>gi|26553600|ref|NP_757534.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycoplasma penetrans HF-2] >gi|81170452|sp|Q8EWQ6|DXR_MYCPE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|26453606|dbj|BAC43938.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycoplasma penetrans HF-2] (377 aa)
Score = 1724, Expect = 0.0e+00, Identities = 376/377 (99%), Positives = 377/377 (100%)
  Q:     1 LLEGEKMENKKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFRY 377
           +LEGEKMENKKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFRY
  S:     1 MLEGEKMENKKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFRY 377
>gi|161723185|ref|NP_243287.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus halodurans C-125] >gi|13124135|sp|Q9KA69|DXR_BACHD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (382 aa)
Score = 621, Expect = 1.3e-62, Identities = 145/361 (40%), Positives = 224/361 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS--------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           K + V GATG+IG  +L+++   ++ + LV  S   N   A E I++F   LV   + + + T+ S                E+      +I++NA++G  GL  TL A++    +ALANKE+LV AG L+ +  R    ++ PVDSEHS+++ +L+    + +  +IIT SGG F  K  +EL  +   DA+KHPNW+MG KI+IDSATMMNK  E+IEA++LFN   +KI V  H +SIIHSM++F D S IA +  PDM++ IQ  LS Y  +         N      L F+ +D+++++ + +AY+    Q   +P ++NAANEEA+ LF  N++ FL I ++IEKA+   E  +   L DIL++++ TR +V+   K
  S:     2 KGISVLGATGSIGTQTLDVLANHRDKFRLVAMSVGKNLTLAEEQIHQFKPPLVSVMTDEDRKTLASKVPEGTRVVCGEEGLIEVATAEKAEILVNAVIGSVGLAPTLAAIEAKKTIALANKETLVTAGHLVTEKAREHGVKLLPVDSEHSAIFQALQGERMDRLHRIIITASGGSFRDKSRDELNGVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFNLPYEKIDVLLHKESIIHSMVEFVDRSVIAQLGTPDMRVPIQYALS-YPDRLEFHEGQQLNLWEVGKLHFAPLDMERFRCMAFAYES-GKQGGTMPTVLNAANEEAVELFLNNQLSFLGIEDVIEKALERHERIDSPSLADILHVDQETRAFVHSLIK 382
>gi|118498054|ref|YP_899104.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. novicida U112] >gi|194323279|ref|ZP_03057063.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. novicida FTE] >gi|166218262|sp|A0Q7Y5|DXR_FRATN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|118423960|gb|ABK90350.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. novicida U112] >gi|151572591|gb|EDN38245.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. novicida GA99-3548] >gi|194322643|gb|EDX20123.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. novicida FTE] (385 aa)
Score = 617, Expect = 4.4e-62, Identities = 142/358 (39%), Positives = 221/358 (61%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKEN-YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSF---------EELLEKTNP----DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK----EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK K+ + GATG+IG S+L +I + N +E+   +  +N EK  E+   F       P +  K  + S          E  LEK +     DI+++A+VG +GL  T  A K    + LANKESLV AG L+ D    +++++ PVDSEH++++  + N++K    EI ++I+T SGGPF  K+ +EL ++    A  HPNW MG+KIS+DS+TM+NK  E+IEAY+LF+    KI V  H QS+IHSM+++ D SYIA + VPDMK  I   +   +  +  +  L F    LTF E   +++  +   ++ L+N+N A  I+ NAANEE +  F   KIK+L+I E+ +K    L      +++++  +++ TR+YV
  S:     3 KKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVTDVEVLVGESGLEKVSSLAEVDIVMSAIVGIAGLKPTFAAAKAGKKILLANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVLIHPQSVIHSMVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREACFERFGALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNFENPKNIEEVFEIDRKTREYV 380
>gi|110799236|ref|YP_696381.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens ATCC 13124] >gi|168211418|ref|ZP_02637043.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens B str. ATCC 3626] >gi|122958817|sp|Q0TPQ9|DXR_CLOP1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|110673883|gb|ABG82870.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens ATCC 13124] >gi|170710550|gb|EDT22732.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens B str. ATCC 3626] (384 aa)
Score = 616, Expect = 5.3e-62, Identities = 148/358 (41%), Positives = 230/358 (64%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP-----------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K++ + G TG+IG  +L+++   KE++ELVG + N N E  ++II  F      SP     N   S+++L++                           DI++ ++VG  GL  T+ A++   D+ALANKE+LVVAG L+    + +  +I PVDSEHS+++ SL+ N + +I ++++T SGGPF      +L ++    A+KHP WNMG+KISIDS+T+MNK  E+IEA++LF+   K I+V  H QSIIHSM+++TD + IA + VPDMKL IQ  L+    + N+   L  F    LTF + DLD +K +  AY+  E + + +P I+N ANE  + LF   KI +L I EIIE+ +   +  +   L +++NL+K  R+Y+Y+
  S:     2 KRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTMDIIKEF------SPKYVAINHEESYKKLVDLVKSQGLKCEVIYGMEGLVKVATLDEIDIVVTSVVGMIGLKPTVEAIRKGKDIALANKETLVVAGELVMREAKENGVKILPVDSEHSAIFQSLQGNAHNKIDKILLTASGGPFRGFTIEDLKSVTPERALKHPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCPYKDIEVVVHPQSIIHSMVQYTDGAVIAQLGVPDMKLPIQYALNYPNRQGNISEKLDLFKIRELTFEKPDLDTFKCLKLAYEAGE-KGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYNKEVTLHNVINLDKEVRQYIYE 381
>gi|18310676|ref|NP_562610.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens str. 13] >gi|21263511|sp|Q8XJR1|DXR_CLOPE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|18145357|dbj|BAB81400.1| 1-deoxy-d-xylulose-5-phosphate reductoisomerase [Clostridium perfringens str. 13] (384 aa)
Score = 613, Expect = 1.1e-61, Identities = 149/358 (41%), Positives = 230/358 (64%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP-----------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K++ + G TG+IG  +L+++   KE++ELVG + N N E  L+II  F      SP     N   S+++L++                           DI++ ++VG  GL  T+ A++   D+ALANKE+LVVAG L+    + +  +I PVDSEHS+++ SL+ N + +I ++++T SGGPF      +L ++    A+KHP WNMG+KISIDS+T+MNK  E+IEA++LF+   K I+V  H QSIIHSM+++TD + IA + VPDMKL IQ  L+    + N+   L  F    LTF + DLD +K +  AY+  E + + +P I+N ANE  + LF   KI +L I EIIE+ +   +  +   L +++NL+K  R+Y+Y+
  S:     2 KRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTLDIIKEF------SPKYVAINHEESYKKLVDLVKSEGLKCEVIYGMEGLVKVATLDEIDIVVTSVVGMIGLKPTVEAIRKGKDIALANKETLVVAGELVMREAKENGVKILPVDSEHSAIFQSLQGNAHNKIDKILLTASGGPFRGFTIEDLKSVTPERALKHPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCSYKDIEVVVHPQSIIHSMVQYTDGAVIAQLGVPDMKLPIQYALNYPNREGNISEKLDLFKIRELTFEKPDLDTFKCLKLAYEAGE-KGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYNKEVTLDNVINLDKEVRQYIYE 381
>gi|56708600|ref|YP_170496.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110671071|ref|YP_667628.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis FSC198] >gi|134301445|ref|YP_001121413.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931171|ref|YP_001891155.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. mediasiatica FSC147] >gi|123169258|sp|Q14G49|DXR_FRAT1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218263|sp|A4IWJ1|DXR_FRATW 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|81170445|sp|Q5NEP6|DXR_FRATT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|56605092|emb|CAG46207.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321404|emb|CAL09590.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis FSC 198] >gi|134049222|gb|ABO46293.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis WY96-3418] >gi|151569472|gb|EDN35126.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Francisella tularensis subsp. tularensis FSC033] >gi|157121693|gb|EDO65863.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica FSC022] >gi|187712080|gb|ACD30377.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. mediasiatica FSC147] (385 aa)
Score = 613, Expect = 1.3e-61, Identities = 141/358 (39%), Positives = 221/358 (61%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKEN-YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSF---------EELLEKTNP----DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK----EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK K+ + GATG+IG S+L +I + N +E+   +  +N EK  E+   F       P +  K  + S          E  LEK +     DI+++A+VG +GL  T  A K    + LANKESLV AG L+ D    +++++ PVDSEH++++  + N++K    EI ++I+T SGGPF  K+ +EL ++    A  HPNW MG+KIS+DS+TM+NK  E+IEAY+LF+    KI V  H QS+ HSM+++ D SYIA + VPDMK  I   +   +  +  +  L F    LTF E   ++++ +   ++ L+N+N A  I+ NAANEE +  F   KIK+L+I E+ +K    L      +++++  +++ TR+YV
  S:     3 KKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILLANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVLIHPQSVTHSMVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREACFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNFENPKNIEEVFEIDRKTREYV 380
>gi|89255941|ref|YP_513303.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica] >gi|156501934|ref|YP_001427999.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009154|ref|ZP_02274085.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica FSC200] >gi|122501069|sp|Q2A4P9|DXR_FRATH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218261|sp|A7NAP0|DXR_FRATF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|89143772|emb|CAJ78974.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica LVS] >gi|134253113|gb|EBA52207.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica 257] >gi|156252537|gb|ABU61043.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica FTNF002-00] (385 aa)
Score = 608, Expect = 4.1e-61, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKEN-YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSF---------EELLEKTNP----DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK----EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK K+ + GATG+IG S+L +I + N +E+   +  +N EK  E+   F       P +  K  + S          E  LEK +     DI+++A+VG +GL  T  A K    + LANKESLV AG L+ D    +++++ PVDSEH++++  + N++K    EI ++I+T SGGPF  K+ +EL ++    A  HPNW MG+KIS+DS+TM+NK  E+IEAY+LF+    KI V  H QS+ HS++++ D SYIA + VPDMK  I   +   +  +  +  L F    LTF E   ++++ +   ++ L+N+N A  I+ NAANEE +  F   KIK+L+I E+ +K    L      +++++  +++ TR+YV
  S:     3 KKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILLANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGPFRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVLIHPQSVTHSIVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREACFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNFENPKNIEEVFEIDRKTREYV 380
>gi|194332968|ref|YP_002014828.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prosthecochloris aestuarii DSM 271] >gi|194310786|gb|ACF45181.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prosthecochloris aestuarii DSM 271] (382 aa)
Score = 607, Expect = 5.5e-61, Identities = 140/354 (39%), Positives = 218/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG S+L+++ +  + + + G +  ++     E I  F  ++V   SV+ + + N   EL+ ++ P                  D++++A+VG +GL  T+ A+K   D+ALANKE+LVVAG L+ +L R    ++ PVDSEHS+++ SL  +  E I+ +I+T SGGPF K    EL  +    A+KHP W+MG KI+IDSAT+MNK  E+IEA++LFN   +KI V  H QSIIHSM+++ D   +A +  PDM+  I   LS  E   + I  L    +  LTF E D+ ++  +  A+D L  + R  P ++NAANE A+  F  N I F DI  I++K + A E     DL + L +++  R+
