V+  ++ N L+   R +RYD   + ++  G + IL AH + D  E+  M L + +  +     ++ + R     RP LN  +  +E Y R    ++  D +N   R++R  +R+
  S:    40 QVLVGVSGGADSVGLLRALLAVGALPAVAHLDHALRPESVDDAAWVSDLCARLGVPCEVTRIDVGAVAARRNWN-LEA-ARRLRYDVLSRAAKHSGAEVILTAHTRRDQAETVLMELLRGEGRIRGIPPQRGRVR-----RPWLNVGRAEIETYLRGLGQDWREDASNADPRFTRAWLRR 212
>gi|151570919|gb|EDN36573.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. novicida GA99-3549] (398 aa)
Score = 142, Expect = 3.0e-07, Identities = 62/242 (25%), Positives = 118/242 (48%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK----MMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFD--INYFLKIKNNYKESLIYLFLNH 247
           +I  SGG DS  LLN  K+  +     ++N++   DS   +   +  C++YNL+   F +H  D  K     + + W  + R  FF+KI Q      +L+ H ++D  E+  +   +      L GI    + +   ++RPLL  +K  +E++ +  NI ++ D +N   +Y RN++R     ++ + +    Q            N    KLL  +  + I QD +  I+  +K+ ++ ++SL++L+   
  S:    21 IIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQRYNLQ---FISHSLD--KVPKGESFEAWASKQRMAFFQKIMQLYSKPLLLLGHHQDDQAETFLIQAIRGSGLAGLAGIPYYKELQHGGVLRPLLKYSKIEIEEFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLTERLQS-ISQDTNLIISELIKLDDDIQKSLLHLWFKQ 265
>gi|27262508|gb|AAN87535.1| cell cycle protein MesJ [Heliobacillus mobilis] (308 aa)
Score = 142, Expect = 3.2e-07, Identities = 49/179 (27%), Positives = 91/179 (50%)
  Q:     2 KHKYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYRE----------IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF--RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + +IA+SGG DS+ LL      + +  +  A  H N+  R ++SD D   V +   +  + LF+            +   L+ W +E          +RYDF  + +++ G + I +AH  +D  E+    + +       GI+  S    +    +RPLL   +K LE++ +++   +  D +N  D Y+RN +R
  S:    21 RERIVIALSGGADSVCLLLLFKKVSPQFGIELAAAHYNHGMRGKESDEDAAFVAELTNRLQVPLFL------------ETAPLKWWQQEPGTKMEAARRLRYDFLSRSAEQAGARWIALAHHADDMAETVLFHMLRGS-----GIKGLSGIPAKRGPFVRPLLPFRRKELEEFLKAEGQHWRHDSSNDSDVYTRNRIR 201
>gi|22299159|ref|NP_682406.1| hypothetical protein tlr1616 [Thermosynechococcus elongatus BP-1] >gi|61217355|sp|Q8DIH2|TILS_SYNEL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|22295341|dbj|BAC09168.1| ycf62 [Thermosynechococcus elongatus BP-1] (344 aa)
Score = 142, Expect = 3.2e-07, Identities = 49/188 (26%), Positives = 89/188 (47%)
  Q:     4 KYLIAVSGGPDSMAL----LNKKRHLVEAVC--HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSK-FRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           + LIA+SGG DS+ L    L+ + H   ++   H ++  R DS  +   V+   +K++L          +V    D+   +   R  RY  FE +++ L    ++ AH ++D  ES  + L +      L     S+   ++ L+RPLL  T+     +C++  +    D TN    Y RN +R  +  + ++ F
  S:    24 RILIALSGGQDSVCLTRLLLDLQPHWQWSLVAVHCDHRWRADSTANANFVQQLAQKWHLPC--------EVVSAPDLPKTEAAARSWRYQVFESVAKALDCTHVVTAHTQSDRAESLLLHLLRGTSPDGLATLLPSRSLGAIQLVRPLLGMTRAQTAAFCQAYGLPIWQDETNHNLEYRRNRLRLELIPYLQQHF 210
>gi|15595133|ref|NP_212922.1| hypothetical protein BB0788 [Borrelia burgdorferi B31] >gi|167932761|ref|ZP_02519848.1| hypothetical protein Bbur1_07051 [Borrelia burgdorferi 156a] >gi|167933978|ref|ZP_02521053.1| hypothetical protein BburZ_04001 [Borrelia burgdorferi ZS7] >gi|167944298|ref|ZP_02531372.1| hypothetical protein BburB_03837 [Borrelia burgdorferi Bol26] >gi|168692639|ref|ZP_02725431.1| hypothetical protein Bbur9_04030 [Borrelia burgdorferi 94a] >gi|195952011|ref|ZP_03093108.1| hypothetical protein Bbur2_06999 [Borrelia burgdorferi 29805] >gi|195960747|ref|ZP_03096952.1| hypothetical protein Bbur6_04035 [Borrelia burgdorferi 64b] >gi|6136576|sp|O51728|TILS_BORBU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|2688713|gb|AAC67121.1| conserved hypothetical protein [Borrelia burgdorferi B31] (440 aa)
Score = 142, Expect = 3.7e-07, Identities = 59/193 (30%), Positives = 98/193 (50%)
  Q:     2 KHKYLIAVSGGPDSMALL-NKKRHLVEAVC--HVNYHDREDSDNDEKI--VRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           K++ ++A SGG DS ALL N K +L   V   +  +  R D++ +++I  V+ +C  YN+ L +     D  S+   +  +++   R+ RY   E   +E G   I +AH +ND +E+  M   +     FL         +  +IRPLL  ++  +E +    NI F +D TN  + Y RN VR  +    KK F+ +
  S:    23 KNRVIVAFSGGADSTALLLNLKYYLSNNVIAFYFAHFIRSDNEQNQEIEHVKGFCDLYNIALQIKKCDIDIKSESARLGVSIEELARKFRYIALENALKENGANYIALAHNENDQIETIIMRFFQGS---FLDGLSGIPSVNRNIIRPLLEVSRLEIENFLSLNNIGFFVDSTNAQNLYLRNRVRNNLLPAIKKVFKGY 218
>gi|61216758|sp|Q9ZGE2|TILS_HELMO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|3820563|gb|AAC84036.1| cell cycle protein MesJ [Heliobacillus mobilis] (470 aa)
Score = 141, Expect = 4.1e-07, Identities = 49/179 (27%), Positives = 91/179 (50%)
  Q:     2 KHKYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYRE----------IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF--RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + +IA+SGG DS+ LL      + +  +  A  H N+  R ++SD D   V +   +  + LF+            +   L+ W +E          +RYDF  + +++ G + I +AH  +D  E+    + +       GI+  S    +    +RPLL   +K LE++ +++   +  D +N  D Y+RN +R
  S:    21 RERIVIALSGGADSVCLLLLFKKVSPQFGIELAAAHYNHGMRGKESDEDAAFVAELTNRLQVPLFL------------ETAPLKWWQQEPGTKMEAARRLRYDFLSRSAEQAGARWIALAHHADDMAETVLFHMLRGS-----GIKGLSGIPAKRGPFVRPLLPFRRKELEEFLKAEGQHWRHDSSNDSDVYTRNRIR 201
>gi|139472899|ref|YP_001127614.1| PP-loop family protein [Streptococcus pyogenes str. Manfredo] >gi|134271145|emb|CAM29355.1| PP-loop family protein [Streptococcus pyogenes str. Manfredo] (428 aa)
Score = 141, Expect = 4.2e-07, Identities = 76/280 (27%), Positives = 129/280 (46%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +  +L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRYLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGY---YYLKKDYYIFI 291
>gi|71281989|ref|YP_268314.1| tRNA(Ile)-lysidine synthetase [Colwellia psychrerythraea 34H] >gi|71147729|gb|AAZ28202.1| tRNA(Ile)-lysidine synthetase [Colwellia psychrerythraea 34H] (462 aa)
Score = 141, Expect = 4.9e-07, Identities = 45/176 (25%), Positives = 89/176 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE--------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           ++A SGG DS  LL+    L +         VCHVN+    +++  +K+    C K ++ L V    K    + K   +L+   R+ RY+  + + ++  +  +L  H  +D  E+  ++L +      L  +  +++    +L+RPLLN  ++ +E Y  +  + +V D +N    + RN +R+
  S:    25 IVAYSGGIDSQVLLHALVQLKQNKIINNEITVCHVNHGLSGNAERWQKLAEQECIKLSVNLIV----KRVNVRSKAQQSLEALARDARYNALKSLREKKSV--VLTGHHSDDQSETFLLALKRGAGLKGLSAMSVQTQLDQHLLVRPLLNVARQEIENYAENHQLSWVEDESNLDTCFDRNFIRQ 203
>gi|24378543|ref|NP_720498.1| putative cell-cycle protein [Streptococcus mutans UA159] >gi|61217358|sp|Q8DWM9|TILS_STRMU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|24376391|gb|AAN57804.1|AE014853_11 putative cell-cycle protein [Streptococcus mutans UA159] (423 aa)
Score = 140, Expect = 5.3e-07, Identities = 59/178 (33%), Positives = 93/178 (52%)
  Q:     3 HKYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  LIAVSGG DSM LL+      KK  +  AV HVN+  R  +D +E  ++++ +  ++  +         + +K I + +   R+ RY FF+ I +E G   ++ AH  ND  E+ ++ L +  +  +L GI+   +F +  LIRP L   KK L       NI    D +N  D Y RN +R
  S:    20 YNILIAVSGGVDSMNLLHFLHIYQKKLQIRIAVAHVNHKQRPQADEEEIYLKNWARDNHIPFYT--------AVFKGIFS-EKKARDFRYTFFKNIMKEHGYTALVTAHHANDQAETVFLRLLRGSRLRYLTGIKEIQEFGNGQLIRPFLKFHKKEL------PNIFHFDDDSNQGDSYLRNRIR 189
>gi|15645348|ref|NP_207522.1| hypothetical protein HP0728 [Helicobacter pylori 26695] >gi|61216365|sp|O25428|TILS_HELPY tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|2313855|gb|AAD07779.1| conserved hypothetical protein [Helicobacter pylori 26695] (336 aa)
Score = 140, Expect = 5.4e-07, Identities = 57/191 (29%), Positives = 95/191 (49%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK-----MMAEWDKKTFQKF 194
           K L+  SGG DS  L  L    ++V  +  V+Y+ ++      +  +   K ++ K ++    K         +N +   R+IRYDFFE + +E   K +++AH  ND LE   M L+K    N  L  +   K  S  ++RPLL   K +L+    +K+++F  D +N   ++ RN  RK     +M ++ K   Q F
  S:    15 KNLLGFSGGLDSTCLFFLLVGENIVFDIALVDYNTQKQRLEIIQHAQKLAKTHHKKCYIHHAPKI-------AHNFEMQARKIRYDFFETLIKEHSYKHLILAHHLNDRLEWFLMQLSKGAGLNTLLSFQAYEKRESYAIVRPLLYTPKDTLKTL--AKDLKFFEDDSNSSLKFKRNCFRKNYANSLMQDYSKGIIQSF 204
>gi|83644690|ref|YP_433125.1| ATPase [Hahella chejuensis KCTC 2396] >gi|83632733|gb|ABC28700.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Hahella chejuensis KCTC 2396] (445 aa)
Score = 140, Expect = 5.7e-07, Identities = 57/183 (31%), Positives = 87/183 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL------VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRN-----VVRKMMAEW 186
           +  IA SGG DS  LL+  R        +EA+ HV++    ++D   +  +  C+  ++       H   VS     ++L+   RE RY  FE+   E     +L  H +ND  E+    L K    K L  GI R+      IL RPLL+ T+  LE   +   + +V D +N    + RN     ++R M A W
  S:    30 RLFIAYSGGLDSSVLLHAARRAWPAKTQIEAI-HVHHGLSPNADAWAEHCQKECQSLDVA-----CHAHHVSVMAVGDSLEAAAREARYRVFERYLSEHADAVLLQGHHQNDQAETILFRLLKGHGVKGL-AGIPRQRTLGKGILRRPLLDFTRLELEALAQRWGLSWVEDESNVDAVFDRNFLRNEILRPMSARW 218
>gi|49482736|ref|YP_039960.1| hypothetical protein SAR0510 [Staphylococcus aureus subsp. aureus MRSA252] >gi|61217256|sp|Q6GJG2|TILS_STAAR tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|49240865|emb|CAG39532.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (431 aa)
Score = 140, Expect = 6.0e-07, Identities = 56/175 (32%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALL-----NKKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLES-AYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL     + K    +  C HVN+  R  S  + + +  YC+++++ L +    K D+S   + NN +Q   R  RY++F+++   L    +L AH  +D LE+  Y   N       LG    SK     + RPLL  +KK ++Q+    +I +  D +N  ++Y RN +R
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEARFLEAYCERHHIDLHI---KKLDLSHSLNRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRNGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIR 194
>gi|126737230|ref|ZP_01752965.1| PP-loop family protein [Roseobacter sp. SK209-2-6] >gi|126721815|gb|EBA18518.1| PP-loop family protein [Roseobacter sp. SK209-2-6] (418 aa)
Score = 140, Expect = 6.0e-07, Identities = 47/177 (26%), Positives = 88/177 (49%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA----------VCHVNYHDREDSDNDEKIVRDYCKKYNLK--LFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNK-NKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +AVSGG DS+ALL    HL+++             V++  R++S  + K   +  +   L+  + +++   ++        NLQ   R  RY      ++  GI  + + H  +D  E+  M L++    N   GI ++     + L+RPLL   +++L  Y R +  +++ D +N   R+ R   RK +
  S:    26 VAVSGGGDSLALL----HLLKSCFDGEPVEILAATVDHGLRKESAEEAKWTAEVARGLGLRHEVLIWEDGPEETG------NLQEQARHARYSLLTNWARRNGIPILTLGHTADDQAETVLMRLSRAGGVNGLAGIPQRRTLNGVTLLRPLLEVRREALRSYLRDEGHDWIDDPSNDDSRFERVRFRKAL 205
>gi|42523405|ref|NP_968785.1| putative cell cycle protein [Bdellovibrio bacteriovorus HD100] >gi|61216531|sp|Q6MLS8|TILS_BDEBA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39575611|emb|CAE79778.1| putative cell cycle protein [Bdellovibrio bacteriovorus HD100] (316 aa)
Score = 140, Expect = 6.1e-07, Identities = 56/185 (30%), Positives = 94/185 (50%)
  Q:     4 KYLIAVSGGPDSMALLNK--KRHLVEAVCHVNYHDREDSDND-EKIVRDYCKKYNLKLFV--FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI--LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDK 188
           K L+A+SGG DS+ALL    K H    +    +H  EDS+ +  K  +++C+K   KL +  +      ++K       +  YRE+RY+  +++ +E G + +   H ++D LE+  + L +       G +  +    L   L RPLL  +KK L++Y R + +    D TN      RN +R+   EW K
  S:    27 KILVALSGGTDSVALLRSLTKVHKKNLLGACYFHHGEDSNQEYRKEAQEFCEKLCKKLEIEFYPLRASQLAKS------EAEYRELRYEALDRLKKEQGFELVATGHHRDDLLETRLIRLIRGT-----GAQGFAAMHVLRDGLFRPLLEISKKELKKYLREERLRSFEDPTNKALDPLRNWLRE---EWLK 204
>gi|19745210|ref|NP_606346.1| putative cell-cycle protein [Streptococcus pyogenes MGAS8232] >gi|61217382|sp|Q8P322|TILS_STRP8 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|19747299|gb|AAL96845.1| putative cell-cycle protein [Streptococcus pyogenes MGAS8232] (428 aa)
Score = 140, Expect = 6.2e-07, Identities = 76/280 (27%), Positives = 129/280 (46%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +  +L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRYLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQIAKQGY---YYLKKDYYIFI 291
>gi|159899546|ref|YP_001545793.1| tRNA(Ile)-lysidine synthetase [Herpetosiphon aurantiacus ATCC 23779] >gi|159892585|gb|ABX05665.1| tRNA(Ile)-lysidine synthetase [Herpetosiphon aurantiacus ATCC 23779] (486 aa)
Score = 140, Expect = 6.4e-07, Identities = 52/184 (28%), Positives = 93/184 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMS-LNKNKKNLFLGIRRKSKFRSL-------------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK----MMAEWDKK 189
           ++AVSGGPDS+ALL++   L         V H+++  R E S  +   V +    + L   +     D V+K   +  L    R  RY F  +++ +     +++ HQ +D  E+  +  L     +    +R ++++                 LIRP+LN T+  +E YC  + +E   D TN    Y+R  +R     ++ E++ K
  S:    24 VVAVSGGPDSLALLHRLTALATPYGWRLHVAHLDHGLRGEQSAAEAAFVAEIAADWGLTATIELRDVDQVAKQYHV-GLPAAARATRYRFLAEVALQQQADAVVLGHQSDDQAETVLLHVLRGTGPSGLSAMRPRTEWVGWRVTAGMPHQAVGPALIRPMLNITRDEIEAYCDEQQLEPRRDPTNNSLEYTRGRIRHQLLPLLGEYNAK 231
>gi|82750216|ref|YP_415957.1| hypothetical protein SAB0458 [Staphylococcus aureus RF122] >gi|82655747|emb|CAI80146.1| conserved hypothetical protein [Staphylococcus aureus RF122] (431 aa)
Score = 139, Expect = 7.1e-07, Identities = 56/175 (32%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALL-----NKKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLES-AYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVS G DSM LL     + K    +  C HVN+  R  S  + + +  YC+ +++ L +    K D+S   + NN +Q   R  RY++F+++   L    +L AH  +D LE+  Y   N       LG    SK +   + RPLL  +KK ++Q+    +I +  D +N  ++Y RN +R
  S:    15 VVAVSTGIDSMCLLYQLLNDYKDSYRKLTCLHVNHGVRSASIEEARFLEAYCEGHHIDLHI---KKLDLSHSLNRNNSIQNEARIKRYEWFDEMMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSKKEIKQFQERYHIPYFEDESNKDNKYVRNDIR 194
>gi|139439222|ref|ZP_01772664.1| Hypothetical protein COLAER_01678 [Collinsella aerofaciens ATCC 25986] >gi|133775246|gb|EBA39066.1| Hypothetical protein COLAER_01678 [Collinsella aerofaciens ATCC 25986] (512 aa)
Score = 139, Expect = 7.2e-07, Identities = 61/175 (34%), Positives = 89/175 (50%)
  Q:     6 LIAVSGGPDSMALL----NKKRHLVEA------------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIK--------KILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ VSGG DS ALL      K  + +             V HVN+H R + SD DE  VR+ C +Y L L V   + D  S      N++   RE+RY    +  +EL  +        +I  AH  +D  E+  M  N  K +   G+    + R+ I++RPLL+ T   L  Y +     +  D +N    Y RN VR
  S:    30 VLMVSGGADSTALLLMACTSKLDIQDGRGVAPIARERLHVLHVNHHLRGKASDGDEAFVRELCAQYGLPLCVEHAYFDGES-----GNIEAAAREVRYAAARRYVRELCAQTGAPRTAARICTAHTSSDRAETFLM--NAIKGSGPAGLSSIPRRRN-IVVRPLLDLTHGELVGYLQVHGQPWREDESNEDISYLRNYVR 221
>gi|58584411|ref|YP_197984.1| ATPase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418727|gb|AAW70742.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control, MesJ [Wolbachia endosymbiont strain TRS of Brugia malayi] (431 aa)
Score = 139, Expect = 7.9e-07, Identities = 47/181 (25%), Positives = 95/181 (52%)
  Q:     3 HKYLIAVSGGPDSMALLN------KKRHLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKL-FVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +K  +AVSGG DS+ LL+      +KR     +   VN+  R +S  + + V  Y K+  +K  F+ +  + ++       N+Q+  R+ RY+   +  +   +K + IAH K+D  E+  + L +    +    +  KS    + ++RPLL+ ++  +++Y     +++V D +N   +Y R + R ++
  S:    19 NKVAVAVSGGIDSIVLLHLITSWAEKRQCPPPIALAVNHGLRPESQEEVEFVVSYAKELGVKKSFILNWKRQNIK-----GNVQSQARKARYELLTEWCKNNDVKHLFIAHHKDDQAETFLLRLERGSGLDGLSSMDYKSSLNGVCMLRPLLSFSRSRIKKYADFYRLKWVEDRSNQSLKYKRTLYRNLL 203
>gi|15899960|ref|NP_344564.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae TIGR4] >gi|111658620|ref|ZP_01409270.1| hypothetical protein SpneT_02000210 [Streptococcus pneumoniae TIGR4] >gi|61217410|sp|Q97TC5|TILS_STRPN tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|14971475|gb|AAK74204.1| tRNA(Ile)-lysidine synthetase [Streptococcus pneumoniae TIGR4] (425 aa)
Score = 139, Expect = 8.1e-07, Identities = 51/177 (28%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+ +M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETIFMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|42518368|ref|NP_964298.1| hypothetical protein LJ0281 [Lactobacillus johnsonii NCC 533] >gi|61216579|sp|Q74LA3|TILS_LACJO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|41582653|gb|AAS08264.1| hypothetical protein LJ_0281 [Lactobacillus johnsonii NCC 533] (431 aa)
Score = 139, Expect = 8.4e-07, Identities = 52/186 (27%), Positives = 94/186 (50%)
  Q:     4 KYLIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           K+L+A SGGPDS+ALL        N    L+  V H+++  R+DS  + ++++       +KL      K    +      ++   RE RY F  K+ ++     +L AH  +D +E+  +   ++     +  ++      S+ L+RPL+  +K  L +Y +  +++F+ D TNF D   RN +R  +    KK
  S:    19 KFLLAASGGPDSVALLKMLVNFLPNPSEQLI--VAHLDHCLRDDSFLESQLLQRLTSALKVKL----VEKKWPVELHPQAGVEAKAREYRYAFLAKVGRKYQTDYLLTAHHGDDLIENILLKFIRSGDVAEMNSLQIVGNLGSMKLLRPLVKYSKDELLKYDKDHHLDFIEDKTNFEDDTLRNRLRHHVVPLLKK 207
>gi|89256102|ref|YP_513464.1| PP-loop family protein [Francisella tularensis subsp. holarctica] >gi|115314576|ref|YP_763299.1| PP-loop superfamily ATPase [Francisella tularensis subsp. holarctica OSU18] >gi|156502120|ref|YP_001428185.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010788|ref|ZP_02275719.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Francisella tularensis subsp. holarctica FSC200] >gi|122325399|sp|Q0BMM2|TILS_FRATO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|122500940|sp|Q2A488|TILS_FRATH tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|166988058|sp|A7NB76|TILS_FRATF tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|89143933|emb|CAJ79152.1| PP-loop family protein [Francisella tularensis subsp. holarctica LVS] >gi|115129475|gb|ABI82662.1| probable PP-loop superfamily ATPase [Francisella tularensis subsp. holarctica OSU18] >gi|156252723|gb|ABU61229.1| tRNA(Ile)-lysidine synthase [Francisella tularensis subsp. holarctica FTNF002-00] (398 aa)
Score = 138, Expect = 9.0e-07, Identities = 61/242 (25%), Positives = 118/242 (48%)
  Q:     6 LIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI---LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK----MMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFD--INYFLKIKNNYKESLIYLFLNH 247
           +I  SGG DS  LLN  K+  +     ++N++   DS   +   +  C+KYNL+   F +H  D  K     + + W  + R  FF+KI Q+     +L+ H ++D  E+  +   +       G+     ++ L    ++RPLL  +K  +E + +  NI ++ D +N   +Y RN++R     ++ + +    Q            N    KLL  +  + I QD +  I+  +K+ ++ +++L++L+   
  S:    21 IIGYSGGVDSSVLLNISKELDIPLIAIYINHNLHRDSLKWQIHCQQTCQKYNLQ---FISHSLD--KVPKGESFEAWASKQRMAFFQKIMQQYSKPLLLLGHHQDDQAETFLIQAIRGSG--LAGLASIPHYKELHHGGVLRPLLKYSKIDIEGFAKLNNISYIYDDSNEDIKYRRNLIRNQIIPILQQVNPNISQTLSRSANICAESNNILQKLLTERLQS-ISQDTNLIISELIKLDDDIQKNLLHLWFKQ 265
>gi|9294051|dbj|BAB02008.1| unnamed protein product [Arabidopsis thaliana] (614 aa)
Score = 138, Expect = 9.0e-07, Identities = 53/189 (28%), Positives = 100/189 (52%)
  Q:     4 KYLIAVSGGPDSMAL--------------LNKKRHLVEAVCH--VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK----------------KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           K  + VSGGPDSMAL              +NK    ++ +    V++  R++S ++ ++V     +  ++  +     D V     + +LQ   RE+RY+    +     I+ +LIAH  +D  E   + L+++                 +NL L  +   K +S+ L+RPLL+  K+ + + C+    ++V D TN    + RN +R  +   +  +F+
  S:    56 KRALGVSGGPDSMALCVLTAKWKTEGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC--DWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDAKHM-KNQSIRLVRPLLDLWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGNLESGSFK 273
>gi|15902054|ref|NP_357604.1| hypothetical protein spr0010 [Streptococcus pneumoniae R6] >gi|116516781|ref|YP_815434.1| tRNA(Ile)-lysidine synthetase [Streptococcus pneumoniae D39] >gi|122279568|sp|Q04N53|TILS_STRP2 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|61217356|sp|Q8DRP9|TILS_STRR6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15457538|gb|AAK98814.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077357|gb|ABJ55077.1| tRNA(Ile)-lysidine synthetase [Streptococcus pneumoniae D39] (425 aa)
Score = 138, Expect = 9.3e-07, Identities = 51/177 (28%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+ +M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETIFMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|33241260|ref|NP_876202.1| ATPase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|61216600|sp|Q7V9L9|TILS_PROMA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|33238790|gb|AAQ00855.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Prochlorococcus marinus subsp. marinus str. CCMP1375] (336 aa)
Score = 138, Expect = 9.4e-07, Identities = 54/175 (30%), Positives = 84/175 (48%)
  Q:     6 LIAVSGGPDSMALLN---KKRHLVEAVCHVNYHDREDSDNDEKI---VRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF--RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           LI+VSGG DSMALL      + + E   HV + D    +   +I   + ++CK   L  F   T+K  VS  +D  N +      +     K S  L  +++L  H  ND  E+  M+L +      L   R+ +     + LIRP+L  +++   Q C   ++   ID +N    YSRN +R
  S:    36 LISVSGGQDSMALLKLILDLQRIYEWKVHVWHGDHGWHNQSRQIAEELEEWCKCQKLSFFCNRTNKQKVSTEEDARNWRYKSLIQQAKTLSKESPSLPCERVLTGHTANDRTETFIMNLARGAHLKGLSSLREDRTLETKIQLIRPILRFSRQETIQICDEMDLPIWIDPSNSNIAYSRNKIR 218
>gi|153812536|ref|ZP_01965204.1| hypothetical protein RUMOBE_02935 [Ruminococcus obeum ATCC 29174] >gi|149831461|gb|EDM86549.1| hypothetical protein RUMOBE_02935 [Ruminococcus obeum ATCC 29174] (471 aa)
Score = 138, Expect = 9.5e-07, Identities = 50/176 (28%), Positives = 92/176 (52%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIK-----KILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           ++ VSGGPDSM +L+    L +       V HVN+  R +++  D+++V   C ++ +   V++     ++    +   +   R++R   FEK  +E  +      ++ +AH +ND  E+    L +       GIR     + L   +IRPLL   +  +  Y    +I+ V+D +N  D Y+RN +R+
  S:    26 ILGVSGGPDSMTMLHILNGLRDEFGYRLRVVHVNHGIRGKEALRDQQMVEKICSEWKIPCAVYNYDVPALALSWKMGTEEAG-RKVRRIAFEK-EKENAVAIPEQVRVALAHNQNDMAETMLHHLARGT-----GIRGLCSLKPLNGEIIRPLLCLERSEIVNYVEENSIQTVLDSSNMEDDYTRNRIRR 208
>gi|28894923|ref|NP_801273.1| putative cell cycle protein [Streptococcus pyogenes SSI-1] >gi|71902678|ref|YP_279481.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS6180] >gi|61217343|sp|Q879R7|TILS_STRP3 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|28810168|dbj|BAC63106.1| putative cell cycle protein [Streptococcus pyogenes SSI-1] >gi|71801773|gb|AAX71126.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS6180] (428 aa)
Score = 138, Expect = 9.5e-07, Identities = 76/280 (27%), Positives = 128/280 (45%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +   L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGY---YYLKKDYYIFI 291
>gi|73749106|ref|YP_308345.1| PP-loop family protein [Dehalococcoides sp. CBDB1] >gi|123620029|sp|Q3ZYX5|TILS_DEHSC tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|73660822|emb|CAI83429.1| PP-loop family protein [Dehalococcoides sp. CBDB1] (471 aa)
Score = 138, Expect = 1.0e-06, Identities = 53/175 (30%), Positives = 84/175 (48%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS------LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGGPDS+ +L      +++      + H+N+  R E+SD D   V +      L L      K  V  Y+  +  +L+   RE+RY F  + + E G   + + H  +D +E+  + L +      L   R    R+      L +IRPLL   +   + YCR   +    D TN      RN +R
  S:    23 LLAVSGGPDSVCMLYIMHKLSREMGFSLRLAHLNHGLRAEESDRDAAYVTELASALGLPLC---QQKVSVKAYQAEHHLSLEEAAREMRYAFLCRTAAEFGSAAVAVGHTLDDNIETVMLHLVRGSGTRGLQGLRPVLNRTIAGAGCLRVIRPLLCLGRAETQVYCREAGLLPRQDITNLSTEPLRNRIR 209
>gi|78777932|ref|YP_394247.1| tRNA(Ile)-lysidine synthetase-like [Sulfurimonas denitrificans DSM 1251] >gi|78498472|gb|ABB45012.1| tRNA(Ile)-lysidine synthetase-like protein [Sulfurimonas denitrificans DSM 1251] (329 aa)
Score = 138, Expect = 1.0e-06, Identities = 53/177 (29%), Positives = 80/177 (45%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+A SGG DS AL  L  +  +   +  VNY  RE S ++    ++     N+   +++  K +        N +   REIRY+FF K+S E   + +L AH   D  E   M   K        G++   K  S  +IRPLL+  K+ L +Y       +  D +N  +   RN  R
  S:    14 KNLLAFSGGADSSALFFLLTQESIPFDIAIVNYGIREQSRDEVAYAKELSAANNITCHIYNAPKIE-------QNFEAKAREIRYEFFSKLSLENSYENLLTAHHLGDRFEWFLMQFCKGAGCAEIAGMQSVQKRGSYTIIRPLLHLEKRELIEYLHRIKARYFEDESNLDESIKRNYFR 186
>gi|56808856|ref|ZP_00366567.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Streptococcus pyogenes M49 591] (428 aa)
Score = 137, Expect = 1.1e-06, Identities = 76/280 (27%), Positives = 128/280 (45%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +   L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLTIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGY---YYLKKDYYIFI 291
>gi|90020884|ref|YP_526711.1| GntR family transcriptional regulator [Saccharophagus degradans 2-40] >gi|89950484|gb|ABD80499.1| transcriptional regulator, GntR family [Saccharophagus degradans 2-40] (429 aa)
Score = 137, Expect = 1.1e-06, Identities = 51/180 (28%), Positives = 90/180 (50%)
  Q:     7 IAVSGGPDSMALLNK------KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-----KMMAEW 186
           +A SGG DS  LL+       K H V    HVN+    ++DN ++    +  +  +    F   K  VS   +   ++   R  RY+  E +     +  +L  H ++D +E+ ++ L +      LG +RR       IL+RPLLN +++SL +Y   + + ++ D +N    Y RN++R     ++ A W
  S:    23 VAFSGGLDSTVLLHALSVLGVKCHAV----HVNHGLSINADNWQRQCSVFASQREI---AFTAVKVIVSA--EGRGIEEAARVARYNAIENLLAPSDV--LLTGHHRDDQIETFFLRLMRGAGLRGLGAMRRTRSLSQAILVRPLLNISRQSLHEYALQQGLTWIEDESNLDTHYDRNLLRQTFVPQLKARW 203