  S:     2 KSLSILGSTGSIGLSTLDVVRQHPDRFTITGLAEGHDVTLLAEQIREFKPSIV---SVRDEASANQLRELIGESGPEIRWGIEGAAVVGEADGSDMVVSAIVGAAGLVPTVRAIKAGKDIALANKETLVVAGQLVSELVREHKVQLLPVDSEHSAIFQSLSGHRTEDIERIILTASGGPFRKTPAEELKLVKPEQALKHPQWSMGAKITIDSATLMNKGLEVIEAHWLFNMPAEKIGVVVHPQSIIHSMVEYIDGCVMAQLGAPDMRAPIAYALSWPERCESGIKKLDLTQIGTLTFEEPDMKRFPALRLAFDALR-EGRTYPAVLNAANEIAVAAFLNNNIGFTDIPAIVDKTMQAHEALTPVDLDEYLAVDRWARE 375
>gi|20807849|ref|NP_623020.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermoanaerobacter tengcongensis MB4] >gi|22095583|sp|Q8RA28|DXR_THETN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|20516412|gb|AAM24624.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermoanaerobacter tengcongensis MB4] (382 aa)
Score = 604, Expect = 1.3e-60, Identities = 152/356 (42%), Positives = 227/356 (63%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLE------------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK+++ G+TG+IG  +L+++   KE +E+VG +  NN     + I  F P  +      K +    + +E +E            K   D+++ A+ G +GL  T+ A+K   ++ALANKE LV AG ++  L +       PVDSEHS++   LK NNK E+  LI+T SGGPF  K+  +L+N+   +A+KHPNW MGKKI+IDSAT+MNK FE+IEA +LF+    KIKV  H QSIIHSM+++ D S IA +SVPDM+++IQ  L+  + K    +  L F  L  LTF E D + +K +  AY   E     +  ++NAA+E A+ LF +NKI FL+I EIIE+A+   +N +   L DI++++  TR+ +
  S:     2 KKLIILGSTGSIGRQTLDVVRSLKEEFEIVGLTGYNNVSLLSKQIKEFRPKVVAVKDEEKARKLRENLDEPIEVLTGKEGLKEIVKYEADMVVVAVEGIAGLIPTVEAIKLGKNIALANKEVLVTAGEIVMGLVKEKKIEFLPVDSEHSAILQCLKGNNKREVSNLILTASGGPFRGKKKKDLVNVTVEEALKHPNWKMGKKITIDSATLMNKGFEVIEARWLFDMPLDKIKVVIHPQSIIHSMVEYVDGSVIAQLSVPDMRIAIQYALNYPDRKYVEGVKFLDFYALGQLTFEEPDFETFKCLSLAYHAAECGG-TMTAVLNAADEVAVSLFLQNKINFLEIAEIIEEALENHKNIQNPTLDDIISVDLETRERI 376
>gi|115314423|ref|YP_763146.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica OSU18] >gi|122325550|sp|Q0BN25|DXR_FRATO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115129322|gb|ABI82509.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Francisella tularensis subsp. holarctica OSU18] (386 aa)
Score = 598, Expect = 5.9e-60, Identities = 140/358 (39%), Positives = 222/358 (62%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKEN-YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSF---------EELLEKTNP----DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK----EIKELIITCSGGPFY-KKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK K+ + GATG+IG S+L +I + N +E+   +  +N EK  E+   F       P +  K  + S          E  LEK +     DI+++A+VG +GL  T  A K    + LANKESLV AG L+ D    +++++ PVDSEH++++  + N++K    EI ++I+T SGGPF  K++ +EL ++    A  HPNW MG+KIS+DS+TM+NK  E+IEAY+LF+    KI V  H QS+ HS++++ D SYIA + VPDMK  I   +   +  +  +  L F    LTF E   ++++ +   ++ L+N+N A  I+ NAANEE +  F   KIK+L+I E+ +K    L      +++++  +++ TR+YV
  S:     3 KKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAELCQEFKPKFAVVPDLSKKQKLQSLVTDVEVLVGESGLEKVSSLAEIDIVMSAIVGIAGLKPTFAAAKAGKKILLANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKCLPEIDKIILTASGGPFRDKQQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVLIHPQSVTHSIVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREACFERFEALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNFENPKNIEEVFEIDRKTREYV 381
>gi|110802247|ref|YP_698981.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens SM101] >gi|123341714|sp|Q0SSC6|DXR_CLOPS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|110682748|gb|ABG86118.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium perfringens SM101] (384 aa)
Score = 598, Expect = 6.9e-60, Identities = 146/358 (40%), Positives = 229/358 (63%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP-----------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K++ + G TG+IG  +L+++   KE++ELVG + N N E  ++II  F      SP     N   S+++L++                           DI++ ++VG  GL  T+ A++   ++ALANKE+LVVAG L+    + +  +I  VDSEHS+++ SL+ N + +I ++++T SGGPF      +L ++    A+KHP WNMG+KISIDS+T+MNK  E+IEA++LF+   K I+V  H QSIIHSM+++TD + IA + VPDMKL IQ  L+    + N+   L  F    LTF + DLD +K +  AY+  E + + +P I+N ANE  + LF   KI +L I EIIE+ +   +  +   L +++NL+K  R+Y+Y+
  S:     2 KRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTMDIIKEF------SPKYVAINHEESYKKLVDLVKSEGLKCEVIYGMEGLVKVATLDEIDIVVTSVVGMIGLKPTVEAIRKGKNIALANKETLVVAGELVMREAKENGVKILAVDSEHSAIFQSLQGNAHNKIDKILLTASGGPFRGFTIKDLKSVTPERALKHPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCPYKDIEVVVHPQSIIHSMVQYTDGAVIAQLGVPDMKLPIQYALNYPNREGNISEKLDLFKIRELTFEKPDLDTFKCLKLAYEAGE-KGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYNKEVTLDNVINLDKEVRQYIYE 381
>gi|118443580|ref|YP_878216.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium novyi NT] >gi|166218257|sp|A0Q0R4|DXR_CLONN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|118134036|gb|ABK61080.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium novyi NT] (385 aa)
Score = 597, Expect = 8.4e-60, Identities = 149/366 (40%), Positives = 232/366 (63%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFRY 377
           K + + GATG+IG  +L++IEKE+  ++LV FS N +YEK + II +F      +P     N   +F ++ +  N                        ++++ ++VG  GL  TL A+    D+ALANKE+LV  G L+    + ++ +I PVDSEH +++  L+ N+ K+I+ + +T SGGPF + +  EL+NI    A+KHP WNMGKKISIDS+TM+NK  E+IEA++LFN    KIKV  H QSI+HSM+++ D S IA ++  DM+L IQ  L+       ++  L   N+ NLTF + D +K++ +  AY+        +P I NA+NE A+ +F  N IK+L+I +I+E+ +   EN  + D++DILN     R ++    KNK+ +
  S:     2 KNICILGATGSIGTQTLDVIEKESNKFKLVAFSANKSYEKIITIIEKF------NPVYGAINDKETFLKVKDHCNINNIKINLLYGMDGLIKISTLEEVELVVTSIVGMIGLVPTLEAINAGKDIALANKETLVTGGELVMKAAKQNNVKILPVDSEHGAIFQCLQGNSYKDIETIYVTASGGPFRQSKLEELINITPEQALKHPKWNMGKKISIDSSTMINKGLEVIEAHWLFNVGYDKIKVLVHPQSIVHSMVEYIDGSIIAQLASTDMRLPIQYALNYPVRNKKVVEKLDVYNMGNLTFEKPDFEKFRGLKLAYE-AGKLGGIMPTIFNASNEVAVNMFLNNHIKYLEIVDIVEECMNKFENKSIKDVEDILNAEAKVRSFI----KNKYNF 385
>gi|15895071|ref|NP_348420.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium acetobutylicum ATCC 824] >gi|21263537|sp|Q97I58|DXR_CLOAB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|15024767|gb|AAK79760.1|AE007688_9 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium acetobutylicum ATCC 824] (385 aa)
Score = 595, Expect = 1.3e-59, Identities = 147/356 (41%), Positives = 226/356 (63%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALV-------------FSPSVKTKNTVN----SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSF-NNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K + + GATG+IG  +L++I  + E ++L+  S ++N++K +EII+ F   LV             +    K K +V     +F E+    + +I++ ++VG  GL  TL A+K   D+ALANKE+LVVAG L+    +     I PVDSEH +++  L+ N  K+I ++++T SGGPF  K F+EL N+   DA+ HP W MG+KI+IDSAT+MNK  E+IEA++LFN   +KI+V  H QSI+HSM+++ D S IA +   DM+L IQ  L+    K  ++  + F +  +L F + D+D ++ +  AYD        +P I+N+ANE A+ LF ++KIKF +I EIIE A+   EN        I+N +    KY+
  S:     2 KNISILGATGSIGTQTLDVIRNDSEAFKLLAVSAHSNFKKMIEIIDEFKPELVVMVDKLAYNKVLDYCCEKKLKTSVKVGYEAFNEVASYKDSNIVVTSIVGMIGLIPTLEAIKAGKDIALANKETLVVAGELVTKEAKKYGVNILPVDSEHGAIFQCLQGNKYKDINKILLTASGGPFRGKSFDELNNVTLNDALNHPKWTMGRKITIDSATLMNKGLEVIEAHWLFNVDYEKIQVLVHPQSIVHSMVQYKDGSVIAQLGPTDMRLPIQYALNYPVRKERIVEPVDFYSTPDLHFEKPDMDTFRCLRLAYD-AGMAGGIMPAILNSANEYAVDLFLKDKIKFTNIQEIIEDALNHFENVNNLTANTIINKSNEVTKYL 379
>gi|31544296|ref|NP_852874.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycoplasma gallisepticum R] >gi|81170451|sp|Q7NC17|DXR_MYCGA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|31541140|gb|AAP56442.1| Dxr [Mycoplasma gallisepticum R] (368 aa)
Score = 595, Expect = 1.6e-59, Identities = 133/347 (38%), Positives = 217/347 (62%)
  Q:    13 KVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRF-PN-ALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNL 359
           K+LV GATG+IG  ++++I +  Y+LVGFS+  N+ +A  I+ +  PN  L  S     KN  +   EL++K+ P +I+NA+ G+ G+  +L+AL    DL LANKESLV+AG  +E +++ + + IYP+DSEHS+LYD LK+  K +IK+L+IT SG  ++ K+ +EL  + + D + HPNW MG +ISI+SAT +NK +EI+EAY+LF  K I       S IH+ + + DNS   + +  DM+ +IQ  L+ ++++TN++  L      + F +ID +++     AYD L+N       ++   NE  + LF++ KI FL I E+I       ++ +++++  I +L
  S:     2 KILVLGATGSIGKQAIDVICQLKYQLVGFSYYQNHNEANNILKQLNPNYVLCHSDPKYNKNVKSDLIELIDKSKPKVIINAINGYHGIEASLIALSKKKDLLLANKESLVIAGSQLEAIRKDTKTTIYPIDSEHSALYDLLKDKKKNQIKQLMITASGAGYFNKDISELRKLTYNDLLNHPNWKMGAEISINSATFVNKVYEIVEAYHLFKIKDIIPVVERSSTIHAGVIYQDNSIHFHATTNDMRWAIQSALTKFDNRTNVVQSLDLYQKTIQFEKIDFEQYPIFKIAYDILKNPYTTRGAVLTCINEHVVKLFQKQKINFLQITELISNFYWNYQHKKIDNIWQINDL 351
>gi|150016079|ref|YP_001308333.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium beijerinckii NCIMB 8052] >gi|189027753|sp|A6LSP7|DXR_CLOB8 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|149902544|gb|ABR33377.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium beijerinckii NCIMB 8052] (387 aa)
Score = 593, Expect = 2.5e-59, Identities = 144/356 (40%), Positives = 231/356 (64%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYEL--VGFSFNNNYEKALEIINRFPNALV-----------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLIND-LSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND---LKDILNLNKNTRKYV 367
           K + + GATG+IG  +L++I K N EL  +G + N + +K +EII  F  + V                  +  +K    +   +++      D+++ ++VG  GL  T+ A++   D+ALANKE+LVVAG ++    + ++ +I+PVDSEHS+++  L+ N+   ++++I+T SGGPF  +    L +I   DA+KHP WNMG+KISIDSAT+MNK  E+IEA++LFN     I+V  H QSI+HSM+++ D S +A +   DM+L IQ  L  YE++   I D + F  ++ LTF + D+D +K ++ A+       R +P I+N ANE A+ LF + KIKFL I +IIE+ +   + T+ N    L++I+ L+K  ++YV
  S:     2 KNISILGATGSIGSQTLDVIRKSNGELKLIGVTANTSVKKVIEIIEEFKPSYVGMMDAVSTHEIKKYCEEHNKKIKVLEGIEGLDKIASLDEIDMVVTSVVGMIGLEPTMKAIEAKKDIALANKETLVVAGEIVMKAAKENNVKIFPVDSEHSAIFQCLRGNDINTLRKIILTASGGPFRGRTLESLEDIKVEDALKHPKWNMGRKISIDSATLMNKGLEVIEAHWLFNCDYDNIQVVVHPQSIVHSMVEYNDGSIVAQLGAQDMRLPIQYALL-YENREKRIADTIDFYEISQLTFEKPDIDTFKALNLAFK-AGKAGRLMPTILNGANEAAVELFLDRKIKFLQIADIIERCMEVFK-TQANKELTLENIIELDKEVKEYV 381
>gi|77919511|ref|YP_357326.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelobacter carbinolicus DSM 2380] >gi|77545594|gb|ABA89156.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelobacter carbinolicus DSM 2380] (394 aa)
Score = 592, Expect = 3.3e-59, Identities = 139/356 (39%), Positives = 222/356 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLN----KNTRKYV 367
           KK+ + G+TG+IG S+L+I+    E +E+V  +  NN  +  E I RF   +V   +V + +     +E L    P                  D++++A+VG +GL  T+ A++   D+ALANKE+LV AG L+ +       R++PVDSEHS+++ SL+ +   +++ LI+T SGGPF  +   ++ ++  ADA+ HPNW+MG+KISIDSATMMNK  E+IEA +LF+   ++I V+ H QSI+HS++++ D + IA + +PDMK  I   LS        +  L   ++ NLTF E DL+++  +  AY+ L     A P ++NAANE A+  F   +I FLDI  +I  A+  LE   +  +  +L  +    K  R+++
  S:     5 KKLGILGSTGSIGVSTLDIVAAFPEQFEVVTLTAGNNLARLEEQIRRFRPKMV---AVISADGAQQLKERLGADAPQILSGVEGLVACACHEDIDMVVSAIVGAAGLVPTMSAIETGKDIALANKETLVTAGSLVTEAVARHGVRLFPVDSEHSAIFQSLEGHRMDDVRRLILTASGGPFRNRMLADMASVTPADALAHPNWSMGRKISIDSATMMNKGLEVIEARWLFDVPAERIAVHIHPQSIVHSLVEYVDGAVIAQLGIPDMKTPIAYALSHPTRLPLDLPPLDLCSMRNLTFDEPDLERFPCLALAYEALAMGGTA-PAVLNAANEIAVDAFLNEEIAFLDIARVIRAALQGLEVKPLEHIDQVLRADLWGRKEARRFI 384
>gi|194335259|ref|YP_002017053.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelodictyon phaeoclathratiforme BU-1] >gi|194307736|gb|ACF42436.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelodictyon phaeoclathratiforme BU-1] (382 aa)
Score = 590, Expect = 5.0e-59, Identities = 138/359 (38%), Positives = 216/359 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + + + G+TG+IG S+L+++ +  E +++ G +  ++     E I  F  A V   SV+  ++V   + LL    P                  D++++A+VG +GL  T+ A+K    +ALANKE+LVVAG L+ DL +  +  + PVDSEHS+++ SL  +  E ++ +I+T SGGPF      EL N+    A+KHP W MG KI+IDSATMMNK  E+IEA++LF+   +KI V  H QSIIHSM+++ D   IA +  PDM+  I   LS  E   + I+ L    +  LTF E D++++  +  A++ L+      P ++NAANE A+  F + KI F DI   +EK + A E  +  +L + L  ++  R+    F
  S:     2 RSLAILGSTGSIGLSTLDVVRQHPEKFKIAGLAEGHDVALLAEQIKEFLPAAV---SVRDADSVKKLQTLLGSHKPEIFHGLEGAAAIASAEGVDMVVSAIVGAAGLLPTVSAIKAGKHIALANKETLVVAGKLVSDLVKKHNVHLLPVDSEHSAIFQSLAGHRAEDVERIILTASGGPFRNTSAEELKNVTLEQALKHPQWTMGAKITIDSATMMNKGLEVIEAHWLFSMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGSPDMRAPIAYALSWPERSESGIHKLDLPKIGTLTFEEPDMERFPALRLAFEALK-AGLTYPAVLNAANEIAVAAFLDRKIGFTDIAATVEKTMQAHEAYDPIELDEYLQADRWAREMAKKF 380
>gi|39997013|ref|NP_952964.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter sulfurreducens PCA] >gi|59797602|sp|Q74BW4|DXR_GEOSL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|39983901|gb|AAR35291.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter sulfurreducens PCA] (386 aa)
Score = 588, Expect = 9.0e-59, Identities = 139/354 (39%), Positives = 216/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG S+LE++    + + +V  +  NN E   + I  F   +V   SV ++      +  L    P+I                  ++ A+VG +GL  T  A++   D+ALANKE+LV AG LI DL R  + R+YPVDSEHS+++ S++  + K++  +I+T SGGPF     ++L  ++  DA+ HPNW+MG+KI+IDSATMMNK  E+IEA +LF+T  ++I V  H QSIIHSM+++ D S +A + VPDMK  I   L+  E     +N L    L+ LTF + D  ++  +  AYD L     ++P +MNAANE A+  F    I F+DI   I + + A E   ++ +++ L  ++  R+
  S:     2 KNITILGSTGSIGVSTLEVVSAHPDRFRVVALTAGNNLEMLRQQIETFRPQMV---SVLSEKLAVELDRSLPGYKPEIHYGVEGLIAAATAGDAHMVVAAIVGAAGLVPTAAAIRAGKDVALANKETLVTAGRLIMDLVRDKNVRLYPVDSEHSAVFQSMEGQSRKDVLRIILTASGGPFLNLPLDQLSRVSIDDALNHPNWSMGRKITIDSATMMNKGLEVIEARWLFDTPAERIDVNIHPQSIIHSMVEYVDGSVMAQLGVPDMKAPIAYALTYPERVPTGVNPLDLTALSGLTFFKPDYRRFPALKLAYDALA-AGESMPAVMNAANEVAVEAFLSGVIGFIDIAATIARIMDAHEAHTLSTIEEALITDRWARE 375
>gi|21672966|ref|NP_661031.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium tepidum TLS] >gi|32171392|sp|Q8KG43|DXR_CHLTE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21646025|gb|AAM71373.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium tepidum TLS] (382 aa)
Score = 587, Expect = 1.3e-58, Identities = 138/354 (38%), Positives = 218/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG S+L+++ +  E + +   +  ++ E  L+ I+ F  +LV   SV+ + +    + +L    P                  D++++A+VG +GL  T+ A++   D+ALANKE+LVVAG L+ DL +    ++ PVDSEHS+++ SL  +  E I+ +I+T SGGPF K    EL N+    A+KHP W+MG KI+IDSAT+MNK  E+IEA++LF+   +KI V  H QSIIHSM+++ D   IA + VPDM+  I   L+  E     I  L    +  LTF E D++++  +  A+D L+   +  P ++NAANE A+  F + KI F DI   ++K + A E      L++ L  +K  R+
  S:     2 KSLSILGSTGSIGLSTLDVVRRHPERFSIAALAEGHDVEMLLKQIDEFRPSLV---SVRDEASRERLKGMLGDHKPEILCGLEGAAEVAAVDGADMVVSAIVGAAGLVPTVRAIEAGKDIALANKETLVVAGQLVSDLVKKHDVKLLPVDSEHSAIFQSLVGHRTEDIERIILTASGGPFRKTPAEELKNVGPEQALKHPQWSMGAKITIDSATLMNKGLEVIEAHWLFDMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGVPDMRAPIAYALAWPERCETGIGKLDLTKVATLTFEEPDMERFPALRLAFDALK-AGQTYPAVLNAANEIAVAAFLDKKIGFTDIAGTVDKTMQAHEAWTPITLEEYLQADKWARE 375
>gi|110598267|ref|ZP_01386542.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Chlorobium ferrooxidans DSM 13031] >gi|110340075|gb|EAT58575.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Chlorobium ferrooxidans DSM 13031] (382 aa)
Score = 586, Expect = 1.6e-58, Identities = 138/359 (38%), Positives = 214/359 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELL------------------EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + + + G+TG+IG S+L+++ +  + + + G +   +     E I  F P A+    SV+ + ++     LL                      PD++++A+VG +GL  T+ A+K    +ALANKE+LVVAG L+ DL +    ++ PVDSEHS+++ SL+ +  E ++ +I+T SGGPF      EL N+    A+KHP W+MG KI+IDSATMMNK  E+IEA++LFN   +KI V  H QSIIHSM+++ D   IA +  PDM+  I   LS  E   + I  L    +  LTF E D+ ++  +  A+D L+   R  P ++NAANE A+  F + KI F+DI   +EK + A +     +L + L  ++  R     F
  S:     2 RSIAILGSTGSIGVSTLDVVRQHPDKFNVTGLAAGRDITLLAEQIREFRPEAV----SVRDEESIAKLHALLGEYKPAILSGSEGASAIASADGPDMVVSAIVGAAGLLPTVSAIKAGKHIALANKETLVVAGQLVSDLVKKHKVQLLPVDSEHSAIFQSLEGHRTEDVERIILTASGGPFRNTSAEELKNVGLEQALKHPQWSMGAKITIDSATMMNKGLEVIEAHWLFNMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGAPDMRAPIAYALSYPERCISGIQKLDLIKIGTLTFEEPDMVRFPALRLAFDALK-AGRTYPAVLNAANEIAVAAFLDKKIAFVDIAATVEKTMQAHDAFTPVELDEYLMADRWARDTATKF 380
>gi|78187992|ref|YP_378330.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium chlorochromatii CaD3] >gi|123580580|sp|Q3AUE4|DXR_CHLCH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|78170191|gb|ABB27287.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium chlorochromatii CaD3] (382 aa)
Score = 586, Expect = 1.7e-58, Identities = 138/355 (38%), Positives = 211/355 (59%)
  Q:    16 VFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + G+TG+IG S+L+++   ++ + +VG +  ++       I  F    V   SV+   +    +ELL    P                  D++++A+VG +GL  T+ A+K    +ALANKE+LVVAG L+  L       + PVDSEHS+++ SL  +  E ++ +I+T SGGPF K    EL  +    A+KHP W+MG KI+IDSAT+MNK  E+IEA++LFN   +KI V  H QSIIHSM+++ D   IA +  PDM+  I   LS  E   + I+ L    +  LTF E D++++  +  A+D L+      P ++NAANE A+  F E KI FLDI  ++EK + A E     +L++ L +++  R     F
  S:     6 ILGSTGSIGLSTLDVVRQHRDRFTIVGLAEGHDVAALAAQIEEFKPLAV---SVRDAESAKKLQELLGAHKPEVYYGLDGAATIAALDGVDMVVSAIVGAAGLRPTVAAIKAGKHIALANKETLVVAGELVSRLVAEHKVHLLPVDSEHSAIFQSLAGHRAEDVERIILTASGGPFRKTSAEELKQVTLEQALKHPQWSMGAKITIDSATLMNKGLEVIEAHWLFNMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGAPDMRAPIAYALSWPERCESGIHKLDLAKIATLTFEEPDMERFPALRLAFDALK-AGGTYPAVLNAANEIAVAAFLERKIGFLDIAAMVEKTMQAHEAFTPVELEEYLQVDRWARDTAKTF 380
>gi|146297351|ref|YP_001181122.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410927|gb|ABP67931.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Caldicellulosiruptor saccharolyticus DSM 8903] (388 aa)
Score = 583, Expect = 3.8e-58, Identities = 140/353 (39%), Positives = 222/353 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNY-------------------EKALEIIN-RFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSR-----IYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG  ++++ ++   ++VG S   N                    E+   I+  +FPN +V +             EL    N D+I+NALVG SGL  T+ A+K    +ALANKE+LVV G +I+ + +  S+      + PVDSEHS+++  L   +K +++ +I+T SGGPF  K+ ++L N+   D + HP W MGKKI++DSAT++NK FE+IEA + F+  T +I V  H QSIIHSM++F D S  A +S PDM+LSI+  L+  +    LI  L F+ L  LTF E D + +  +  AYD  + +  + P+++NAA+EEA+ +F E KI F+D+   + K +      ++N ++DIL ++K  R
  S:     3 KRICILGSTGSIGCQAVDVAKRLGIKVVGLSAYQNIGMLISQAKDLNPEILCIGDERYYSILKEQFPNKIVVAGQ-------KGLIELATYENADLIVNALVGISGLVPTIEAIKAGKKVALANKETLVVGGKIIKQMIKDKSNENQDYILIPVDSEHSAIFQCLVGEDKRDVRRIILTASGGPFRGKKLDQLKNVKIEDVLSHPTWRMGKKITVDSATLINKGFEVIEAMFFFDKKTDEIDVVIHPQSIIHSMVEFVDGSIKAQISNPDMRLSIEYSLTYPKRSICLIEPLDFSKLKQLTFEEPDFETFFLLKLAYDCAQ-KGESYPVVLNAADEEAVKIFLEGKITFVDMMNYVAKVVENHRPQQINSIEDILEVDKIAR 376
>gi|10175041|dbj|BAB06140.1| 1-deoxy-d-xylulose-5-phosphate reductoisomerase [Bacillus halodurans C-125] (365 aa)
Score = 582, Expect = 4.6e-58, Identities = 136/340 (40%), Positives = 209/340 (61%)
  Q:    33 KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS--------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           ++ + LV  S   N   A E I++F   LV   + + + T+ S                E+      +I++NA++G  GL  TL A++    +ALANKE+LV AG L+ +  R    ++ PVDSEHS+++ +L+    + +  +IIT SGG F  K  +EL  +   DA+KHPNW+MG KI+IDSATMMNK  E+IEA++LFN   +KI V  H +SIIHSM++F D S IA +  PDM++ IQ  LS Y  +         N      L F+ +D+++++ + +AY+    Q   +P ++NAANEEA+ LF  N++ FL I ++IEKA+   E  +   L DIL++++ TR +V+   K
  S:     8 RDKFRLVAMSVGKNLTLAEEQIHQFKPPLVSVMTDEDRKTLASKVPEGTRVVCGEEGLIEVATAEKAEILVNAVIGSVGLAPTLAAIEAKKTIALANKETLVTAGHLVTEKAREHGVKLLPVDSEHSAIFQALQGERMDRLHRIIITASGGSFRDKSRDELNGVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFNLPYEKIDVLLHKESIIHSMVEFVDRSVIAQLGTPDMRVPIQYALS-YPDRLEFHEGQQLNLWEVGKLHFAPLDMERFRCMAFAYES-GKQGGTMPTVLNAANEEAVELFLNNQLSFLGIEDVIEKALERHERIDSPSLADILHVDQETRAFVHSLIK 365
>gi|30021449|ref|NP_833080.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus ATCC 14579] >gi|39931056|sp|Q81B49|DXR1_BACCR 1-deoxy-D-xylulose 5-phosphate reductoisomerase 1 (DXP reductoisomerase 1) (1-deoxyxylulose-5-phosphate reductoisomerase 1) (2-C-methyl-D-erythritol 4-phosphate synthase 1) >gi|29897003|gb|AAP10281.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus ATCC 14579] (385 aa)
Score = 582, Expect = 4.9e-58, Identities = 144/355 (40%), Positives = 223/355 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-------SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L+++    E++++VG + N N +   + I  F   +V               S + K  +  + F  +    + +++L+++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ +L + +  R+ PVDSEHS+++  LK  NNKEI++LI+T SGG F  K  +E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LF+   KKI V  H +SIIHS+++F D S +A +  PDM++ IQ          S YE K NL+   S     L F + DL+K+  + +AY+         P ++NAANE A  LF +N+I F DI + I K + A  N +   L  IL  ++  R+Y
  S:     3 KYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATKDLADKLRTRISANTKITHGTDGFIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLKGENNKEIEKLIVTASGGAFRDKTRDEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYKKINVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYE-KLNLLEIGS-----LHFEKPDLEKFPCLQYAYE-CGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQY 376
>gi|167037630|ref|YP_001665208.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856464|gb|ABY94872.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermoanaerobacter pseudethanolicus ATCC 33223] (382 aa)
Score = 580, Expect = 7.1e-58, Identities = 148/356 (41%), Positives = 233/356 (65%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN----LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KKV++ G+TG+IG  +L++I+  +EN+E+VG +  NN E   + I  F   +V   +VK ++  N   E L+K                 + D+++ A+ G +GL  T+ A++   D+ALANKE LV AG ++ DL +     + PVDSEHS++   L+ N+ KE+  LI+T SGGPF  K+  +L  +   +A+ HPNW MGKKI+IDSAT+MNK FE+IEA +LF+    KI V  H QSIIHSM+++ D S IA ++  DM++ IQ  L+ Y ++ N IN ++F + +    LTF + DL+ ++ +  AY+ L+     +  ++NAA+E A+ LF   KI+FL I EIIE+++    N +   L DI+N++K  ++ +
  S:     2 KKVIILGSTGSIGTQTLDVIKNFRENFEIVGLTAYNNVELLSKQIREFNPKVV---AVKDEDKANQLRENLKKNVEILTGSKGLQEIVKYDADLVVVAVEGIAGLIPTVTAIQRGKDIALANKEVLVTAGQIVMDLVKKKDITLLPVDSEHSAILQCLRGNDKKEVSRLILTASGGPFRGKKKEDLRKVTVNEALNHPNWKMGKKITIDSATLMNKGFEVIEAKWLFDISEDKIDVIVHPQSIIHSMVEYIDGSVIAQLAAADMRIPIQYALN-YPTR-NYINGINFLDFSLTTQLTFEKPDLETFRCLSLAYEALKIGG-TMTTVLNAADEIAVSLFLNKKIEFLQIAEIIEESMKEHNNIQNPTLDDIINVDKEVKEKI 376
>gi|145218955|ref|YP_001129664.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prosthecochloris vibrioformis DSM 265] >gi|189027759|sp|A4SCF3|DXR_PROVI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|145205119|gb|ABP36162.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prosthecochloris vibrioformis DSM 265] (384 aa)