>gi|15674260|ref|NP_268433.1| putative cell-cycle protein [Streptococcus pyogenes M1 GAS] >gi|71909825|ref|YP_281375.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS5005] >gi|94989520|ref|YP_597620.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10270] >gi|94993407|ref|YP_601505.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10750] >gi|61217414|sp|Q9A201|TILS_STRP1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|13621335|gb|AAK33155.1| putative cell-cycle protein [Streptococcus pyogenes M1 GAS] >gi|71852607|gb|AAZ50630.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS5005] >gi|94543028|gb|ABF33076.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10270] >gi|94546915|gb|ABF36961.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS10750] (428 aa)
Score = 137, Expect = 1.1e-06, Identities = 76/280 (27%), Positives = 128/280 (45%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +   L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGY---YYLKKDYYIFI 291
>gi|94987642|ref|YP_595743.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS9429] >gi|94991508|ref|YP_599607.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS2096] >gi|94541150|gb|ABF31199.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS9429] >gi|94545016|gb|ABF35063.1| tRNA(Ile)-lysidine synthetase TilS [Streptococcus pyogenes MGAS2096] (428 aa)
Score = 137, Expect = 1.2e-06, Identities = 74/280 (26%), Positives = 130/280 (46%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +   L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+      D+  F +   + +  L+  +L     +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTT--DLTEFNEQSKSIQHFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGY---YYLKKDYYIFI 291
>gi|116628949|ref|YP_814121.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus gasseri ATCC 33323] >gi|116094531|gb|ABJ59683.1| tRNA(Ile)-lysidine synthetase, MesJ [Lactobacillus gasseri ATCC 33323] (431 aa)
Score = 137, Expect = 1.2e-06, Identities = 49/186 (26%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           K+L+A SGGPDS+AL         N  + L+  V H+++  R+DS  + ++++     + +KL      K           ++   RE RY F     ++  +  +L AH  +D +E+  +   ++     +  ++      S+ L+RPL+  +K  L +Y +   ++++ D TNF D   RN +R  +    KK
  S:    19 KFLLAASGGPDSVALFHMLVNFLPNPSKQLI--VAHLDHCLRKDSYLESELLQKLTTAFKIKLI----EKSWPVALHPQTGIEAKAREFRYAFLAHTGKKYQVDYLLTAHHGDDLIENILLKFIRSGDVAEMNSLQIVGNLDSMRLLRPLIKYSKDQLLEYDKRNGLDYIEDETNFEDDTLRNRLRHYVVPLLKK 207
>gi|86142944|ref|ZP_01061366.1| putative cell-cycle protein [Flavobacterium sp. MED217] >gi|85830389|gb|EAQ48848.1| putative cell-cycle protein [Leeuwenhoekiella blandensis MED217] (436 aa)
Score = 137, Expect = 1.3e-06, Identities = 49/180 (27%), Positives = 97/180 (53%)
  Q:     1 MKHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  ++L+AVSGG DS+ L  L  +  +   + H N++ R ++SD D   V    +K ++K  + +   +  ++ + ++ +Q   RE+RY +FE++ Q   +  +  AH   D LE+  ++L++    N   GI  ++      L+RPLL  +++ +  Y  +  + +  D +N  D+Y RN +R
  S:    17 LNARFLLAVSGGLDSVVLAHLFSECKIDFEIAHCNFNLRGKESDADAVFVEKLAEKLHVKFHLQNFDTEAYAQDQKVS-IQMAARELRYHWFEELCQLHHLPFLATAHHAKDDLETFLINLSRGSGLNGLTGITAENDR----LVRPLLPFSREEILTYAEANTLAWREDSSNASDKYLRNHLR 195
>gi|42572523|ref|NP_974357.1| RSY3 (RASPBERRY 3); ATP binding / ligase, forming carbon-nitrogen bonds / nucleotide binding [Arabidopsis thaliana] (660 aa)
Score = 137, Expect = 1.3e-06, Identities = 52/186 (27%), Positives = 99/186 (53%)
  Q:     7 IAVSGGPDSMAL--------------LNKKRHLVEAVCH--VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK----------------KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           + VSGGPDSMAL              +NK    ++ +    V++  R++S ++ ++V     +  ++  +     D V     + +LQ   RE+RY+    +     I+ +LIAH  +D  E   + L+++                 +NL L  +   K +S+ L+RPLL+  K+ + + C+    ++V D TN    + RN +R  +   +  +F+
  S:    89 LGVSGGPDSMALCVLTAKWKTEGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC--DWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDAKHM-KNQSIRLVRPLLDLWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGNLESGSFK 303
>gi|62424688|ref|ZP_00379831.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Brevibacterium linens BL2] (343 aa)
Score = 136, Expect = 1.5e-06, Identities = 52/178 (29%), Positives = 84/178 (47%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI--------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           ++AVSGG DSMALL+      ++  L      V++  +  S    + V    + + +   V       V+    ++ L+   RE RYD  E      G   +L AH ++D  E+           + LG+ R S  RSL         ++RPLL+  + S    CR++NIE   D  N  D ++R   R ++
  S:    42 IVAVSGGADSMALLHACAFLHRRGELRARAVTVDHGLQPTSAEVARRVISIAESWGVPAEV-----SSVNVEAGVDGLEAAAREARYDALEAARSADGADWVLTAHTRSDQAET-----------VLLGLMRGSGTRSLAGMALRTGRVVRPLLDVDRASTLASCRAQNIEVWHDPMNVDDSFARVRARSLL 217
>gi|149020169|ref|ZP_01835143.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP23-BS72] >gi|147930847|gb|EDK81828.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP23-BS72] (425 aa)
Score = 136, Expect = 1.6e-06, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+  M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|134096346|ref|YP_001101421.1| hypothetical protein HEAR3193 [Herminiimonas arsenicoxydans] >gi|133740249|emb|CAL63300.1| putative ATPase [Herminiimonas arsenicoxydans] (318 aa)
Score = 136, Expect = 1.6e-06, Identities = 52/186 (27%), Positives = 93/186 (50%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS ALL+    L E       +  VN  D++  +  E I+  Y K+ ++   +   ++D  S  K +        +    +R     +++ ELG  KI + H ++D +E+ ++       N+F G + K    K +S     I+IRPL    +   E+Y + KN   +  D     +   R  ++ M+ EW+KK
  S:    59 KIMVCLSGGKDSYALLDILMTLRERAPIKFDIVAVNL-DQKQPNFPEHILPAYLKQLDIPFHI--ENQDTYSIVKRLIPEGKTTCSLCSRLRRGILYRVADELGATKIALGHHRDDIMETFFL-------NMFFGAKIKGMPPKLQSDDGKHIVIRPLAYVKEADTERYAQIKNFPIIPCDLCGSQENLQRKQIKNMLREWEKK 252
>gi|90407914|ref|ZP_01216089.1| mesJ protein [Psychromonas sp. CNPT3] >gi|90311005|gb|EAS39115.1| mesJ protein [Psychromonas sp. CNPT3] (441 aa)
Score = 136, Expect = 1.6e-06, Identities = 49/176 (27%), Positives = 88/176 (50%)
  Q:     5 YLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKI-VRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + IA+SGG DS+ LL+   + H  + + H  +H      +D  +     CK  N+       H D     K+ ++L+   RE RY   + + +   +   L+ AH ++D LES  ++L +      L G+    K    +LIRPLL+ +++ +E Y    ++ ++ D +N   R+ RN +R
  S:    24 FKIALSGGMDSVVLLHLFSRLHNGKVMAHHVHHGLSAHADDWLLFCSTLCKALNVDFCATRVHLDK----KNRSSLEAVAREHRY---KALQENASVTTCLVTAHHQDDQLESILLALKRGAGLTGLQGVLATQKLPKGMLIRPLLDVSRQQIEDYAALFSLAWIEDESNQDQRFDRNFIR 197
>gi|50913357|ref|YP_059329.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS10394] >gi|61217204|sp|Q5XEL7|TILS_STRP6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|50902431|gb|AAT86146.1| tRNA(Ile)-lysidine synthetase [Streptococcus pyogenes MGAS10394] (428 aa)
Score = 136, Expect = 1.7e-06, Identities = 76/280 (27%), Positives = 128/280 (45%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           LIAVSGG DSM LL+       K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +   L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:    24 LIAVSGGVDSMNLLHFLYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQIAKQGY---YYLKKDYYIFI 291
>gi|87307758|ref|ZP_01089901.1| cell cycle protein mesJ-like [Blastopirellula marina DSM 3645] >gi|87289372|gb|EAQ81263.1| cell cycle protein mesJ-like [Blastopirellula marina DSM 3645] (328 aa)
Score = 136, Expect = 1.8e-06, Identities = 47/175 (26%), Positives = 85/175 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFV----FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFR-SLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++AVSGG DS+ALL     + E+        HV+++ R++SD D + V    ++  ++  +    F+    D         ++   R  RY F    + + G + ++ AH  +D +E+    + +      L GI R  +    + L+RP+L+  +  +E Y       F  D TN   R+ RN +R
  S:    23 MVAVSGGADSVALLRSLAAIRESGPGRLIAVHVDHNLRKESDTDAQFVAQLAQQLGIEGILGRVDFELSGPD--------GIEAAARSARYGFLRTFAMDHGARYVVTAHTADDQIETVLHRILRGTSLAGLSGIPRARELELGISLLRPMLSIRRSEVEAYLADLGQTFRHDETNDESRFFRNRLR 201
>gi|148997947|ref|ZP_01825460.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP11-BS70] >gi|168491781|ref|ZP_02715924.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC0288-04] >gi|169834329|ref|YP_001693445.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae Hungary19A-6] >gi|147755957|gb|EDK63000.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP11-BS70] >gi|168996831|gb|ACA37443.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae Hungary19A-6] >gi|183574048|gb|EDT94576.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC0288-04] (425 aa)
Score = 136, Expect = 1.8e-06, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+  M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|94501920|ref|ZP_01308430.1| Cell cycle protein MesJ [Oceanobacter sp. RED65] >gi|94425973|gb|EAT10971.1| Cell cycle protein MesJ [Oceanobacter sp. RED65] (446 aa)
Score = 136, Expect = 1.8e-06, Identities = 48/178 (26%), Positives = 93/178 (52%)
  Q:     3 HKYLIAVSGGPDSMALLNKKRHLVE--------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK-----------KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
            +  + +SGG DS+ LL   +  VE           HVN+   E +D  ++ V   C+ +++ L    +H+ ++ +   I  +    R  RYD F++   +  +  +++ H ++D +E+    L +             + L LG  +++     I++RPLL+ TKK +EQY     +++V D +N   ++ RN  R
  S:    24 QRLYVGLSGGIDSVVLLFLCKQFVEYHHSSVELHGIHVNHGLSEFADQWQQHVEGLCEAWSIPLV---SHRVELEQKGSIEEVA---RNARYDAFKRSLDDQDV--LVLGHHQDDQVETMMQRLMRGSGLSGLLSMNVARTLDLGNNKQA-----IILRPLLSTTKKQIEQYANDHQLKYVQDDSNLDTQFDRNFWR 207
>gi|148984555|ref|ZP_01817843.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP3-BS71] >gi|147923332|gb|EDK74446.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP3-BS71] (425 aa)
Score = 135, Expect = 1.9e-06, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+  M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|148993574|ref|ZP_01823045.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP9-BS68] >gi|149003152|ref|ZP_01828061.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP14-BS69] >gi|149007705|ref|ZP_01831314.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP18-BS74] >gi|168487652|ref|ZP_02712160.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC1087-00] >gi|168489346|ref|ZP_02713545.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae SP195] >gi|147758893|gb|EDK65889.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP14-BS69] >gi|147760700|gb|EDK67672.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP18-BS74] >gi|147927795|gb|EDK78817.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP9-BS68] >gi|183569575|gb|EDT90103.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae CDC1087-00] >gi|183572160|gb|EDT92688.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Streptococcus pneumoniae SP195] (425 aa)
Score = 135, Expect = 1.9e-06, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+  M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|148988915|ref|ZP_01820330.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP6-BS73] >gi|147925726|gb|EDK76802.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP6-BS73] (425 aa)
Score = 135, Expect = 2.1e-06, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+  M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|149013373|ref|ZP_01834082.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP19-BS75] >gi|182682980|ref|YP_001834727.1| mesJ/ycf62 family protein [Streptococcus pneumoniae CGSP14] >gi|194398531|ref|YP_002036732.1| tRNA(Ile)-lysidine synthase [Streptococcus pneumoniae G54] >gi|147762896|gb|EDK69844.1| MesJ/Ycf62 family protein [Streptococcus pneumoniae SP19-BS75] >gi|182628314|gb|ACB89262.1| mesJ/ycf62 family protein [Streptococcus pneumoniae CGSP14] >gi|194358198|gb|ACF56646.1| tRNA(Ile)-lysidine synthase [Streptococcus pneumoniae G54] (425 aa)
Score = 135, Expect = 2.2e-06, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A+SGG DSM L        K+  +   + HVN+  R +SD +EK +R    +  L +++      + S+ +         R  RYDFF+++ ++ G   ++ AH  +D +E+  M L +  +  +L GI+ K     + +IRP L+  KK         +I    D +N  + Y RN +R
  S:    21 KAVLALSGGLDSMFLFKVLSTYQKELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYI-SNFSGEFSEARA--------RNFRYDFFQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQKKDF------PSIFHFEDTSNQENHYFRNRIR 189
>gi|109947271|ref|YP_664499.1| hypothetical protein Hac_0697 [Helicobacter acinonychis str. Sheeba] >gi|109714492|emb|CAJ99500.1| conserved hypothetical protein [Helicobacter acinonychis str. Sheeba] (349 aa)
Score = 135, Expect = 2.2e-06, Identities = 55/191 (28%), Positives = 95/191 (49%)
  Q:     4 KYLIAVSGGPDSMALLN--KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK-----MMAEWDKKTFQKF 194
           K L+  SGG DS  L +   K ++   +  V+Y+ ++      K  +   K ++ K ++    K         ++ +   R+IRYDFFE + +E   K +++AH  ND LE   M L+K    N  L  +   K     ++RPLL  +K  L+    +K+++F  D++N+  ++ RN  RK     +M  + K   Q F
  S:    28 KNLLGFSGGVDSTCLFHLLVKENIAFDIALVDYNTQKQRLEIIKHAQKLAKTHHKKCYIHYAQKI-------THDFEMQARKIRYDFFETLIREHSYKHLILAHHLNDRLEWFLMQLSKGAGLNTLLSFQAYEKRGFYAIVRPLLYTSKDILKTL--AKDMKFFEDFSNYSLKFKRNFFRKHYANSLMQYYSKGIIQSF 217
>gi|51599039|ref|YP_073227.1| hypothetical protein BG0813 [Borrelia garinii PBi] >gi|61216476|sp|Q65ZY6|TILS_BORGA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51573610|gb|AAU07635.1| conserved hypothetical protein [Borrelia garinii PBi] (440 aa)
Score = 134, Expect = 2.8e-06, Identities = 69/249 (27%), Positives = 119/249 (47%)
  Q:     2 KHKYLIAVSGGPDSMALL-NKKRHLVEAVC--HVNYHDREDSDNDEKI--VRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQ-----DFDINYFLKIKNNYKESLIYLFLNHIGI 250
           K++ ++A SGG DS  LL N K +L   +   +  +  R D++ +++I  V+ +C  YN+ L V     D  S+   +  +++   R+ RY+  E   +E     I +AH +ND +E+  M   +     FL         +  +IRPLL  ++  +E +    NI F +D TN  D Y RN VR  +    +K F+ +   +K  +  +  F+   +      +++      FD+  FL         LI+  LN  GI
  S:    23 KNRVIVAFSGGADSTTLLLNLKYYLSNNIVAFYFAHFIRTDNEQNKEIEHVKGFCDLYNIALQVKKCDIDIKSESVRLGVSIEELARKCRYNALENALKENDANYIALAHNENDQIETIIMRFFQGS---FLDGLSGIPGVNKNIIRPLLEVSRLEIENFLSLNNISFFVDSTNAQDLYLRNRVRNNLLPSIEKIFKGYQKCLKRISEFSKEFVDYFEKDEFFPVEKGKYYYSFDLKTFLNFPKYLVFRLIFKILNSEGI 279
>gi|152968782|ref|YP_001333891.1| tRNA(Ile)-lysidine synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953631|gb|ABR75661.1| tRNA(Ile)-lysidine synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (437 aa)
Score = 134, Expect = 3.0e-06, Identities = 49/177 (27%), Positives = 87/177 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA-------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L+A SGG DS  LL++   L E          HV++     +D      R  C+++ + L V       V+  +    ++   R  RY  F+   + L   ++L+ A  ++D  E+  ++L +      L  +   S F    L+RPLLN+T++SL Q+  +  + ++ D +N  D Y RN +R
  S:    18 QLLVAFSGGLDSTVLLHQLVQLREQDPALTLRAVHVHHGLSAHADQWVAHCRQVCQQWQVPLVV-----HHVTLARGGLGVEAHARAARYQAFQ---ETLNAGEVLVTAQHQDDQCETLLLALKRGSGPTGLSAMAPSSAFAGSRLLRPLLNETRESLRQWALAHQLSWIEDESNQDDTYDRNFLR 195
>gi|29654800|ref|NP_820492.1| tRNA(Ile)-lysidine synthase [Coxiella burnetii RSA 493] >gi|154706200|ref|YP_001423893.1| tRNA(Ile)-lysidine synthase [Coxiella burnetii Dugway 5J108-111] >gi|164686109|ref|ZP_01946931.2| tRNA(Ile)-lysidine synthase [Coxiella burnetii 'MSU Goat Q177'] >gi|165919314|ref|ZP_02219400.1| tRNA(Ile)-lysidine synthase [Coxiella burnetii RSA 334] >gi|61216625|sp|Q83BJ9|TILS_COXBU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|29542068|gb|AAO91006.1| tRNA(Ile)-lysidine synthetase [Coxiella burnetii RSA 493] >gi|154355486|gb|ABS76948.1| tRNA(Ile)-lysidine synthase [Coxiella burnetii Dugway 5J108-111] >gi|164601674|gb|EAX32419.2| tRNA(Ile)-lysidine synthase [Coxiella burnetii 'MSU Goat Q177'] >gi|165916974|gb|EDR35578.1| tRNA(Ile)-lysidine synthase [Coxiella burnetii RSA 334] (449 aa)
Score = 134, Expect = 3.1e-06, Identities = 48/176 (27%), Positives = 87/176 (49%)
  Q:     5 YLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + IA SGG DS  L++   HL +         H+N+     +++ E   +  C +  +    F + +  +S  +  ++++   R+ RY  F++   E   + +L AH +ND  E+  + L +      L  +  K K     L+RPLL  T+  L++Y    N+ +V D TN   R++RN +R
  S:    30 FCIAYSGGIDSHVLVHAMSHLCQEHPWQLRALHINHGLNPKANDWENHCQQICNRLKIP---FQSERVTLS-LQPGDSIEAVARKARYAIFQQALSE--NETLLTAHTENDQAETFLLQLLRGAGVKGLSAMPAKRKLGKGELVRPLLAITRDDLKKYAEKNNLRWVEDDTNLELRFNRNYLR 206
>gi|75906734|ref|YP_321030.1| PP-loop [Anabaena variabilis ATCC 29413] >gi|75700459|gb|ABA20135.1| PP-loop [Anabaena variabilis ATCC 29413] (342 aa)
Score = 133, Expect = 3.8e-06, Identities = 49/189 (25%), Positives = 91/189 (48%)
  Q:     3 HKYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
            + L+AVSGG DS+ L+     L         + H ++  R DS  +   V++  + + +  ++        +  K IN+  T  RE RY+    I+Q    + I+  H  +D  E+   +L +      L     ++    +++L+RPLL  T+K  EQ+C+   +    D TN   +Y+RN +R+ +  + +  F
  S:    24 QRLLVAVSGGQDSLCLIKLLLDLQLKWGWELGIAHCDHRWRVDSQANADHVKNLSETWGVSFYL-------ETASKPINSEAT-AREWRYETLSAIAQAYNYEYIVTGHTASDRAETLLYNLMRGTGADGLQALTWQRPLTENILLVRPLLEITRKQTEQFCQEFQLPIWEDSTNQDLKYARNRIRQELIPYLQANF 212
>gi|15672001|ref|NP_266175.1| hypothetical protein L1002 [Lactococcus lactis subsp. lactis Il1403] >gi|61216729|sp|Q9CJH4|TILS_LACLA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|12722856|gb|AAK04117.1|AE006241_6 cell cycle protein MesJ [Lactococcus lactis subsp. lactis Il1403] (423 aa)
Score = 133, Expect = 3.9e-06, Identities = 58/191 (30%), Positives = 85/191 (44%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYM-SLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           K L+A+SGG DSM L N    L E       + H+N+  RE+S  +E  +R+   K  + ++V     +   K           R+ RY FFEK+        +L AH + D +E+  M  +         GI  +  F    LIRPLL  TK+ L+         +  D TN    Y RN +R  +    KK   +F
  S:    23 KILLALSGGKDSMTLFNWLYDLKEVLGIELGLAHINHGLREESKFEEIALREMATKLKVPIYVDKFTGEFTEKNA---------RDFRYQFFEKLMIGENYNILLTAHHQGDLVETVLMRQITGRPLRSLQGIADRQPFAGGQLIRPLLKFTKEELDAQ------TYYEDSTNQGLDYFRNRIRNQLIPELKKENPQF 205
>gi|19699031|gb|AAL91135.1| MG083-like protein [Mycoplasma gallisepticum] (57 aa)
Score = 132, Expect = 4.3e-06, Identities = 25/52 (48%), Positives = 36/52 (69%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKK 53
           K +YLI VSGGPDS+ LL++ +  ++  CH+NY+ R  +  D+ IV DYC K
  S:     6 KKQYLIGVSGGPDSIYLLDRYQDQIKVACHINYNKRPTALRDQLIVSDYCLK 57
>gi|86135031|ref|ZP_01053613.1| putative cell-cycle protein [Tenacibaculum sp. MED152] >gi|85821894|gb|EAQ43041.1| putative cell-cycle protein [Polaribacter dokdonensis MED152] (436 aa)
Score = 132, Expect = 4.6e-06, Identities = 54/177 (30%), Positives = 98/177 (55%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVE-AVCHVNYHDRED-SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K LIA+SGG DS+ L  L  + ++ E A+ H N+  R   SD DE+ V    +  + ++F+     + +S+ +   ++Q   RE+RY++F+++  E  +  IL AH  +D LE+  ++L +    + F GI   +      ++R LL  ++  +  + +S NIE+  D +N   +Y RN +R
  S:    20 KLLIAISGGLDSVVLTHLFHQLNIAEIALAHCNFKLRNKASDLDEEFVNKLSQITSNQIFIKSFQTEKISENQK-KSIQITARELRYNWFQELMDEHQLDYILTAHHADDNLETFLINLTRGSGLDGFTGIPAINGN----IVRTLLPFSRSEILNFAKSNNIEWREDASNASIKYVRNKIR 196
>gi|149372519|ref|ZP_01891631.1| tRNA(Ile)-lysidine synthetase [unidentified eubacterium SCB49] >gi|149354562|gb|EDM43126.1| tRNA(Ile)-lysidine synthetase [unidentified eubacterium SCB49] (436 aa)
Score = 132, Expect = 4.7e-06, Identities = 52/177 (29%), Positives = 88/177 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVC--HVNYHDR-EDSDNDEKIVRDYCKKYNLKLF--VFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL--ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A SGG DS  L    + L   +C  H N+  R E SD D   V +   + ++  +  VFDT K   + +K   + Q   RE+RY +F+++  ++    I  AH  +D LE+  ++L++       GIR  +    L   +IRPLL  ++  +  + +     +  D +N    Y RN +R
  S:    20 KIIVACSGGLDSTVLTRLLKQLGFTICIAHCNFSLRGEASDGDAAFVENLATELDIPFYKTVFDT-KAFANDHK--LSTQMAARELRYQWFKELRTQIKFDLIATAHHADDMLETVLINLSRGT-----GIRGLTGIPELTETIIRPLLPFSRTEILNFAKKSEFYWREDASNASTDYLRNDLR 195
>gi|146310390|ref|YP_001175464.1| tRNA(Ile)-lysidine synthetase [Enterobacter sp. 638] >gi|145317266|gb|ABP59413.1| tRNA(Ile)-lysidine synthetase [Enterobacter sp. 638] (426 aa)
Score = 132, Expect = 5.1e-06, Identities = 50/177 (28%), Positives = 88/177 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA-------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L+  SGG DS  LL++     E          HV++    ++D+        CK +++ L V      +  K +D     +   R+ RY  FEK  Q    + ++ A   +D  E+  ++L +      L  +  +++F    LIRPLL +T+ SLE++ +  N+ ++ D +N  DRY RN +R
  S:    15 QLLVGFSGGLDSTVLLHRLMLWREQEPDVQIRAIHVHHGLSSNADHWVAHCESLCKSWHIPLIV------ERVKLRDEGLGTEAQARKARYLAFEKTLQ--AGEALVTAQHLDDQCETFLLALKRGSGPAGLSAMPVRTEFAGSQLIRPLLGETRTSLEKWAQDYNLCWIDDESNQDDRYDRNFLR 192
>gi|152980618|ref|YP_001353795.1| MesJ cell cycle protein [Janthinobacterium sp. Marseille] >gi|151280695|gb|ABR89105.1| MesJ cell cycle protein [Janthinobacterium sp. Marseille] (462 aa)
Score = 132, Expect = 5.2e-06, Identities = 56/193 (29%), Positives = 93/193 (48%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEA----------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS------------LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           K K  +A SGG DS ALL    HL+ A            HV++    ++D+     R  C    +   VFD  +  V++ +  N ++   R+ RY     + +  G+  +L AH  +D  E+  + L +       G+   S   S            L++ RPLL   ++ L+ Y  +  I+FV D +N   RY+RN +R  +    ++ F  F
  S:    23 KAKIALAYSGGLDSAALL----HLLHAYGLAQQIEIFAFHVHHGLSPNADDWLAHCRAQCAALGV---VFDARQVQVTR-QGKNGIEEAARQSRYAALGDMCRAHGVPLLLTAHHLDDQAETVLLQLLRGS-----GVAGLSGMDSANHAADLLGDANLLMGRPLLQVRREDLQAYVTAHAIQFVEDESNLDPRYARNALRHQVMPKLEEYFPGF 224
>gi|158520085|ref|YP_001527955.1| tRNA(Ile)-lysidine synthetase [Desulfococcus oleovorans Hxd3] >gi|158508911|gb|ABW65878.1| tRNA(Ile)-lysidine synthetase [Desulfococcus oleovorans Hxd3] (480 aa)
Score = 131, Expect = 6.7e-06, Identities = 53/175 (30%), Positives = 85/175 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE-------AVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN--NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+ VSGGPDS+ALL+    L         +V HV++  R  ++D D+  V    ++  L  +   T K DV+        +++   R  RY FF   +   G  KI  AH   D  E   M+L +       G+      R  I IRPL++ +++ +  +     +++V D TN    ++RN VR
  S:    34 LVGVSGGPDSVALLHALVRLQPELAVARVSVAHVHHGLRGAEADADQAFVAALAERLGLPFY---TEKIDVAAAARNTGASVEDAARTARYRFFSDTAAAHGYHKIATAHHAGDNAEWVLMNLVRGAGP--EGLSGIPPVRENI-IRPLIHVSREDILAFLTHGGMDYVEDSTNADLTFTRNRVR 212
>gi|17228427|ref|NP_484975.1| hypothetical protein all0932 [Nostoc sp. PCC 7120] >gi|61216693|sp|Q8YYB8|TILS_ANASP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|17130278|dbj|BAB72889.1| all0932 [Nostoc sp. PCC 7120] (342 aa)
Score = 131, Expect = 6.7e-06, Identities = 48/188 (25%), Positives = 90/188 (47%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           + L+AVSGG DS+ L+        K      + H ++  R DS  +   V++  + + +  ++        +  K +N+  T  RE RY     I+Q    + I+  H  +D  E+   +L +      L     ++    +++L+RPLL  T+K  EQ+C+   +    D TN   +Y+RN +R+ +  + +  F
  S:    25 RLLVAVSGGQDSLCLIKLLLDLQPKWGWELGIAHCDHRWRADSQANADHVKNLAENWGVSFYL-------ETATKPVNSEAT-AREWRYQALSAIAQAHNYQYIVTGHTASDRAETLLYNLMRGTGADGLQALTWQRPLTENILLVRPLLEITRKQTEQFCQEFQLPIWEDSTNQDLKYARNRIRQELIPYLQANF 212
>gi|46446273|ref|YP_007638.1| hypothetical protein pc0639 [Candidatus Protochlamydia amoebophila UWE25] >gi|61216530|sp|Q6MDI6|TILS_PARUW tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|46399914|emb|CAF23363.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (458 aa)
Score = 131, Expect = 7.0e-06, Identities = 52/203 (25%), Positives = 104/203 (51%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMS-LNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK------FYLKVKWFNLKNMFF 208
           L+A+SGG DS++L         +  L   V HV++  RE+S  +  I+++  +++ +    +   K D+S+     NL+   R+ R  FF++I  +  ++ + + HQ+ND +E+     L  +  + F G++ +     +  +RPLL   K  +  + +   ++   D TN  +R+ R  +R+ +     ++F K       Y+  +   LKN F 
  S:    32 LLALSGGADSLSLFYCLLACRLEGILSFHVAHVDHGWREESAKEATILKNLAEQHQVP---YHQLKIDLSQLA--GNLEDACRKQRQKFFKEICLQNNLQAVCLGHQENDQVETVLKRILEGSHWSHFDGLKERMWHDQVQFLRPLLGIQKDEILAFLKGNQLKAFEDGTNCDERFMRARMRRTIIPDLNRSFGKKIDNSLVYIASEMSELKNFFL 242
>gi|87198103|ref|YP_495360.1| tRNA(Ile)-lysidine synthetase-like [Novosphingobium aromaticivorans DSM 12444] >gi|123491176|sp|Q2GC97|TILS_NOVAD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|87133784|gb|ABD24526.1| tRNA(Ile)-lysidine synthetase-like protein [Novosphingobium aromaticivorans DSM 12444] (326 aa)
Score = 130, Expect = 7.3e-06, Identities = 48/178 (26%), Positives = 87/178 (48%)
  Q:     7 IAVSGGPDSMALLNKKRHLVE---AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS---------LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
           +AVSGGPDS+AL+   + +      V  V++  R +S  +  +V   C+   ++   + T + D++    +   Q   R+ RY     +++  G+  ++ AH  +D  E+  M LN+       G+R  +  R+         + L+RPLL   +  L        +  V+D +N   RY R  +R +MA
  S:    30 LAVSGGPDSLALMLLMQEVAPRDFCVATVDHGLRAESAAEAAMVAGLCE---MRGIAYHTLRLDLAGGSAV---QERARKARYAALADLARRDGLSAVVTAHHADDQAETLVMRLNRGA-----GLRGLAGMRAASSVPGAGEVRLLRPLLGWRRAELVALVEDAGLAPVLDPSNHDHRYERVRIRDVMA 208
>gi|124021791|ref|YP_001016098.1| ATPase [Prochlorococcus marinus str. MIT 9303] >gi|123962077|gb|ABM76833.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Prochlorococcus marinus str. MIT 9303] (343 aa)
Score = 130, Expect = 7.7e-06, Identities = 52/176 (29%), Positives = 87/176 (49%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELG-------IKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSK-------FRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           LIAVSGG DSMALL       +K      V H +++  + S      ++D+C+ +NL  +       D +K    NN  T  R  RY+     ++ L         + +L  H  +D  E+  ++L +      L   R+ +        +++ LIRPLL  +++   Q C   ++   +D  N    +SRN VR+
  S:    36 LIAVSGGQDSMALLGLLIDLQRKHGWSLEVWHGDHNWHQQSATIATELKDWCEAHNLSFW------SDQAKPGQTNNEAT-ARHWRYEQLTLHTERLSSNNPNHPCRYVLTGHTSSDRAETLLLNLARGADLAGLSSMRQCRPISKDNPRKNVQLIRPLLGFSREDTAQICSELSLPIWLDPANSNPDFSRNRVRQ 224
>gi|15611732|ref|NP_223383.1| hypothetical protein jhp0665 [Helicobacter pylori J99] >gi|61216760|sp|Q9ZLB5|TILS_HELPJ tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|4155227|gb|AAD06249.1| putative [Helicobacter pylori J99] (338 aa)
Score = 130, Expect = 7.9e-06, Identities = 41/119 (34%), Positives = 63/119 (52%)
  Q:    76 NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK-----MMAEWDKKTFQKF 194
           N +   R++RYDFFE + +E   K +++AH  ND LE   M L+K    N  L  +   K  S  ++RPLL   K +L+    +K+ +F  D +N   ++ RN  RK     +M  + K   Q F
  S:    84 NFEMQARKVRYDFFETLIKEHSYKHLILAHHLNDRLEWFLMQLSKGAGLNTLLSFQAYEKRESYAIVRPLLYTPKDTLKTL--AKDQKFFEDDSNSSLKFKRNCFRKHYANALMQHYSKGIIQSF 206
>gi|77918602|ref|YP_356417.1| cell cycle protein [Pelobacter carbinolicus DSM 2380] >gi|77544685|gb|ABA88247.1| cell cycle protein [Pelobacter carbinolicus DSM 2380] (458 aa)
Score = 130, Expect = 8.6e-06, Identities = 49/175 (28%), Positives = 92/175 (52%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAV------CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKD-DVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLES-AYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+ +SGG DSM LL+   H+ +++       H+++  R +S +D   V  +C++ ++ L V   H+D      +    L+   RE R +F ++ ++  G + I + H +ND +E+  +  L  +  +   G+R     RS   IRPLL+ +++ +  Y     I  V D +N    ++RN +R
  S:    22 LVGLSGGADSMVLLDVLLHVADSLQLAILAAHLDHGMRPESADDAAFVARFCRRRDVPLTV--GHRDVPALARQHKQGLEEAAREARREFLQQTARVEGCRFIALGHHRNDQVETFLHRLLRGSGLSGLAGMR----LRSGPFIRPLLSFSRQDILAYLDDHQIPHVEDASNADTVFTRNRLR 198
>gi|30249461|ref|NP_841531.1| hypothetical protein NE1490 [Nitrosomonas europaea ATCC 19718] >gi|30138824|emb|CAD85401.1| Uncharacterized protein family UPF0021 [Nitrosomonas europaea ATCC 19718] (314 aa)
Score = 129, Expect = 1.1e-05, Identities = 51/186 (27%), Positives = 95/186 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS ALL+  R+L +A   +++       D++     E ++  Y  + N+   + +  +D  S  K +        +    +R     +++ ELG  KI + H ++D LE+ ++       N+F G + K+    L       ++IRPL    +K L  Y  + + +F I   N         R V+++MM +WDKK
  S:    40 RVMVCLSGGKDSYALLDILRNL-QAHAPLDFELIAVNLDQKQPGFPEHVLPGYLSEINMPFRIVE--QDTYSVVKRVIAEGKTTCSLCSRLRRGVLYRVATELGATKIALGHHRDDILETFFL-------NMFYGGKLKAMPPKLVSDDGCHVVIRPLAYCKEKDLAAY--AWHAQFPIIPCNLCGSQPNLQRQVIKEMMQQWDKK 233
>gi|39934200|ref|NP_946476.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris CGA009] >gi|61216538|sp|Q6NAQ6|TILS_RHOPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|39648048|emb|CAE26568.1| YaeN protein [Rhodopseudomonas palustris CGA009] (346 aa)
Score = 129, Expect = 1.1e-05, Identities = 50/180 (27%), Positives = 85/180 (47%)
  Q:     6 LIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAE 185
           ++AVSGGPDS+AL+          KR    AV  V++  R ++  + + V+      +L         D  S       +Q   R  RY    K ++ LG   ++ AH ++D  E+  M L++      L  + R+ +   ++L RPLL+  K  L        I F  D +N   R++R  +R++M +
  S:    28 VLAVSGGPDSLALMWLAARWRKALKRGPALAVVTVDHGLRPEAAAEARAVKRLAASLDLPHRTLRWSGDKPS-----TGIQAAARGARYRLLAKAAKTLGASHVMTAHTRDDQAETVLMRLSRGSGIAGLAAMAREIERDGVVLARPLLDVPKARLIATLAKARIAFATDPSNADPRFTRPRLRELMPQ 211
>gi|50406064|ref|XP_456602.1| hypothetical protein DEHA0A06435g [Debaryomyces hansenii CBS767] >gi|49652266|emb|CAG84558.1| unnamed protein product [Debaryomyces hansenii CBS767] (502 aa)
Score = 129, Expect = 1.1e-05, Identities = 52/182 (28%), Positives = 93/182 (51%)
  Q:     4 KYLIAVSGGPDSMALLN--------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKF-----------RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYS-RNVVRKMMAE 185
           + ++A+SGG DS+ L           K  L      +++  R  S  + + V    + + +K  V     +D    K I N +   RE RYD FE++ +EL +K +++AH  ND +E+    L +N      +G+R                 S+ ++RPLL+  K  + + C    I +  D+TN     + RN++R +++E
  S:    23 RIVVALSGGVDSLCLTYLLGQFKRIYKPSLQITAITIDHKYRAGSGKEAEKVGVLVRPWGVKHIVKTLEYEDRDIGK-ITNFEEVAREKRYDIFEQVCRELDVKSLIVAHNLNDQIETFLQRLQQNSSIFGLVGLRTVDHLPISPTSPSENGDSIHVVRPLLSFDKSEIIETCTKNGIRWFEDHTNSDIHLTRRNLLRHIVSE 224
>gi|149191306|ref|ZP_01869560.1| putative ATPase [Vibrio shilonii AK1] >gi|148834842|gb|EDL51825.1| putative ATPase [Vibrio shilonii AK1] (297 aa)
Score = 129, Expect = 1.1e-05, Identities = 62/185 (33%), Positives = 92/185 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+   +L +A      V  VN  D++     E I+ DY +  N+  ++ D     V K K      T        R   Y F EKI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +K L +Y   K  EF I   N     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLNLQKAAPIKFDVVAVNL-DQKQPGFPEHILPDYFETLNIPYYIVDKDTYSVVKEKIPEGKTTCGLCSRLRRGTLYSFAEKI----GATKIALGHHLDDIVETMFL-------NMFHGSRLKAMPPKLRSDDGRNVVIRPLTYCREKDLIRYAEHK--EFPIIPCNLCGSQENLQRQSIKAMLIDWDKKT 233
>gi|84703692|ref|ZP_01017520.1| hypothetical protein PB2503_08309 [Parvularcula bermudensis HTCC2503] >gi|84690126|gb|EAQ15967.1| hypothetical protein PB2503_08309 [Parvularcula bermudensis HTCC2503] (393 aa)
Score = 129, Expect = 1.2e-05, Identities = 36/153 (23%), Positives = 71/153 (46%)
  Q:    37 REDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS-----LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKK 189
           R  S  +  +V  +C+   L+       + D ++ K    L    R+ RY    +  ++ G+ ++  AH  +D  E+ +M L +       G+ R+    +     + L+RPLL   +  L  Y ++ ++ FV D +N   RY R  VR ++   +++
  S:     2 RPSSREEADLVAAWCRARGLRHTTLTWARSDPAR-KGGGTLTAAARQARYKLLCQACEQHGLDRVATAHTADDQAETVFMRLRRGGGQGMAGMPRERLIAAGPGPAIRLLRPLLGVRRARLRAYAKTHDLPFVDDPSNADPRYERVRVRALLGALEEQ 158
>gi|81096413|ref|ZP_00874758.1| PP-loop [Streptococcus suis 89/1591] >gi|80977552|gb|EAP41090.1| PP-loop [Streptococcus suis 89/1591] (422 aa)
Score = 129, Expect = 1.2e-05, Identities = 54/189 (28%), Positives = 96/189 (50%)
  Q:     3 HKYLIAVSGGPDSMALLN-----KKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           +K L+AVSGG DSM L +     K+   +E  + H+N+  RE+S  +EK +R   ++ N+  ++        S ++ + + +   R+ RY FF  I ++ G   ++ AH  +D  E+ +M L +  +   L  I+    F +  LIRPLL+  K   E+    ++     D+  F +R   + + K+  E  K  F
  S:    19 NKVLVAVSGGLDSMNLFHLLYECKQVLGIELGIAHINHGQREESVIEEKYLRQLAEESNVPFYL--------SYFEGVFSEEA-ARKWRYGFFATIMEKEGYTALVTAHHADDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKKADFEKLFHFEDCSNA-DFKYFRNRVRNDYLPKLKQENPKIEF 204
>gi|114330769|ref|YP_746991.1| PP-loop domain-containing protein [Nitrosomonas eutropha C91] >gi|114307783|gb|ABI59026.1| PP-loop domain protein [Nitrosomonas eutropha C91] (313 aa)
Score = 128, Expect = 1.2e-05, Identities = 50/186 (26%), Positives = 96/186 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS ALL+  R+L +A   +++       D++     E ++  Y  + N+   + +  +D  S  K +        +    +R     +++ ELG  KI + H ++D LE+ ++       N+F G + K+    L       ++IRPL    +K L  Y  ++ ++F I   N         R V+++MM +W+KK
  S:    40 RIMVCLSGGKDSYALLDILRNL-QAHAPLDFELIAVNLDQKQPGFPEHVLPGYLSEINMPFRIVE--QDTYSVVKRVIPEGKTTCSLCSRLRRGVLYRVATELGATKIALGHHRDDILETFFL-------NMFYGGKLKAMPPKLVSDDGCHVVIRPLAYCKEKDLAAY--AQLVQFPIIPCNLCGSQPNLQRQVIKEMMQQWNKK 233
>gi|90426215|ref|YP_534585.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisB18] >gi|90108229|gb|ABD90266.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisB18] (346 aa)
Score = 128, Expect = 1.2e-05, Identities = 47/186 (25%), Positives = 90/186 (48%)
  Q:     6 LIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           ++AVSGGPDS+AL+          +R    +V  V++  R ++  + + V+ +  + +L         D  S       +    RE RY    + ++  G   ++ AH ++D  E+  M +++      L  + R+++   +I+ RPLL  +K  L        I F  D +N   RY+R  +R ++A + ++ F
  S:    28 VLAVSGGPDSLALMWLAARWRKALRRGPAISVITVDHGLRPEAAREARDVKRHAAELDLPHRTLRWRGDKPS-----TGVPAAAREARYQLLARAARAAGASHVMTAHTRDDQAETLLMRMSRGSGIAGLAAMARQTERFGVIIARPLLEVSKAQLVATLDKAKIGFATDPSNTDPRYARPRLRGLIAAYAEEGF 217
>gi|146317675|ref|YP_001197387.1| ATPase [Streptococcus suis 05ZYH33] >gi|146319865|ref|YP_001199576.1| ATPase [Streptococcus suis 98HAH33] >gi|145688481|gb|ABP88987.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Streptococcus suis 05ZYH33] >gi|145690671|gb|ABP91176.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Streptococcus suis 98HAH33] (422 aa)
Score = 128, Expect = 1.3e-05, Identities = 54/177 (30%), Positives = 91/177 (51%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K L+AVSGG DSM L +     K+   +E  + H+N+  RE+S  +EK +R   ++ N+  ++        S ++ + + +   R+ RY FF  I ++ G   ++ AH  +D  E+ +M L +  +   L  I+    F +  LIRPLL+  K   E+    +      D +N   +Y RN VR
  S:    20 KVLVAVSGGLDSMNLFHLLYECKQVLGIELGIAHINHGQREESVIEEKYLRQLAEESNVPFYL--------SYFEGVFSEEA-ARKWRYGFFATIMEKEGYTALVTAHHADDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLSFKKADFEKLFHFE------DCSNADFKYFRNRVR 188
>gi|119509008|ref|ZP_01628159.1| hypothetical protein N9414_04385 [Nodularia spumigena CCY9414] >gi|119466174|gb|EAW47060.1| hypothetical protein N9414_04385 [Nodularia spumigena CCY9414] (333 aa)
Score = 128, Expect = 1.3e-05, Identities = 47/189 (24%), Positives = 87/189 (46%)
  Q:     3 HKYLIAVSGGPDSMAL------LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI----LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
            + L+AVSGG DS+ L      L  K      + H ++  R DS+ +   V    K + +  ++        +  ++  N +   R  RY     I+Q    + I+  H  +D  E+   +L +       G++  +  R L     L+RPLL  T+   E++C+  ++    D TN   +Y+RN +R+ +  + +  F
  S:    24 QRLLVAVSGGQDSLCLIKILLDLEPKWGWDLGIAHCDHRWRTDSEANASHVEKLAKIWGVSFYL--------ATAREPLNSEAAARNWRYAALSAIAQANNYQYIVTGHTASDRAETLLYNLMRGTGGD--GLQALTWQRPLTADICLVRPLLEITRTQTEEFCQEFHLPIWEDSTNLDVKYARNRIRQELIPYLQANF 212
>gi|108563137|ref|YP_627453.1| hypothetical protein HPAG1_0712 [Helicobacter pylori HPAG1] >gi|107836910|gb|ABF84779.1| hypothetical protein HPAG1_0712 [Helicobacter pylori HPAG1] (338 aa)
Score = 128, Expect = 1.4e-05, Identities = 41/119 (34%), Positives = 63/119 (52%)
  Q:    76 NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK-----MMAEWDKKTFQKF 194
           N +   R+IRYDFFE + +E   K +++AH  ND LE   M L+K    N  L  +   K     ++RPLL   K +L+    +K+ +F  D +N   ++ RN  RK     +M ++ K   Q F
  S:    84 NFEMQARKIRYDFFETLMREYSYKHLILAHHLNDRLEWFLMQLSKGAGLNTLLSFQAYEKRGFYAIVRPLLYTPKDTLKTL--AKDQKFFEDDSNSSLKFKRNFFRKHYANALMQDYSKGIIQSF 206
>gi|82701643|ref|YP_411209.1| hypothetical protein Nmul_A0509 [Nitrosospira multiformis ATCC 25196] >gi|82409708|gb|ABB73817.1| conserved hypothetical protein [Nitrosospira multiformis ATCC 25196] (298 aa)
Score = 128, Expect = 1.5e-05, Identities = 53/216 (24%), Positives = 99/216 (45%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSK--YKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNW 219
           + ++ +SGG DS ALL+  R L +A     +       D++     E ++ +Y     +   + +     V K    +     +    +R     +++ ELG  KI + H ++D LE+  ++L    K   +  +  S     I+IRPL    +K L  Y   +N   +  +         R VV++M+ +WDKK   +  L+  + +L+N+    LLDS   ++
  S:    42 RVMVCLSGGKDSYALLDILRSL-QAHAATQFELIAVNLDQKQPGFPEHVLPNYLTSIGMPFRIVEQDTYSVVKRLIPEGKTTCSLCSRLRRGVLYRVADELGATKIALGHHRDDILETLLLNLFHGGKLKTMPPKLVSDDGKHIVIRPLAYCKEKDLAAYAEMENFPIIPCNLCGSQKNMQRQVVKEMLQQWDKKFPGR--LENMFSSLQNIQPSHLLDSSLYDF 263
>gi|160872844|ref|ZP_02062976.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Rickettsiella grylli] >gi|159121643|gb|EDP46981.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Rickettsiella grylli] (458 aa)
Score = 128, Expect = 1.6e-05, Identities = 53/176 (30%), Positives = 84/176 (47%)
  Q:     5 YLIAVSGGPDSMALLNKKRHLVEA----VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + IA SGG DS  LL     L+        H+N+     SD   KI R  C+K  +  ++   D       + K   +L+   RE RY   EK         +L AH +ND  E+  + L +    K L      +    ++ L+RPLLN T++ L  Y ++ ++ ++ D +N   R+SRN +R
  S:    20 FWIAYSGGLDSHVLLYALSQLLPTERLRAIHINHGLHIHSDKWAKICRHACEKLTIDCEIVTLDI------RPKTGESLEASLREARYHAIEKKIPAGNF--LLTAHHRNDQAETFLLQLFRGAGLKGLISMPFCRPLTNNVYLMRPLLNFTRQELYAYAQTHHLTWIEDDSNKNQRFSRNFIR 195
>gi|152981386|ref|YP_001355128.1| hypothetical protein mma_3438 [Janthinobacterium sp. Marseille] >gi|151281463|gb|ABR89873.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] (317 aa)
Score = 127, Expect = 1.7e-05, Identities = 51/186 (27%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS ALL+    L E       +  VN  D++  +  + I+  Y K+ ++   +   ++D  S  K +        +    +R     +++ ELG  KI + H ++D +E+ ++       N+F G + K    K +S     I+IRPL    +   E+Y   KN   +  D     +   R  ++ M+ EW+KK
  S:    57 KVMVCLSGGKDSYALLDILMTLRERAPIKFDIVAVNL-DQKQPNFPDHILPAYLKQLDIPFHI--ENQDTYSIVKRLIPEGKTTCSLCSRLRRGILYRVADELGANKIALGHHRDDIMETFFL-------NMFFGAKIKGMPPKLQSDDGKHIVIRPLAYVKEADTERYAEVKNFPIIPCDLCGSQENLQRKQIKGMLREWEKK 250
>gi|32266754|ref|NP_860786.1| hypothetical protein HH1255 [Helicobacter hepaticus ATCC 51449] >gi|61216602|sp|Q7VGR5|TILS_HELHP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|32262806|gb|AAP77852.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] (423 aa)
Score = 127, Expect = 1.7e-05, Identities = 60/210 (28%), Positives = 102/210 (48%)
  Q:     4 KYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLF-LGIRRKSKFRSL---ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-----KMMAEWDKKTFQKF-YLKVKWFNLKNMFFIKLLD 213
           + L+  S G DS AL  L  +  +   +  V+YH R  +D++    ++    YN   FV   H    +      N ++  R  R+DFF+ +  +     +L+AHQ ND LE   M L K     NL      R +  +SL    ++RPL +  K  L ++C+ + I++  D +N    + RN  R     K++ E+     +   YL+    +L+NM +   L+
  S:    37 RNLLGFSSGVDSTALFFLLLECEIPFDIAIVHYHTRLQADDEVAYAKELAATYNKLCFV--AHAPHFNA-----NFESNARSFRFDFFQSLIIKHHYTHLLLAHQLNDRLEWLLMQLTKGAGLGNLLGFADERYNYDKSLNNYTIVRPLESIPKNELYRFCKERGIKYFEDSSNQDKTFRRNYFRYEFCDKLVNEFSAGIARSLSYLQRDRQSLENMLYADTLE 253
>gi|73540827|ref|YP_295347.1| PP-loop [Ralstonia eutropha JMP134] >gi|72118240|gb|AAZ60503.1| PP-loop [Ralstonia eutropha JMP134] (484 aa)
Score = 127, Expect = 1.7e-05, Identities = 43/177 (24%), Positives = 87/177 (49%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA--------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL----GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +A+SGG DS+ALL+  +  V A          HV++  +  +D  +    D C ++ L  FV    +    +      ++   R  RY+    + +  G + +L AH  +D +E+  + L +      +     +R+  +   ++L+RP L   +  ++ YC +  + ++ D +N   RY+RN +R  +
  S:    48 VALSGGRDSVALLHATQAAVSAWRMPARVVALHVHHGLQAQADAWDAFCADLCARWELGYFV----RRVSVQAGTGEGIEAAARRARYEALGDMCRASGARFLLFAHHLDDQVETVLLRLFRGAGVAGMSGMPAMRKLDEAGDIMLLRPWLEVPRADIDSYCAAHELAWIDDPSNDSTRYARNALRAQL 232
>gi|66880311|ref|ZP_00405293.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Mycoplasma genitalium G-37] (71 aa)
Score = 127, Expect = 1.7e-05, Identities = 27/67 (40%), Positives = 38/67 (56%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDV 68
           + +Y+  VSGG DSM +L   +  +  V HVNY+ R  S  D+K+V  YC+K N+ L V     D V
  S:     4 EKQYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVEQYCQKLNIPLVVHTVDPDLV 70
>gi|91223706|ref|ZP_01258970.1| putative ATPase [Vibrio alginolyticus 12G01] >gi|194539376|ref|YP_002074428.1| pyridoxamine 5'-phosphate oxidase [Vibrio sp. Ex25] >gi|91191198|gb|EAS77463.1| putative ATPase [Vibrio alginolyticus 12G01] >gi|151937931|gb|EDN56776.1| pyridoxamine 5'-phosphate oxidase [Vibrio sp. Ex25] (297 aa)
Score = 127, Expect = 1.7e-05, Identities = 57/185 (30%), Positives = 91/185 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+   +L +A      V  VN  D++     E I+ +Y +  N+  ++ D     V K K      T        R   Y F EKI    G  K+ + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +K L +Y   K+   +  +     +   R  ++ M+ EWDKKT
  S:    41 MACISGGKDSFAMLDILLNLQKAAPIKFEVVAVNL-DQKQPGFPEHILPEYFETLNIPYYIVDKDTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKI----GATKLALGHHMDDIVETMFL-------NMFHGSRLKAMPPKLRSDDGRNVVIRPLTYCREKDLIKYAEHKDFPIIPCNLCGSQENLQRQSIKAMLIEWDKKT 233
>gi|154247011|ref|YP_001417969.1| tRNA(Ile)-lysidine synthetase [Xanthobacter autotrophicus Py2] >gi|154161096|gb|ABS68312.1| tRNA(Ile)-lysidine synthetase [Xanthobacter autotrophicus Py2] (368 aa)
Score = 127, Expect = 1.9e-05, Identities = 53/179 (29%), Positives = 87/179 (48%)
  Q:     4 KYLIAVSGGPDSMALL----------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSK-YKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKM 182
           + LIAVSGGPDS ALL               L+ A   V++  R ++  + + V  +        F+   H+  + +  K  + +Q   RE RYD     ++E G   I +AH ++D  E+    L +    +   G+R  +    L L+RPLL+  K  L     + ++ FV D +N   R++R  +R M
  S:    31 RILIAVSGGPDSTALLYLAARWRAGRASGPDLIAAT--VDHGLRAEAAAEAEAVGAFAT------FLGVPHRILIWQGAKPTHGIQEAAREARYDLLADAAREAGATAIALAHTRDDQAETVLFRLARGSGLSGLSGMRGDAARDGLALLRPLLDVPKARLVATLEAASVAFVRDPSNSDPRFARPRLRAM 213
>gi|126725520|ref|ZP_01741362.1| PP-loop family protein [Rhodobacterales bacterium HTCC2150] >gi|126704724|gb|EBA03815.1| PP-loop family protein [Rhodobacterales bacterium HTCC2150] (419 aa)
Score = 127, Expect = 2.0e-05, Identities = 47/163 (28%), Positives = 78/163 (47%)
  Q:     7 IAVSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSL-NKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTN 169
           +AVSGG DSMALL        +  H++  V  V++  R D+  + + V D+C    L   V  T    V +     N     R  RYD  +  ++ L +  + + H ++D  E+  MS+  K+  +    +R +     L+L+RPLL   +  L Q     +I +  D +N
  S:    28 VAVSGGSDSMALLVLANAWAIENGHVLYVVT-VDHQLRPDARVEAETVGDFCSTLGLPHQVL-TWNGWVGR----GNKAELARNARYDLMQVWAKSLRLNGLFLGHTEDDQAETLLMSIARKSGVDGLSAMRARRAHGDLVLMRPLLGFARGDLRQILTEGDISWADDPSN 192
>gi|119504829|ref|ZP_01626907.1| cell cycle protein [marine gamma proteobacterium HTCC2080] >gi|119459434|gb|EAW40531.1| cell cycle protein [marine gamma proteobacterium HTCC2080] (426 aa)
Score = 127, Expect = 2.0e-05, Identities = 47/175 (26%), Positives = 93/175 (53%)
  Q:     6 LIAVSGGPDSMALLN-----------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD-THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNK-KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ +SGG DS+ALL+           ++R  + AV H+++    ++D   ++  D C++ ++ L V+  T   D  K      ++   R  RY  +    QEL   ++L+ AH  +D +E+    L +      F G+ R+ +    +L RPLL   +  ++++  ++ + +VID +N   R+ R  +R
  S:     1 MLGLSGGCDSIALLHLAHAWLDHVGPERRPALRAV-HIHHGLAPEADAWVEVCHDVCQQLSIALSVYRVTPVTDEGK-----GIEAAARTARYSVYR---QELKSGEVLLLAHHADDQVETVLQRLLRGTGPKGFAGMPRRRELGQGVLSRPLLGVARSVIKRWADNRELAYVIDASNQDMRFDRGFLR 180
>gi|145298953|ref|YP_001141794.1| hypothetical protein ASA_1975 [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851725|gb|ABO90046.1| conserved hypothetical protein [Aeromonas salmonicida subsp. salmonicida A449] (302 aa)
Score = 127, Expect = 2.1e-05, Identities = 52/186 (27%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL-VEAVCHVNY----HDREDSDNDEKIVRDYCKKY--NLKLFVFDTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS A+L+    L   A  H +      D++     E ++ +Y      + K+   DT+   KD V + K    L +    +R     + +QELG  KI + H ++D LE+ ++       N+F G + KS    L       ++IRPL    +K L +Y   K    +  +     +   R  +++MM +WD++
  S:    39 KIMVCLSGGKDSFAMLDILMSLKASAPIHFDLVAVNLDQKQPGFPEHVLPEYLATLGVDFKIVEEDTYSIVKDKVPEGKTTCALCS---RLRRGILYRTAQELGCTKIALGHHRDDILETLFL-------NMFYGGKLKSMPPKLVSDDGKNVVIRPLAYCKEKDLVRYAEVKAFPIIPCNLCGSQENLQRQAIKQMMQDWDRR 232
>gi|117619906|ref|YP_856828.1| tRNA s2C32 biosynthesis protein TtcA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117561313|gb|ABK38261.1| tRNA s2C32 biosynthesis protein TtcA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (302 aa)
Score = 127, Expect = 2.1e-05, Identities = 49/186 (26%), Positives = 87/186 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL-VEAVCHVNY----HDREDSDNDEKIVRDYCKKY--NLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS A+L+    L   A  H +      D++     E ++ +Y      + K+   DT+     K  +          +R     + +QELG  KI + H ++D LE+ ++       N+F G + KS    L+       +IRPL    +K L +Y   K    +  +     +   R  +++MM EWD++
  S:    39 KVMVCLSGGKDSFAMLDILMSLKASAPIHFDLVAVNLDQKQPGFPEHVLPEYLTTLGIDFKIVEEDTYAIVKEKVPEGKTTCALCSRLRRGILYRTAQELGCTKIALGHHRDDILETLFL-------NMFYGGKLKSMPPKLVSDDGKNVVIRPLAYCKEKDLVRYAEVKAFPIIPCNLCGSQENLQRQAIKQMMQEWDRR 232
>gi|78777588|ref|YP_393903.1| hypothetical protein Suden_1391 [Sulfurimonas denitrificans DSM 1251] >gi|78498128|gb|ABB44668.1| conserved hypothetical protein [Sulfurimonas denitrificans DSM 1251] (260 aa)
Score = 126, Expect = 2.2e-05, Identities = 46/163 (28%), Positives = 87/163 (53%)
  Q:     4 KYLIAVSGGPDSMALLNK-KRHLVEAVCHVNYHDREDS----DNDEKIVRDYCKKYNLKLFVFDTHKDDVS--KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVID 166
           K L+ +SGG DS+ L++  K     A     +     S    +N EK+ + +CK++ +   V+DT+  D++  K +  ++  +++  +R       +Q+ G  K+ + H  +D  ES +M+   N +   L  + K+  R +I+IRPL+   ++ LE + R  NIE + D
  S:    36 KILVGLSGGKDSLTLIHALKEQQRRAPFKFEFIAVTISYGMGENYEKL-KAHCKEHKIDYEVYDTNIYDIAEDKIRKNSSFCSFFSRMRRGSLYSAAQKYGCNKVALGHHMDDAAESFFMNFIYNGQLRSLAPKYKAD-RGVIVIRPLIEMRERQLEAFVRENNIETIGD 203
>gi|57233795|ref|YP_182129.1| PP-loop family protein [Dehalococcoides ethenogenes 195] >gi|57224243|gb|AAW39300.1| PP-loop family protein [Dehalococcoides ethenogenes 195] (470 aa)
Score = 126, Expect = 2.4e-05, Identities = 53/175 (30%), Positives = 83/175 (47%)
  Q:     6 LIAVSGGPDSMALLNKKRHLV------EAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT--WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS------LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVSGGPDS+ +L     L         + H+N+  R E+S+ D   V +      + L      K  V  Y+  ++L T    RE+RY F  + + E G   + + H  +D +E+  + L +      L   R    R+      L +IRPLL  ++   + YC    +  V D TN      RN +R
  S:    22 LLAVSGGPDSVCMLYIMHKLSCEMGFSLRLAHLNHSLRGEESERDAAYVAELAAALGVPLC---QQKVSVKAYQAEHHLSTEEAAREMRYAFLCRTAAEYGSAAVAVGHTTDDNIETVMLHLVRGSGTRGLQGLRPVLNRTVAGEGCLRVIRPLLGLSRAETQNYCCEAGLSPVQDVTNQSTDLLRNRIR 208
>gi|19071761|gb|AAL80000.1| RASPBERRY3 [Arabidopsis thaliana] (662 aa)
Score = 126, Expect = 2.6e-05, Identities = 51/186 (27%), Positives = 97/186 (52%)
  Q:     7 IAVSGGPDSMAL--------------LNKKRHLVEAVCH--VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKN----------------KKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           + VSGGPDSMAL              +NK    ++ +    V++  R++S ++ ++V     +  ++  +     D V     + +LQ   RE+RY+    +     I+ +LIAH  +D  E   + L+++                 +NL L  +   K +S+ L+ PLL+  K+ + + C+    ++V D TN    + RN +R  +      +F+
  S:    89 LGVSGGPDSMALCVLTAKWKTQGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIASC--DWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLDAKHM-KNQSIRLVGPLLDFWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGNLQSGSFK 303
>gi|94986853|ref|YP_594786.1| ATPase [Lawsonia intracellularis PHE/MN1-00] >gi|94731102|emb|CAJ54464.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Lawsonia intracellularis PHE/MN1-00] (341 aa)
Score = 126, Expect = 2.7e-05, Identities = 52/175 (29%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHL-VEAV-CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS----KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++  SGG DSMAL      L ++ V  H+++  R +S +D   V+ +    + +  +    + D+S    KYK    ++   R+ RY F E++ +E G + I   H  ND  E   + L +      L G++   K R   L+RPLL   +  L  +  S+NI +V D +N    + RN +R
  S:    41 IVGCSGGVDSMALALILHCLGIDVVFAHMDHQLRAESKDDANHVKSFAAALDRRCII---SRVDISGLAIKYK--KGIEETARQERYCFLEQVRKEYGAQWIATGHHLNDLSEDILLRLLRGTGWPGLAGMKAVDKKR--YLLRPLLTTRRTLLVSFLSSQNISWVEDNSNKDITFKRNRIR 215
>gi|28898307|ref|NP_797912.1| putative ATPase [Vibrio parahaemolyticus RIMD 2210633] >gi|28806524|dbj|BAC59796.1| putative ATPase [Vibrio parahaemolyticus RIMD 2210633] (297 aa)
Score = 125, Expect = 2.9e-05, Identities = 56/185 (30%), Positives = 91/185 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+   +L +A      V  VN  D++     E I+ +Y +  N+  ++ D     V K K      T        R   Y F EKI    G  K+ + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +K L +Y   K+   +  +     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLNLQKAAPIKFEVVAVNL-DQKQPGFPEHILPEYFETLNIPYYIVDKDTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKI----GATKLALGHHMDDIVETMFL-------NMFHGSRLKAMPPKLRSDDGRNVVIRPLTYCREKDLIKYAEHKDFPIIPCNLCGSQENLQRQAIKAMLIDWDKKT 233
>gi|62178806|ref|YP_215223.1| tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62126439|gb|AAX64142.1| cell cycle protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (430 aa)
Score = 125, Expect = 3.0e-05, Identities = 49/177 (27%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRH--LVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L A SGG DS  LL+     ++RH  +     H+++     +D+  +     C+++ + L V     + V+   +   ++   RE RY  F   +Q L   ++L  A   +D  E+  ++L +      L  +  +S F   +L+RPLL +T+K+LEQ+     + ++ D +N  D Y RN +R
  S:    15 RILAAFSGGLDSTVLLHQLVLWRERHPDVTLRAIHIHHGLSPHADSWVRHCETVCERWQVPLVV-----ERVTLADNGLGIEAHAREARYRAF---AQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKTLEQWAVRHGLCWIEDESNQDDAYDRNFLR 192
>gi|16759227|ref|NP_454844.1| tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29140776|ref|NP_804118.1| tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|61216696|sp|Q8Z996|TILS_SALTI tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|25325274|pir||AG0531 cell cycle protein MesJ [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501518|emb|CAD08695.1| cell cycle protein MesJ [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136400|gb|AAO67967.1| cell cycle protein MesJ [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|33356621|gb|AAQ16558.1| putative cell cycle protein [Salmonella enterica subsp. enterica serovar Typhi] (430 aa)
Score = 125, Expect = 3.0e-05, Identities = 49/177 (27%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRH--LVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L A SGG DS  LL+     ++RH  +     H+++     +D+  +     C+++ + L V     + V+   +   ++   RE RY  F   +Q L   ++L  A   +D  E+  ++L +      L  +  +S F   +L+RPLL +T+K+LEQ+     + ++ D +N  D Y RN +R