Score = 579, Expect = 1.2e-57, Identities = 133/355 (37%), Positives = 213/355 (60%)
  Q:    16 VFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-------------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + G+TG+IG S+L+++   KE++ +VG +  ++     E I  F   +V   SV+ +N  +  + LL   +                    D++++A+VG +GL  T+ A+K   D+ALANKE+LVVAG L+ DL + +   + PVDSEHS+++ SL  +  E ++ +I+T SGGPF      E+       A+KHP W MG KI+IDSATMMNK  E+IEA++LFN    +I V  H QSI+HSM+++ D   IA +  PDM+  I   LS  E   + +  L+   +  LTF E D+ ++  +  A+D L+   +  P ++NAANE A+  F   +I F DI + ++K + A E     +L + ++ ++  R+    F
  S:     6 ILGSTGSIGLSTLDVVRRHKESFSVVGLAEGHDVHALAEQIKEFRPTIV---SVRDENAADELKTLLGPADRPEIVHGIEGAGTVAAAEGSDMVVSAIVGAAGLTPTIKAIKAGKDIALANKETLVVAGQLVSDLVKQNGVELLPVDSEHSAIFQSLLGHRAEDVERIILTASGGPFRNTPLEEMKKAGPEQALKHPQWTMGAKITIDSATMMNKGLEVIEAHWLFNMPADRIGVVVHPQSIVHSMVEYRDGCVIAQLGSPDMRAPIAYALSYPERSESGVKKLNLAEIGTLTFEEPDMVRFPALQLAFDALK-AGKTYPAVLNAANEIAVAAFLNKQIGFTDIADTVDKTMQAHEAYTPMELDEYIHADRWARQTASTF 381
>gi|189425770|ref|YP_001952947.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter lovleyi SZ] >gi|189422029|gb|ACD96427.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter lovleyi SZ] (390 aa)
Score = 577, Expect = 1.9e-57, Identities = 136/358 (37%), Positives = 219/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE----------------KTNPDI--ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K++ + G+TG+IG S+LEI+    + + ++  S   N +     I +F   L    +V     +   +ELL                  T P +  ++ A+VG +GL  T  A++  +D+ALANKE+LV AG L  +L      ++YPVDSEHS+++ S++ + +++I ++I+T SGGPF +    +L ++   DA+ HPNW+MG+KI+IDSATMMNK  E+IEA +LF+   +KI V  H QSIIHSM+++ D   IA +  PDMK  I   LS  E  +  +  L    L+ LTFS+ DL+++  +  AY  L  +  ++P +MNAANE A+  F + +I +L I  +IEK + A +   +  ++++L  ++  R    D
  S:     2 KQIAILGSTGSIGVSTLEIVAAHPDKFRVLSLSGAKNLDLLARQIRQFRPRLA---AVADPADIPRLKELLSGVEVELTGGVEGLCAAATAPGVQMVVAAIVGAAGLVPTAAAIRAGIDVALANKETLVTAGHLFMELVERHKVKLYPVDSEHSAIFQSIEGHRSQDITKIILTASGGPFRETPLEKLQSVTIQDALNHPNWSMGRKITIDSATMMNKGLEVIEARWLFDAPAEKISVNIHPQSIIHSMVEYIDGCVIAQLGTPDMKAPIAYALSYPERVSTGVKPLDLTELSGLTFSKPDLERFPCLGLAYRAL-GEGESMPAVMNAANEVAVEAFLDGRISYLQIAALIEKTMDAHQAHRLGSIEEVLEADRWGRATARD 379
>gi|29347412|ref|NP_810915.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacteroides thetaiotaomicron VPI-5482] >gi|32171382|sp|Q8A684|DXR_BACTN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|29339312|gb|AAO77109.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacteroides thetaiotaomicron VPI-5482] (390 aa)
Score = 575, Expect = 2.8e-57, Identities = 132/341 (38%), Positives = 212/341 (62%)
  Q:     2 LEGEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS--------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ EK +NKKK++ + G+TG+IG  +L++IE+  + YE    + NN  E  +    +F P  +V +                +K    +++  +++E    D++L A+VG++GL  T+ A++    +ALANKE+LVVAG LI  L +   + I PVDSEHS+++  L       I+++I+T SGGPF      +L ++    A+KHPNW MG KI+IDSA+MMNK FE+IEA +LF  +  +I+V  H QS+IHSM++F D +  A + +PDM+L IQ   S  +   +  + L F    NLTF + D  +++ +  AY+ +      +P I+NAANE  +  F  + I FL + ++IEK +
  S:     1 MDSEK-KNKKKQIAILGSTGSIGTQALQVIEEHPDLYEAYALTANNRVELLIAQARKFQPEVVVIANEEKYAQLKEALSDLPIKVYAGIDAVCQIVEAGPVDMVLTAMVGYAGLKPTINAIRAKKAIALANKETLVVAGELINQLAQQYHTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASGGPFRTCTLEQLKSVTKTQALKHPNWEMGAKITIDSASMMNKGFEVIEAKWLFGVQPSQIEVVVHPQSVIHSMVQFEDGAVKAQLGMPDMRLPIQYAFSYPDRICSSFDRLDFTQCTNLTFEQPDTKRFRNLALAYEAMYRGGN-MPCIVNAANEVVVAAFLRDGISFLGMSDVIEKTM 360
>gi|53714984|ref|YP_100976.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacteroides fragilis YCH46] >gi|59797513|sp|Q64PY9|DXR_BACFR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|52217849|dbj|BAD50442.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacteroides fragilis YCH46] (388 aa)
Score = 574, Expect = 3.7e-57, Identities = 134/358 (37%), Positives = 214/358 (59%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS--------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           E KKK++ + G+TG+IG  +L++IE+  E YE+   + NN  +  +    +F P A+V +                VK      +  +++E    D++L A+VG++GL  T+ A++    +ALANKE+LVVAG LI  L R   + I PVDSEHS+++  L       I+++I+T SGGPF      +L  +    A+KHPNW MG KI+IDSA+MMNK FE+IEA +LF  +  +I+V  H QS+IHSM++F D +  A + +PDM+L IQ   S  +   +  + L F+   NLTF + D  +++ +  AY+ +      +P I+NAANE  +  F  ++I FL + ++IE  +  +   +     D +  +   R+
  S:     3 EIKKKQIAILGSTGSIGTQALQVIEEHPELYEVYALTANNKVDLLIAQARKFMPEAVVIANEEKYAQLKEALSDLPVKVYAGAAALCQIVESGPIDVVLTAMVGYAGLKPTMNAIRAGKAIALANKETLVVAGELINQLARQYRTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASGGPFRTCTMEQLKTVTKVQALKHPNWEMGAKITIDSASMMNKGFEVIEAKWLFGVQPGQIEVVVHPQSVIHSMVQFEDGAIKAQLGMPDMRLPIQYAFSYPDRINSSFDRLDFSKCTNLTFEQPDTKRFRNLALAYESMYRGGN-MPCIVNAANEVVVAAFLRDEISFLGMSDVIEHTMGQVSFVQTPTYDDYVATDAEARR 380
>gi|60682951|ref|YP_213095.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacteroides fragilis NCTC 9343] >gi|81170437|sp|Q5L9P6|DXR_BACFN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|60494385|emb|CAH09181.1| putative terpenoid biosynthesis related reductoisomerase [Bacteroides fragilis NCTC 9343] (388 aa)
Score = 573, Expect = 4.8e-57, Identities = 134/358 (37%), Positives = 214/358 (59%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS--------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           E KKK++ + G+TG+IG  +L++IE+  E YE+   + NN  +  +    +F P A+V +                VK      +  +++E    D++L A+VG++GL  T+ A++    +ALANKE+LVVAG LI  L R   + I PVDSEHS+++  L       I+++I+T SGGPF      +L  +    A+KHPNW MG KI+IDSA+MMNK FE+IEA +LF  +  +I+V  H QS+IHSM++F D +  A + +PDM+L IQ   S  +   +  + L F+   NLTF + D  +++ +  AY+ +      +P I+NAANE  +  F  ++I FL + ++IE  +  +   +     D +  +   R+
  S:     3 EIKKKQIAILGSTGSIGTQALQVIEEHPELYEVYALTANNKVDLLIAQARKFMPEAVVIANEEKYAQLKEALSDLPVKVYAGAAALCQIVESGPIDVVLTAMVGYAGLKPTMNAIRAGKAIALANKETLVVAGELINQLARQYRTPILPVDSEHSAVFQCLAGEVGNPIEKVILTASGGPFRTCTMEQLKTVTKVQALKHPNWEMGAKITIDSASMMNKGFEVIEAKWLFGVQPSQIEVVVHPQSVIHSMVQFEDGAIKAQLGMPDMRLPIQYAFSYPDRINSSFDRLDFSKCTNLTFEQPDTKRFRNLALAYESMYRGGN-MPCIVNAANEVVVAAFLRDEISFLGMSDVIEHTMGQVSFVQTPTYDDYVATDAEARR 380
>gi|30021909|ref|NP_833540.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus ATCC 14579] >gi|168138549|ref|ZP_02581778.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus B4264] >gi|39931055|sp|Q819Y3|DXR2_BACCR 1-deoxy-D-xylulose 5-phosphate reductoisomerase 2 (DXP reductoisomerase 2) (1-deoxyxylulose-5-phosphate reductoisomerase 2) (2-C-methyl-D-erythritol 4-phosphate synthase 2) >gi|29897465|gb|AAP10741.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus ATCC 14579] (380 aa)
Score = 573, Expect = 5.7e-57, Identities = 143/358 (39%), Positives = 222/358 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVF-----------SPSVKTKNTVNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V            S S  TK    S E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F ++D ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQSVSGNTKIVYGS-EGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEIGTLHFEKMDQERFRCLRFAYE-AGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 378
>gi|189345641|ref|YP_001942170.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium limicola DSM 245] >gi|189339788|gb|ACD89191.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium limicola DSM 245] (382 aa)
Score = 573, Expect = 5.9e-57, Identities = 138/354 (38%), Positives = 213/354 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG S+L+++ +    + + G +  ++     E IN F   +V   SV+   + +   +LL    P+I                  +++A+VG +GL  T+ A+K    +ALANKE+LVVAG L+ DL +  + ++ PVDSEHS+++ SL  +  E I+ +I+T SGGPF K    EL       A+KHP W MG KI+IDSAT+MNK  E+IEA++LFN   +KI V  H QSIIHSM+++ D   +A M VPDM+  I   L+  E     I  L    +  LTF E D++++  +  A+D L+   R  P ++NAANE A+  F + KI F DI + ++K + A E     +L + L  ++  R+
  S:     2 KALSILGSTGSIGLSTLDVVRQHPGKFTITGLAEGHDVGLLNEQINEFRPDVV---SVRDAASADQLRKLLGTHKPEIFYGIEGAATVAAAEGAEMVVSAIVGAAGLVPTVSAIKAGKHIALANKETLVVAGQLVSDLVKKHNVQLLPVDSEHSAIFQSLAGHRTEDIERIILTASGGPFRKTPAEELKLAGPEQALKHPQWTMGAKITIDSATLMNKGLEVIEAHWLFNMPAEKIGVVVHPQSIIHSMVEYIDGCVMAQMGVPDMRAPIAYALAWPERCGTGIGKLDLAKIGTLTFEEPDMERFPALRLAFDALK-AGRTYPAVLNAANEIAVAAFLDKKIGFTDIADTVDKTMQAHEAYAPVELDEYLQADRWARE 375
>gi|52142188|ref|YP_084641.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus E33L] >gi|59797684|sp|Q638M6|DXR1_BACCZ 1-deoxy-D-xylulose 5-phosphate reductoisomerase 1 (DXP reductoisomerase 1) (1-deoxyxylulose-5-phosphate reductoisomerase 1) (2-C-methyl-D-erythritol 4-phosphate synthase 1) >gi|51975657|gb|AAU17207.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus E33L] (385 aa)
Score = 571, Expect = 8.4e-57, Identities = 147/355 (41%), Positives = 221/355 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF------------PNALVFSPSVKTKNTVNSFEELLEKTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-------SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L+++    E++++VG + N N E   + I  F             + L    S  TK T  +   +   T+PD  ++L+++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ +L + +  R+ PVDSEHS+++  L   NNKEI +LI+T SGG F  K   E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LF+   +KI V  H +SIIHS+++F D S +A +  PDM++ IQ          S YE K NL+   S     L F + DL+K+  + +AY+         P ++NAANE A  LF +N+I F DI + I K + A  N +   L  IL  ++  R+Y
  S:     3 KYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKMFQPRIVSVATKDLADTLRMHISANTKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKINVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYE-KLNLLEIGS-----LHFEKPDLEKFPCLQYAYE-CGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQY 376
>gi|49479979|ref|YP_037467.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|59797759|sp|Q6HG59|DXR1_BACHK 1-deoxy-D-xylulose 5-phosphate reductoisomerase 1 (DXP reductoisomerase 1) (1-deoxyxylulose-5-phosphate reductoisomerase 1) (2-C-methyl-D-erythritol 4-phosphate synthase 1) >gi|49331535|gb|AAT62181.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar konkukian str. 97-27] (385 aa)
Score = 571, Expect = 9.4e-57, Identities = 146/355 (41%), Positives = 220/355 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT-----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-------SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L+++    E++++VG + N N E   + I  F   +V   SV TK   ++    +                    N +++L+++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ +L + +  R+ PVDSEHS+++  L   NNKEI +LI+T SGG F  K   E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LF+   +KI V  H +SIIHS+++F D S IA +  PDM++ IQ          S YE K NL+   S     L F + DL+K+  + +AY+         P ++NAANE A  LF +N+I F DI + I K + A  N +   L  IL  ++  R+Y
  S:     3 KYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIV---SVATKELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYE-KLNLLEIGS-----LHFEKPDLEKFPCLQYAYE-CGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQY 376
>gi|167040291|ref|YP_001663276.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermoanaerobacter sp. X514] >gi|166854531|gb|ABY92940.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermoanaerobacter sp. X514] (382 aa)
Score = 570, Expect = 1.2e-56, Identities = 146/356 (41%), Positives = 232/356 (65%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN----LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KKV++ G+TG+IG  +L++I+  +EN+E+VG +  NN E   + I  F   +V   +VK ++  N   E L+K                 + D+++ A+ G +GL  T+ A++   D+ALANKE LV AG ++ DL +     + PVDSEHS++   L+ N+ KE+  LI+T SGGPF  K+  +L  +   +A+ HPNW MGKKI+IDSAT+MNK FE+IEA +LF+    KI V  H QSIIHSM+++ D S IA ++  DM++ I   L+ Y ++ N IN ++F + +    LTF + DL+ ++ +  AY+ L+     +  ++NAA+E A+ LF   KI+FL I EIIE+++    N +   L DI+N+++  ++ +
  S:     2 KKVIILGSTGSIGTQTLDVIKNFRENFEIVGLTAYNNVELLSKQIREFNPKVV---AVKDEDKANQLRENLKKNVEILTGSKGLQEIVKYDADLVVVAVEGIAGLIPTVTAIQMGKDIALANKEVLVTAGQIVMDLVKKKDISLLPVDSEHSAILQCLRGNDKKEVSRLILTASGGPFRGKKKEDLRKVTVNEALNHPNWKMGKKITIDSATLMNKGFEVIEAKWLFDISEDKIDVIVHPQSIIHSMVEYIDGSVIAQLATADMRIPIHYALN-YPTR-NYINGMNFLDFSLTTQLTFEKPDLETFRCLSLAYEALKIGG-TMTTVLNAADEIAVSLFLNKKIEFLQIAEIIEESMKEHNNIQNPTLDDIINVDEEVKEKI 376
>gi|95928702|ref|ZP_01311448.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Desulfuromonas acetoxidans DSM 684] >gi|95135047|gb|EAT16700.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Desulfuromonas acetoxidans DSM 684] (385 aa)
Score = 570, Expect = 1.3e-56, Identities = 132/353 (37%), Positives = 210/353 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFP---------------NALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + V G+TG+IG S+L+++ +  + + +V  S     E   + I RF                 ALV   SV+  + ++            ++++A+VG +GL  T+ A++   D+ALANKE+LV AG LI D  +     + PVDSEHS++Y SL  +   +++ LI+T SGGPF +   ++L ++    A+ HPNW MG KI+IDSATMMNK  E+IEAY+LFN   + I V+ H QSI+HSM+++ D S +A + +PDMK  I   L+  +     +  L      +L+FS  DL+ +  +  AY+ L     A PI++NAANE A+  F +  I++LDI  +I + +    N  ++ + D+L+ +   R
  S:     2 KSISVLGSTGSIGVSTLDVVAEFPDKFRVVALSAGRQIELLADQIRRFKPDVVSVANPADCPRLQALVQDCSVEIVSGIDGVVSCATLPQAQMVVSAIVGAAGLVPTMAAIEAGKDIALANKETLVTAGALIMDAVQRHKVNLLPVDSEHSAIYQSLSGHQYADVRRLILTASGGPFREFSRDQLEHVTLEQALNHPNWTMGAKITIDSATMMNKGLEVIEAYWLFNIPAEHIDVHIHPQSIVHSMVEYIDGSVVAQLGIPDMKTPIAYALAWPDRLPLSLPALDLCQWADLSFSRPDLELFPCLKLAYEALAEGGSA-PIVLNAANEIAVEEFLQQNIQYLDISSVIRQVLDQYRNESIHSIDDVLHCDDRAR 374
>gi|148265747|ref|YP_001232453.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter uraniireducens Rf4] >gi|189027756|sp|A5G7W2|DXR_GEOUR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|146399247|gb|ABQ27880.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter uraniireducens Rf4] (386 aa)
Score = 569, Expect = 1.5e-56, Identities = 135/354 (38%), Positives = 217/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           KK+ + G+TG+IG S+L+I+    + +++V  +   N +   + I  F   LV   +V  +      +++L    P I+                  + A+VG +GL  T  A+K   D+ALANKE+LV AG LI D+ ++   ++YPVDSEHS+++ SL+ +  E +K++I+T SGGPF+     +L  +  +DA+ HPNW+MG+KI+IDSA+MMNK  E+IEA +LF+   +KI V  H QSIIHSM+++ D   +A + +PDMK  I   L+        +  L    L+ LTF   D  ++  +  AY  LE+   ++P +MNAANE A+  F   +IKF  I E IEK +   +   +N ++++L +++  R+
  S:     2 KKLAILGSTGSIGVSTLDIVAAHPDKFQVVALTAGGNLDLLKKQIEEFSPQLV---AVLNEELAQKLQQMLSGKGPAILHGVEGMIAAATAADADMVVAAIVGAAGLVPTAAAIKAGKDIALANKETLVTAGRLIMDMVKAHGVKLYPVDSEHSAVFQSLQGHRMEDVKQIILTASGGPFFTWPAEKLAQVTVSDALNHPNWSMGQKITIDSASMMNKGLEVIEARWLFDIPAEKIAVNIHPQSIIHSMVEYIDGCVMAQLGIPDMKAPIAYALTYPGRVPTGVKPLDLTALSGLTFFNPDYSRFPALKLAYRALED-GESMPTVMNAANEVAVGAFLNGRIKFTAIAEAIEKTMDFHQPHLLNTIEEVLLVDRWGRE 375
>gi|75762602|ref|ZP_00742451.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489911|gb|EAO53278.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] (385 aa)
Score = 569, Expect = 1.6e-56, Identities = 147/355 (41%), Positives = 222/355 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK---------------TNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-------SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L+++    E++++VG + N N +   + I  F   +V   SV TK+  ++    +                 T+PD  ++L+++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ +L + +  R+ PVDSEHS+++  L   NNKEI +LI+T SGG F  K   E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LF+   KKI V  H +SIIHS+++F D S +A +  PDM++ IQ          S YE K NL+   S     L F + DL+K+  + +AY+         P ++NAANE A  LF +N+I F DI + I   I A  N +   L  IL  ++  R+Y
  S:     3 KYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIV---SVATKDLADTLRTRISANTKITHGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEAKWLFDIPYKKIDVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYE-KLNLLELGS-----LHFEKPDLEKFPCLQYAYE-CGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYTTIEAHHNVKDPSLDAILEADQWARQY 376
>gi|30263316|ref|NP_845693.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Ames] >gi|47528694|ref|YP_020043.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186165|ref|YP_029417.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Sterne] >gi|165868689|ref|ZP_02213349.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0488] >gi|167632558|ref|ZP_02390885.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0442] >gi|167637022|ref|ZP_02395302.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0193] >gi|170685015|ref|ZP_02876240.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0465] >gi|170704938|ref|ZP_02895403.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0389] >gi|177649981|ref|ZP_02932982.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0174] >gi|190564775|ref|ZP_03017696.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis Tsiankovskii-I] >gi|39931065|sp|Q81N10|DXR1_BACAN 1-deoxy-D-xylulose 5-phosphate reductoisomerase 1 (DXP reductoisomerase 1) (1-deoxyxylulose-5-phosphate reductoisomerase 1) (2-C-methyl-D-erythritol 4-phosphate synthase 1) >gi|30257950|gb|AAP27179.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Ames] >gi|47503842|gb|AAT32518.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180092|gb|AAT55468.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Sterne] >gi|164715415|gb|EDR20932.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0488] >gi|167514529|gb|EDR89895.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0193] >gi|167532856|gb|EDR95492.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0442] >gi|170129793|gb|EDS98655.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0389] >gi|170671275|gb|EDT22013.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0465] >gi|172083933|gb|EDT68992.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0174] >gi|190564092|gb|EDV18056.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis Tsiankovskii-I] (385 aa)
Score = 569, Expect = 1.7e-56, Identities = 146/355 (41%), Positives = 220/355 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT-----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-------SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L+++    E++++VG + N N E   + I  F   +V   SV TK   ++    +                    N +++L+++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ +L + +  R+ PVDSEHS+++  L   NNKEI +LI+T SGG F  K   E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LF+   +KI V  H +SIIHS+++F D S IA +  PDM++ IQ          S YE K NL+   S     L F + DL+K+  + +AY+         P ++NAANE A  LF +N+I F DI + I K + A  N +   L  IL  ++  R+Y
  S:     3 KYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIV---SVATKELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKINVMIHKESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYE-KLNLLEIGS-----LHFEKPDLEKFPCLQYAYE-CGKIGGITPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQY 376
>gi|126699747|ref|YP_001088644.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium difficile 630] >gi|123363224|sp|Q185R8|DXR_CLOD6 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115251184|emb|CAJ69015.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Clostridium difficile 630] (384 aa)
Score = 568, Expect = 1.7e-56, Identities = 148/361 (40%), Positives = 225/361 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT-------------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           KK+ + G+TG+IG  +L+++   ++ +E+V  S N+N E  LE I  F    V   +V  +N     +E+L K                      D++L A+VG  GL  TL A+K  +D+ALANKE+LV AG L+       +  I PVDSEHS+++  L   NK+ I+++I+T SGGPF  K+  EL+NI   +A+KHPNW+MG+KISIDS+T+MNK  E+IEA +LF  ++  I V  H QSIIHSM+++TD+S IA +  PDM+L IQ  L+  +   +    ++F+  + LTF E DL+ +  +  AY+ L+        ++N+ANE  +  F E+KI F DI   IEK +    +     L++IL  ++ +R YV +  K
  S:     2 KKISILGSTGSIGKQTLDVVRDNRDKFEIVAISANSNIELLLEQIVEFKPKYV---TVFEENKALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIALANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFRGKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFGVEQENIDVVVHPQSIIHSMVQYTDSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPDLETFPCLKLAYECLK-MGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSISEPTLEEILETDRWSRAYVANLIK 383
>gi|85859436|ref|YP_461638.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Syntrophus aciditrophicus SB] >gi|85722527|gb|ABC77470.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Syntrophus aciditrophicus SB] (387 aa)
Score = 568, Expect = 2.0e-56, Identities = 136/354 (38%), Positives = 223/354 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVF------SPSVKTKNTVNSFEELL----------EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKT--NLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           KK+ + G+TG+IG S+LE+I +    +++V  +   N +   + I  F   +V       + ++K K + +S  E+L             + D++++A+VG +GL  TL A+    D+ALANKE+LV+AG L+ +  +     I+PVDSEHS+++  L   N+K ++ +++T SGGPFY+    +L ++   DA+KHPNW MG KI+IDSATMMNK  EIIEA++LFN   ++I VY H QSI+HSM+++ D S IA + +PDMK+ I   LS  E      L  DL F    L F   D++++  +  A + +  Q   +P+++NA+NE A+  F   ++ F  I E++++A+ + +     +++DIL  +   RK
  S:     2 KKISLLGSTGSIGCSALEVIRRNPTKFQIVSLAAGRNIDLLKKQIEEFHPVMVSVLEQECAAALKKKLSPSSGIEILYGCEGCCRVASVEDADMVISAIVGAAGLLPTLAAIDAGKDIALANKETLVMAGKLVTEKAKYRGVTIFPVDSEHSAIFQCLAGQNSKTVRRVLLTASGGPFYRFSSKQLESVKPGDALKHPNWVMGNKITIDSATMMNKGLEIIEAHWLFNMDIERIHVYIHPQSIVHSMVEYIDGSVIAQLGIPDMKIPIAYALSFPERLDCPELSLDL-FRVGKLEFFPPDVNRFPCLSLACEAVR-QGGTMPVVLNASNEVAVEAFLAKRLPFTRISELVDRAMSSHQCMTSPEIEDILEADGWARK 376
>gi|78222470|ref|YP_384217.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter metallireducens GS-15] >gi|123572204|sp|Q39W82|DXR_GEOMG 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|78193725|gb|ABB31492.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacter metallireducens GS-15] (384 aa)
Score = 568, Expect = 2.1e-56, Identities = 139/347 (40%), Positives = 210/347 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI-------ILNALVGFSG-----------LHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILN 358
           KK+ + G+TG+IG S+LEI+    + ++++  +  +N E   + +  F   LV   SV T +     + +L    P+I       I  A  G +            L  T  A+K   D+ALANKE+LV AG ++ DL R +  R+YPVDSEHS+++ SL+  + K++K +I+T SGGPF     + L  ++ ADA+ HPNW+MG+KI+IDSATMMNK  E+IEA +LF+T  ++I V  H QSIIHSM+++ D   +A + VPDMK  I   L+  E     +  L    L+ LTF   D  ++  +  AYD L     ++P +MNAANE A+  F + KI F  I   I + + A E   +  ++D+L+