  S:    15 RILAAFSGGLDSTVLLHQLVLWRERHPDVTLRAIHIHHGLSPHADSWVRHCETVCERWQVPLVV-----ERVTLADNGLGIEAHAREARYRAF---AQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKTLEQWAVRHGLCWIEDESNQDDAYDRNFLR 192
>gi|16763626|ref|NP_459241.1| tRNA(Ile)-lysidine synthetase [Salmonella typhimurium LT2] >gi|167990123|ref|ZP_02571223.1| tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168264644|ref|ZP_02686617.1| tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|61216700|sp|Q8ZRN5|TILS_SALTY tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|16418741|gb|AAL19200.1| cell cycle protein [Salmonella typhimurium LT2] (430 aa)
Score = 125, Expect = 3.0e-05, Identities = 49/177 (27%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRH--LVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L A SGG DS  LL+     ++RH  +     H+++     +D+  +     C+++ + L V     + V+   +   ++   RE RY  F   +Q L   ++L  A   +D  E+  ++L +      L  +  +S F   +L+RPLL +T+K+LEQ+     + ++ D +N  D Y RN +R
  S:    15 RILAAFSGGLDSTVLLHQLVLWRERHPDVTLRAIHIHHGLSPHADSWVRHCETVCERWQVPLVV-----ERVTLADNGLGIEAHAREARYRAF---AQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKTLEQWAVRHGLCWIEDESNQDDAYDRNFLR 192
>gi|153839797|ref|ZP_01992464.1| pyridoxamine 5'-phosphate oxidase [Vibrio parahaemolyticus AQ3810] >gi|149746686|gb|EDM57674.1| pyridoxamine 5'-phosphate oxidase [Vibrio parahaemolyticus AQ3810] (297 aa)
Score = 125, Expect = 3.0e-05, Identities = 56/185 (30%), Positives = 91/185 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+   +L +A      V  VN  D++     E I+ +Y +  N+  ++ D     V K K      T        R   Y F EKI    G  K+ + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +K L +Y   K+   +  +     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLNLQKAAPIKFEVVAVNL-DQKQPGFPEHILPEYFETLNIPYYIVDKDTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKI----GATKLALGHHMDDIVETMFL-------NMFHGSRLKAMPPKLRSDDGRNVVIRPLTYCREKDLIKYAEHKDFPIIPCNLCGSQENLQRQAIKAMLIDWDKKT 233
>gi|33151295|ref|NP_872648.1| cell-cycle protein MesJ [Haemophilus ducreyi 35000HP] >gi|61216603|sp|Q7VPN7|TILS_HAEDU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|33147515|gb|AAP95037.1| probable cell-cycle protein MesJ [Haemophilus ducreyi 35000HP] (428 aa)
Score = 125, Expect = 3.1e-05, Identities = 49/178 (27%), Positives = 88/178 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEAVCHVNYHD--REDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           L+++SGG DS+ LL+        +  +  H     ++DN        CK+YN+    F   K  V K   I   +   R  RY   + I++ +   +IL  AH  ND  E+  ++L +      L  ++  S  +++ + RPLL+ TKK ++QY + + + ++ D +N  + Y RN +R  +
  S:    21 LLSLSGGIDSVVLLDLFSRTTTPLRAIYIHHGLSANADNWADFCEALCKQYNIP---FILQKVTVDKSTGI---EAGARTARY---KAIAEHIQANEILATAHHLNDQAETFLLALKRGSGVKGLSAMQIVSHRQNMTIFRPLLSTTKKEIQQYAKQQQLCWIEDESNQNNHYDRNFLRNQI 193
>gi|155370502|ref|YP_001426036.1| hypothetical protein FR483_N404R [Paramecium bursaria Chlorella virus FR483] >gi|155123822|gb|ABT15689.1| hypothetical protein FR483_N404R [Paramecium bursaria Chlorella virus FR483] (513 aa)
Score = 124, Expect = 3.7e-05, Identities = 50/185 (27%), Positives = 89/185 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN-LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYT--NFWDRYSRNVVRKMMAEWDK 188
           K ++++SGG DSM   +    L EA      V  VNY +R+ +  +E  V D+   +   L V     D++ + +  NN L+T Y +   D      + LG   +++ H K+D LE+   ++   +K +   G+        +   RPLL+ +K  +  Y R   I F+ + T         RN V  ++ +W++
  S:   210 KLIMSISGGSDSMVAFHIIHGLKEAFGYDIDVVMVNYTNRDSAYAEEAFVADWVNSFGYPLHV--RRIDEIKRKQCANNQLRTVYEKYTRDVRYATYKTLGPHPVVMGHNKDDCLENILQNIGSCQKYDNLSGMDTLVVQDGIPFFRPLLDVSKNDIVAYAREHQIPFLPNSTPPTMKRGQIRNKVAPVLNDWNE 402
>gi|146329382|ref|YP_001209278.1| tRNA(Ile)-lysidine synthetase [Dichelobacter nodosus VCS1703A] >gi|146232852|gb|ABQ13830.1| tRNA(Ile)-lysidine synthetase [Dichelobacter nodosus VCS1703A] (415 aa)
Score = 124, Expect = 3.8e-05, Identities = 47/176 (26%), Positives = 82/176 (46%)
  Q:     5 YLIAVSGGPDSMALLN----KKRHLVEA--VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           YL+A SGG DS+ALL+    +K  L     + ++N+   +D+    ++V      Y         H       K   N +   R+ RY  F ++    G+  +L AH ++D  E+  ++L +    +    +  +  F +    RP L   +  +E Y +S+ + FV D +N   RY RN +R
  S:    21 YLLACSGGRDSIALLHALYQQKTQLSAPLEIVYINHGWHQDAAKWGELVATRAAAYGFSFRSVSLH------LKATKNAEAVARKARYQAFAQLLPVNGV--LLTAHHQDDQAETLLLNLCRGSGLDGLSAMPLRRSFAAGEHWRPWLLHARAEIEDYLKSQQLTFVDDSSNTDTRYQRNWLR 195
>gi|152993337|ref|YP_001359058.1| hypothetical protein SUN_1754 [Sulfurovum sp. NBC37-1] >gi|151425198|dbj|BAF72701.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1] (265 aa)
Score = 124, Expect = 3.9e-05, Identities = 40/163 (24%), Positives = 82/163 (50%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE--------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVS--KYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVID 166
           + L+ +SGG DS+AL++  +H+            C V Y      D     +  +C++Y +K  V+DT+  ++S    ++ ++  +++  +R       +++ G  K+ + H  +D +ES +M++  N     L    K+  R   LIRPL+   +  L  +    N++ + D
  S:    37 RVLVGLSGGKDSLALVHGLKHIQRHAPFRFEFEACTVKYG---MPDEHYDFLSKHCEEYGIKHTVYDTNIFEISHNTIRENSSFCSYFSRMRRGALYTFAEQGGFNKVALGHHFDDTVESFFMNMFYNGTMRALAPIYKTG-RGFHLIRPLIQARESQLRAFADDNNLQVIGD 205
>gi|119471144|ref|ZP_01613676.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Alteromonadales bacterium TW-7] >gi|119445800|gb|EAW27082.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Alteromonadales bacterium TW-7] (434 aa)
Score = 124, Expect = 4.1e-05, Identities = 49/190 (25%), Positives = 95/190 (50%)
  Q:     5 YLIAVSGGPDSMALLNKKRHLVE-------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL----ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           + +A+SGG DS+ LL+    L +       +  +VN+   E +++ +   ++ C + ++    F+T +  +S  +   +L+   RE RY   +++S    +  IL+    ND +E+  + L +       G+      R L    I  RPLL+ T+  +E +  + NI  + D +N  +R+ RN +R  +     K F+ F
  S:    25 FTVALSGGVDSVVLLHVMHVLKQEMPKLKVSAIYVNHGLSEYANDWQAFCQNLCVELDIP---FNTAQVTISP-QTRTSLEAQAREARYKALDELSAPQSV--ILLGQHLNDQIETFLLRLKRGSG--LKGLGAMQAMRELQSGRICYRPLLSITRSDIEHFATAFNIAHITDDSNTDERFDRNFLRARVVPELAKRFKGF 217
>gi|111115622|ref|YP_710240.1| hypothetical protein BAPKO_0840 [Borrelia afzelii PKo] >gi|123046902|sp|Q0SM64|TILS_BORAP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|110890896|gb|ABH02064.1| hypothetical protein BAPKO_0840 [Borrelia afzelii PKo] (440 aa)
Score = 124, Expect = 4.6e-05, Identities = 70/249 (28%), Positives = 118/249 (47%)
  Q:     2 KHKYLIAVSGGPDSMALL-NKKRHLVEAVC--HVNYHDREDSDNDEKI--VRDYCKKYNLKLFVFDTHKDDVSKYKDIN-NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQD-------------FDINYFLKIKNNYKESLIYLFLNHIGI 250
           K++ ++A SGG DS  LL N K +L   +   +  +  R D++ +++I  V+ +C  YN+ L +     D  S+   +  +++   R+ RY+  E   +E     I +AH +ND +E+  M   +     FL         +  +IRPLL  ++  +E +    NI   ID TN  + Y RN VR  +    +K F+ +         K +  I     +F N+ ++D             FD+  FL         LI+  LN  GI
  S:    23 KNRVIVAFSGGADSTTLLLNLKYYLSNNIIAFYFAHFIRPDNEQNKEIEHVKGFCDLYNIALQIKKCDIDIKSESVRLGVSIEELARKCRYNALENALKENDANYIALAHNENDQIETIIMRFFQGS---FLDGLAGIPSVNKNIIRPLLEVSRPEIENFLSLNNIRVFIDSTNSQNLYLRNKVRNNLLPSIEKIFKGYE--------KCLKRISEFSKEFVNYFEKDEFFPVEKGKYYYSFDLKAFLDFPKYLVFRLIFKILNSEGI 279
>gi|33862207|ref|NP_893768.1| hypothetical protein PMM1651 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|61216598|sp|Q7UZL1|TILS_PROMP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|33634425|emb|CAE20110.1| conserved hypothetical protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (336 aa)
Score = 123, Expect = 5.1e-05, Identities = 55/176 (31%), Positives = 90/176 (51%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKK-------ILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL----ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           LIAVSGG DSMALLN       + +    V H ++   + S      ++ YC K N+  F    +K+++S  +         R+ RY    + + +L I+        +L  H   D  E+  ++L +     + G+   +K R L     LIRPLL  +++  +++C+ +NI    D TN      RN+VRK
  S:    36 LIAVSGGQDSMALLNLINDMKTQHNWFVNVWHGDHQWHKKSAKYALELKSYCNKKNISFFFDQANKNNISSEEKA-------RDWRYKKLSERANQLLIENQKEIDIYLLTGHTNTDNAETFLLNLARGSN--YAGLSNINKKRLLKHHIFLIRPLLIFSREDTKKFCQLQNIPIWEDPTNCDLTIKRNIVRK 219
>gi|186685996|ref|YP_001869192.1| tRNA(Ile)-lysidine synthetase [Nostoc punctiforme PCC 73102] >gi|186468448|gb|ACC84249.1| tRNA(Ile)-lysidine synthetase [Nostoc punctiforme PCC 73102] (331 aa)
Score = 123, Expect = 5.4e-05, Identities = 47/189 (24%), Positives = 87/189 (46%)
  Q:     3 HKYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
            + LIAVSGG DS+ L+     L         + H ++  R DS  +   V +  + + +  F  +T  + +       N +   R+ RY     I+Q    + I+  H  +D  E+   +L +      L     ++     ++L+RPLL  T+   EQ+C+   +    D TN   +Y+RN +R+ +  + ++ F
  S:    24 QRLLIAVSGGQDSLCLIKLLLDLKSKWGWDLGIAHCDHRWRSDSQANANHVENLAETWGIS-FYLETANEPI-------NSEAAARDWRYQALSAIAQANNYQYIVTGHTASDRAETLLYNLIRGTGADGLQALTWQRPLTTGIMLVRPLLEVTRIQTEQFCQEFKLPIWEDSTNQDLQYARNRIRQELIPYLRENF 212
>gi|153947345|ref|YP_001400015.1| tRNA(Ile)-lysidine synthetase [Yersinia pseudotuberculosis IP 31758] >gi|152958840|gb|ABS46301.1| tRNA(Ile)-lysidine synthase [Yersinia pseudotuberculosis IP 31758] (451 aa)
Score = 123, Expect = 6.0e-05, Identities = 47/175 (26%), Positives = 88/175 (50%)
  Q:     6 LIAVSGGPDSMALLNK----KRHLVEAV----CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+  SGG DS  LL+     ++ L+  +     H+++     +D+  K     C ++ ++L V   + D        N ++   R  RY  F   S  L  K++L+  Q  +D  E+  ++L +      L  +  K  F    L+RPLL  +++ LE Y +++ ++++ D +N  DR+ RN +R
  S:    17 LVGFSGGLDSTVLLHLLVCLRQQLIPELNIRAIHIHHGLNPQADSWVKHCMQQCDQWKIELKVVRVNIDPRQ-----NGIEAAARTARYQAF---SANLAAKEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAAKMPFAHSQLLRPLLAFSREILENYAQAQQLQWIEDDSNQDDRFDRNFLR 193
>gi|51597300|ref|YP_071491.1| tRNA(Ile)-lysidine synthetase [Yersinia pseudotuberculosis IP 32953] >gi|186896405|ref|YP_001873517.1| tRNA(Ile)-lysidine synthetase [Yersinia pseudotuberculosis PB1/+] >gi|61217229|sp|Q667K7|TILS_YERPS tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|51590582|emb|CAH22223.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] >gi|186699431|gb|ACC90060.1| tRNA(Ile)-lysidine synthetase [Yersinia pseudotuberculosis PB1/+] (460 aa)
Score = 123, Expect = 6.0e-05, Identities = 47/175 (26%), Positives = 88/175 (50%)
  Q:     6 LIAVSGGPDSMALLNK----KRHLVEAV----CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+  SGG DS  LL+     ++ L+  +     H+++     +D+  K     C ++ ++L V   + D        N ++   R  RY  F   S  L  K++L+  Q  +D  E+  ++L +      L  +  K  F    L+RPLL  +++ LE Y +++ ++++ D +N  DR+ RN +R
  S:    26 LVGFSGGLDSTVLLHLLVCLRQQLIPELNIRAIHIHHGLNPQADSWVKHCMQQCDQWKIELKVVRVNIDPRQ-----NGIEAAARTARYQAF---SANLAAKEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAAKMPFAHSQLLRPLLAFSREILENYAQAQQLQWIEDDSNQDDRFDRNFLR 202
>gi|77957707|ref|ZP_00821756.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Yersinia bercovieri ATCC 43970] (451 aa)
Score = 123, Expect = 6.0e-05, Identities = 49/179 (27%), Positives = 87/179 (48%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVC--------------HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +  +L+  SGG DS  LL    HL+  VC              H+++     +D   K  +  C+++ + L V     D        N ++   R  RY  F   S  L   ++L+  Q  +D  E+  ++L +      L  +  +  F    L+RPLL  ++++LE Y R + ++++ D +N  DR+ RN +R
  S:    22 QRNFLVGFSGGLDSSVLL----HLL--VCIRDQLIPELKVRAIHIHHGLNPRADGWVKHCQQQCERWQIPLEVVRVSIDPRH-----NGIEAAARSARYQAF---SSHLAADEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAARMPFAHSQLLRPLLTLSRETLENYARIQQLQWIEDDSNQDDRFDRNFLR 202
>gi|16121362|ref|NP_404675.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis CO92] >gi|22126993|ref|NP_670416.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis KIM] >gi|45442556|ref|NP_994095.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis biovar Microtus str. 91001] >gi|108806535|ref|YP_650451.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis Antiqua] >gi|108813098|ref|YP_648865.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis Nepal516] >gi|145598932|ref|YP_001163008.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis Pestoides F] >gi|149366937|ref|ZP_01888970.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis CA88-4125] >gi|162418463|ref|YP_001607754.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis Angola] >gi|165927115|ref|ZP_02222947.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939833|ref|ZP_02228373.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Orientalis str. IP275] >gi|166011914|ref|ZP_02232812.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211335|ref|ZP_02237370.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399756|ref|ZP_02305274.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419749|ref|ZP_02311502.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425306|ref|ZP_02317059.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470891|ref|ZP_02335595.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis FV-1] >gi|61217402|sp|Q8ZH50|TILS_YERPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|21960038|gb|AAM86667.1|AE013912_11 cell cycle protein [Yersinia pestis KIM] >gi|45437421|gb|AAS62972.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Yersinia pestis biovar Microtus str. 91001] >gi|108776746|gb|ABG19265.1| hypothetical protein YPN_2938 [Yersinia pestis Nepal516] >gi|108778448|gb|ABG12506.1| hypothetical protein YPA_0538 [Yersinia pestis Antiqua] >gi|115346841|emb|CAL19727.1| conserved hypothetical protein [Yersinia pestis CO92] >gi|145210628|gb|ABP40035.1| hypothetical protein YPDSF_1650 [Yersinia pestis Pestoides F] >gi|149290551|gb|EDM40627.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis CA88-4125] >gi|162351278|gb|ABX85226.1| tRNA(Ile)-lysidine synthetase [Yersinia pestis Angola] >gi|165912236|gb|EDR30873.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Orientalis str. IP275] >gi|165921011|gb|EDR38235.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989180|gb|EDR41481.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Antiqua str. E1979001] >gi|166207106|gb|EDR51586.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962490|gb|EDR58511.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050464|gb|EDR61872.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055706|gb|EDR65490.1| tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) [Yersinia pestis biovar Mediaevalis str. K1973002] (460 aa)
Score = 123, Expect = 6.0e-05, Identities = 47/175 (26%), Positives = 88/175 (50%)
  Q:     6 LIAVSGGPDSMALLNK----KRHLVEAV----CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+  SGG DS  LL+     ++ L+  +     H+++     +D+  K     C ++ ++L V   + D        N ++   R  RY  F   S  L  K++L+  Q  +D  E+  ++L +      L  +  K  F    L+RPLL  +++ LE Y +++ ++++ D +N  DR+ RN +R
  S:    26 LVGFSGGLDSTVLLHLLVCLRQQLIPELNIRAIHIHHGLNPQADSWVKHCMQQCDQWKIELKVVRVNIDPRQ-----NGIEAAARTARYQAF---SANLAAKEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAAKMPFAHSQLLRPLLAFSREILENYAQAQQLQWIEDDSNQDDRFDRNFLR 202
>gi|154483317|ref|ZP_02025765.1| hypothetical protein EUBVEN_01018 [Eubacterium ventriosum ATCC 27560] >gi|149735827|gb|EDM51713.1| hypothetical protein EUBVEN_01018 [Eubacterium ventriosum ATCC 27560] (502 aa)
Score = 122, Expect = 6.4e-05, Identities = 59/188 (31%), Positives = 100/188 (53%)
  Q:     6 LIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFF----------------------------------EKISQELGIKKILIAHQKNDFLE---SAYMSLNKNKKNLFLGIRRKSKFRSL--------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           ++ VSGG DS+ +L      + + +L   V H+N+H R + + +D   V+D C+K N+     D     + K   +   +   R+ RY  F                                  E  ++E GIKK     +KN +     +   +LN N + +   + R +  + L        +++RPLL  T++ +E Y +SKNI +  D TN    YSRN +R  +  + K    K
  S:    22 ILGVSGGADSICMLYLLKDISSEMNLTLYVVHINHHIRGKQAQHDADYVKDVCRKLNVDFKQIDADVPLMVKQTGMTEEEAG-RQARYKAFFERAIEVKIKEKKQAKNQTKKPDESRKLSLKENKENSAKEDGIKKNDPKERKNSYNNIKIAVAHNLNDNSETVLFNLFRGTGIKGLTGIPVRRDMIVRPLLCCTRQEIEHYLKSKNISYCSDATNKETEYSRNKIRLELLPYIKNNINK 260
>gi|148978813|ref|ZP_01815166.1| putative ATPase [Vibrionales bacterium SWAT-3] >gi|145962124|gb|EDK27409.1| putative ATPase [Vibrionales bacterium SWAT-3] (297 aa)
Score = 122, Expect = 6.5e-05, Identities = 61/185 (32%), Positives = 90/185 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+    L EA      V  VN  D++     E I+ +Y +  N+  ++ D     V K K      T        R   Y F EKI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +  L +Y   K  EF I   N     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLRLREAAPIKFDVVAVNL-DQKQPGFPEHILPEYFETLNIPYYIVDKDTYSVVKEKIPEGKTTCGLCSRLRRGTLYSFAEKI----GATKIALGHHMDDIVETMFL-------NMFHGARLKAMPPKLRSDDGRNVVIRPLTYCRETDLIKYAEHK--EFPIIPCNLCGSQENLQRQSIKAMLIDWDKKT 233
>gi|87118609|ref|ZP_01074508.1| cell cycle protein [Marinomonas sp. MED121] >gi|86166243|gb|EAQ67509.1| cell cycle protein [Marinomonas sp. MED121] (434 aa)
Score = 122, Expect = 6.6e-05, Identities = 52/178 (29%), Positives = 92/178 (51%)
  Q:     3 HKYL--------IAVSGGPDSMALLN-----KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           H+YL        + +SGG DS+ALL+        H V+A+ H+++   +++D   +     C++Y +    F  HK ++   K  ++++   R  RYD F     +     +L+AH   D  E+    L +      L G+  K +  +  L RPLL+  K +L QY +   + +V D +N  + +SRN +R
  S:    17 HQYLGTKEQPIYLGLSGGVDSVALLHLLVEAGLGHRVKAI-HIHHGLSQNADAWYRFCEALCQQYQV---AFKGHKVELDTQK--HSIEEAARIARYDIFASYLNKNAY--LLLAHHAGDQAETLMFRLLRGTGGKGLAGMPAKRELGAGFLYRPLLSFDKTNLIQYVKQNGLTWVEDESNQDEAFSRNHIR 200
>gi|118474467|ref|YP_892648.1| PP-loop family protein [Campylobacter fetus subsp. fetus 82-40] >gi|118413693|gb|ABK82113.1| PP-loop family protein [Campylobacter fetus subsp. fetus 82-40] (250 aa)
Score = 122, Expect = 7.0e-05, Identities = 51/162 (31%), Positives = 84/162 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHL---------VEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVI 165
           K L+ +SGG DS+AL +  +H           EAV  ++Y   ED       +  +C+K+ +K  V D+   ++SK K   N    +++  +R  +    + E G  K+ IAH  +D  ES +M+   N     L  + ++K   L+LIRPL+N  ++ L       N+ FVI
  S:    27 KILLGLSGGKDSLALAHILKHFQNVTPDKFEFEAVT-LSYGMGEDY----AYLTAHCEKHGIKHSVIDSSIFEISKDKIRKNSSFCSFFSRMRRGYLYTYALEHGFNKLAIAHHLDDAAESFFMNFTYNGALRTLAPKYRAK-NGLVLIRPLINVRERQLRDNATKNNL-FVI 192
>gi|56412509|ref|YP_149584.1| tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|61216419|sp|Q5PD76|TILS_SALPA tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56126766|gb|AAV76272.1| cell cycle protein MesJ [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (430 aa)
Score = 122, Expect = 7.3e-05, Identities = 48/177 (27%), Positives = 90/177 (50%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRH--LVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKIL-IAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + L A SGG DS  LL+     ++RH  +     H+++     +D+  +     C+++ + L V     + ++   +   ++   RE RY  F   +Q L   ++L  A   +D  E+  ++L +      L  +  +S F   +L+RPLL +T+K+LEQ+     + ++ D +N  D Y RN +R
  S:    15 RILAAFSGGLDSTVLLHQLVLWRERHPDVTLRAIHIHHGLSPHADSWVRHCETVCERWQVPLVV-----ERMTLADNGLGIEAHAREARYRAF---AQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKTLEQWAVRHGLCWIEDESNQDDAYDRNFLR 192
>gi|91978603|ref|YP_571262.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisB5] >gi|91685059|gb|ABE41361.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisB5] (347 aa)
Score = 122, Expect = 7.3e-05, Identities = 50/178 (28%), Positives = 87/178 (48%)
  Q:     6 LIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKD-DVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           ++AVSGGPDS+ALL          KR     V  V++  R ++  + + V+   +  +L       H+    +  K    L    R  RY    K ++  G   I+ AH ++D  E+  M L++      L  + R+++    +L+RPLL+ +K+ L        IE+  D +N   R++R   R++M
  S:    28 VLAVSGGPDSLALLWLAARWRKALKRGPALGVVTVDHGLRPEAAREARAVKQLARTLDLP------HRTLRWTGEKPTTGLPAAARAARYRLLAKAAKRFGATHIMTAHTRDDQAETVLMRLSRGSGIAGLAAMARETERDGAVLVRPLLDVSKQRLIATLSKAQIEYTTDPSNLDPRFTRPRWRELM 209
>gi|113476777|ref|YP_722838.1| tRNA(Ile)-lysidine synthetase [Trichodesmium erythraeum IMS101] >gi|110167825|gb|ABG52365.1| tRNA(Ile)-lysidine synthetase [Trichodesmium erythraeum IMS101] (344 aa)
Score = 122, Expect = 7.9e-05, Identities = 53/178 (29%), Positives = 80/178 (44%)
  Q:     3 HKYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
            + LIAVSGG DS+ L         K     AV H ++  R DS+ +   V+     + L  +V    K     YK     + W    RY    KI+ E   + I+  H  +D  E+   +L +       G++  +  R LI      L+RPLL  T+     +C+ + I    D TN    Y+RN +R
  S:    32 QRILIAVSGGQDSLCLTKLLLDLQSKWGWYLAVAHCDHKWRSDSEANANYVKKIAINWQLPSYVETADK----IYKSEAEARKW----RYQVLSKIALEFNFQYIVTGHTASDRAETLLYNLIRGSGTE--GLQALTWQRPLIENFLPLLVRPLLEITRTQTSNFCQEQKIRIWEDSTNQDLHYARNRIR 211
>gi|145590171|ref|YP_001156768.1| PP-loop domain-containing protein [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048577|gb|ABP35204.1| PP-loop domain protein [Polynucleobacter sp. QLW-P1DMWA-1] (302 aa)
Score = 122, Expect = 8.0e-05, Identities = 47/186 (25%), Positives = 87/186 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ VSGG DS A+L+    L E       +  VN  D++  +   + + +Y +   +   +    +D  S  K +             +R     +++ ELG  KI + H ++D LE+  +++    K   +  + +S     I+IRPL    +K LE+Y    N   +  D         R V+++M+ +W+KK
  S:    37 KVMVCVSGGKDSYAMLDILMKLRERAPIDFEIVAVNL-DQKQPNFPAETLPNYLRSLGIPFHI--EEQDTYSIVKRVIPEGKTTCGLCSRLRRGILYRVADELGATKIALGHHRDDILETLMLNMFYAGKLKGMPPKLRSDDGKHIVIRPLAYVPEKLLERYAIDMNFPIIPCDLCGSQPNLQRQVMKEMLRDWEKK 230
>gi|77963156|ref|ZP_00826968.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Yersinia mollaretii ATCC 43969] (451 aa)
Score = 121, Expect = 8.6e-05, Identities = 49/176 (27%), Positives = 87/176 (49%)
  Q:     5 YLIAVSGGPDSMALLNKKRHLVEAVC--------------HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +L+  SGG DS  LL    HL+  VC              H+++     +D+  K  +  C+++ + L V     D        N ++   R  RY  F   S  L   ++L+  Q  +D  E+  ++L +      L  +  +  F    L+RPLL  +++ LE Y R++ ++++ D +N  DR+ RN +R
  S:    25 FLVGFSGGLDSSVLL----HLL--VCIRDQLIPELKVRAIHIHHGLNPLADDWVKHCQQQCERWQIPLEVVRVSIDPRH-----NGIEAAARTARYQAF---SSHLAANEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAARMPFAHSQLLRPLLTFSREMLESYARTQQLQWIEDDSNQDDRFDRNFLR 202
>gi|157962688|ref|YP_001502722.1| tRNA(Ile)-lysidine synthetase [Shewanella pealeana ATCC 700345] >gi|157847688|gb|ABV88187.1| tRNA(Ile)-lysidine synthetase [Shewanella pealeana ATCC 700345] (469 aa)
Score = 121, Expect = 8.7e-05, Identities = 50/179 (27%), Positives = 88/179 (49%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEA-------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKN--KKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + K ++A SGG DS  L +      +A       + HV++    ++D+  K      + Y L   +    K    K     +++   R +RY   + +  EL    +L+ AH ++D LE+  ++L +    K L    + +   +   LIRPLL+ +K  +E Y +  NI  + D +NF D+Y RN +R
  S:    32 RRKLVLAYSGGVDSEILAHGLSQFAKANLDIECLLVHVHHGLSLNADSWAKHCASQAQYYELGCAI----KRVEVKLAPRVSVEAQARTVRY---QALLSELEQGDVLMTAHHQDDQLETVLLALKRGLGPKGLAAMGKVQCFEQQHWLIRPLLDFSKVEIEVYAKQHNISHIEDESNFDDKYDRNFLR 213
>gi|155371675|ref|YP_001427209.1| hypothetical protein ATCV1_Z728L [Acanthocystis turfacea Chlorella virus 1] >gi|155124995|gb|ABT16862.1| hypothetical protein ATCV1_Z728L [Acanthocystis turfacea Chlorella virus 1] (504 aa)
Score = 121, Expect = 9.0e-05, Identities = 50/183 (27%), Positives = 92/183 (50%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHK-DDVSKYKDIN-----NLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYT--NFWDRYSRNVVRKMMAEWDKK 189
           +++SGG DSM L +    L         V  VNY +R  + ++E  V D+    N    V +  + D++S+   ++       +T+ R +RY  ++ I+++     + + H K+D LE+ + ++    K   L G+    +   +   RPLL   K  + +Y RS NI F+ + T  +F     RN +   M  W+ +
  S:   207 MSISGGVDSMTLFHILSGLRNVYGYELRVAMVNYANRACAYDEETFVADWV---NWNGHVLNIRRIDEISRKPCVDMGMRTTYETFTRNVRYGVYKTIARD---AYVAMGHNKDDVLENIFQNVAMETKYENLSGMDTVVEQDGIKFFRPLLGVAKDDIVEYARSHNIPFLPNSTPPHFMRGQIRNTIVPTMNAWNDR 398
>gi|86145984|ref|ZP_01064311.1| putative ATPase [Vibrio sp. MED222] >gi|85836189|gb|EAQ54320.1| putative ATPase [Vibrio sp. MED222] (297 aa)
Score = 121, Expect = 9.0e-05, Identities = 60/185 (32%), Positives = 93/185 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+    L EA      V  VN  D++     E I+ +Y +  N+  ++ D     V K K      T        R   Y F EKI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +  L QY  +++++F I   N     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLRLREAAPIKFDVVAVNL-DQKQPGFPEHILPEYFETLNIPYYIVDKDTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKI----GATKIALGHHLDDIVETMFL-------NMFHGARLKAMPPKLRSDDGRNVVIRPLTYCRETDLIQY--AEHLDFPIIPCNLCGSQENLQRQNIKAMLIDWDKKT 233
>gi|95930473|ref|ZP_01313209.1| tRNA(Ile)-lysidine synthetase-like [Desulfuromonas acetoxidans DSM 684] >gi|95133513|gb|EAT15176.1| tRNA(Ile)-lysidine synthetase-like [Desulfuromonas acetoxidans DSM 684] (415 aa)
Score = 121, Expect = 9.3e-05, Identities = 36/159 (22%), Positives = 78/159 (49%)
  Q:    22 KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN--LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + H    V H+++  R++S +D   V++   + +L+ F     + +V      N   L+   RE R  F  +++ ++G   I +AH ++D  E+  M L    +   +G     +++    IRP+L+  +  +  + +   +E+  D +N  +R+ RN++R
  S:     4 QHHFDVVVAHLDHGLRDESADDALFVQELAARLDLRFF---KRRVEVGGLAQRNRWGLEEAGREARRAFLSEVADQVGGAVIALAHHRDDQSETVLMHL---ARGCGVGGLAGMRWQEGKYIRPMLSICRNEINAFLQRHRLEWREDDSNRNERFKRNLIR 158
>gi|126667577|ref|ZP_01738547.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Marinobacter sp. ELB17] >gi|126628003|gb|EAZ98630.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Marinobacter sp. ELB17] (212 aa)
Score = 121, Expect = 9.7e-05, Identities = 50/174 (28%), Positives = 81/174 (46%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAVC---------HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKI--SQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           IA SGG DS  LL    HL  A+          H+N+  + ++   +   RD C + ++ L V         K + +  L+   R  RY  FE+   + EL    +L+AH  +D LE+    L +      L G+       +  L RPLL  ++  LE +     + ++ D +N   R+ RN +R
  S:    31 IAFSGGLDSSLLL----HLFAAITPASIALSALHINHQLQPNAAEVDAFCRDVCARLSVPLRVVSVTVP--VKAEGVGGLEQAARAARYGVFEQYLRADEL----LLLAHHGDDQLETVLFRLFRGSGVAGLAGMPFTRALCARALARPLLEFSRAQLEAWAEGAGLPWMEDPSNSDQRFDRNYLR 206
>gi|90416187|ref|ZP_01224119.1| mesJ protein [marine gamma proteobacterium HTCC2207] >gi|90331912|gb|EAS47126.1| mesJ protein [marine gamma proteobacterium HTCC2207] (458 aa)
Score = 120, Expect = 1.1e-04, Identities = 47/175 (26%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKR-----HLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+  SGG DS  LL+          + AV H+++    ++D+ ++  +  C    ++L       + V   K    L++  R+ RY  FE+   E G+  +L+ H  +D +E+    L +      L GI +     +  LIRPLLN+ K  L+ Y  ++ + ++ D +N  +++ RN +R
  S:    37 LVGFSGGLDSTVLLHLLCELLPPERITAV-HIHHGLSANADDWQQHAKTLCHSLGVRLI-----SESVVVNKTGAGLESAARDARYKVFEEHLIEDGL--LLLGHHADDQVETVLFRLLRGSGARGLSGIPQTRAVGAGHLIRPLLNQPKSRLQAYAEAQQLVWIEDESNQQEQFDRNYLR 209
>gi|26246135|ref|NP_752174.1| tRNA(Ile)-lysidine synthetase [Escherichia coli CFT073] >gi|61216659|sp|Q8FL00|TILS_ECOL6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|26106532|gb|AAN78718.1|AE016755_218 Putative cell cycle protein mesJ [Escherichia coli CFT073] (437 aa)
Score = 120, Expect = 1.1e-04, Identities = 48/175 (27%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D   K   + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  LEQ+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVKHCENICQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|119945858|ref|YP_943538.1| PP-loop domain-containing protein [Psychromonas ingrahamii 37] >gi|119864462|gb|ABM03939.1| PP-loop domain protein [Psychromonas ingrahamii 37] (309 aa)
Score = 120, Expect = 1.1e-04, Identities = 50/186 (26%), Positives = 87/186 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L+    L  A      +  VN  D++  D  E I+ +Y +K  +  K+   DT+     K  +     +    +R     + ++ELG  KI + H ++D L +  +       N+F G + KS    L+       +IRPL    +K +E Y + K    +  +         R V + M+ EWD K
  S:    39 RVMVCLSGGKDSFTMLDILLELRAAAPIHFEIIAVNL-DQKQPDFPEHILPEYLQKLGVDYKIVEEDTYSIVQDKIPEGKTTCSLCSRLRRGILYRTAKELGATKIALGHHRDDLLATLML-------NMFFGGKLKSMPAKLVSDNGEHVVIRPLAYCKEKEIEAYAKLKEYPIIPCNLCGSQPNLQRQVTKNMLNEWDVK 232
>gi|88801375|ref|ZP_01116903.1| putative cell-cycle protein [Polaribacter irgensii 23-P] >gi|88782033|gb|EAR13210.1| putative cell-cycle protein [Polaribacter irgensii 23-P] (436 aa)
Score = 120, Expect = 1.1e-04, Identities = 52/179 (29%), Positives = 88/179 (49%)
  Q:     2 KHKYLIAVSGGPDSMAL--LNKKRHLVEAVCHVNYHDRE-DSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL-FLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + LIA+SGG DS+ L  L         + H N++ R  +S+ D   V +  K+  +K F      + ++K K   + Q   R +RY +F++IS       IL AH  +D LE+  ++L +      F GI          +IRPLL  +++ +  + +  NI +  D +N   +Y RN +R
  S:    18 EKRLLIAISGGLDSVVLTRLLSTLKFDITLAHCNFNLRGIESNLDAIFVEELAKELAVKCFSTSFKTEKLAKEKK-ESTQIAARNLRYHWFQEISARHHFDYILTAHHADDNLETFLINLTRGTGLAGFTGIPPVHGN----VIRPLLQFSREEILHFAKENNICWREDQSNASTKYLRNKIR 195
>gi|149376348|ref|ZP_01894111.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Marinobacter algicola DG893] >gi|149359362|gb|EDM47823.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Marinobacter algicola DG893] (303 aa)
Score = 120, Expect = 1.1e-04, Identities = 55/186 (29%), Positives = 97/186 (52%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYRE-IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K +  +SGG DS A+L+   +L ++      +  VN  D++     E+++ +Y     ++  +   DT+   K+ V + K    L +  R  I Y+F    ++E G+ KI + H ++D LE+ ++       N+F G + KS    L        +IRPL    +K + +Y R +  EF I   N     +   R V++ M   WDK+
  S:    51 KVMCCLSGGKDSYAMLDILLNLQKSAPVRFELIAVNL-DQKQPGFPEEVLPEYLSALGIEYHIIEKDTYSIVKEKVPEGKTTCGLCSRLRRGILYNF----AEEHGVTKIALGHHRDDLLETLFL-------NMFYGGKLKSMPPVLHSDDGRNTVIRPLAYSREKDIARYARLR--EFPIIPCNLCGSQENLQRQVIKDMFQGWDKQ 244
>gi|123967074|ref|YP_001012155.1| ATPase [Prochlorococcus marinus str. MIT 9515] >gi|123201440|gb|ABM73048.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Prochlorococcus marinus str. MIT 9515] (338 aa)
Score = 120, Expect = 1.2e-04, Identities = 50/178 (28%), Positives = 89/178 (50%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKK-------ILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS--LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K LI+VSGG DSMALLN       + +    + H ++   E S+     +++YC + N+  F    +K  +S  +         R+ RY    + + +L I+        +L  H   D  E+  ++L +      L    K +     + LIRPLL  +++  +++C+ + I    D TN+  +  RN++RK
  S:    34 KLLISVSGGQDSMALLNLINDMKMQHNWFVNIWHGDHQWHEKSETYALELKNYCNQKNISFFFDRANKQTISSEEKA-------RDWRYKKLTERANQLFIENQKEIDIYLLTGHTNTDNAETFLLNLARGSNYAGLSYIEKKRLLEPHIFLIRPLLIFSREDTKKFCQLQKIPIWEDPTNYDLKIKRNLIRK 219
>gi|124514863|gb|EAY56374.1| PP-loop-containing protein [Leptospirillum sp. Group II UBA] (504 aa)
Score = 120, Expect = 1.3e-04, Identities = 49/187 (26%), Positives = 88/187 (47%)
  Q:     5 YLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDR-EDSDNDEKIVRDYCKKYN--LKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK-KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           + +A+SGG DS+ L        + RH +  V H N+  R ++++ DE  +R++ +     L++ +      D       N  + + R+ RY FF+ +  E     + +AH ++D +E+  M+L +       LG+  K   R   + RPLL      +        I + ID +N    Y RN VR  +    ++ F
  S:    42 FHVAISGGADSVFLAFLLHLFLEDRHSLTLV-HFNHRTRGKENEEDEIFLRNFARHIGRPLRIGILSEPLPD-------NVPEDFLRKKRYAFFDTLLTENRKNILFLAHHQDDQVETILMNLFRGTGPKGVLGMLNKPDRR---IFRPLLETGADEIRNVLSDHRIPYRIDSSNLQHDYLRNRVRMELVPTIRRIF 227
>gi|126090134|ref|YP_001041615.1| hypothetical protein Sbal_4497 [Shewanella baltica OS155] >gi|126174427|ref|YP_001050576.1| PP-loop domain-containing protein [Shewanella baltica OS155] >gi|125997632|gb|ABN61707.1| PP-loop domain protein [Shewanella baltica OS155] >gi|125999790|gb|ABN63860.1| hypothetical protein Sbal_4497 [Shewanella baltica OS155] (310 aa)
Score = 120, Expect = 1.3e-04, Identities = 53/186 (28%), Positives = 95/186 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K +  +SGG DS A+L+   +L +       +  VN  D++     E ++  Y +K N+   +   DT+   KD + + K   +L +    +R       +Q +G  KI + H ++D +E+ ++       N+F G + K+    L       ++IRPL    +K LE+Y   K  EF I   N     +   R  V+ M+ +WD++
  S:    39 KIMCCLSGGKDSYAMLDILMNLQQRAPIQFEIIAVNL-DQKQPGFPEHVLPAYLEKLNVPYHILEKDTYSIVKDKIPEGKTTCSLCS---RLRRGTLYGFAQRIGATKIALGHHRDDIIETLFL-------NMFFGGKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYANLK--EFPIIPCNLCGSQENLKRAAVKDMLNQWDRQ 232
>gi|86133422|ref|ZP_01052004.1| hypothetical protein MED152_01920 [Tenacibaculum sp. MED152] >gi|85820285|gb|EAQ41432.1| hypothetical protein MED152_01920 [Polaribacter dokdonensis MED152] (265 aa)
Score = 120, Expect = 1.3e-04, Identities = 49/216 (22%), Positives = 108/216 (50%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCK--KYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNW 219
           K ++ +SGG DS  LL+   +  + V  +N+       D++     E+++  Y    K + K+   +T+K  + K  +     +    +R     + +++LG  K+ + H KND LE+ ++++  + K   +  + K+    L+++RPL    +  +E++   KN   +  +     +   R  V++M+A W+K+   +  + +    L+N+F   LLD+   ++
  S:    30 KIMVCLSGGKDSYTLLDLLLYF-QKVAPINFDLIAVNLDQKQPGFPEEVLPTYLSNLKVDFKIIEKNTYKVVMDKTPEGKTTCSLCSRLRRGTLYEAAKDLGCNKLALGHHKNDILETFFLNMFFSGKLETMPPKFKNDAGDLVVLRPLAFCNESDIEEFSNYKNYPIIPCNLCGSQENLQRKKVKEMIAHWEKEFPNRNAIMMN--ALQNVFPSHLLDTNLYDF 251
>gi|155122075|gb|ABT13943.1| hypothetical protein MT325_M389R [Paramecium bursaria chlorella virus MT325] (499 aa)
Score = 120, Expect = 1.3e-04, Identities = 49/185 (26%), Positives = 85/185 (45%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYT--NFWDRYSRNVVRKMMAEWDK 188
           K ++++SGG DSM   +    L EA      V  VNY +R  +  +E  V D+   +   L V    +    +  D N L+T Y +   D      + LG   +++ H K+D LE+   ++   +K +   G+        +   RPLL+ +K  +  Y R   I F+ + T         RN V  ++ +W++
  S:   196 KLIMSISGGSDSMVAFHIIHGLKEAFGYDIDVVMVNYTNRNSAYAEEAFVADWVNSFGYPLHVRRIDEIKRKQCAD-NQLRTVYEKYTRDVRYATYKTLGPHPVVMGHNKDDCLENILQNIGSCQKYDNLSGMDTLVVQDGIPFFRPLLDVSKNDIVAYAREHQIPFLPNSTPPTMKRGQIRNKVAPVLNDWNE 388
>gi|89900146|ref|YP_522617.1| tRNA(Ile)-lysidine synthetase-like [Rhodoferax ferrireducens T118] >gi|89344883|gb|ABD69086.1| tRNA(Ile)-lysidine synthetase-like [Rhodoferax ferrireducens T118] (320 aa)
Score = 119, Expect = 1.4e-04, Identities = 48/188 (25%), Positives = 91/188 (48%)
  Q:     7 IAVSGGPDSMALL----NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKIS----QELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS-LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           +A SGG DS ALL     K    V A+ H+++  +   D+ E+  +  C +  L L V    K   +++    + +   R  RY  FE ++     ++ IK I +A   +D +E+  ++L++      +     S  R+ L   RPLL      + ++   + + ++ D TN  ++++RN +R  +      TF +F
  S:    20 VAFSGGADSTALLLACAEKWPGQVHAI-HIHHGVQAAGDDFERHCQAVCVRLGLPLVV----KRVDARHASGQSPEDAARRARYKAFEAVALVEYAQVAIKSIALAQHADDQVETLLLALSRGAGLPGMSAMPASWRRAGLTYHRPLLGVAASDIRRWLVGRGVAWIEDPTNVDEQFTRNRIRARLLPALDATFPQF 211
>gi|49083500|gb|AAT51049.1| PA1192 [synthetic construct] (275 aa)
Score = 119, Expect = 1.4e-04, Identities = 48/187 (25%), Positives = 93/187 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   +L + V  + +       D++     E ++ +Y K   ++  +   DT+     K  +     +    +R       + E+G  K+ + H ++D LE+ ++       N+F G   K+    L       ++IRPL   ++K +E Y + K  EF I   N     +   R VV++M+ EW++K+
  S:    34 KVMVCLSGGKDSYTMLDILLYL-QKVAPIRFEIVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIVEKDTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFL-------NMFYGGTLKAMPPKLLADDGRNVVIRPLAYCSEKDIEAYSQLK--EFPITPCNLCGSQENLQRQVVKEMLLEWERKS 228
>gi|91762265|ref|ZP_01264230.1| cell cycle protein mesj [Candidatus Pelagibacter ubique HTCC1002] >gi|91718067|gb|EAS84717.1| cell cycle protein mesj [Candidatus Pelagibacter ubique HTCC1002] (351 aa)
Score = 119, Expect = 1.5e-04, Identities = 53/199 (26%), Positives = 95/199 (47%)
  Q:     7 IAVSGGPDSMAL------LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFR--SLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKN 205
           +AVSGGPDS+AL       + K  +      V++  R +S  +  +V+   +K  +   V        S+     N+Q+  RE RY    K  ++  IK +L+ H  ND +E+  + + +    N  +   +  K++   L ++RPLLN  K  L    +     F+ D +N  + Y R  +R ++   +K+      LK+   NL++
  S:    44 VAVSGGPDSLALAYLAKCYSIKNKIKVKFFLVDHRLRNESTKEATLVKKILQKIGITCKVLIWKGKKPSR-----NIQSLAREARYSLLSKECKKNNIKYLLLGHHSNDLVENFLIRVVRGSGLNGLVSFNKSVKYKDEDLNILRPLLNLKKNDLINISKIVFKFFIKDPSNINEIYKRTRIRTLLESLEKEGLDLKKLKLTIDNLRD 246
>gi|110638235|ref|YP_678443.1| ATPase [Cytophaga hutchinsonii ATCC 33406] >gi|110280916|gb|ABG59102.1| conserved hypothetical protein; possible ATPase [Cytophaga hutchinsonii ATCC 33406] (285 aa)
Score = 118, Expect = 1.8e-04, Identities = 43/184 (23%), Positives = 87/184 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA-----VCHVNYHDREDSDNDEKIVRDYCKKY--NLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWD 187
           K ++ +SGG DS  +L+   H         +  VN  D++  D  E I+ +Y      N K+   DT+   + K      + +    +R       ++ELG+ KI + H + D LE+ +++L  + K   +  + ++     ++IRPL+   +  + +Y   K    +  +     +   R + +KM+A+W+
  S:    42 KIMVCLSGGKDSYTMLDMFIHAQTVRKNFEIIAVNL-DQKQPDYPEHILPEYLTHLGVNFKIVEKDTYSIVIDKTPAGKTMCSLCSRLRRGSLYATAEELGVTKIALGHHREDVLETFFLNLFFSGKMEAMPAKYRTDDGKHVVIRPLVYCKENEIAEYSIYKKFPIIPCNLCGSQENMQRKITKKMLADWE 232
>gi|90580988|ref|ZP_01236789.1| hypothetical cell cycle protein MesJ [Vibrio angustum S14] >gi|90437866|gb|EAS63056.1| hypothetical cell cycle protein MesJ [Vibrio angustum S14] (438 aa)
Score = 118, Expect = 1.9e-04, Identities = 50/177 (28%), Positives = 86/177 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLV----EAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDIN----NLQTWYREIRYDFFEKISQELGIKKILI-AHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++++A SGG DS  LL+     +    E  CH  Y     S N + I  D C  +     +      DV + K +     +L+   RE RY+    ++Q + +  +L+ A   +D +E+  ++L +      L  +     F   + +RPLLN T+  +EQY     + +V D +N  +RY RN +R
  S:    24 RFVLAFSGGLDSRVLLDLMARFITQNPEYSCHAVYVHHGLSSNAD-IWADKCVVWAKSAGI----SCDVERVKVLTGNRISLEQAAREARYNI---LAQHVNMGDMLLTAQHSDDQIETFLLALKRGSGPAGLAAMPMILPFAKGMHLRPLLNITRADIEQYGLEHKLSWVEDESNQDERYDRNFIR 202
>gi|194439921|ref|ZP_03071983.1| tRNA(Ile)-lysidine synthase [Escherichia coli 101-1] >gi|194421167|gb|EDX37192.1| tRNA(Ile)-lysidine synthase [Escherichia coli 101-1] (432 aa)
Score = 118, Expect = 2.0e-04, Identities = 47/175 (26%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D       + C+++ + L V     + V   ++   ++   R++RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  LEQ+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQVRYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMGEVSEFAGTRLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|119946581|ref|YP_944261.1| tRNA(Ile)-lysidine synthetase [Psychromonas ingrahamii 37] >gi|119865185|gb|ABM04662.1| tRNA(Ile)-lysidine synthetase [Psychromonas ingrahamii 37] (460 aa)
Score = 118, Expect = 2.1e-04, Identities = 46/181 (25%), Positives = 86/181 (47%)
  Q:     3 HKYLIAVSGGPDSMALLN---KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
             + IA+SGG DS+ LL+   + R   +      +H      ++    + +C+     L V       + + K+  +L+   RE RY         L    ++ AH ++D LE+  ++L +   +  L GI++  K +   LIRPLLN +++ L  Y     +++V D +N    + RN +R+ +
  S:    26 QNFHIALSGGLDSVVLLHLFTRLRAFDKKYSLCAHHINHGLSDNAAHWQLFCENLCASLAVDFCCSPVILEKKNRTSLEALAREKRYACL--TGNLLDNSYLITAHHQDDQLETVLLALKRGSGSTGLQGIQKMQKLQKGHLIRPLLNFSRQQLAAYAELFQLDWVEDESNQDQDFDRNFIRQTI 208
>gi|21672395|ref|NP_660462.1| putative cell cycle protein MesJ [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25090671|sp|Q8KA23|TILS_BUCAP tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|21623002|gb|AAM67673.1| putative cell cycle protein MesJ [Buchnera aphidicola str. Sg (Schizaphis graminum)] (445 aa)
Score = 118, Expect = 2.1e-04, Identities = 75/280 (26%), Positives = 127/280 (45%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEA-------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM-----AEWD---KKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIK-PNENKIEQIIEFINKNKNGSVKKYRLKENQ 281
           K  +LIA SGG DS  LL K   + E          H+N++    S   E+     C KY + +   +     K ++ +   I    T Y  +  D           + +L  H  ND  E+ ++SL +      L G+  ++      ++RP L KTKK L+++    N+E + D++NF   Y RN +R  +       W    K  F+   +  +   LKN+F  + + +  N    +  +I  F  I     ++LI  +++   IK P+   IE I   I  +K  S  K  + +N+
  S:    11 KKLFLIAYSGGIDSTVLLYKMLKIKEKNPQIKIRAIHINHNLHPSSKKWEEHCIKICHKYKIPIITKEIKILLKKNIEETLRIKRYNTIYNYLLND-----------EILLTGHHLNDQCETLFLSLKRGSGPTGLSGMSIENFLGKKRIVRPFLTKTKKELQKWACENNLESIEDFSNFNIDYDRNFIRHKLIPILEQRWPFFLKNCFRTTVICREETKLKNIFLKEKIQNLIN--FDESLNIQNFKNINKEVCKALIRYWISLKNIKMPSYKTIECIYNEIICSKKDSNPKIIIDKNE 297
>gi|152987414|ref|YP_001349540.1| hypothetical protein PSPA7_4186 [Pseudomonas aeruginosa PA7] >gi|150962572|gb|ABR84597.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] (274 aa)
Score = 118, Expect = 2.2e-04, Identities = 48/187 (25%), Positives = 93/187 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   +L + V  + +       D++     E ++ +Y K   ++  +   DT+     K  +     +    +R       + E+G  K+ + H ++D LE+ ++       N+F G   K+    L       ++IRPL   ++K +E Y + K  EF I   N     +   R VV++M+ EW++K+
  S:    34 KVMVCLSGGKDSYTMLDILLYL-QKVAPIRFEIVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIVEKDTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFL-------NMFYGGTLKAMPPKLLADDGRNVVIRPLAYCSEKDIEAYSQLK--EFPIIPCNLCGSQENLQRQVVKEMLLEWERKS 228
>gi|56552554|ref|YP_163393.1| ATPase [Zymomonas mobilis subsp. mobilis ZM4] >gi|61217187|sp|Q5NLX8|TILS_ZYMMO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56544128|gb|AAV90282.1| ATPase [Zymomonas mobilis subsp. mobilis ZM4] (329 aa)
Score = 118, Expect = 2.2e-04, Identities = 48/177 (27%), Positives = 82/177 (46%)
  Q:     7 IAVSGGPDSMALL---NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRR----KSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           IAVSGG DS+ALL         VEAV  V++  R ++  + + V   C++  +   +  T  +      +   +Q   R  RY    + ++E  +  ++ AH  +D  E+  M   +    N    IR      ++ + L L+RPLL  T+ +L +        FV D +N    Y R   R+++
  S:    34 IAVSGGSDSLALLLLGAVSDFPVEAVT-VDHGMRPEAAEEARFVAQICQQIGVPHQILTTKIE-----ANGEGMQAAARIRRYALMAEWAKEKNVGALMTAHHADDQAETFLMRAARGSGLNGLAAIRPDVVITAEGQKLRLLRPLLGFTRSALAEIVEKAGFTFVSDPSNDNPHYDRTHFRRLL 212
>gi|67924269|ref|ZP_00517706.1| PP-loop [Crocosphaera watsonii WH 8501] >gi|67853884|gb|EAM49206.1| PP-loop [Crocosphaera watsonii WH 8501] (322 aa)
Score = 118, Expect = 2.3e-04, Identities = 51/190 (26%), Positives = 91/190 (47%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDRED---SDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG--IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           K   LIAVSGG DS+ LL     L E      A+ H ++    D   +D+ EKI  ++   + LK+             K +   +   RE RY    +I++E   ++I+  H  +D  E+   +L +   +  LG    ++    ++ L+RPLL  ++    ++C+   +    D  N    Y+RN +R+ +  + K+ F
  S:    22 KSNLLIAVSGGQDSLCLLKIMIDLQEKWGWNIAIAHCDHGWASDLGIADHVEKIANNWNIPFYLKV------------AKAMKETEAAAREWRYQSLVEIAEENDCREIVTGHTLSDRSETLLYNLIRGAGSNGLGALTWKRPLTNNINLVRPLLKVSRGETLEFCQQFALPIWEDAANANLDYARNRIRQELVPYLKENF 210
>gi|153000684|ref|YP_001366365.1| PP-loop domain-containing protein [Shewanella baltica OS185] >gi|151365302|gb|ABS08302.1| PP-loop domain protein [Shewanella baltica OS185] (322 aa)
Score = 117, Expect = 2.4e-04, Identities = 52/186 (27%), Positives = 96/186 (51%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K +  +SGG DS A+L+     ++R  ++  +  VN  D++     E ++  Y  K N+   +   DT+   KD + + K   +L +    +R       +Q +G  KI + H ++D +E+ ++       N+F G + K+    L       ++IRPL    +K LE+Y   +  EF I   N     +   R  V+ M+ +WD++
  S:    51 KIMCCLSGGKDSYAMLDILMNLQQRAPIQFEIIAVNL-DQKQPGFPEHVLPAYLDKLNVPYHILEKDTYSIVKDKIPEGKTTCSLCS---RLRRGTLYGFAQRIGATKIALGHHRDDIIETLFL-------NMFFGGKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYANLR--EFPIIPCNLCGSQENLKRAAVKDMLNQWDRQ 244
>gi|77979519|ref|ZP_00834937.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Yersinia intermedia ATCC 29909] (297 aa)
Score = 117, Expect = 2.4e-04, Identities = 57/184 (30%), Positives = 86/184 (46%)
  Q:     6 LIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           +  +SGG DS A+L+      K   +   V  VN  D++     E I+  Y +  N+  ++ D     V K K      T        R   Y F EKI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     I+IRPL    +K L +Y   K    +  +     +   R  ++ M+ EWDKK
  S:    41 MACMSGGKDSFAMLDILLGLQKVAPIKFEVIAVNL-DQKQPGFPEHILPAYLESLNIPYYIVDKDTYSVVKEKIPEGKTTCGLCSRLRRGTLYSFAEKI----GATKIALGHHMDDIVETLFL-------NIFHGARMKAMPPKLRSDDGRNIVIRPLAYCREKDLIKYSEYKTFPIIPCNLCGSQENLQRQAIKAMLGEWDKK 232
>gi|118594050|ref|ZP_01551397.1| hypothetical protein MB2181_00240 [Methylophilales bacterium HTCC2181] >gi|118439828|gb|EAV46455.1| hypothetical protein MB2181_00240 [Methylophilales bacterium HTCC2181] (286 aa)
Score = 117, Expect = 2.5e-04, Identities = 47/185 (25%), Positives = 86/185 (46%)
  Q:     4 KYLIAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDK 188
           K ++ VSGG DS  LL       KK  +   V  +N  D++     E ++ +Y KKY +   +   DT+     K  +     +    +R     K ++ +G  KI + H KND +E+ ++++    K   +  +  S  +  I+IRPL    +K +  Y  + N   +  +     +   R  ++ M+ +WDK
  S:    40 KVMVCVSGGKDSFTLLTILLALQKKAPINFEVIAMNL-DQKQPGFPEDVLPNYFKKYGIPFEIVNADTYSIVKEKIPEGKTTCSLCSRLRRGIIYKKAKAIGANKIALGHHKNDIVETFFLNMFHGSKLKAMPPKLLSDDKDNIIIRPLAFCEEKDIMTYANTMNFPIIPCNLCGSQENLERKKIKAMLFDWDK 232
>gi|114562464|ref|YP_749977.1| tRNA(Ile)-lysidine synthetase [Shewanella frigidimarina NCIMB 400] >gi|114333757|gb|ABI71139.1| tRNA(Ile)-lysidine synthetase [Shewanella frigidimarina NCIMB 400] (488 aa)
Score = 117, Expect = 2.6e-04, Identities = 47/177 (26%), Positives = 86/177 (48%)
  Q:     4 KYLIAVSGGPDS-------MALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYC-KKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A SGG DS        AL +K  H+   + HV++    ++D    I   +C  + N         +  V K     +L+   R+ RY  F++      I  +L AH ++D LE+  ++L + +    L  +     ++   L+RPLL+ ++  +EQ+   K +  + D +N  D + RN +R
  S:    40 KLVLAYSGGVDSEVLACGLSALAHKHPHIACLLIHVHHGLSANAD----IWVQHCITRANHYQLPVQIERVKVEKGPR-QSLEAQARDARYQAFDRYLNPGDI--LLTAHHQDDQLETLLLALKRGQGPKGLAAMGAIQAYKQAWLVRPLLDISRDQIEQFAAQKQLSHIEDESNQDDSFDRNFLR 218
>gi|70731809|ref|YP_261551.1| hypothetical protein PFL_4463 [Pseudomonas fluorescens Pf-5] >gi|68346108|gb|AAY93714.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5] (288 aa)
Score = 117, Expect = 2.6e-04, Identities = 41/187 (21%), Positives = 91/187 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   HL + V  + +       D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  +  +     ++IRPL   ++K ++ Y   K    +  +     +   R VV++M+ EW++KT
  S:    48 KVMVCLSGGKDSYTMLDVLLHL-QKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGIEYHIVE--KDTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFYNGSLKAMPPKLLADDGRNVVIRPLAYCSEKDIQAYSDLKQFPIIPCNLCGSQENLQRQVVKEMLQEWERKT 242
>gi|146329374|ref|YP_001209974.1| adenine nucleotide alpha hydrolase ATP-binding family protein [Dichelobacter nodosus VCS1703A] >gi|146232844|gb|ABQ13822.1| adenine nucleotide alpha hydrolase ATP-binding family protein [Dichelobacter nodosus VCS1703A] (267 aa)
Score = 117, Expect = 2.7e-04, Identities = 44/190 (23%), Positives = 95/190 (50%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           + ++ +SGG DS ALL+      K   +   +  VN  +++  +  E+++ DY +K  +K  +   DT++  + K      + +    +R     + ++E GI KI + H K D +E+ +++L    +   +  +  S  +  I+IRPL+   +K + +Y + K    +  +         R ++++M+  W+K   Q+
  S:    31 RIMVCLSGGKDSYALLDILLALQKSAPIHFEIIAVNL-NQKFPNFPERVLPDYLEKLGVKYDIIEHDTYQVVMEKIPAGKTMCSLCSRLRRGILYRYAEEHGITKIALGHHKIDVIETFFLNLFFTGRLKAMPAKLLSDNKKQIVIRPLVYCDEKDIVKYAKLKAFPIIPSNLCGVQKNMQRTIIKEMLLAWEKDYPQR 228
>gi|94985996|ref|YP_605360.1| PP-loop domain-containing protein [Deinococcus geothermalis DSM 11300] >gi|94556277|gb|ABF46191.1| PP-loop domain protein [Deinococcus geothermalis DSM 11300] (289 aa)
Score = 117, Expect = 2.7e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  LL+   HL +       V  VN  D+      + ++ +Y  +  +   +   DT+     K  +          +R     + ++E+G  KI + H ++D LE+ +M       N+F G R K+    L       ++IRPL    ++ +E+Y ++K    +  +         R VV +M+  W+++
  S:    33 RVMVCLSGGKDSYTLLDILLHLQKRAPIHFEVVAVNL-DQGQPGFPKHVLPEYLTRLGVPFDILTEDTYSIVKEKTPEGKTTCALCSRLRRGILYRHAREIGATKIALGHHRDDILETLFM-------NMFFGARLKAMPPKLQSDDGTNVVIRPLAYLAERDIERYAQAKGFPIIPCNLCGSQPNLQRRVVGEMLEGWERE 226
>gi|83720432|ref|YP_442474.1| tRNA(Ile)-lysidine synthetase [Burkholderia thailandensis E264] >gi|83654257|gb|ABC38320.1| tRNA(Ile)-lysidine synthetase [Burkholderia thailandensis E264] (494 aa)
Score = 117, Expect = 2.8e-04, Identities = 42/174 (24%), Positives = 77/174 (44%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFV-FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGI---RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           IA SGG DS  LL+    +  A   +  H       +      +C +    L V FD  + DV +      ++   R++RY   E +    G + + +A   +D  E+  + L +      L     + +     ++ +RPLL+  +  LE+Y +   + ++ D +N   RY+RN +R
  S:    32 IAYSGGLDSTVLLHAAARIAGAGRCIALHVHHGLSANADAWLAHCAETAQALGVRFDAARVDVPRASG-QGVEASARDVRYRALETMCARYGARALWLAQHADDQAETVLLQLLRGAGIAGLAAMAPQYRPALADVMRVRPLLHLLRAQLERYAQQHALRWIDDESNADTRYARNALR 208
>gi|115526688|ref|YP_783599.1| tRNA(Ile)-lysidine synthetase-like [Rhodopseudomonas palustris BisA53] >gi|115520635|gb|ABJ08619.1| tRNA(Ile)-lysidine synthetase [Rhodopseudomonas palustris BisA53] (343 aa)
Score = 117, Expect = 2.8e-04, Identities = 52/181 (28%), Positives = 82/181 (45%)
  Q:     6 LIAVSGGPDSMALL--------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEW 186
           ++AVSGGPDS+AL+          KR        +++  RE S  + + V+       L         D     K  + +    R  RY    K ++  G   I  AH ++D  E+  M L++      L  + R+S+   L L RPLL   K  L        IEF +D +N   R++R  +R++MA +
  S:    28 VLAVSGGPDSLALMVLAARWRAALKRGPELIAVTIDHGLREASAREARDVKKLAGNLGLPHKTLRWRGD-----KPTSGIPAAARAARYALLAKAARSTGATHIFTAHTRDDQAETVLMRLSRGSGLAGLAAMARQSERCGLQLARPLLGIAKSQLIATLAKARIEFAVDPSNSDPRFTRPRLRRLMAAF 212
>gi|90578588|ref|ZP_01234398.1| putative ATPase [Vibrio angustum S14] >gi|90439421|gb|EAS64602.1| putative ATPase [Vibrio angustum S14] (297 aa)
Score = 117, Expect = 2.8e-04, Identities = 57/185 (30%), Positives = 89/185 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+   +L +A      V  VN  D++     E I+ +Y    N+  ++ D     V K K      T        R   Y F EKI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +K L +Y   K    +  +     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLNLKKAAPINFEVVAVNL-DQKQPGFPEHILPEYFSSLNIPYYIVDKDTYSVVKEKVEEGKTTCGLCSRLRRGTLYSFAEKI----GATKIALGHHLDDIVETLFL-------NMFHGSRLKAMPPKLRSDDGRNVVIRPLSYCREKDLIKYAEHKAFPIIPCNLCGSQENLQRQSIKAMLIDWDKKT 233
>gi|15596389|ref|NP_249883.1| hypothetical protein PA1192 [Pseudomonas aeruginosa PAO1] >gi|107100641|ref|ZP_01364559.1| hypothetical protein PaerPA_01001667 [Pseudomonas aeruginosa PACS2] >gi|116049140|ref|YP_792058.1| ATPase [Pseudomonas aeruginosa UCBPP-PA14] >gi|194545310|ref|YP_002080338.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|9947118|gb|AAG04581.1|AE004549_8 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] >gi|115584361|gb|ABJ10376.1| putative ATPase of the PP-loop superfamily [Pseudomonas aeruginosa UCBPP-PA14] >gi|126166256|gb|EAZ51767.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] (274 aa)