  S:     2 KKLTILGSTGSIGTSTLEIVAAHPDRFQVIALTAGSNLELLKQQVEVFRPRLV---SVLTADLARQLDRMLSDPKPEIHHGIPGLIAAATAGEADVVVAAIVGAAGLVPTAAAIKAGKDVALANKETLVTAGRIMMDLVRENGVRLYPVDSEHSAVFQSLEGQSGKDVKRIILTASGGPFLNLPLDRLSRVSVADALNHPNWSMGQKITIDSATMMNKGLEVIEARWLFDTPAERIAVNIHPQSIIHSMVEYVDGCVMAQLGVPDMKAPIAYALTYPERIPTGVKPLDLTALSGLTFLAPDYQRFPALKLAYDALA-AGESMPAVMNAANEVAVEAFLKGKIGFTGIATSIARTMDAHEPHTLATIEDVLS 368
>gi|145954160|ref|ZP_01803167.1| hypothetical protein CdifQ_04002466 [Clostridium difficile QCD-32g58] >gi|168694297|ref|ZP_02726574.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium difficile QCD-37x79] >gi|168725637|ref|ZP_02757914.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium difficile QCD-76w55] >gi|168730674|ref|ZP_02762951.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium difficile QCD-97b34] >gi|196160705|ref|ZP_03121266.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium difficile CIP 107932] (384 aa)
Score = 566, Expect = 3.6e-56, Identities = 147/361 (40%), Positives = 224/361 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT-------------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           KK+ + G+TG+IG  +L+++   ++ +E+V  S N+N E  LE I  F    V   +V  +N     +E+L K                      D++L A+VG  GL  TL A+K  +D+ALANKE+LV AG L+       +  I PVDSEHS+++  L   NK+ I+++I+T SGGPF  K+  EL+NI   +A+KHPNW+MG+KISIDS+T+MNK  E+IEA +LF  ++  I V  H QSIIHSM+++ D+S IA +  PDM+L IQ  L+  +   +    ++F+  + LTF E DL+ +  +  AY+ L+        ++N+ANE  +  F E+KI F DI   IEK +    +     L++IL  ++ +R YV +  K
  S:     2 KKISILGSTGSIGKQTLDVVREHRDKFEIVAISANSNIELLLEQIVEFKPKYV---TVFEENKALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIALANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFRGKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFRVEQENIDVVVHPQSIIHSMVQYADSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPDLETFPCLKLAYECLK-MGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSISEPTLEEILETDRWSRAYVANLIK 383
>gi|118418268|gb|ABK86687.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis str. Al Hakam] (388 aa)
Score = 566, Expect = 3.8e-56, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:    10 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKVVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEIGTLHFEKMNQERFRCLRFAYE-AGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 386
>gi|42782912|ref|NP_980159.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus ATCC 10987] >gi|59797593|sp|Q732P8|DXR_BACC1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|42738839|gb|AAS42767.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus ATCC 10987] (380 aa)
Score = 565, Expect = 3.9e-56, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEMGTLHFEKMNQERFRCLRFAYE-AGKTGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDATTRRFVME 378
>gi|65321148|ref|ZP_00394107.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A2012] (388 aa)
Score = 564, Expect = 5.4e-56, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:    10 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEIGTLHFEKMNQERFRCLRFAYE-AGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 386
>gi|47569099|ref|ZP_00239788.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus G9241] >gi|166986178|ref|ZP_02257433.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus AH187] >gi|47554261|gb|EAL12623.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus G9241] (380 aa)
Score = 564, Expect = 5.9e-56, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEMGTLHFEKMNQERFRCLRFAYE-AGKTGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 378
>gi|30263825|ref|NP_846202.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Ames] >gi|47529249|ref|YP_020598.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186671|ref|YP_029923.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Sterne] >gi|52141667|ref|YP_085162.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus E33L] >gi|165872593|ref|ZP_02217224.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0488] >gi|166994475|ref|ZP_02260935.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus AH820] >gi|167635796|ref|ZP_02394105.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0442] >gi|167639756|ref|ZP_02398025.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0193] >gi|170706775|ref|ZP_02897233.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0389] >gi|177652026|ref|ZP_02934572.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0174] >gi|190568458|ref|ZP_03021365.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis Tsiankovskii-I] >gi|196036919|ref|ZP_03104303.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus W] >gi|196042146|ref|ZP_03109429.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus NVH0597-99] >gi|39931070|sp|Q81WL4|DXR2_BACAN 1-deoxy-D-xylulose 5-phosphate reductoisomerase 2 (DXP reductoisomerase 2) (1-deoxyxylulose-5-phosphate reductoisomerase 2) (2-C-methyl-D-erythritol 4-phosphate synthase 2) >gi|59797683|sp|Q636K5|DXR2_BACCZ 1-deoxy-D-xylulose 5-phosphate reductoisomerase 2 (DXP reductoisomerase 2) (1-deoxyxylulose-5-phosphate reductoisomerase 2) (2-C-methyl-D-erythritol 4-phosphate synthase 2) >gi|30258469|gb|AAP27688.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Ames] >gi|47504397|gb|AAT33073.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180598|gb|AAT55974.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. Sterne] >gi|51975136|gb|AAU16686.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus E33L] >gi|164711625|gb|EDR17171.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0488] >gi|167512157|gb|EDR87534.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0193] >gi|167528753|gb|EDR91511.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0442] >gi|170128193|gb|EDS97062.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0389] >gi|172082395|gb|EDT67460.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis str. A0174] >gi|190560462|gb|EDV14440.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus anthracis Tsiankovskii-I] >gi|195990474|gb|EDX54458.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus W] >gi|196026998|gb|EDX65622.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus NVH0597-99] (380 aa)
Score = 564, Expect = 6.1e-56, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEIGTLHFEKMNQERFRCLRFAYE-AGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 378
>gi|116872748|ref|YP_849529.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123460984|sp|A0AIB8|DXR_LISW6 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|116741626|emb|CAK20750.1| dxr [Listeria welshimeri serovar 6b str. SLCC5334] (380 aa)
Score = 563, Expect = 6.6e-56, Identities = 139/356 (39%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-------GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK+++ GATG+IG  +L II +  E ++LV  SF  N E+   II  F   +V               P+VK  N +    E+    + D++LNA++G  GL  TL A++    +A+ANKE+LV AG ++    R  +  + PVDSEHS++  +L   N E I++L++T SGG F  K   EL  +   +A+KHPNWNMG K++IDSATM NK  E++EA++LF  +   I+V    +SI+HSM++F D S+IA +  PDM++ IQ  L+        YE K   I D S     L F ++D +++  +  AY+        +P ++NAANE A+  F   ++ F +I  ++E A+    +    DL  IL +++ TR YV
  S:     2 KKIILLGATGSIGTQTLAIIRENPEKFQLVALSFGRNMERGRAIIQEFKPKMVAVWHTRDRITLESEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKSIAIANKETLVTAGHIVMRAAREKNISLLPVDSEHSAILQALNGENPERIEKLVLTASGGSFRDKTRGELSEVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIVHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLFIPYE-KNFRITDFS----ALHFEKVDYERFPALKLAYN-AGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENALNRHTSISEPDLDTILQVDQETRAYV 376
>gi|28210954|ref|NP_781898.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium tetani E88] >gi|32171378|sp|Q895K5|DXR_CLOTE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|28203393|gb|AAO35835.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Clostridium tetani E88] (384 aa)
Score = 562, Expect = 1.0e-55, Identities = 153/356 (42%), Positives = 219/356 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP--------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K + + GATG+IG  +LE+I  EKEN +L   S N + EK + II  F    V   S+  K      +E   K N                     DI+L ++VG  GL  TL A++N  D+ALANKE+LVVAG +I+     +   I PVDSEH +++  L  N K +I ++ +T SGGPF  K+  EL N+    A+KHPNWNMGKKISIDSAT+MNK  E+IEA++LF+   + I+V  H +SIIHSM+++ D S IA ++ PDMKL IQ  L+    K  +I  L+ F    LTF + DL  +K +  AY         +P I+N++NE A+ LF   KI FL+I +IIE+ +      E   ++ I++++K   +Y+
  S:     2 KNICILGATGSIGTQTLEVIREEKENLKLYAASANKSSEKIISIIEEFEPKYV---SMTDKEAFLKVKEFCMKNNKNTEVLYGIEGMNTIASLDKVDIVLTSVVGMIGLEPTLKAIRNKKDIALANKETLVVAGEIIKKEAHENKVNILPVDSEHGAIFQCLLGNLKGDINKIHLTASGGPFRGKKREELENVTVEQALKHPNWNMGKKISIDSATLMNKGLEVIEAHFLFDVDYEDIEVVVHPESIIHSMVEYKDGSVIAQLASPDMKLPIQYALNYPIRKDRVIEKLNLFEIEKLTFYKPDLKTFKCLDLAYR-AGKIGGMMPTILNSSNEYAVELFLNKKIGFLEIPKIIEECMKKFYTKEEQSVEKIIHMDKIIGEYI 379
>gi|49478394|ref|YP_037882.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|59797758|sp|Q6HEZ4|DXR2_BACHK 1-deoxy-D-xylulose 5-phosphate reductoisomerase 2 (DXP reductoisomerase 2) (1-deoxyxylulose-5-phosphate reductoisomerase 2) (2-C-methyl-D-erythritol 4-phosphate synthase 2) >gi|49329950|gb|AAT60596.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar konkukian str. 97-27] (380 aa)
Score = 562, Expect = 1.0e-55, Identities = 140/358 (39%), Positives = 221/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKIVYGNEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEIGTLHFEKMNQERFRCLRFAYE-AGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 378
>gi|163941559|ref|YP_001646443.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus weihenstephanensis KBAB4] >gi|163863756|gb|ABY44815.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus weihenstephanensis KBAB4] (380 aa)
Score = 561, Expect = 1.2e-55, Identities = 139/358 (38%), Positives = 220/358 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------FSPSVKTKNT--VNSFEELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   +V              + NT  V   E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R ++  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL  +   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F +++ ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++I  ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNVDYAVKVIQEFSPQIVSVQREEDVLKLQAVSGNTKVVYGSEGLLEVALHPDTEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKNNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHQVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEMGTLHFEKMNQERFRCLRFAYE-AGKTGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMHHHTVIARPSLEEIQEIDAATRRFVME 378
>gi|16800422|ref|NP_470690.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria innocua Clip11262] >gi|21263530|sp|Q92C37|DXR_LISIN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|16413827|emb|CAC96585.1| lin1354 [Listeria innocua] (380 aa)