Score = 117, Expect = 2.9e-04, Identities = 48/187 (25%), Positives = 93/187 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   +L + V  + +       D++     E ++ +Y K   ++  +   DT+     K  +     +    +R       + E+G  K+ + H ++D LE+ ++       N+F G   K+    L       ++IRPL   ++K +E Y + K  EF I   N     +   R VV++M+ EW++K+
  S:    34 KVMVCLSGGKDSYTMLDILLYL-QKVAPIRFEIVAVNMDQKQPGFPEHVLPEYLKSIGVEYHIVEKDTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFL-------NMFYGGTLKAMPPKLLADDGRNVVIRPLAYCSEKDIEAYSQLK--EFPIIPCNLCGSQENLQRQVVKEMLLEWERKS 228
>gi|74310809|ref|YP_309228.1| tRNA(Ile)-lysidine synthetase [Shigella sonnei Ss046] >gi|73854286|gb|AAZ86993.1| cell cycle protein [Shigella sonnei Ss046] (432 aa)
Score = 117, Expect = 2.9e-04, Identities = 47/175 (26%), Positives = 87/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D   +   + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  LEQ+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVRHCENICQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMGEVSEFAGTRLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|146281659|ref|YP_001171812.1| hypothetical protein PST_1276 [Pseudomonas stutzeri A1501] >gi|145569864|gb|ABP78970.1| conserved hypothetical protein [Pseudomonas stutzeri A1501] (274 aa)
Score = 117, Expect = 3.0e-04, Identities = 49/187 (26%), Positives = 92/187 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   +L +       V  VN  D++     E ++ +Y K   ++  +   DT+     K  +     +    +R       + E+G  K+ + H ++D LE+ ++       N+F G   K+    L       ++IRPL   ++  +E Y + K  EF I   N     +   R VV++M+ EW++K+
  S:    34 KVMVCLSGGKDSYTMLDVLLYLQKVAPIRFEVVAVNM-DQKQPGFPEHVLPEYLKSIGVEYHIIEKDTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDILETFFL-------NMFYGGTLKAMPPKLLSDDGRNVVIRPLAYCSEADIEAYSKMK--EFPIIPCNLCGSQENLQRQVVKEMLQEWERKS 228
>gi|113866291|ref|YP_724780.1| ATPase [Ralstonia eutropha H16] >gi|113525067|emb|CAJ91412.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Ralstonia eutropha H16] (314 aa)
Score = 117, Expect = 3.0e-04, Identities = 46/184 (25%), Positives = 91/184 (49%)
  Q:     6 LIAVSGGPDSMALLN-----KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           L+ +SGG DS  +L+     +KR  ++        D++     E I+ +Y K   ++  +   DT+     K  +     +    +R     + ++ELG  KI + H ++D +++ ++       N+F G + K+    L       I+IRPL   ++K +  Y R+  +EF I   N     +   R  V +M+ +W+++
  S:    35 LVCMSGGKDSYTMLSVLMALQKRAPIKFKLIAMNLDQKQPGFPEHILPEYLKSVGVEYVIVEADTYSIVKEKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVQTFFL-------NMFFGGKMKAMPPKLSTDDGQHIVIRPLAYCSEKDIASYARA--MEFPIIPCNLCGSQENLQRKKVSEMLQDWERQ 226
>gi|82544200|ref|YP_408147.1| C32 tRNA thiolase [Shigella boydii Sb227] >gi|81245611|gb|ABB66319.1| conserved hypothetical protein [Shigella boydii Sb227] (311 aa)
Score = 116, Expect = 3.1e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGTTKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|71909752|ref|YP_287339.1| PP-loop [Dechloromonas aromatica RCB] >gi|71849373|gb|AAZ48869.1| PP-loop [Dechloromonas aromatica RCB] (287 aa)
Score = 116, Expect = 3.2e-04, Identities = 47/184 (25%), Positives = 85/184 (46%)
  Q:     6 LIAVSGGPDSMALLN-----KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           L+ VSGG DS  LL      ++R  V+        D++       I+  Y +   ++  + +     V K K      T      +R     + ++ELG  KI + H ++D + + +++L    K   +  +  +  +S ++IRPL    +  + ++ R   +EF I   N     D   R  +R+MM EWDK+
  S:    35 LVCVSGGKDSYTLLAMLMALQQRAPVKFRLIAMNLDQKQPGFPADILPRYFESIGIEYRIVEADTYSVVKEKIPEGKTTCSLCSRLRRGIIYRTAKELGANKIALGHHRDDMVHTLFLNLLFGGKLKAMPPKLVTDDKSHVVIRPLAYCAEADIAKFARG--MEFPIIPCNLCGSQDNLQRQKIREMMQEWDKR 226
>gi|94310033|ref|YP_583243.1| tRNA(Ile)-lysidine synthetase-like protein [Ralstonia metallidurans CH34] >gi|93353885|gb|ABF07974.1| tRNA(Ile)-lysidine synthetase-like protein [Ralstonia metallidurans CH34] (487 aa)
Score = 116, Expect = 3.3e-04, Identities = 43/177 (24%), Positives = 87/177 (49%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAV--------CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG---IRRKSKFRSLI-LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMM 183
           +A+SGG DS+ALL+  R  + A          HV++  +  +D+ ++     C    + L    +      +      ++   R  R++   ++ +E G + +L AH ++D +E+  + L +      +     RR    R  I L+RP L  T+  ++ YC  + + ++ D +N   R++RN +R  +
  S:    52 VALSGGRDSVALLHATREALAATWPLARLVALHVHHGLQAQADDWDRFCTARCGDLQVPL----SSARVTVQAATGEGIEAAARRARHEALGRMCREQGARLLLFAHHRDDQVETVLLRLFRGTGVAGMAGMPARRPLDERGDIQLVRPWLGVTRAEIDDYCAWQGLRWIDDPSNADTRFARNALRAQL 236
>gi|84389775|ref|ZP_00991327.1| Cell cycle protein MesJ [Vibrio splendidus 12B01] >gi|84376876|gb|EAP93750.1| Cell cycle protein MesJ [Vibrio splendidus 12B01] (444 aa)
Score = 116, Expect = 3.3e-04, Identities = 47/178 (26%), Positives = 90/178 (50%)
  Q:     3 HKYLIAVSGGPDSMALLN-----KKRHLVEA-VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++ ++A SGG DS  LL       + H +E    HV++   +++D+  +  + +C   ++ L V +    D+   + +  L    R+ RY+ F+K    L    +LI  Q  +D LE+  ++L +      L  + +   F +  ++RPLL+ T+  +E   R   + +V D +N   R+ RN +R
  S:    20 NRLIVAFSGGVDSRVLLELAAQYAQTHGIECCAVHVHHGLSKNADHWAEQCQTWCDALSVSLAV-ERVSLDIDSGESVEKLA---RDARYNAFQK---HLSFGDVLITGQHIDDQLETFLLALKRGSGPKGLSSMAKMMPFANAHIVRPLLSVTRTDIEGAARDMALTWVEDESNQDLRFDRNFIR 198
>gi|77460453|ref|YP_349960.1| hypothetical protein PflO1_4232 [Pseudomonas fluorescens PfO-1] >gi|77384456|gb|ABA75969.1| conserved hypothetical protein [Pseudomonas fluorescens PfO-1] (274 aa)
Score = 116, Expect = 3.5e-04, Identities = 43/187 (22%), Positives = 92/187 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   HL + V  + +       D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  + ++     ++IRPL          YC  K+I+   D+  F           +   R VV++M+ +W++KT
  S:    34 KVMVCLSGGKDSYTMLDVLMHL-QKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGIEYHIVE--KDTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGSLKAMPPKLRADDGRNVVIRPL---------AYCNEKDIQAYSDFKQFPIIPCNLCGSQENLQRQVVKEMLQDWERKT 228
>gi|196156872|ref|YP_002126361.1| ATPase of the PP-loop superfamily protein [Alteromonas macleodii 'Deep ecotype'] >gi|88771915|gb|EAR03228.1| ATPase of the PP-loop superfamily protein [Alteromonas macleodii 'Deep ecotype'] >gi|196112651|gb|ACG66367.1| ATPase of the PP-loop superfamily protein [Alteromonas macleodii 'Deep ecotype'] (317 aa)
Score = 116, Expect = 3.5e-04, Identities = 53/186 (28%), Positives = 99/186 (53%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  +L+    L +       +  VN  D++     E ++ +Y ++  +  K+   DT+   KD + + K   +L +    +R     + ++ELG  KI + H ++D LE+ ++       N+F G + KS    L       I+IRPL   T+K + +Y  S+ +EF I   N     +   R  ++ M+ +W+K+
  S:    50 KVMVCLSGGKDSYTMLDILLFLKKIAPIHFDIVAVNL-DQKQPGFPEHVLPEYLERIGVDYKIVEEDTYSIVKDKIPEGKTTCSLCS---RLRRGILYRTAKELGATKIALGHHRDDMLETFFL-------NMFHGGKLKSMPPKLVSDNGEHIVIRPLAYCTEKDIVKY--SQAVEFPIIPCNLCGSQENLQRQNIKAMLQDWNKR 243
>gi|194433858|ref|ZP_03066132.1| protein YdaO [Shigella dysenteriae 1012] >gi|194417961|gb|EDX34056.1| protein YdaO [Shigella dysenteriae 1012] (311 aa)
Score = 116, Expect = 3.5e-04, Identities = 46/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E I+ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHILPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|84385469|ref|ZP_00988500.1| putative ATPase [Vibrio splendidus 12B01] >gi|84379449|gb|EAP96301.1| putative ATPase [Vibrio splendidus 12B01] (297 aa)
Score = 116, Expect = 3.6e-04, Identities = 60/185 (32%), Positives = 90/185 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+    L EA      V  VN  D++     E I+ +Y +  N+  ++ D     V K K      T        R   Y F EKI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +  L +Y   K  EF I   N     +   R  ++ M+ +WDK+T
  S:    41 MACISGGKDSFAMLDILLRLREAAPIKFDVVAVNL-DQKQPGFPEHILPEYFETLNIPYYIVDKDTYSVVKEKVPEGKTTCGLCSRLRRGTLYSFAEKI----GATKIALGHHLDDIVETMFL-------NMFHGARLKAMPPKLRSDDGRNVVIRPLTYCRETDLIKYAEHK--EFPIIPCNLCGSQENLQRQNIKAMLIDWDKQT 233
>gi|37526466|ref|NP_929810.1| C32 tRNA thiolase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36785897|emb|CAE14949.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] (306 aa)
Score = 115, Expect = 4.2e-04, Identities = 44/186 (23%), Positives = 89/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  LL+  ++L ++   VN+       D++     E I+  Y  +  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL    +K +E+Y  +K    +  +         R V++ M+ EWDK+
  S:    38 RIMVCLSGGKDSYTLLSILQNLQKSA-PVNFSLVAVNLDQKQPGFPEHILPAYLGELGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERYATAKAFPIIPCNLCGSQPNLQRQVIKDMLREWDKR 231
>gi|83644992|ref|YP_433427.1| ATPase [Hahella chejuensis KCTC 2396] >gi|83633035|gb|ABC29002.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Hahella chejuensis KCTC 2396] (285 aa)
Score = 115, Expect = 4.3e-04, Identities = 56/186 (30%), Positives = 95/186 (51%)
  Q:     4 KYLIAVSGGPDSMA----LLNKKRH--LVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYRE-IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K +  +SGG DS A    LLN K+H  +   V  VN  D++     E ++ +Y     ++ +V   DT+   KD + + K    L +  R  I YDF    + E    KI + H ++D +E+ ++++    K   +  + KS     I+IRPL    +K +E+Y   +  EF I   N     +   R  ++ M+ +WDK+
  S:    43 KVMCCLSGGKDSYAMLDILLNLKKHAPISFEVIAVNL-DQKQPGFPEHVLPEYLSSLGVEYYVIERDTYSIVKDKIPEGKTTCGLCSRLRRGILYDF----AVEHKCTKIALGHHRDDIMETLFLNMFYGGKMRAMPPKLKSDDGRNIVIRPLAYCREKDIERYAGLR--EFPIIPCNLCGSQENLQRQNIKMMLQDWDKR 236
>gi|24113173|ref|NP_707683.1| C32 tRNA thiolase [Shigella flexneri 2a str. 301] >gi|30062867|ref|NP_837038.1| C32 tRNA thiolase [Shigella flexneri 2a str. 2457T] >gi|110805759|ref|YP_689279.1| C32 tRNA thiolase [Shigella flexneri 5 str. 8401] >gi|24052163|gb|AAN43390.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30041115|gb|AAP16845.1| hypothetical protein S1448 [Shigella flexneri 2a str. 2457T] >gi|110615307|gb|ABF03974.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (311 aa)
Score = 115, Expect = 4.4e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGTTKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|33862341|ref|NP_893901.1| hypothetical protein PMT0068 [Prochlorococcus marinus str. MIT 9313] >gi|61216599|sp|Q7V987|TILS_PROMM tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|33640454|emb|CAE20243.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT 9313] (343 aa)
Score = 115, Expect = 4.4e-04, Identities = 51/180 (28%), Positives = 85/180 (47%)
  Q:     2 KHKYLIAVSGGPDSMAL------LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELG-------IKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSK-------FRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           K   LIAVSGG DSMAL      L +K      V H +++  + S      ++++C+ +NL          D +K    NN  T  R  RY+     ++ L         + +L  H  +D  E+  ++L +      L   R+ +        +++ LIRPLL  +++     C    +   +D  N    +SRN VR+
  S:    32 KASLLIAVSGGQDSMALLGLLIDLQRKHGWSLEVWHGDHNWHKQSATIATELKNWCESHNLSFC------SDQAKPGQTNNEAT-ARHWRYEQLTLHAERLSSNNPNHPCRYVLTGHTSSDRAETLLLNLARGTDLAGLSSMRQCRPISKDHPHKNVQLIRPLLGFSREDTALICSELGLPIWLDPANSNPDFSRNRVRQ 224
>gi|85713119|ref|ZP_01044153.1| ATPase of the PP-loop superfamily protein [Idiomarina baltica OS145] >gi|85693067|gb|EAQ31031.1| ATPase of the PP-loop superfamily protein [Idiomarina baltica OS145] (447 aa)
Score = 115, Expect = 4.4e-04, Identities = 61/260 (23%), Positives = 123/260 (47%)
  Q:     3 HKYLIAVSGGPDSMALLNKKRHLVEA-------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFD---THKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKN----------KKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-KMMAEWDKK--TFQKFYLKVKWFNL-KNMFFIKLLDSKFNN------WIKQDFDINYFLKIKNNYKESLIYLFLNH-IGIK--PNENKIEQIIE 262
            + ++A+ GG DS  +L+      +A         H+++H    S    K ++   + Y +     D     K+ VSK       +   RE RY    +++ +  I  IL+   +ND +E+  + L +           +   F+G R+        L+RPLL  +K+++ +Y     + ++ D TN+  R  RN +R K++ + +++   F +  L+       ++    +LL  K NN      W+     +          + + I  +L H  G +  P++ ++ QI +
  S:    23 QQLVVALGGGADSQTVLDCLNRFRQANPQYEYLAIHLDHHFHPQSPAWAKTIKGSVESYGMASHFEDLIFIEKNRVSK-------EAMGRERRYQRLAELTADNAI--ILLGQHRNDQIETFLLQLKRGSGPRGLASMAEVQPFVGQRK--------LVRPLLEVSKQAILKYAHEHQLTWIEDNTNYDTRIERNYLRHKVIPQLEQRWPQFGQSVLRSAALCAEQDALLDELLADKLNNAWCSHAWLNIGLSLTELAHFSEPLQRAAIRYWLTHQTGCERMPSQAQLHQICQ 298
>gi|50086047|ref|YP_047557.1| cell cycle protein [Acinetobacter sp. ADP1] >gi|61216503|sp|Q6F880|TILS_ACIAD tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|49532023|emb|CAG69735.1| tRNA(Ile)-lysidine synthetase [Acinetobacter sp. ADP1] (459 aa)
Score = 115, Expect = 4.7e-04, Identities = 47/189 (24%), Positives = 89/189 (47%)
  Q:     5 YLIAVSGGPDSMALLNKKR----HLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQK 193
           +LI  SGG DSM LL+       H V A+ ++++  +  S      V+++ ++ ++   +            D  NL+   RE RY  FE  S     + +++AH + D  E+  + L        LG ++   + +++   RP+L+ +++ +E +     I ++ D TNF   Y R   R+ +    +K F K
  S:    33 FLIGCSGGMDSMLLLHLMSELFPHKVRAI-YIDHQLQSSSRAWGVFVQNFAQQSHIPFTIQPV-------IVDTGNLENQAREARYAAFE--SHLKSNEVLVLAHHQQDQTETVLLRLLSGSGVKGLGAMKEIEQKKNICCWRPMLSVSRQQIEHWVEHLKIPYIQDLTNFDTTYDRAWCRETVWPVLQKRFPK 216
>gi|124546776|ref|ZP_01705811.1| PP-loop [Shewanella putrefaciens 200] >gi|124509828|gb|EAY53903.1| PP-loop [Shewanella putrefaciens 200] (314 aa)
Score = 115, Expect = 4.7e-04, Identities = 49/186 (26%), Positives = 94/186 (50%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + +  +SGG DS A+L+     ++R  ++  +  VN  D++     E I+  Y  K  +   +   DT+   KD + + K   +L +    +R       +Q +G  KI + H ++D +E+ ++       N+F G + K+    L       I+IRPL    +K LE+Y + K    +  +     +   R  V+ M+ +WD++
  S:    43 RVMCCLSGGKDSYAMLDILMNLQQRAPIQFEIIAVNL-DQKQPGFPEDILPAYLDKLKVPYHILEKDTYSIVKDKIPEGKTTCSLCS---RLRRGTLYGFAQRIGATKIALGHHRDDIIETLFL-------NMFFGGKMKAMPPKLLSDDGANIVIRPLAYCREKDLEEYAQLKQFPIIPCNLCGSQENLKRAAVKDMLNQWDRQ 236
>gi|120598865|ref|YP_963439.1| PP-loop domain-containing protein [Shewanella sp. W3-18-1] >gi|146293047|ref|YP_001183471.1| PP-loop domain-containing protein [Shewanella putrefaciens CN-32] >gi|120558958|gb|ABM24885.1| PP-loop domain protein [Shewanella sp. W3-18-1] >gi|145564737|gb|ABP75672.1| PP-loop domain protein [Shewanella putrefaciens CN-32] (310 aa)
Score = 115, Expect = 4.8e-04, Identities = 49/186 (26%), Positives = 94/186 (50%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRHLVE-AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + +  +SGG DS A+L+     ++R  ++  +  VN  D++     E I+  Y  K  +   +   DT+   KD + + K   +L +    +R       +Q +G  KI + H ++D +E+ ++       N+F G + K+    L       I+IRPL    +K LE+Y + K    +  +     +   R  V+ M+ +WD++
  S:    39 RVMCCLSGGKDSYAMLDILMNLQQRAPIQFEIIAVNL-DQKQPGFPEDILPAYLDKLKVPYHILEKDTYSIVKDKIPEGKTTCSLCS---RLRRGTLYGFAQRIGATKIALGHHRDDIIETLFL-------NMFFGGKMKAMPPKLLSDDGANIVIRPLAYCREKDLEEYAQLKQFPIIPCNLCGSQENLKRAAVKDMLNQWDRQ 232
>gi|30061745|ref|NP_835916.1| tRNA(Ile)-lysidine synthetase [Shigella flexneri 2a str. 2457T] >gi|30039987|gb|AAP15721.1| cell cycle protein [Shigella flexneri 2a str. 2457T] (432 aa)
Score = 115, Expect = 4.9e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D       + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  LEQ+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|24111623|ref|NP_706133.1| tRNA(Ile)-lysidine synthetase [Shigella flexneri 2a str. 301] >gi|61216594|sp|Q7UDQ6|TILS_SHIFL tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|24050392|gb|AAN41840.1| cell cycle protein [Shigella flexneri 2a str. 301] (432 aa)
Score = 115, Expect = 4.9e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D       + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  LEQ+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|157158325|ref|YP_001461357.1| tRNA(Ile)-lysidine synthetase [Escherichia coli E24377A] >gi|193063304|ref|ZP_03044395.1| tRNA(Ile)-lysidine synthase [Escherichia coli E22] >gi|193067588|ref|ZP_03048555.1| tRNA(Ile)-lysidine synthase [Escherichia coli E110019] >gi|194428333|ref|ZP_03060875.1| tRNA(Ile)-lysidine synthase [Escherichia coli B171] >gi|157080355|gb|ABV20063.1| tRNA(Ile)-lysidine synthase [Escherichia coli E24377A] >gi|192931212|gb|EDV83815.1| tRNA(Ile)-lysidine synthase [Escherichia coli E22] >gi|192959000|gb|EDV89436.1| tRNA(Ile)-lysidine synthase [Escherichia coli E110019] >gi|194413708|gb|EDX29988.1| tRNA(Ile)-lysidine synthase [Escherichia coli B171] (432 aa)
Score = 115, Expect = 4.9e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D       + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  LEQ+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELEQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|149192143|ref|ZP_01870364.1| cell cycle protein MesJ [Vibrio shilonii AK1] >gi|148834013|gb|EDL51029.1| cell cycle protein MesJ [Vibrio shilonii AK1] (437 aa)
Score = 115, Expect = 4.9e-04, Identities = 47/181 (25%), Positives = 87/181 (48%)
  Q:     1 MKHKYLIAVSGGPDSMALLN-----KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFLGIRRKS-KFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           M  K ++  SGG DS  LL       K+H +  +    +H   D+ N+ ++    C+++  +  V  T +          +L+   R+ RY   + + Q +    IL+  Q  +D  E+  ++L +      L     S  F S  L+RPLLN  +  +E+Y + + +++V D +N   R+ RN +R+
  S:    17 MHGKIIVGFSGGVDSRVLLRLAARYSKQHSITCLAVHVHHGLSDNANEWQV---QCERWAQEEAVEFTCERVTLSQDSGESLEQLARQARY---QALRQHMQSGDILLTGQHLDDQAETMLLALKRGSGPKGLSSMASSMNFGSGRLVRPLLNIARHDIERYAQHEQLQWVEDESNSDTRFDRNFLRQ 198
>gi|120553850|ref|YP_958201.1| tRNA(Ile)-lysidine synthetase [Marinobacter aquaeolei VT8] >gi|120323699|gb|ABM18014.1| tRNA(Ile)-lysidine synthetase [Marinobacter aquaeolei VT8] (445 aa)
Score = 115, Expect = 5.0e-04, Identities = 46/174 (26%), Positives = 79/174 (45%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAV------CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +A+SGG DS  LL    H+V A        H+N+  + + D  E+   D C    ++L V       V+      +L+   R  RY+ F ++  +  +  +L+AH  +D  E+    L +    N   G+          L RP L  ++  LEQ  R + + +  D +N  + + RN +R
  S:    32 VALSGGLDSSLLL----HVVAAAYPRVRALHINHQLQSNHDQTERACIDLCAGLGVELQV-----RRVNVATGAGSLEESARAARYEVFREVLGDNDL--LLMAHHADDQAETVLFRLLRGTGVNGLAGMPVSRSLGRGHLYRPWLGVSRSRLEQVAREQGVSWAEDPSNQSEVHDRNYLR 201
>gi|157159153|ref|YP_001462653.1| C32 tRNA thiolase [Escherichia coli E24377A] >gi|157160856|ref|YP_001458174.1| C32 tRNA thiolase [Escherichia coli HS] >gi|168711159|ref|ZP_02743436.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4045] >gi|168738090|ref|ZP_02770367.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4115] >gi|168749012|ref|ZP_02774034.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4113] >gi|168756029|ref|ZP_02781036.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4401] >gi|168769430|ref|ZP_02794437.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4486] >gi|168775173|ref|ZP_02800180.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4196] >gi|168782878|ref|ZP_02807885.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4076] >gi|168788326|ref|ZP_02813333.1| PP-loop family protein [Escherichia coli O157:H7 str. EC869] >gi|168795383|ref|ZP_02820390.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4042] >gi|168799658|ref|ZP_02824665.1| PP-loop family protein [Escherichia coli O157:H7 str. EC508] >gi|170020290|ref|YP_001725244.1| PP-loop domain-containing protein [Escherichia coli ATCC 8739] >gi|188491839|ref|ZP_02999109.1| PP-loop family protein [Escherichia coli 53638] >gi|191165079|ref|ZP_03026923.1| PP-loop family protein [Escherichia coli B7A] >gi|193066928|ref|ZP_03047897.1| PP-loop family protein [Escherichia coli E110019] >gi|194426010|ref|ZP_03058566.1| PP-loop family protein [Escherichia coli B171] >gi|195938013|ref|ZP_03083395.1| C32 tRNA thiolase [Escherichia coli O157:H7 str. EC4024] >gi|121486021|gb|ABM54890.1| ATPase [Escherichia coli] >gi|157066536|gb|ABV05791.1| PP-loop family protein [Escherichia coli HS] >gi|157081183|gb|ABV20891.1| PP-loop family protein [Escherichia coli E24377A] >gi|169755218|gb|ACA77917.1| PP-loop domain protein [Escherichia coli ATCC 8739] >gi|187769348|gb|EDU33192.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4196] >gi|188016561|gb|EDU54683.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4113] >gi|188487038|gb|EDU62141.1| PP-loop family protein [Escherichia coli 53638] >gi|188999726|gb|EDU68712.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4076] >gi|189356826|gb|EDU75245.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4401] >gi|189361597|gb|EDU80016.1| PP-loop family protein [Escherichia coli O157:H7 str. EC4486] >gi|189371828|gb|EDU90244.1| PP-loop family protein [Escherichia coli O157:H7 str. EC869] >gi|189377987|gb|EDU96403.1| PP-loop family protein [Escherichia coli O157:H7 str. EC508] >gi|190904851|gb|EDV64556.1| PP-loop family protein [Escherichia coli B7A] >gi|192959518|gb|EDV89952.1| PP-loop family protein [Escherichia coli E110019] >gi|194416065|gb|EDX32331.1| PP-loop family protein [Escherichia coli B171] (311 aa)
Score = 115, Expect = 5.0e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|15801821|ref|NP_287839.1| C32 tRNA thiolase [Escherichia coli O157:H7 EDL933] >gi|15831182|ref|NP_309955.1| C32 tRNA thiolase [Escherichia coli O157:H7 str. Sakai] >gi|74312284|ref|YP_310703.1| C32 tRNA thiolase [Shigella sonnei Ss046] >gi|168762635|ref|ZP_02787642.1| protein YdaO [Escherichia coli O157:H7 str. EC4501] >gi|194437000|ref|ZP_03069099.1| protein YdaO [Escherichia coli 101-1] >gi|12515408|gb|AAG56453.1|AE005371_9 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|13361393|dbj|BAB35351.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|73855761|gb|AAZ88468.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|189367043|gb|EDU85459.1| protein YdaO [Escherichia coli O157:H7 str. EC4501] >gi|194423983|gb|EDX39971.1| protein YdaO [Escherichia coli 101-1] (311 aa)
Score = 115, Expect = 5.0e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|16129305|ref|NP_415860.1| predicted C32 tRNA thiolase [Escherichia coli str. K-12 substr. MG1655] >gi|89108192|ref|AP_001972.1| predicted C32 tRNA thiolase [Escherichia coli W3110] >gi|170081023|ref|YP_001730343.1| putative tRNA 2-thiocytidine (s(2)C32) synthase [Escherichia coli str. K12 substr. DH10B] >gi|2495598|sp|P76055|YDAO_ECOLI UPF0021 protein ydaO >gi|1787606|gb|AAC74426.1| predicted C32 tRNA thiolase [Escherichia coli str. K-12 substr. MG1655] >gi|85674916|dbj|BAE76407.1| predicted C32 tRNA thiolase [Escherichia coli W3110] >gi|169888858|gb|ACB02565.1| putative tRNA 2-thiocytidine (s(2)C32) synthase [Escherichia coli str. K12 substr. DH10B] (311 aa)
Score = 114, Expect = 5.3e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|146311794|ref|YP_001176868.1| C32 tRNA thiolase [Enterobacter sp. 638] >gi|145318670|gb|ABP60817.1| PP-loop domain protein [Enterobacter sp. 638] (311 aa)
Score = 114, Expect = 5.4e-04, Identities = 42/186 (22%), Positives = 94/186 (50%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTH-----KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L +      ++  VN  D++     E I+ +Y ++  ++  + + +     KD + + K   +L +    +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL    +K +E++ +++    +  +         R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSAPVKFSLVAVNL-DQKQPGFPEHILPEYLEQQGVEYKIVEENTYGIVKDKIPEGKTTCSLCS---RLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAQAREYPIIPCNLCGSQPNLQRQVIGDMLRDWDKR 234
>gi|82776711|ref|YP_403060.1| C32 tRNA thiolase [Shigella dysenteriae Sd197] >gi|81240859|gb|ABB61569.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (311 aa)
Score = 114, Expect = 5.4e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLLEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|16128181|ref|NP_414730.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K-12 substr. MG1655] >gi|89107068|ref|AP_000848.1| tRNA(Ile)-lysidine synthetase [Escherichia coli W3110] >gi|170079824|ref|YP_001729144.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K12 substr. DH10B] >gi|1708989|sp|P52097|TILS_ECOLI tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|971394|emb|CAA90751.1| mesJ [Escherichia coli] >gi|1122208|dbj|BAA08428.1| YaeN [Escherichia coli W3110] >gi|1552765|gb|AAB08617.1| hypothetical [Escherichia coli] >gi|1786386|gb|AAC73299.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K-12 substr. MG1655] >gi|4902929|dbj|BAA77863.1| tRNA(Ile)-lysidine synthetase [Escherichia coli W3110] >gi|47230786|tpd|FAA00003.1| TPA: tRNA-Ile lysidine synthetase [Escherichia coli] >gi|169887659|gb|ACB01366.1| tRNA(Ile)-lysidine synthetase [Escherichia coli str. K12 substr. DH10B] (432 aa)
Score = 114, Expect = 5.4e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D       + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  L Q+ R  ++ ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSYDRNFLR 191
>gi|194435002|ref|ZP_03067243.1| tRNA(Ile)-lysidine synthase [Shigella dysenteriae 1012] >gi|194416738|gb|EDX32866.1| tRNA(Ile)-lysidine synthase [Shigella dysenteriae 1012] (432 aa)
Score = 114, Expect = 5.6e-04, Identities = 47/175 (26%), Positives = 89/175 (50%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D   +   + C+++ + L V     + V   ++   ++   R+ RY  F   ++ L + ++L+  Q  +D  E+  ++L +      L  +   S+F    LIRPLL +T+  L Q+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVRHCENICQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAF---ARTLLLGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMGEVSEFAGTRLIRPLLARTRGELAQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|193062617|ref|ZP_03043711.1| protein YdaO [Escherichia coli E22] >gi|192931739|gb|EDV84339.1| protein YdaO [Escherichia coli E22] (311 aa)
Score = 114, Expect = 5.6e-04, Identities = 45/186 (24%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|170720389|ref|YP_001748077.1| PP-loop domain-containing protein [Pseudomonas putida W619] >gi|169758392|gb|ACA71708.1| PP-loop domain protein [Pseudomonas putida W619] (274 aa)
Score = 114, Expect = 5.7e-04, Identities = 44/186 (23%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  +L+   HL + V  + +       D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  + ++     ++IRPL   ++K ++ Y   K  EF I   N     +   R VV+ M+ EW++K
  S:    34 KVMVCLSGGKDSYTMLDVLLHL-QKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVE--KDTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGSLKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMK--EFPIIPCNLCGSQENLQRQVVKDMLVEWERK 227
>gi|50120922|ref|YP_050089.1| C32 tRNA thiolase [Pectobacterium atrosepticum SCRI1043] >gi|49611448|emb|CAG74896.1| conserved hypothetical protein [Erwinia carotovora subsp. atroseptica SCRI1043] (311 aa)
Score = 114, Expect = 5.7e-04, Identities = 41/186 (22%), Positives = 91/186 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTH-----KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E I+  Y     ++  + + +     KD + + K   +L +    +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL    +K +E++  ++    +  +         R V++ M+ +WDK+
  S:    41 RIMVCLSGGKDSFTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHILPQYLDNIGVEYKIVEENTYGIVKDKIPEGKTTCSLCS---RLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKLKGMPPKLMSDDGKHIVIRPLAYCREKDIERFAEARQYPIIPCNLCGSQPNLQRQVIKDMLRDWDKR 234
>gi|145632883|ref|ZP_01788616.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae 3655] >gi|144986539|gb|EDJ93105.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae 3655] (276 aa)
Score = 114, Expect = 5.8e-04, Identities = 57/212 (26%), Positives = 103/212 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           K ++ +SGG DS  LL+   +L ++      +  VN  D++     E ++ +Y +   +  K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K  EF I   N         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:     7 KVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIGVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAK--EFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMSDPKLFDFK 229
>gi|110834127|ref|YP_692986.1| hypothetical protein ABO_1266 [Alcanivorax borkumensis SK2] >gi|110647238|emb|CAL16714.1| conserved hypothetical protein [Alcanivorax borkumensis SK2] (284 aa)
Score = 114, Expect = 6.3e-04, Identities = 47/186 (25%), Positives = 89/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT--WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNI-------EFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  +L   R+L  +   VN+       D++     E I+ +Y +K  +   + +     + K K      T      +R       ++E+G  KI + H ++D +E+ ++++    K   +  + +S     ++IRPL          YCR K+I       E+ I   N         R V+++M+ +WDK+
  S:    39 KVMVCLSGGKDSYTMLEILRNLQHSA-PVNFELVAVNMDQKQPGFPEHILPEYLEKEGVAYHILEKDTYSIVKEKVPEGKTTCGLCSRLRRGSLYGFAEEIGANKIALGHHRDDIVETLFLNMFYGGKMKAMPPKLRSDDSRNVVIRPL---------AYCREKDIIEFSALKEYPIIPCNLCGSQKNLQRQVIKEMLQQWDKQ 232
>gi|121634977|ref|YP_975222.1| hypothetical protein NMC1192 [Neisseria meningitidis FAM18] >gi|120866683|emb|CAM10435.1| hypothetical protein [Neisseria meningitidis FAM18] (319 aa)
Score = 114, Expect = 6.3e-04, Identities = 47/186 (25%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS ALL+  R L +A   +++       D++     E+++  Y +   +  K+   DT+        +     +    +R     + ++ELG  KI + H ++D L + ++       N+F G + K+    L       I+IRPL    +K L +Y   K    +  +         R V+  M+ +WDK+
  S:    37 KIMVCLSGGKDSYALLDILRQL-QASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEEDTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFL-------NMFYGGKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQPNLQRQVIGDMLRDWDKR 230
>gi|28374025|pdb|1NI5|A Chain A, Structure Of The Mesj Pp-Atpase From Escherichia Coli (433 aa)
Score = 114, Expect = 6.4e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRK-SKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D       + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L    + S+F    LIRPLL +T+  L Q+ R  ++ ++ D +N  D Y RN +R
  S:    17 LVAFSGGLDSTVLLHQ---LVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAXAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSYDRNFLR 192
>gi|77972730|ref|ZP_00828289.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Yersinia frederiksenii ATCC 33641] (461 aa)
Score = 114, Expect = 6.5e-04, Identities = 50/179 (27%), Positives = 89/179 (49%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAVC--------------HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + L+  SGG DS  LL    HL+  VC              H+++     +D+     +  CK++ + L V     D  +++  I   +   R  RY  F   S  L   ++L+  Q  +D  E+  ++L +      L  +  K  F    L+RPLL  +++ LE Y R++ ++++ D +N  DR+ RN +R
  S:    22 QRRVLVGFSGGLDSSVLL----HLL--VCLRDQLIPELKIRAIHIHHGLNPQADSWVMHCQQQCKQWRIPLEVVRVSID--ARHSGI---EAAARTARYQAF---SSHLAADEVLLTAQHLDDQCETFLLALKRGSGPAGLSAMAAKMPFAHSQLLRPLLAFSREILENYARAQQLQWIEDDSNQDDRFDRNFLR 202
>gi|104780539|ref|YP_607037.1| PP-loop ATPase [Pseudomonas entomophila L48] >gi|95109526|emb|CAK14227.1| putative PP-loop ATPase [Pseudomonas entomophila L48] (274 aa)
Score = 113, Expect = 6.8e-04, Identities = 45/186 (24%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  +L+   HL +       +  VN  D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  + ++     ++IRPL   ++K ++ Y   K  EF I   N     +   R VV+ M+ EW++K
  S:    34 KVMVCLSGGKDSYTMLDVLLHLQKVAPIKFDIVAVNM-DQKQPGFPEHVLPAYLKELGVEYHIVE--KDTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGALKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMK--EFPIIPCNLCGSQENLQRQVVKDMLVEWERK 227
>gi|30249025|ref|NP_841095.1| hypothetical protein NE1022 [Nitrosomonas europaea ATCC 19718] >gi|61216622|sp|Q82VP4|TILS_NITEU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|30138642|emb|CAD84933.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] (458 aa)
Score = 113, Expect = 6.9e-04, Identities = 43/174 (24%), Positives = 80/174 (45%)
  Q:     7 IAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG----IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           +A+SGG DS+ LL      ++   L  +  HV +     S       +  C    + L +   H+  + + +   +L+   RE RY  F+ I  +     +++A  ++D +E+  + L +      L     +R     +++ L RPLLN  +  +  Y R   + +V D +N    Y RN +R
  S:    32 VALSGGVDSVVLLHLLTTFSESMQLEVSAVHVEHGISTYSGEWSAFCQSLCDSLAIPLSI---HRLKIRR-RPQESLEAIAREARYQIFKHIQADY----VMLAQHQDDQVETLILQLLRGAGVKGLSAMPTVRLLEPGKTIRLFRPLLNIPRSEILNYARLHGLSWVTDESNLDTSYDRNFLR 207
>gi|119493467|ref|ZP_01624136.1| hypothetical protein L8106_08621 [Lyngbya sp. PCC 8106] >gi|119452711|gb|EAW33890.1| hypothetical protein L8106_08621 [Lyngbya sp. PCC 8106] (338 aa)
Score = 113, Expect = 7.0e-04, Identities = 45/190 (23%), Positives = 82/190 (43%)
  Q:     2 KHKYLIAVSGGPDSMAL------LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKN-----------KKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTF 191
           K + L+AVSGG DSM+L      L  K     A+ H ++  R DS  +   +      + L  +     K        I   +   R  RY    +I+       ++  H K+D  E+   +L +            K+ + +         ++ L+RP+L   +    Q+C+ + ++   D TN    Y+RN +R  +  + +  F
  S:    27 KQRLLVAVSGGQDSMSLIKLLLDLQPKWGWDLAIAHCDHRWRSDSGANADYIEQLADSWQLSFYRQTAQK--------IPKTEADARHWRYQVLSEIALTHNYDYVVTGHTKSDRAETLLYNLIRGSGSDGLQALAWKRPIDIEANVNHTNHNIGLVRPMLEILRSQTGQFCQDQQLKIWEDSTNEDLSYARNRIRTELIPYLQTHF 225
>gi|167032255|ref|YP_001667486.1| PP-loop domain-containing protein [Pseudomonas putida GB-1] >gi|166858743|gb|ABY97150.1| PP-loop domain protein [Pseudomonas putida GB-1] (274 aa)
Score = 113, Expect = 7.2e-04, Identities = 44/186 (23%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  +L+   HL + V  + +       D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  + ++     ++IRPL   ++K ++ Y   K  EF I   N     +   R VV+ M+ EW++K
  S:    34 KVMVCLSGGKDSYTMLDVLLHL-QKVAPIKFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVE--KDTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGALKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMK--EFPIIPCNLCGSQENLQRQVVKDMLVEWERK 227
>gi|15676911|ref|NP_274057.1| hypothetical protein NMB1023 [Neisseria meningitidis MC58] >gi|81784654|sp|Q9JZJ6|Y1023_NEIMB UPF0021 protein NMB1023 >gi|7226263|gb|AAF41423.1| conserved hypothetical protein [Neisseria meningitidis MC58] (319 aa)
Score = 113, Expect = 7.3e-04, Identities = 47/186 (25%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS ALL+  R L +A   +++       D++     E+++  Y +   +  K+   DT+        +     +    +R     + ++ELG  KI + H ++D L + ++       N+F G + K+    L       I+IRPL    +K L +Y   K    +  +         R V+  M+ +WDK+
  S:    37 KIMVCLSGGKDSYALLDILRQL-QASAPIDFQLVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEEDTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATLFL-------NMFYGGKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQPNLQRQVIGDMLRDWDKR 230
>gi|15966489|ref|NP_386842.1| hypothetical protein SMc02940 [Sinorhizobium meliloti 1021] >gi|61216708|sp|Q92JY3|TILS_RHIME tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|15075760|emb|CAC47315.1| Hypothetical protein [Sinorhizobium meliloti 1021] (453 aa)
Score = 113, Expect = 7.3e-04, Identities = 44/181 (24%), Positives = 86/181 (47%)
  Q:     4 KYLIAVSGGPDSMALL---------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKY---KDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF-----------RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
           + L+AVSGG DSM LL         +++R    A C V++  R  S  + + V  +C    +       H+  + ++   K    +Q   R  RY+   + +  LG   I I H ++D  E+  M + + K +     + +              R + ++RP L   +  +  + +++ + ++ D +N    + R  VR  +A
  S:    21 RILVAVSGGSDSMGLLVALHSAIAADERRGFSLAACTVDHALRPQSACEAEDVAAFCAALGI------AHR--ICRWEGAKPSTGIQAAARNKRYELLAEAADALGADCIAIGHTRDDQQETVAMRIARGKGDGAGDGQGEGHGGAGMAASMLYGRRIWVLRPFLGLARAEIRSFLQARGVSWIDDPSNANPAFERVRVRARIA 216
>gi|34498644|ref|NP_902859.1| cell cycle protein [Chromobacterium violaceum ATCC 12472] >gi|61216591|sp|Q7NT72|TILS_CHRVO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|34104497|gb|AAQ60855.1| cell cycle protein [Chromobacterium violaceum ATCC 12472] (435 aa)
Score = 113, Expect = 7.7e-04, Identities = 44/176 (25%), Positives = 85/176 (48%)
  Q:     5 YLIAVSGGPDSMALLN-------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + +  SGG DS+ALL+       ++  +  +  HV++    ++D      +  C    + L +   H     +     +++   RE RY  + + + E+    I +AH ++D  E+  + L +       G R  +   +L       +L RPLL   ++ LE Y +++   +V D +N   RY RN++R
  S:    19 FEVGFSGGLDSVALLSLLCEARARRPEIGLSAVHVHHGLSPNADAWAAHCQALCDSLRVPLRIERVH----VRAGGGESVEAAAREARYQVYRRSASEV----IALAHHQDDQAETILLQLLRGG-----GARALAAMPALRELAPGKLLWRPLLEIPRERLEAYVKARGFAWVDDESNLDTRYRRNLLR 195
>gi|59800981|ref|YP_207693.1| hypothetical protein NGO0547 [Neisseria gonorrhoeae FA 1090] >gi|59717876|gb|AAW89281.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] (319 aa)
Score = 113, Expect = 8.0e-04, Identities = 47/186 (25%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS ALL+  R L +A   +++       D++     E+++  Y +   +  K+   DT+        +     +    +R     + ++ELG  KI + H ++D L + ++       N+F G + K+    L       I+IRPL    +K L +Y   K    +  +         R V+  M+ +WDK+
  S:    37 KIMVCLSGGKDSYALLDILRRL-QASAPIDFELVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEEDTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATMFL-------NMFYGGKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQPNLQRQVIGDMLRDWDKR 230
>gi|15794367|ref|NP_284189.1| hypothetical protein NMA1465 [Neisseria meningitidis Z2491] >gi|121052292|emb|CAM08621.1| hypothetical protein NMA1465 [Neisseria meningitidis Z2491] (319 aa)
Score = 113, Expect = 8.0e-04, Identities = 47/186 (25%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS ALL+  R L +A   +++       D++     E+++  Y +   +  K+   DT+        +     +    +R     + ++ELG  KI + H ++D L + ++       N+F G + K+    L       I+IRPL    +K L +Y   K    +  +         R V+  M+ +WDK+
  S:    37 KIMVCLSGGKDSYALLDILRRL-QASAPIDFQLVAVNLDQKQPGFPEEVLPTYLESIGVPYKIVEEDTYSTVKRVLDEGKTTCSLCSRLRRGILYRTAKELGCTKIALGHHRDDILATLFL-------NMFYGGKLKAMPPKLVSDNGEHIVIRPLAYVKEKDLIKYAELKQFPIIPCNLCGSQPNLQRQVIGDMLRDWDKR 230
>gi|117923751|ref|YP_864368.1| tRNA(Ile)-lysidine synthetase [Magnetococcus sp. MC-1] >gi|117607507|gb|ABK42962.1| tRNA(Ile)-lysidine synthetase [Magnetococcus sp. MC-1] (349 aa)
Score = 113, Expect = 8.4e-04, Identities = 53/175 (30%), Positives = 79/175 (45%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA---VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNL--FLGIRR-----KSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+AVS G DS ALL+  R          H ++  R  +  D   V+  C +Y + L     H           NL    R+ RY F  + +  L    I IAH + D  E+    L      L    G+R       ++F  + L+RPLL  +KK L  + + + I +  D +N   RY+RN +R
  S:    31 LVAVSAGVDSSALLHLLRLCYPGPLQAAHFDHALRPCAKQDLAHVQQQCAQYAIPL-----HVGHWLPPAQKANLAAQARQARYRFLAQTAYGLKAPFIGIAHHQEDQAETLLERLLLRGAGLKGLSGMRPLAPLPMAEFAQVQLLRPLLPFSKKELTSWLQGEQITWREDPSNQDLRYTRNHIR 210
>gi|91209258|ref|YP_539244.1| tRNA(Ile)-lysidine synthetase [Escherichia coli UTI89] >gi|117622473|ref|YP_851386.1| tRNA(Ile)-lysidine synthetase [Escherichia coli APEC O1] >gi|91070832|gb|ABE05713.1| putative cell cycle protein MesJ [Escherichia coli UTI89] >gi|115511597|gb|ABI99671.1| putative cell cycle protein MesJ [Escherichia coli APEC O1] (432 aa)
Score = 112, Expect = 9.0e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D   K   + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  L Q+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVKHCENICQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGELVQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|110640407|ref|YP_668135.1| tRNA(Ile)-lysidine synthetase [Escherichia coli 536] >gi|191172763|ref|ZP_03034300.1| tRNA(Ile)-lysidine synthase [Escherichia coli F11] >gi|110341999|gb|ABG68236.1| putative cell cycle protein MesJ [Escherichia coli 536] >gi|190906913|gb|EDV66515.1| tRNA(Ile)-lysidine synthase [Escherichia coli F11] (437 aa)
Score = 112, Expect = 9.0e-04, Identities = 47/175 (26%), Positives = 86/175 (49%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVE----------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++   LV+             HV++    ++D   K   + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  L Q+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQ---LVQWRTENPGVTLRAIHVHHGLSANADAWVKHCENICQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGELVQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|148825910|ref|YP_001290663.1| threonyl-tRNA synthetase [Haemophilus influenzae PittEE] >gi|148716070|gb|ABQ98280.1| threonyl-tRNA synthetase [Haemophilus influenzae PittEE] (276 aa)
Score = 112, Expect = 9.0e-04, Identities = 53/212 (25%), Positives = 101/212 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           K ++ +SGG DS  LL+   +L ++      +  VN  D++     E ++ +Y +   +  K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K    +  +         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:     7 KVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIGVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAKKFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFK 229
>gi|145631383|ref|ZP_01787154.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae 22.4-21] >gi|144983042|gb|EDJ90546.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R3021] (273 aa)
Score = 112, Expect = 9.3e-04, Identities = 58/215 (26%), Positives = 103/215 (47%)
  Q:     1 MKHKYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           M  K ++ +SGG DS  LL+   +L +       +  VN  D++     E ++ +Y +   +  K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K  EF I   N         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:     1 MAIKVMVCLSGGKDSYTLLDILLNLQQNAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIGVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAK--EFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFK 226
>gi|82775579|ref|YP_401926.1| tRNA(Ile)-lysidine synthetase [Shigella dysenteriae Sd197] >gi|81239727|gb|ABB60437.1| cell cycle protein [Shigella dysenteriae Sd197] (431 aa)
Score = 112, Expect = 9.3e-04, Identities = 45/175 (25%), Positives = 84/175 (48%)
  Q:     6 LIAVSGGPDSMALLNK-------KRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           L+A SGG DS  LL++          +V    HV++    ++D       + C+++ + L V     + V   ++   ++   R+ RY  F +    L  + ++ A   +D  E+  ++L +      L  +   S+F    LIRPLL +T+  L Q+  +  + ++ D +N  D Y RN +R
  S:    16 LVAFSGGLDSTVLLHQLVQWRTENPGVVLRAIHVHHGLSANADAWVTHCENVCQQWQVPLVV-----ERVQLAQEGLGIEAQARQARYQAFARTL--LPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELAQWALAHGLRWIEDESNQDDSYDRNFLR 191
>gi|66046934|ref|YP_236775.1| hypothetical protein Psyr_3705 [Pseudomonas syringae pv. syringae B728a] >gi|63257641|gb|AAY38737.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae B728a] (274 aa)
Score = 112, Expect = 9.3e-04, Identities = 44/187 (23%), Positives = 91/187 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   HL +       +  VN  D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  + ++     ++IRPL          YC  K+I+   D   F           +   R VV++M+ +W++KT
  S:    34 KVMVCLSGGKDSYTMLDVLMHLQKVAPIKFDIVAVNM-DQKQPGFPEHVLPAYLKELGIEYHIVE--KDTYSVVKELIPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGSLKAMPPKLRADDGRNVVIRPL---------AYCHEKDIQAYSDLKQFPIIPCNLCGSQENLQRQVVKEMLQDWERKT 228
>gi|159904318|ref|YP_001551662.1| ATPase [Prochlorococcus marinus str. MIT 9211] >gi|159889494|gb|ABX09708.1| Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Prochlorococcus marinus str. MIT 9211] (339 aa)
Score = 112, Expect = 9.5e-04, Identities = 43/176 (24%), Positives = 81/176 (46%)
  Q:     6 LIAVSGGPDSMALLN---KKRHLVE---AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS--LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRK 181
           L+++SGG DSMALL      R L E    + H ++   + S      ++++C    L+       K+ +   +   N +            + +Q      +L  H   D  E+  ++L++      LG  + S+  S  + L+RPLL  +++   Q C+  ++   +D +N   R SRN +R+
  S:    36 LLSISGGQDSMALLKLIVDLRRLYEWKIFIWHGDHGWHKQSTQIATGLKEWCNNQELRFVSERATKEKIHSEQAARNWRYECLTAHAQLLSQQNQSSPCHYVLTGHTSTDRAETLLLNLSRGTHLSGLGSLKSSRTLSGQIKLVRPLLIFSREDTAQICKEMDLPVWLDPSNSNMRISRNRIRE 219
>gi|52425142|ref|YP_088279.1| MesJ protein [Mannheimia succiniciproducens MBEL55E] >gi|52307194|gb|AAU37694.1| MesJ protein [Mannheimia succiniciproducens MBEL55E] (312 aa)
Score = 112, Expect = 9.6e-04, Identities = 49/186 (26%), Positives = 88/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLN---KKRHLVEA---VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  LL+     RH       +  VN  D++     E I+ +Y     ++  + + +   + K K      T      +R     + + ELG  KI + H ++D LE+ ++       N+F G + KS    L       I+IRPL    +K +E+Y  +K    +  +         R V+++M+  WD++
  S:    42 KVMVCLSGGKDSYTLLDILLNLRHNAPVHFDIVAVNL-DQKQPGFPEHILPEYLSSIGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLETLFL-------NMFYGGKLKSMPPKLVSDDGKQIVIRPLAYCKEKDIEKYAVAKQFPIIPCNLCGSQPNLQRQVIKEMLQTWDRR 235
>gi|11465849|ref|NP_053993.1| hypothetical protein PopuCp198 [Porphyra purpurea] >gi|1723412|sp|P51383|TILS_PORPU tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|1276849|gb|AAC08269.1| ORF327 [Porphyra purpurea] (327 aa)
Score = 112, Expect = 9.6e-04, Identities = 69/261 (26%), Positives = 123/261 (47%)
  Q:     7 IAVSGGPDSMAL------LNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKF-RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNM------FFIKLLDSKFNNWIKQDF-DINYF-LKIKNNYKESLIY--LFLNHIGIKPNENKIEQIIEFINKN 267
           +A SGG DS+ L      LN        + H ++  R DS    K V  + + YN  L+ F+          D  N +   R+ RY     ++ +    KIL+AH   D  E+   +L +    +    I    +  +S+ ++RPLLN  +     +CR   +   +D +N+     RN +R+ +  + K  FQ   L+ + ++L ++      F  +     +   I QD   IN+  L++ +   +S I+   F+ ++   PN  +IE +I FI +N
  S:    29 VAFSGGQDSLTLVKLLYDLNPFYRWRITLIHFDHRWRWDSMLASKQVFSFARYYNFPLYYFEC--------PDYLNTEEASRKWRYTTLIDLAVKNNFTKILLAHTATDSSETLLSNLFRGTSLDGLASIGWSCQLAQSVYIVRPLLNFYRFETSWFCRKYYLPIWVDRSNYDYIMFRNRLRQELVPYIKSYFQP-NLEERCYSLSSLVKYDTDFLEQEALRIYFILIHQDLIAINHTALRLLHLSVQSRIFKIFFIANLNFNPNSRQIEDVIIFIKQN 298
>gi|83950085|ref|ZP_00958818.1| PP-loop family protein [Roseovarius nubinhibens ISM] >gi|83837984|gb|EAP77280.1| PP-loop family protein [Roseovarius nubinhibens ISM] (396 aa)
Score = 112, Expect = 1.0e-03, Identities = 46/178 (25%), Positives = 82/178 (46%)
  Q:     7 IAVSGGPDSMALL------NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKK-NLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
           +AVSGG DS ALL       + R +      V++  R  + ++ + V   C +  L       H  +   +    NL    R  RYD     +    I  +++ H +ND  E+  M L +    +   G+  ++   ++ L RPLL  +++SL  Y R ++I +  D +N   +Y+R   R  ++
  S:     3 VAVSGGSDSTALLLGLKDWAQGREVSLYAVTVDHGLRAAAAHEAEAVAQLCAELALP-----HHCLEWQGWDGQGNLSDAARRARYDLMADWALSHDIHDLVLGHTQNDQAETLVMRLARGAGLDGLAGMGARTARGAMTLHRPLLGVSRESLRAYLRRRDIGWADDPSNEDPQYARVRTRAALS 182
>gi|148549282|ref|YP_001269384.1| PP-loop domain-containing protein [Pseudomonas putida F1] >gi|148513340|gb|ABQ80200.1| PP-loop domain protein [Pseudomonas putida F1] (274 aa)
Score = 112, Expect = 1.0e-03, Identities = 40/186 (21%), Positives = 90/186 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDI----NNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           K ++ +SGG DS  +L+   HL + V  + +       D++     E ++  Y K+  ++  + +  KD  S  K++        +    +R       + E+G  K+ + H ++D +E+ ++++  N     +  + ++     ++IRPL   ++K ++ Y   K    +  +     +   R VV+ M+ EW++K
  S:    34 KVMVCLSGGKDSYTMLDVLLHL-QKVAPITFEIVAVNMDQKQPGFPEHVLPAYLKELGVEYHIVE--KDTYSVVKELVPEGKTTCSLCSRLRRGTLYTFADEIGATKMALGHHRDDIVETFFLNMFFNGALKGMPPKLRADDGRNVVIRPLAYCSEKDIQAYSDMKAFPIIPCNLCGSQENLQRQVVKDMLVEWERK 227
>gi|67153882|ref|ZP_00415627.1| conserved hypothetical protein [Azotobacter vinelandii AvOP] >gi|67088015|gb|EAM07481.1| conserved hypothetical protein [Azotobacter vinelandii AvOP] (331 aa)
Score = 112, Expect = 1.0e-03, Identities = 51/187 (27%), Positives = 97/187 (51%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYRE-IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKKT 190
           K ++ +SGG DS  +L+   +L + V  + +       D++     E+++  Y K   +   +   DT+   K+ + + K   +L +  R    Y F ++I    G  K+ + H ++D LE+ ++       NLF G   K+    L       ++IRPL   ++  +E Y + K  EF I   N     +   R VV++M+ EW++++
  S:    91 KVMVCLSGGKDSYTMLDVLLYL-QKVAPIGFEIVAVNMDQKQPGFPEEVLPTYLKSIGVDYHIIEKDTYSVVKEKIPEGKTTCSLCSRLRRGTLYTFADRI----GATKMALGHHRDDILETFFL-------NLFYGGTLKAMPPKLLSDDGRNVVIRPLAYCSETDIEAYAKLK--EFPIIPCNLCGSQENLQRQVVKEMLREWERQS 285
>gi|56697938|ref|YP_168309.1| PP-loop family protein [Silicibacter pomeroyi DSS-3] >gi|61216401|sp|Q5LNU7|TILS_SILPO tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|56679675|gb|AAV96341.1| PP-loop family protein [Silicibacter pomeroyi DSS-3] (419 aa)
Score = 112, Expect = 1.0e-03, Identities = 45/178 (25%), Positives = 83/178 (46%)
  Q:     7 IAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDV-SKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS-LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
           +AVSGG DS+AL++       +  +   V  V++  R +S ++  +V        L       H+  + + +    NLQ   R  RY      +    +  + +AH  +D  E+  M L ++     L      + +  ++L+RPLL  T+ +L  + R++ I +  D +N   RY R   R+ +A
  S:    28 VAVSGGGDSVALMHLLARCFPRGEVKLCVATVDHGLRSESASEAALVARQAAGLGLP------HETLLWTGWTGEGNLQDQARRARYGLLTDWALRNRVTTVALAHTADDQAETLLMRLGRSAGVSGLAAMAPRRMQDGVVLVRPLLGITRDALRDFLRAEGIAWAEDPSNEDIRYDRIKARQALA 207
>gi|157370847|ref|YP_001478836.1| C32 tRNA thiolase [Serratia proteamaculans 568] >gi|157322611|gb|ABV41708.1| PP-loop domain protein [Serratia proteamaculans 568] (310 aa)
Score = 112, Expect = 1.0e-03, Identities = 45/186 (24%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTH-----KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   VN+       D++     E I+  Y +   ++  + + +     KD + + K   +L +    +R     + + ELG  KI + H ++D L++ ++       N+F G + K     L       ++IRPL    +K +E++  +K    +  +         R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PVNFSLVAVNLDQKQPGFPEHILPAYLESLGVEYQIVEENTYSIVKDKIPEGKTTCSLCS---RLRRGILYRTATELGATKIALGHHRDDILQTLFL-------NMFYGGKLKGMPPKLMSDDGKHVVIRPLAYCREKDIERFSVAKGFPIIPCNLCGSQPNLQRQVIGDMLRDWDKR 234
>gi|21909546|ref|NP_663814.1| putative cell-cycle protein [Streptococcus pyogenes MGAS315] >gi|21903726|gb|AAM78617.1| putative cell-cycle protein [Streptococcus pyogenes MGAS315] (395 aa)
Score = 112, Expect = 1.1e-03, Identities = 65/270 (24%), Positives = 117/270 (43%)
  Q:    16 MALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFL-GIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWFNLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHI-----GIKPNENKIEQIIEFINKNKNGSVKKYRLKENQFIEI 285
           + L   K  +   + HVN+  R +SD++E  ++ + KK+++ ++        VS ++ I + +   R+ RY FF+ I  +     ++ AH  +D  E+  M L +  +   L GI+    F +  LIRP L  +KK L +      I    D +N    + RN VR       K+   +F   +    L+N    +      N+    D      L   N   +S+ Y  L         +   +++  Q+++ I   K G    Y LK++ +I I
  S:     7 LYLFQDKLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIY--------VSNFEGIFS-EKAARDWRYAFFKSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRHLSGIKSVQPFANGQLIRPFLTFSKKDLPE------IFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAFKELTNHITTTD------LTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGY---YYLKKDYYIFI 258
>gi|86359050|ref|YP_470942.1| putative cell cycle protein MesJ/cytosine deaminase-related protein [Rhizobium etli CFN 42] >gi|86283152|gb|ABC92215.1| putative cell cycle protein MesJ/cytosine deaminase-related protein [Rhizobium etli CFN 42] (486 aa)
Score = 112, Expect = 1.1e-03, Identities = 46/179 (25%), Positives = 81/179 (45%)