Score = 561, Expect = 1.4e-55, Identities = 134/356 (37%), Positives = 217/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN---LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK+++ GATG+IG  +L II +  E ++LV FSF  N E+   II  F   +V               P VK  N ++   E+    + D++LNA++G  GL  TL A++    +A+ANKE+LV AG L+    +  +  + PVDSEHS++  +L   N+E I+++I+T SGG F  K   +L  +   +A+KHPNWNMG K++IDSATM NK  E++EA++LF  +   I+V    +SI+HSM++F D S+IA +  PDM++ IQ  L+ Y  + ++  +  F   +   L F E++ +++  +  AY+        +P ++NAANE A+  F   ++ F +I  ++E A+    +    +L  IL +++ TR YV
  S:     2 KKIILLGATGSIGTQTLTIIRENPEKFQLVAFSFGRNIERGRAIIQEFKPKMVAVWHTRDRVTLESEFPDVKFFNGLDGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMQAAKEKNISLLPVDSEHSAILQALNGENRERIEKIILTASGGSFRDKTREQLSEVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIVHSMVQFVDGSFIAQLGTPDMRMPIQYALT-YPDRLSIPYEKEFRITDFSALHFEEVNYERFPALKLAYN-AGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNPNLDTILQVDQETRAYV 376
>gi|56552046|ref|YP_162885.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zymomonas mobilis subsp. mobilis ZM4] >gi|59802559|sp|Q9X5F2|DXR_ZYMMO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|4768865|gb|AAD29659.1|AF124757_19 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zymomonas mobilis] >gi|56543620|gb|AAV89774.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zymomonas mobilis subsp. mobilis ZM4] (388 aa)
Score = 560, Expect = 1.6e-55, Identities = 130/356 (36%), Positives = 210/356 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF--PNALVFSPSV----------KTKNTVNSFEELLEKT--NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++ + V V GATG+IG S+L++IE+  + Y+++  + N N +   +   R     A++  PS+           +       + L+E      D  + A++G +GL  TL A++    +ALANKESLV AG L+ D  R   + + PVDSEH++++    ++N++ ++ +IIT SGGPF      E+  +    AV+HPNW+MG KISIDSATMMNK  E+IEAY+LF    +K ++  H QS+IHSM+++ D S +A +  PDM+  I   L+  +        L F  L  + F   D +++  +  A + +++   A P +MNAANE A+  F + KI FLDI +I+EK +        + L+D+  ++   R
  S:     2 SQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQHPNWSMGAKISIDSATMMNKGLELIEAYHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGG-ARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEAR 376
>gi|189499092|ref|YP_001958562.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium phaeobacteroides BS1] >gi|189494533|gb|ACE03081.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium phaeobacteroides BS1] (382 aa)
Score = 559, Expect = 2.3e-55, Identities = 133/353 (37%), Positives = 210/353 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + + G+TG+IG S+L+++ +  E + + G +  ++     E I  F   +V   SV+ K +     E L    P+I                  +++A+VG +GL  T+ A+K   D+ALANKE+LVVAG L+ DL +     + PVDSEHS+++ SL  + KE I+ +I+T SGGPF      +L ++    A+KHP W MG KI+IDSAT+MNK  E+IEA++LF+    KI V  H QSIIHSM+++ D   +A +  PDM+  I   L+  E   + I  L    +  LTF + D++++  +  A+D L+   +  P ++NAANE A+  F + KI F DI  I ++ + A +    + L + L  ++  R
  S:     2 KSLSILGSTGSIGLSTLDVVRQHPEKFNVTGLAEGHDINLLAEQIKEFRPDIV---SVRDKASAGLLREQLGSEKPEILWGIEGAAAVGAAEGSEMVVSAIVGAAGLVPTVSAIKAGKDIALANKETLVVAGQLVSDLVKEHKVTLLPVDSEHSAIFQSLSGHRKEDIERIILTASGGPFRHTSAEDLRHVGPEKALKHPQWTMGAKITIDSATLMNKGLEVIEAHWLFDMPADKIGVVVHPQSIIHSMVEYIDGCVMAQLGAPDMRAPIAYALAWPERCESGIKKLDLTQIGTLTFEQPDMERFPALRLAFDALK-AGQTFPAVLNAANEIAVAAFLDKKIGFTDIPAIADRTMQAHDPYTPSGLDEYLAADRWAR 374
>gi|119358444|ref|YP_913088.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium phaeobacteroides DSM 266] >gi|166218253|sp|A1BJT7|DXR_CHLPD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|119355793|gb|ABL66664.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlorobium phaeobacteroides DSM 266] (384 aa)
Score = 558, Expect = 3.2e-55, Identities = 132/354 (37%), Positives = 211/354 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL-KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + G+TG+IG S+L+++ +  E + + G +  ++    ++ I  F   LV   SV+  +       LL    P+I                  +++A+VG +GL  T+ A+K   ++ALANKE++VVAG L+ DL R     I PVDSEHS++Y SL  + ++++  LI+T SGGPF      EL  +    A+KHP W MG KI+IDSAT+MNK  E+IEA++LF+    KI V  H QSIIHSM+++ D   +A + +PDM+  I   ++  E   + I  L    + +L+F E D  ++  +  AY+ LE   R  P ++NAANE A+  F + +I F DI + ++K + A E      L++ L  ++  R+
  S:     2 RSLSILGSTGSIGLSTLDVVRQHPEQFTITGLAEGHDVGMLVKQIREFNPRLV---SVRNADAAAELASLLGNEKPEIFYGIEGAATVAAADGADMVVSAIVGAAGLVPTISAIKAGKNIALANKETMVVAGRLVTDLARQHKVTIIPVDSEHSAIYQSLLGHRHEDVLRLILTASGGPFLNTSAEELREVTLEQALKHPKWTMGAKITIDSATLMNKGLEVIEAHWLFDMPAHKIGVVVHPQSIIHSMVEYIDGCVMAQLGMPDMRAPIAYAIAYPERCPSGIERLDLPKIGSLSFQEPDPGRFPCLRLAYESLE-AGRTCPAVLNAANEIAVAAFLDKRIGFTDIADTVDKTMQAHEAYTPVSLEEYLEADRWARE 375
>gi|51247274|pdb|1R0K|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis >gi|51247275|pdb|1R0K|B Chain B, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis >gi|51247276|pdb|1R0K|C Chain C, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis >gi|51247277|pdb|1R0K|D Chain D, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis >gi|51247278|pdb|1R0L|A Chain A, 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis In Complex With Nadph >gi|51247279|pdb|1R0L|B Chain B, 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis In Complex With Nadph >gi|51247280|pdb|1R0L|C Chain C, 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis In Complex With Nadph >gi|51247281|pdb|1R0L|D Chain D, 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis In Complex With Nadph >gi|6434139|emb|CAB60758.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zymomonas mobilis] (388 aa)
Score = 556, Expect = 4.6e-55, Identities = 129/356 (36%), Positives = 210/356 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF--PNALVFSPSV----------KTKNTVNSFEELLEKT--NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++ + V V GATG+IG S+L++IE+  + Y+++  + N N +   +   R     A++  PS+           +       + L+E      D  + A++G +GL  TL A++    +ALANKESLV AG L+ D  R   + + PVDSEH++++    ++N++ ++ +IIT SGGPF      E+  +    AV+HPNW+MG KISIDSATMMNK  E+IEA++LF    +K ++  H QS+IHSM+++ D S +A +  PDM+  I   L+  +        L F  L  + F   D +++  +  A + +++   A P +MNAANE A+  F + KI FLDI +I+EK +        + L+D+  ++   R
  S:     2 SQPRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPSLYNDLKEALAGSSVEAAAGADALVEAAMMGADWTMAAIIGCAGLKATLAAIRKGKTVALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPFRTTSLAEMATVTPERAVQHPNWSMGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILVHPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRMETPAESLDFTKLRQMDFEAPDYERFPALTLAMESIKSGG-ARPAVMNAANEIAVAAFLDKKIGFLDIAKIVEKTLDHYTPATPSSLEDVFAIDNEAR 376
>gi|125973514|ref|YP_001037424.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium thermocellum ATCC 27405] >gi|166218258|sp|A3DE52|DXR_CLOTH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|125713739|gb|ABN52231.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium thermocellum ATCC 27405] (381 aa)
Score = 556, Expect = 5.3e-55, Identities = 131/330 (39%), Positives = 207/330 (62%)
  Q:    13 KVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ + G+TG+IG  +L++    N ++ G + N N +   +    F   +V   +VK +       + L  T+  ++                  + ++VG +GL  T+ A+K+  ++ALANKE+LV AG ++         +I PVDSEHS+++ SL  NN K++ ++I+T SGGPF  ++  EL N+   +A+ HPNW+MG KI+IDSATMMNK  E+IEA++LF   +  I+V  H QSIIHSM+++ D S IA +  PDM+L IQ  L+  + K N  + L    + +LTF   DL+ +  +  A++ L      +P ++NAANE+A+ LF + KI+FLDI EIIEK +
  S:     4 RISILGSTGSIGVQTLDVARNLNIKVDGLAANKNIDLLEKQAREFQPKIV---AVKDEERARILRDRLSDTDCKVVGGVEGLKMVASIETVETVVTSIVGIAGLIPTMEAIKHKKNIALANKETLVTAGHIVMSEAARMGVKILPVDSEHSAVFQSLMGNNKKDVAKIILTASGGPFRGRKKEELRNVTLREALNHPNWSMGSKITIDSATMMNKGLEVIEAHWLFEIPQDDIEVLVHPQSIIHSMVEYKDGSIIAQLGSPDMRLPIQFALTYPDRKQNNFSKLDIVKIGSLTFEAPDLEAFPCLGLAFEALR-AGGTMPAVLNAANEKAVGLFLQEKIRFLDIPEIIEKVM 351
>gi|163941006|ref|YP_001645890.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus weihenstephanensis KBAB4] >gi|163863203|gb|ABY44262.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus weihenstephanensis KBAB4] (385 aa)
Score = 555, Expect = 5.7e-55, Identities = 146/355 (41%), Positives = 225/355 (63%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEE--------------LLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-------SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L+++    E++++VG + N N +   + I  F   +V   SV TK   ++                 L+E  T+PD  ++L+++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ +L + +  R+ PVDSEHS+++  L   NNKEI++LI+T SGG F  K   E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LF+   +KI V  H +SIIHS+++F D S +A +  PDM++ IQ          S YE K NL+   S     L F + +L+K+  + +A++         P ++NAANE A  LF +N+I F DI + I   + A  N +   L DIL  ++  R+Y
  S:     3 KYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEKQIESFQPRIV---SVATKELAHTLRSRISTNTKITYGTDGLIEVSTHPDTNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVSAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRDKTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEAKWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYE-KLNLLEIGS-----LHFEKPNLEKFPCLQYAFE-CGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYNTVEAHHNVKDPSLDDILEADQWARQY 376
>gi|52080258|ref|YP_079049.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus licheniformis ATCC 14580] >gi|52785635|ref|YP_091464.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus licheniformis ATCC 14580] >gi|81170438|sp|Q65JJ3|DXR_BACLD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|52003469|gb|AAU23411.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Bacillus licheniformis ATCC 14580] >gi|52348137|gb|AAU40771.1| Dxr [Bacillus licheniformis DSM 13] (383 aa)
Score = 555, Expect = 5.8e-55, Identities = 146/356 (41%), Positives = 217/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALV---------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---------NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K + + GATG+IG  +L++I+   + + L   +F  N EKA EII  F    V               FS + KT     +  E       DI++NALVG  GL  TL A+++   +ALANKE+LV AG ++++  +     + PVDSEHS+++ +L+  N K IK LI+T SGG F  +   EL  +   +A+ HPNW+MG KI+IDSATMMNK  E+IEA++LF+    +I V  H +SIIHSM++F D S IA +  PDM++ IQ  LS  E        L FN            L F++ D ++++ + +AY+        +P ++NAANEEA+  F   +I FL I +IIEKA+   +      L++I  ++K+ RK+V
  S:     2 KNICLLGATGSIGEQTLDVIKAHDDKFRLTAMTFGKNAEKAAEIIETFKPKYVGVGDEHTYETLKQHSFSYTFKTGIGEEALIEAAVIPEADIVVNALVGSVGLLPTLKAMEHKKTIALANKETLVTAGHIVKEHAQKYDVPLLPVDSEHSAIFQALQGENPKHIKRLIVTASGGSFRDRTRRELEGVTVEEALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDLPYDQIDVLLHKESIIHSMVEFHDRSVIAQLGTPDMRVPIQYALSHPER-------LPFNEAKSLDLWEVGQLNFAQADFERFRCLQFAYES-GKIGGTMPTVLNAANEEAVAAFLSGRISFLGIEDIIEKALERHQVIAKPSLQEIREVDKDARKFV 378
>gi|78185967|ref|YP_374010.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelodictyon luteolum DSM 273] >gi|123583631|sp|Q3B6R4|DXR_PELLD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|78165869|gb|ABB22967.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelodictyon luteolum DSM 273] (382 aa)