  Q:     6 LIAVSGGPDSMALL-------NKKRHLVEAVCH--VNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF-RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMA 184
           L+A+SGG DS  LL            L  ++C   V++  R  S ++ + V   C    +   +     +     K    +    RE RY      ++ LG   I+  H  +D  E+  M   + ++ L  GI     F R L ++RPLL  T+  +  + R++ + ++ D +N   RY R   R+ ++
  S:    26 LVAISGGSDSTGLLLLLAEAMKAAPDLEMSLCAATVDHGLRAGSADEAREVAALCASLGIPHMIARWQGE-----KPKTGIMAAAREARYSLLADAAEALGANLIVTGHTLDDQRETLRMRGMRTEQ-LSSGIADAVLFDRRLWILRPLLFATRADIRAFLRARGVRWIDDPSNEDIRYERVRTRRQLS 208
>gi|157953048|ref|YP_001497940.1| hypothetical protein NY2A_B744L [Paramecium bursaria Chlorella virus NY2A] >gi|155123275|gb|ABT15143.1| hypothetical protein NY2A_B744L [Paramecium bursaria Chlorella virus NY2A] (504 aa)
Score = 111, Expect = 1.2e-03, Identities = 52/183 (28%), Positives = 92/183 (50%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA----------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINN---LQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSL-NKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYT--NFWDRYSRNVVRKMMAEWDKK 189
           +++SGG DSM L     H+++           V  VNY +R  + ++E  V D+       + V    + +     D N     +T+ R++RY+ ++ IS E     + + H K+D LE+   ++ + +K +   GI    K       RPLL+ +K  +  Y R  NI ++ + T  +F     RN V   M +WD++
  S:   202 MSLSGGVDSMTLF----HILDGLRGFYGYKMNVAMVNYTNRACAYDEEYFVTDWANWLGYPISVRRIEEINRKPCIDANIRTLYETYTRKVRYNTYKSISHE---AFVAMGHNKDDCLENILQNICSGHKYDNLAGIVTVVKQDDNNFFRPLLDVSKDEIIAYARYHNIPYLPNSTPAHFKRGMVRNFVVPCMNDWDER 393
>gi|89076564|ref|ZP_01162872.1| putative ATPase [Photobacterium sp. SKA34] >gi|89047756|gb|EAR53355.1| putative ATPase [Photobacterium sp. SKA34] (297 aa)
Score = 111, Expect = 1.2e-03, Identities = 55/185 (29%), Positives = 89/185 (48%)
  Q:     6 LIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQT------WYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS---KFRS----LILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKKT 190
           +  +SGG DS A+L+   +L +A      V  VN  D++     E I+ +Y    N+  ++ D     V + K      T        R   Y F +KI    G  KI + H  +D +E+ ++       N+F G R K+   K RS     ++IRPL    +K L +Y   K    +  +     +   R  ++ M+ +WDKKT
  S:    41 MACISGGKDSFAMLDILLNLKKAAPINFDVVAVNL-DQKQPGFPEHILPEYFSSLNIPYYIVDKDTYSVVREKVEEGKTTCGLCSRLRRGTLYSFADKI----GATKIALGHHLDDIVETMFL-------NMFHGSRLKAMPPKLRSDDGRNVVIRPLSYCREKDLIKYAEHKAFPIIPCNLCGSQENLQRQSIKAMLIDWDKKT 233
>gi|113953772|ref|YP_729309.1| MesJ-like protein [Synechococcus sp. CC9311] >gi|113881123|gb|ABI46081.1| possible MesJ homolog [Synechococcus sp. CC9311] (331 aa)
Score = 111, Expect = 1.3e-03, Identities = 47/175 (26%), Positives = 77/175 (44%)
  Q:     6 LIAVSGGPDSMALLNKKR--------HLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRR------KSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           LIA+SGG DSMALL            H         +HD+  +   E  ++++C+   L L +    +D           +   R  RY     +SQ+   + +L AH  +D  E+  + L +      LG  R       +      L+RPLL  ++    Q C+   +   +D +N    +SRN +R
  S:    32 LIALSGGQDSMALLGLLLGLQHLHHWHFQLWHGDHGWHDQSAATASE--LKEWCQGQELDLQISRNTRDHTGT-------EASARSWRYQELAALSQQFCCRTVLTAHTASDRAETLLLQLARGTDLAGLGSLRPIRPLQNNDPNGTRLVRPLLTFSRDDTTQICQDLQLPVWLDPSNANPAFSRNRIR 211
>gi|15602471|ref|NP_245543.1| hypothetical protein PM0606 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12720877|gb|AAK02690.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] (314 aa)
Score = 111, Expect = 1.3e-03, Identities = 31/106 (29%), Positives = 57/106 (53%)
  Q:    84 IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           +R     + + ELG  KI + H ++D LE+ ++       N+F G + KS    LI       +IRPL    +K +E+Y ++K+   +  +         R VV++M+ +WD++
  S:   130 LRRGILYRTATELGATKIALGHHRDDMLETLFL-------NMFYGGKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAQAKHFPIIPCNLCGSQPNLQRQVVKEMLQKWDRQ 236
>gi|77360937|ref|YP_340512.1| lysidine forming enzyme [Pseudoalteromonas haloplanktis TAC125] >gi|76875848|emb|CAI87069.1| putative lysidine forming enzyme, modifying isoleucine tRNA decoding AUA [Pseudoalteromonas haloplanktis TAC125] (467 aa)
Score = 111, Expect = 1.3e-03, Identities = 46/190 (24%), Positives = 91/190 (47%)
  Q:     5 YLIAVSGGPDSMALLNKKRHLVEAV-----------CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNK--KNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           + +A+SGG DS+ LL    HL+ A+            ++++   + +D+ +   +  C + N+    F T K ++ + +   +L+   R+ RY   +++S    I  IL+    ND +E+  + L +    K L    R ++     +  RPLL   +  +E +     +  V D +N  +R+ RN +R+ +       F  F
  S:    57 FTVALSGGVDSVVLL----HLMHALRVQDPALQVSAIYIHHGLSQYADDWQVFCQTLCNELNVP---FQTAKVNIEQ-QSRTSLEAQARDARYQALDELSPHGSI--ILLGQHLNDQIETFLLRLKRGSGLKGLGAMQRERTLTSGRLCFRPLLAVKRSDIEAFAAQYALNHVTDDSNTDERFERNFMRQQVVPILAARFNGF 249
>gi|152969928|ref|YP_001335037.1| C32 tRNA thiolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954777|gb|ABR76807.1| hypothetical protein KPN_01375 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (311 aa)
Score = 111, Expect = 1.3e-03, Identities = 42/186 (22%), Positives = 89/186 (47%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVE------AVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L +      ++  VN  D++     E I+  Y ++  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL    +K +E++ ++K    +  +         R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQKSAPISFSLVAVNL-DQKQPGFPEHILPAYLEQLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPLAYCREKDIERFSQAKGFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|187732105|ref|YP_001880184.1| PP-loop family protein [Shigella boydii CDC 3083-94] >gi|187429097|gb|ACD08371.1| PP-loop family protein [Shigella boydii CDC 3083-94] (311 aa)
Score = 111, Expect = 1.4e-03, Identities = 45/186 (24%), Positives = 87/186 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++  Y +K  ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPVYLEKLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|42629335|ref|ZP_00154882.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R2846] (313 aa)
Score = 111, Expect = 1.4e-03, Identities = 57/212 (26%), Positives = 103/212 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           K ++ +SGG DS  LL+   +L ++      +  VN  D++     E ++ +Y +   +  K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K  EF I   N         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:    44 KVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIGVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAK--EFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFK 266
>gi|145629546|ref|ZP_01785344.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae 22.1-21] >gi|144978389|gb|EDJ88153.1| predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae 22.1-21] (310 aa)
Score = 111, Expect = 1.4e-03, Identities = 53/212 (25%), Positives = 102/212 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCK--KYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           K ++ +SGG DS  LL+   +L ++      +  VN  D++     E ++ +Y +  + + K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K    +  +         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:    41 KVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIRVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAKKFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFK 263
>gi|59801231|ref|YP_207943.1| hypothetical protein NGO0820 [Neisseria gonorrhoeae FA 1090] >gi|75432494|sp|Q5F8F6|TILS_NEIG1 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) >gi|59718126|gb|AAW89531.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] (426 aa)
Score = 111, Expect = 1.4e-03, Identities = 65/267 (24%), Positives = 125/267 (46%)
  Q:     4 KYLIAVSGGPDSMALLN------KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRY-DFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSL-------ILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR-KMMAEWDKKT--FQKFYLKVKWFNLKNMFFIKLLDSKFNNWI--KQDFDINYFLKIKNNYKESLIYLFLNHIGIK-PNENKIEQIIEFINKNKNG 270
           K  +A+SGG DS+ LL+      K+   V    H+++     +D+     R+YC    + L   +T K  V   K+   ++   R+ RY +F EK     G   + +AH ++D +E+  +++ +       G+R  +   ++       I+ RPLL  +++ +  Y R   +  + D +N    Y RN  R +++ E   +   F +  L       +++  ++ +  +   W+     FD   +L      K  ++  FL   GI  PN+N +  I   + + K G
  S:    13 KTAVALSGGLDSVVLLHLLVCAGKRAGFVPEALHIHHGLSPRADDWADFCRNYCDMLGVGL---ETVK--VCVEKNGLGIEAAARQKRYAEFAEK-----GFDVLALAHHRDDQIETFMLAVARGG-----GLRALAAMPAVRPLGENGIIWRPLLPFSRQDIWDYARKHGLPNIEDESNTDTAYLRNRFRHRILPELSAQIPHFGRHVLNNVRALQEDLALLEEVVVQDCRWVCGAGYFDTARWLTFSPRRKTHILRNFLKENGIPVPNQNALADIARVLTEAKTG 284
>gi|148981150|ref|ZP_01816312.1| cell cycle protein MesJ [Vibrionales bacterium SWAT-3] >gi|145960977|gb|EDK26302.1| cell cycle protein MesJ [Vibrionales bacterium SWAT-3] (443 aa)
Score = 111, Expect = 1.5e-03, Identities = 46/178 (25%), Positives = 88/178 (49%)
  Q:     3 HKYLIAVSGGPDSMALLN-----KKRHLVEA-VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQK-NDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           H+ ++A SGG DS  LL       K H ++    HV++   +++D   +  + +C   ++ L V +    DV   + I  L    R+ RY+ F+     L    +L+  Q  +D +E+  ++L +      L  + +   F    ++RP+L+ T+  +E + R   + +V D +N   R+ RN +R
  S:    20 HRLVVAFSGGVDSRVLLELAAQYTKTHEIDCQAIHVHHGLSDNADQWAEQCQVWCDDLSVPLAV-ERVSLDVRSGESIEKLA---RDARYNAFK---SHLRQGDVLVTGQHVDDQVETFLLALKRGSGPKGLSSMAKVMPFSGAHIVRPMLSVTRAEIEAFARRMGLTWVEDESNQDVRFDRNFIR 198
>gi|114570963|ref|YP_757643.1| tRNA(Ile)-lysidine synthetase [Maricaulis maris MCS10] >gi|114341425|gb|ABI66705.1| tRNA(Ile)-lysidine synthetase [Maricaulis maris MCS10] (450 aa)
Score = 111, Expect = 1.5e-03, Identities = 49/186 (26%), Positives = 85/186 (45%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKK--YNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKN---KKNLFLGIRRKSKF----RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQ 192
           IA SGG DS+ALL        A      V  V++  R+ S ++   V     +  +      +D  +           LQ   R+ R+    +  ++LG+ ++ +AH ++D  E+ ++ L      +    +  R  S      R L L+RP L+ T+  L +      I++V D +N  DRY+R   R  +    +  FQ
  S:    24 IACSGGGDSLALLVIASDWARANGRSLQVLTVDHGLRKSSADEANHVAAMADRLGWPCTCLTWDDARPGAG-------LQARARDARHRLLARACRDLGLTELALAHTRDDQSETVWLRLAAGGSWRSAAVMSDRAPSPVWPEGRDLDLLRPCLDVTRAELRRVLSDAGIDWVDDPSNEDDRYARVRARGDLGLLSEAGFQ 217
>gi|126208449|ref|YP_001053674.1| hypothetical protein APL_0975 [Actinobacillus pleuropneumoniae L20] >gi|126097241|gb|ABN74069.1| hypothetical protein APL_0975 [Actinobacillus pleuropneumoniae L20] (318 aa)
Score = 111, Expect = 1.5e-03, Identities = 31/106 (29%), Positives = 55/106 (51%)
  Q:    84 IRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           +R     + + ELG  KI + H ++D LE+ ++       N+F G + KS    LI       +IRPL    +K +E+Y ++K    +  +         R VV++M+  WD++
  S:   133 LRRGILYRTATELGATKIALGHHRDDMLETLFL-------NMFYGGKLKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYSQAKQFPIIPCNLCGSQPNLQRQVVKEMLQTWDRQ 239
>gi|26247680|ref|NP_753720.1| C32 tRNA thiolase [Escherichia coli CFT073] >gi|110641578|ref|YP_669308.1| C32 tRNA thiolase [Escherichia coli 536] >gi|191170922|ref|ZP_03032473.1| protein YdaO [Escherichia coli F11] >gi|26108082|gb|AAN80282.1|AE016760_141 Hypothetical protein ydaO [Escherichia coli CFT073] >gi|27526304|emb|CAD42727.1| YdaO protein [Escherichia coli] >gi|110343170|gb|ABG69407.1| hypothetical protein YdaO [Escherichia coli 536] >gi|190908654|gb|EDV68242.1| protein YdaO [Escherichia coli F11] (311 aa)
Score = 110, Expect = 1.5e-03, Identities = 44/186 (23%), Positives = 87/186 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +   ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|134094514|ref|YP_001099589.1| hypothetical protein HEAR1289 [Herminiimonas arsenicoxydans] >gi|133738417|emb|CAL61462.1| putative tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) TilS [Herminiimonas arsenicoxydans] (465 aa)
Score = 110, Expect = 1.6e-03, Identities = 51/178 (28%), Positives = 83/178 (46%)
  Q:     3 HKYLIAVSGGPDSMALLNKKR-----HLVEAVC-HVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS------------LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
            K  IA SGG DS ALL   R     H +E    HV++    ++D      +  C    +    FD  +  ++  +D + ++   R  RY    ++ +   +  +L AH ++D  E+  + L +       G+   S   S            L++ RPLL   +  LE+   S  I FV D +N   RY+RN +R
  S:    32 QKIAIAYSGGLDSAALLYLLRAYATQHGLELFAFHVHHGLSLNADQWLAHCQQQCAGLGV---AFDARRVQIAN-QDKSGVEEAARHSRYAALGEMCRAHDVPLLLTAHHQDDQAETVLLQLLRGS-----GVAGLSGMDSVNHAADLLGDATLLMGRPLLQLARADLEKIVTSNAIAFVEDESNLDPRYARNALR 218
>gi|88798315|ref|ZP_01113901.1| hypothetical protein MED297_13692 [Reinekea sp. MED297] >gi|88779091|gb|EAR10280.1| hypothetical protein MED297_13692 [Reinekea sp. MED297] (310 aa)
Score = 110, Expect = 1.6e-03, Identities = 42/186 (22%), Positives = 91/186 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVF--DTH---KDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFV-IDYTNFWDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L+    L ++   VN+       D++     E I+ +Y K   +   +   DT+   ++ V + K    + +    +R       + ++G  K+ + H ++D +E+ ++++    K   +  +  S  +S ILIRPL    +  +E++ R KN   +  +     +   R  ++ M  EW+K+
  S:    39 RIMVCLSGGKDSFTMLDILMSLQKSA-PVNFELIAVNLDQKQPGFPEHILPEYLKSVGVPFHILERDTYSIVQETVPEGKTTCGICS---RLRRSTIYAFADQIGANKVALGHHRDDIIETLFLNMFYGGKLKAMPPKLLSDSKSNILIRPLAYCRESDIEEFARLKNYPIIPCNLCGSQENLQRQNIKAMCREWEKQ 232
>gi|91210638|ref|YP_540624.1| C32 tRNA thiolase [Escherichia coli UTI89] >gi|91072212|gb|ABE07093.1| hypothetical protein YdaO [Escherichia coli UTI89] (311 aa)
Score = 110, Expect = 1.6e-03, Identities = 44/186 (23%), Positives = 87/186 (46%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEAVCHVNYH------DREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWY--REIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF----------WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS  +L   R+L ++   +N+       D++     E ++ +Y +   ++  + + +   + K K      T      +R     + + ELG  KI + H ++D L++ ++++    K   +  +  S     I+IRPL          YCR K+I+   D   F               R V+  M+ +WDK+
  S:    41 RIMVCLSGGKDSYTMLEILRNLQQSA-PINFSLVAVNLDQKQPGFPEHVLPEYLETLGVEYKIVEENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDGKHIVIRPL---------AYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKR 234
>gi|91788722|ref|YP_549674.1| tRNA(Ile)-lysidine synthetase-like [Polaromonas sp. JS666] >gi|91697947|gb|ABE44776.1| tRNA(Ile)-lysidine synthetase-like [Polaromonas sp. JS666] (326 aa)
Score = 110, Expect = 1.6e-03, Identities = 49/190 (25%), Positives = 94/190 (49%)
  Q:     5 YLIAVSGGPDSMALL----NKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQE----LGIKKILIAHQKNDFLESAYMSLNKNKKNLFLG-IRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKF 194
           + +A+SGG DS ALL     K    V AV H+++  +  +D+ E+  +  C + N+ L V    K   +++    + +   R+ RY  F  +++E      IK I IA   +D +E+  ++L++      L  +  + +   ++  RPLL      +  +   + + +V D TN  +R++RN +R  +       F +F
  S:    23 FAVALSGGADSTALLVGCAEKWPGQVRAV-HIHHGLQAAADDFERHCQALCAQLNVPLAV----KRVQARHAPGESPEDAARKARYAAFGAVAREEWAQHAIKDIAIAQHADDQVETMLLALSRGAGLPGLAAMPARWERDGIVYHRPLLAVPGALVRAWLVERGLPWVEDPTNTDERFTRNRIRARLLPALADAFPQF 216
>gi|81299947|ref|YP_400155.1| hypothetical protein Synpcc7942_1138 [Synechococcus elongatus PCC 7942] >gi|81168828|gb|ABB57168.1| conserved hypothetical protein YCF62 [Synechococcus elongatus PCC 7942] (336 aa)
Score = 110, Expect = 1.6e-03, Identities = 46/179 (25%), Positives = 82/179 (45%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKR------HLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRR--KSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + L+AVSGG DS+AL+   R      H   A+ H ++  R DS  + + +R    ++ L  +   + +   S+       +TW    RY   E I+ ++    ++  H  +D  E+   +L +      L   R  +S    L L+RP L  T+    +  +   +    D TN   R++RN +R
  S:    37 RSRLLLAVSGGQDSLALVQLLRGLQPHWHWSLAIAHCDHGWRSDSTANAEHLRQLADQWQLPFYCQRSPEPPRSEAA----ARTW----RYQVLEAIAADIDAALLVTGHTASDRAETLLYNLTRGSHLQGLASLRWQRSLSDRLTLVRPFLGFTRAETSKMVQQFQLPVWEDSTNRDRRFARNRLR 215
>gi|61217183|sp|Q5N517|TILS_SYNP6 tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) (325 aa)
Score = 110, Expect = 1.6e-03, Identities = 46/179 (25%), Positives = 82/179 (45%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKR------HLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRR--KSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           + + L+AVSGG DS+AL+   R      H   A+ H ++  R DS  + + +R    ++ L  +   + +   S+       +TW    RY   E I+ ++    ++  H  +D  E+   +L +      L   R  +S    L L+RP L  T+    +  +   +    D TN   R++RN +R
  S:    26 RSRLLLAVSGGQDSLALVQLLRGLQPHWHWSLAIAHCDHGWRSDSTANAEHLRQLADQWQLPFYCQRSPEPPRSEAA----ARTW----RYQVLEAIAADIDAALLVTGHTASDRAETLLYNLTRGSHLQGLASLRWQRSLSDRLTLVRPFLGFTRAETSKMVQQFQLPVWEDSTNRDRRFARNRLR 204
>gi|145641388|ref|ZP_01796967.1| DNA topoisomerase I [Haemophilus influenzae R3021] >gi|145273931|gb|EDK13798.1| DNA topoisomerase I [Haemophilus influenzae 22.4-21] (313 aa)
Score = 110, Expect = 1.6e-03, Identities = 57/212 (26%), Positives = 104/212 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCK--KYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           K ++ +SGG DS  LL+   +L ++      +  VN  D++     E ++ +Y +  + + K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K  EF I   N         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:    44 KVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIRVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLTYCKEKDIEKYAIAK--EFPIIPCNLCGSQPNLQRQVVKEMLNNWDRQYPGRLETMFSAMQNITLSHMSDPKLFDFK 266
>gi|90416674|ref|ZP_01224604.1| putative ATPase [marine gamma proteobacterium HTCC2207] >gi|90331427|gb|EAS46663.1| putative ATPase [marine gamma proteobacterium HTCC2207] (278 aa)
Score = 110, Expect = 1.7e-03, Identities = 45/186 (24%), Positives = 92/186 (49%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVF--DTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLILIRPLLNKTKKSLEQYCRSKNI-------EFVIDYTNF---WDRYSRNVVRKMMAEWDKK 189
           + ++ +SGG DS A+L+    L  +      +  VN  D++     E ++ +Y  K +++  +   DT+    SK  +     +    +R       ++++G  K+ + H ++D +E+ ++++    K   +  +  S  +  I+IRPL          YCR  ++       EF I   N     D   RNVV+ M+ +W+++
  S:    36 RIMVCLSGGKDSYAMLDILMGLQSSAPIKFELVAVNL-DQKQPGFPEHVLPEYLDKLDIEYHILEKDTYSIVTSKVPEGKTYCSLCSRLRRGTLYGFAEQIGCTKVALGHHRDDIVETLFLNMFYQSKLKAMPPKLLSDDKKNIVIRPL---------AYCRESDLVALAELKEFPIIPCNLCGSQDGLQRNVVKDMLVQWERQ 229
>gi|163854237|ref|YP_001642280.1| tRNA(Ile)-lysidine synthetase [Methylobacterium extorquens PA1] >gi|163665842|gb|ABY33209.1| tRNA(Ile)-lysidine synthetase [Methylobacterium extorquens PA1] (342 aa)
Score = 110, Expect = 1.7e-03, Identities = 46/164 (28%), Positives = 74/164 (45%)
  Q:     6 LIAVSGGPDSMALLNKK----RHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRS--LILIRPLLNKTKKSLEQYCRSKNIEFVIDYTN 169
           L+AVSGGPDS AL++      R L   V  V++  R  S ++ + V     +  L   +  +D  +         + +Q   R  RY      +  +G   IL AH  +D  E+  M L        L   R+ +  +  + L+RP L+ +K  L  YC    + F+ D +N
  S:    28 LLAVSGGPDSTALMHAAARAGRDLFR-VATVDHALRPGSADEARAVGRLATELGLIHTILTWDAPRHG-------SRIQASARGARYRLLTDHAARIGAGLILTAHTLDDQAETVLMRLIAGSGPSGLAGMREERVLAPGIRLVRPFLSLSKADLVAYCEMHRLPFLRDPSN 191
>gi|194540438|ref|YP_002075477.1| PP-loop family [Vibrio sp. Ex25] >gi|151938993|gb|EDN57825.1| PP-loop family [Vibrio sp. Ex25] (449 aa)
Score = 110, Expect = 1.7e-03, Identities = 56/177 (31%), Positives = 85/177 (48%)
  Q:     4 KYLIAVSGGPDSMALLN-----KKRHLVEAVCHVNY-HDREDSDNDEKIVRDYCKKYNLKLFV---FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKS-KFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           K ++A SGG DS  LL      ++ H +E  CH  Y H    S+ D+    D C  +  ++ +    +    D+S  + I  L    RE RY    K  QE  I  +L     +D LE+  ++L +      L    +S  F S  L+RPLL   +K++E       +E+V D +N   RY RN +R
  S:    34 KVVLAFSGGVDSRLLLELLSRYQQAHSIE--CHAVYVHHGLSSNADD--WADKCLLWAKQVGISCSIELVSLDISNGESIELLA---REARYQALTKYIQEGDI--LLTGQHADDQLETFLLALKRGSGPKGLSSMAESMPFSSGSLVRPLLTIKRKTIEDAATKLGLEWVEDESNQDTRYDRNFLR 211
>gi|126439105|ref|YP_001059568.1| tRNA(Ile)-lysidine synthetase [Burkholderia pseudomallei 668] >gi|126218598|gb|ABN82104.1| tRNA(Ile)-lysidine synthetase [Burkholderia pseudomallei 668] (489 aa)
Score = 110, Expect = 1.8e-03, Identities = 41/174 (23%), Positives = 75/174 (43%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFV-FDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGI---RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           IA SGG DS  LL+    +  A   +  H       +      +C +    L   FD  + DV +      ++   R+ RY   E +    G + + +A   +D  E+  + L +      L     + +     ++ +RPLL+  +  LE+Y +   + ++ D +N   RY+RN +R
  S:    32 IAYSGGLDSTVLLHAAARIAGAGRCIALHVHHGLSANADAWLAHCAETAQALGARFDAARVDVPRASG-QGIEASARDARYRALETMCARYGARTLWLAQHADDQAETVLLQLLRGAGIAGLAAMAPQYRPALADVVRMRPLLHLLRAQLERYAQQHALRWIDDESNTNTRYARNALR 208
>gi|119477118|ref|ZP_01617354.1| tRNA(Ile)-lysidine synthase [marine gamma proteobacterium HTCC2143] >gi|119449481|gb|EAW30719.1| tRNA(Ile)-lysidine synthase [marine gamma proteobacterium HTCC2143] (446 aa)
Score = 110, Expect = 1.8e-03, Identities = 45/177 (25%), Positives = 77/177 (43%)
  Q:     4 KYLIAVSGGPDSMALLN----KKRHLVEAVCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSK-FRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           ++L+A SGG DS  LL+       H      H+N+  +  S+   K         N+ +   D   D  S      +L+   R  RYD FE I +   +  +   H  +D +E+  + L +   +        S+   S  L RPLL+  + ++E Y     +E++ D +N    + RN +R
  S:    26 RWLVAYSGGVDSCVLLDCLIGVADHPPIVAVHINHQLQAASEQWRKHCEKRAAALNIAIICIDVDVDLHSG----RSLEDAARVARYDAFETIVRHDDV--LFFGHHLDDQVETMLLRLLRGSGSRGAAAMPSSRALGSGQLARPLLDIPRSAIETYATINQLEWIDDSSNQSLDFDRNFLR 201
>gi|172061025|ref|YP_001808677.1| tRNA(Ile)-lysidine synthetase [Burkholderia ambifaria MC40-6] >gi|171993542|gb|ACB64461.1| tRNA(Ile)-lysidine synthetase [Burkholderia ambifaria MC40-6] (468 aa)
Score = 110, Expect = 1.9e-03, Identities = 41/174 (23%), Positives = 78/174 (44%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA--VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGI---RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           IA SGG DS  LL+    +  A     ++ H    ++ D  +         L +  F++ + DV +   +  ++   RE RY   + + +  G+  + +A   +D  E+  + L +      L     R +    S+  +RP L   +  LE+Y   + + ++ D +N   RY+RN +R
  S:    32 IAYSGGLDSTVLLDAAVRVAGASRCVALHVHHGLSANADAWVAHAQATAERLGV-TFESERVDVPRDSGLG-IEASARERRYAALDAMCERHGVAALWVAQHADDQAETVLLQLLRGAGIAGLAAMAPRYRPDGASVERVRPFLRLLRAQLERYAAQRELAWIDDESNADTRYARNALR 208
>gi|115352161|ref|YP_774000.1| tRNA(Ile)-lysidine synthetase [Burkholderia ambifaria AMMD] >gi|115282149|gb|ABI87666.1| tRNA(Ile)-lysidine synthetase [Burkholderia ambifaria AMMD] (473 aa)
Score = 110, Expect = 1.9e-03, Identities = 41/174 (23%), Positives = 78/174 (44%)
  Q:     7 IAVSGGPDSMALLNKKRHLVEA--VCHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGI---RRKSKFRSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVR 180
           IA SGG DS  LL+    +  A     ++ H    ++ D  +         L +  F++ + DV +   +  ++   RE RY   + + +  G+  + +A   +D  E+  + L +      L     R +    S+  +RP L   +  LE+Y   + + ++ D +N   RY+RN +R
  S:    32 IAYSGGLDSTVLLDAAVRVAGASRCVALHVHHGLSANADAWVAHAQATAERLGV-TFESERVDVPRDSGLG-IEASARERRYAALDAMCERHGVAALWVAQHADDQAETVLLQLLRGAGIAGLAAMAPRYRPDGASVERVRPFLRLLRAQLERYAAQRELAWIDDESNADTRYARNALR 208
>gi|46133442|ref|ZP_00157209.2| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Haemophilus influenzae R2866] >gi|145639032|ref|ZP_01794640.1| hypothetical protein CGSHiII_02560 [Haemophilus influenzae PittII] >gi|145272004|gb|EDK11913.1| hypothetical protein CGSHiII_02560 [Haemophilus influenzae PittII] (313 aa)
Score = 110, Expect = 1.9e-03, Identities = 57/212 (26%), Positives = 103/212 (48%)
  Q:     4 KYLIAVSGGPDSMALLNKKRHLVEA------VCHVNYHDREDSDNDEKIVRDYCKKYNL--KLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKFRSLI-------LIRPLLNKTKKSLEQYCRSKNIEFVIDYTNF---WDRYSRNVVRKMMAEWDKK---TFQKFYLKVKWFNLKNMFFIKLLDSK 215
           K ++ +SGG DS  LL+   +L ++      +  VN  D++     E ++ +Y +   +  K+   +T+     K  +     +    +R     + + ELG  KI + H ++D L + ++       N+F G + KS    LI       +IRPL    +K +E+Y  +K  EF I   N         R VV++M+  WD++     +  +  ++   L +M   KL D K
  S:    44 KVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNL-DQKQPGFPEHVLPEYLESIGVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTATELGATKIALGHHRDDMLATLFL-------NMFYGGKMKSMPPKLISDDGKQIVIRPLAYCKEKDIEKYAIAK--EFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMCDPKLFDFK 266
>gi|32034944|ref|ZP_00135035.1| COG0037: Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209005|ref|YP_001054230.1| tRNA(Ile)-lysidine synthase [Actinobacillus pleuropneumoniae L20] >gi|126097797|gb|ABN74625.1| tRNA(Ile)-lysidine synthase [Actinobacillus pleuropneumoniae L20] (419 aa)
Score = 110, Expect = 1.9e-03, Identities = 60/272 (22%), Positives = 124/272 (45%)
  Q:     2 KHKYLIAVSGGPDSMALLNKKRHLVEAV--CHVNYHDREDSDNDEKIVRDYCKKYNLKLFVFDTHKDDVSKYKDINNLQTWYREIRYDFFEKISQELGIKKILIAHQKNDFLESAYMSLNKNKKNLFLGIRRKSKF-RSLILIRPLLNKTKKSLEQYCRSKNIEFVIDYTNFWDRYSRNVVRKMMAEWDKKTFQKFYLKVKWF-------NLKNMFFIKLLDSKFNNWIKQDFDINYFLKIKNNYKESLIYLFLNHIGIK-PNENKIEQIIE---FINKNKNGSVK 273
           +  +++ +SGG DS+ LL+    L   +   H+++    ++DN        CK+  +  F+      D S+      ++   R  RY    +I Q   +  ++ AH  +D  E+  ++L +      L   +   F ++  + RPLLN +K  +EQY   +   ++ D +N    Y RN +R  +     + +Q F   V           +     +     ++ ++ ++  +I  F +     ++ LI L+L   G + P+  ++ QII+   + + +KN  +K
  S:    17 QRNFVLGLSGGIDSIVLLHLLAELQLNLRAVHIHHGLSPNADNWAAFCEQVCKRLKIP-FILQKVTVDRSE-----GIEAGARAARYQAIGEIIQPNEV--LVTAHHLDDQTETFLLALKRGSGIKGLSAMQAVGFWQNFTIFRPLLNVSKAQIEQYALQQQFTWIEDESNHDSHYDRNFLRNEVLPIVNQRWQHFSQMVARSAQHCAEQQMLLEELLAQELQRYADFSEKRLNIEAFPQFSLAKQQQLIRLWLEKCGAQMPSTAQLMQIIQQTIYADVDKNPQLK 294