Score = 554, Expect = 7.8e-55, Identities = 137/350 (39%), Positives = 216/350 (61%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + G+TG+IG S+L+++ +  + +++VG +  ++     E I  F  ++V   SV+   +    + LL    P                  D++++A+VG +GL  T+ A+K   D+ALANKE+LVVAG L+ DL +  + R+ PVDSEHS+++ SL+ + +E ++ +I+T SGGPF    F ++       A+KHP W+MG KI+IDSA+MMNK  E+IEA++LFN   +KI V  H QSIIHSM+++ D   IA +  PDM+  I   LS  E   + I  L    +  LTF E D+ ++  +  A+D L+   R  P ++NAANE A+  F  NKI F  I E ++K + A E     +L++ +N +   R+
  S:     6 ILGSTGSIGLSTLDVVRQHPDRFKIVGLAEGHDVNMLAEQIREFNPSIV---SVRDAGSAELLKTLLGTDLPEICHGIEGAGTVAAAEGSDMVVSAIVGAAGLTPTVKAIKAGKDIALANKETLVVAGQLVSDLVKKHNVRLLPVDSEHSAIFQSLQGHRQEDVERIILTASGGPFRNSSFADMEKAGPEQALKHPQWSMGAKITIDSASMMNKGLEVIEAHWLFNMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGSPDMRAPIAYALSWPERCESGIKKLDLATIGTLTFEEPDMVRFPALRLAFDALK-AGRTYPAVLNAANEVAVAAFLNNKIGFTAIAETVDKTMQAHEAYTPVELEEYINADGWARR 375
>gi|46907543|ref|YP_013932.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes str. 4b F2365] >gi|47093941|ref|ZP_00231678.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes str. 4b H7858] >gi|153202158|ref|ZP_01943787.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes HPB2262] >gi|167014606|ref|ZP_02277139.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes FSL J1-194] >gi|167453945|ref|ZP_02320168.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes FSL J2-064] >gi|59797579|sp|Q720A5|DXR_LISMF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|46880811|gb|AAT04109.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes str. 4b F2365] >gi|47017679|gb|EAL08475.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes str. 4b H7858] >gi|133735441|gb|EBA37139.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes HPB2262] (380 aa)
Score = 554, Expect = 7.8e-55, Identities = 138/356 (38%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-------GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK+++ GATG+IG  +L II +  E +++V  SF  N E+   II  F   +V               P+VK  N +    E+    + D++LNA++G  GL  TL A++    +A+ANKE+LV AG L+    +  +  + PVDSEHS++  +L   N E I++L++T SGG F  K   +L  +   +A+KHPNWNMG K++IDSATM NK  E++EA++LF  +   I+V    +SIIHSM++F D S+IA +  PDM++ IQ  L+        YE K   I D S     L F ++D +++  +  AY+        +P ++NAANE A+  F   ++ F +I  ++E A+    +    DL  IL +++ TR YV
  S:     2 KKIILLGATGSIGTQTLAIIRENPEKFQIVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVILEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKLVLTASGGSFRDKTREQLSEVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYE-KEFRITDFS----ALHFEKVDYERFPALKLAYN-AGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISDPDLDTILQVDQETRAYV 376
>gi|170727614|ref|YP_001761640.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella woodyi ATCC 51908] >gi|169812961|gb|ACA87545.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella woodyi ATCC 51908] (395 aa)
Score = 553, Expect = 9.5e-55, Identities = 136/359 (37%), Positives = 219/359 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------------FSPSVKTKNTV--NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWL-IEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + +++ GATG+IG S+L +I    E Y +     N N +K + +  ++   +                SPS+K + T   +  E ++  +  D ++ A+VG +GL  TL A+K    + LANKESLV++G L IE++K+S + ++ PVDSEH++++ +L    ++           I  +++T SGGPF     + L  +  A A KHPNW+MG+KIS+DSA+MMNK  E IEA +LFN   +++KV  H QS+IHSM+++ D S IA +  PDM+  I   +S  +   + +  L F  +  L+F E D  ++  +  A D   NQ +    I+NAANE ++  F +NKIKF DI ++ E  +  +    +N + DIL L+  TR Y  ++
  S:     2 QSMVILGATGSIGASTLSVIASNPETYSVYALVANTNVDKMMALCEQYRPKVAHMVDEQAAKSLQERLSPSLKIEVTTGESQLESIVTSSCVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKESLVMSGRLFIEEMKKSGA-QVLPVDSEHNAIFQALPEPVQQEIGFCDLDEAGISHILLTGSGGPFLTSPLSSLPQMTPAQACKHPNWSMGRKISVDSASMMNKGLEYIEARWLFNASAEQLKVVIHPQSVIHSMVQYRDGSVIAQLGNPDMRTPIAHCMSYPQRINSGVEPLDFFKVGQLSFLEPDFTRFPCLALAIDAC-NQGQEATTILNAANEISVAAFLDNKIKFTDIAKVNETCLSQVAKQALNSIDDILALDVQTRTYASEW 391
>gi|47096942|ref|ZP_00234519.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes str. 1/2a F6854] >gi|153179388|ref|ZP_01932607.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes F6900] >gi|153183680|ref|ZP_01934497.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes J0161] >gi|47014702|gb|EAL05658.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes str. 1/2a F6854] >gi|126943332|gb|EBA21053.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes J0161] >gi|133732873|gb|EBA34571.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes F6900] (380 aa)
Score = 553, Expect = 1.1e-54, Identities = 138/356 (38%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-------GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK+++ GATG+IG  +L II +  E +++V  SF  N E+   II  F   +V               P+VK  N +    E+    + D++LNA++G  GL  TL A++    +A+ANKE+LV AG L+    +  +  + PVDSEHS++  +L   N E I++L++T SGG F  K   +L  +   +A+KHPNWNMG K++IDSATM NK  E++EA++LF  +   I+V    +SIIHSM++F D S+IA +  PDM++ IQ  L+        YE K   I D S     L F ++D +++  +  AY+        +P ++NAANE A+  F   ++ F +I  ++E A+    +    DL  IL +++ TR YV
  S:     2 KKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENPERIEKLVLTASGGSFRDKTREQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYE-KEFRITDFS----ALHFEKVDYERFPALKLAYN-AGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNPDLDTILQVDQETRAYV 376
>gi|16803357|ref|NP_464842.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Listeria monocytogenes EGD-e] >gi|21263516|sp|Q8Y7G4|DXR_LISMO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|16410733|emb|CAC99395.1| lmo1317 [Listeria monocytogenes] (380 aa)
Score = 551, Expect = 1.9e-54, Identities = 138/356 (38%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-------GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           KK+++ GATG+IG  +L II +  E +++V  SF  N E+   II  F   +V               P+VK  N +    E+    + D++LNA++G  GL  TL A++    +A+ANKE+LV AG L+    +  +  + PVDSEHS++  +L   N E I+++I+T SGG F  K   +L  +   +A+KHPNWNMG K++IDSATM NK  E++EA++LF  +   I+V    +SIIHSM++F D S+IA +  PDM++ IQ  L+        YE K   I D S     L F ++D +++  +  AY+        +P ++NAANE A+  F   ++ F +I  ++E A+    +    DL  IL +++ TR YV
  S:     2 KKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTRDRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIANKETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKIILTASGGSFRDKTREQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRESIIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYE-KEFRITDFS----ALHFEKVDYERFPALKLAYN-AGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNPDLDTILQVDQETRAYV 376
>gi|152975868|ref|YP_001375385.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024620|gb|ABS22390.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus subsp. cytotoxis NVH 391-98] (386 aa)
Score = 548, Expect = 4.5e-54, Identities = 136/355 (38%), Positives = 219/355 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL---SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + G+TG+IG S+L++I    E+++++G + N+N E   + I  F   +V               S ++K     N   E+    + +++L ++VG SGL  T+ ALK   D+A+ANKE+LV AG ++ DL   ++ R+ PVDSEHS+++  L   N++EI++LIIT SGG F +K   E+  +   DA+KHPNW MG K++IDSAT+MNK FE++EA +LFN   +K+ V  H +SIIHS+++F D S +A +  PDM++ IQ      +  +S    +N L   NL+  F + D  K+  +++AY+  +    A P ++NAANE A   + +N I F DI + I   + A +      L+ +L  +   R+Y
  S:     3 KYISILGSTGSIGTSALDVIANHPEHFQIIGLTANHNIELLEKQIEAFHPRIVCVGTKELATTLRQRISGNIKITYGPNGLIEVATHPDTNLVLTSVVGISGLLPTIEALKEKKDIAIANKETLVAAGHIVTDLANQNNCRLIPVDSEHSAIFQCLNGENSQEIEKLIITASGGAFREKTREEMAMLKVQDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFNIPYEKMDVLIHPESIIHSLVEFVDGSVMAQLGAPDMRIPIQYAFHYPTRLQSNYKKLNLLEVGNLH--FEKPDFKKFPCLYYAYEAGKLGGTA-PTVLNAANEIANARYLQNDISFFDIEKTIYSTLEAHDTIINPSLEAVLAADNWAREY 376
>gi|118580466|ref|YP_901716.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelobacter propionicus DSM 2379] >gi|166218270|sp|A1AQN8|DXR_PELPD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|118503176|gb|ABK99658.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelobacter propionicus DSM 2379] (386 aa)
Score = 547, Expect = 4.9e-54, Identities = 134/361 (37%), Positives = 213/361 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRF-------------PNALVFSPSVKTKNTVNSFEELLEKTNPD---IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYES-KTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           K++ + G+TG+IG S+LEI+    + + +   +   N E     I +F             P        ++ K  V   E L+E    D   +++ A+VG +GL  T  A++   D+ALANKE+LV AG L  ++  S   ++YPVDSEHS+++ SL+ + + +I ++I+T SGGPF      +L  +   DA+ HPNW+MG+KI+IDSATMMNK  E+IEA +LF+   +KI +  H QSIIHSM+++ D   IA + +PDMK  I   LS  E   T +          LTF + DL+K++ +  AY  + +   ++P +MNAANE A+  F E +I FL I  +IE+ + +    ++  + ++L  ++  R    D  +
  S:     2 KQLSILGSTGSIGVSTLEIVAAHPDRFRVSALTAGKNLELLARQIRQFSPRIAAVAAKEDVPRLAQLCDGLEVK-IVGGVEGLIEAATADETDMVVAAIVGAAGLVPTAAAIRAGKDIALANKETLVTAGHLFMEMVSSHGVKLYPVDSEHSAIFQSLEGHRSDDISKIILTASGGPFLNTSLEQLAGVTVGDALNHPNWSMGRKITIDSATMMNKGLEVIEARWLFDAPMEKIHINIHPQSIIHSMVEYIDGCVIAQLGMPDMKAPIAYALSYPERVATGIKPLDLTTLTGLTFFKPDLEKFRCLGLAYRAMAD-GESMPAVMNAANEIAVDAFLEGRIAFLQIARVIEETMDSHIPHDLKSIAEVLQADQWGRDTARDICR 382
>gi|45644746|gb|AAS73134.1| predicted 1-deoxy-d-xylulose-5-phosphate reductoisomerase [uncultured marine gamma proteobacterium EBAC20E09] (382 aa)
Score = 547, Expect = 5.1e-54, Identities = 140/329 (42%), Positives = 201/329 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVF--SPSVKTKNTVN----------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL--KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEK 340
           K +L+ GATG+IG S L +I   K  + L+G SFN+NY KA EIIN F    V+        KNT N          S E+L++ T  DII+ A  GF+GL    +A+     + LANKES+V  G LI  L +  SS I P+DSEH++++  L  +N   +++++IIT SGGPF     ++L N+    A+ HPNW MG K++IDSAT++NKC E+IEA YLFN ++   ++  H QSIIHS++ + D S I+ MS PDM++ I  GLS           L F +L L+F E   D+ K    A +   N+   +  + NAANE A+  F + +I F  I+E+I +
  S:     2 KNILLLGATGSIGKSVLSVISENKNKFNLMGISFNSNYSKAEEIINNFLPKYVYIDDHDCYVKNTTNNGCIFLNGDSSLEQLIKNTEIDIIICATSGFAGLKAASIAVTTGKKILLANKESIVAGGDLIIPLAKKHSSEIIPIDSEHNAIFQCLSGENGTDDVQKVIITASGGPFLNSSISDLKNVTLNQALNHPNWEMGNKVTIDSATLVNKCLELIEAKYLFNLEENIFELVVHPQSIIHSIVTYKDGSSISQMSSPDMRIPIANGLSDMNRVPISFEQLDFTSLKLSFHEFPNDRKKIQDIAREVC-NKGSNLGAVFNAANEIAVESFIKGQINFDKIYEVIYR 347
>gi|15603853|ref|NP_246927.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431443|sp|P57985|DXR_PASMU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|12722428|gb|AAK04072.1| Dxr [Pasteurella multocida subsp. multocida str. Pm70] (405 aa)
Score = 545, Expect = 9.4e-54, Identities = 141/354 (39%), Positives = 210/354 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSV-------------------KTKNTV----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           KK+++ G+TG+IG S+L +I    + Y++       N E        F   L F PS                    +++ TV     +  EL      D+++ A+VG +GL  TL A+K    + LANKE+LV  G L  D  R S +++ PVDSEH++++ SL    +            I ++++T SGGPF      +   I  A AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++ D S IA M  PDM+  I + ++ Y S+T   +  L F  LN LTF E D  ++  +  A D       A    MNAANE A+  F +NKIKF DI  + +  +  L+  +++ ++D+L ++K  R+
  S:     8 KKIVILGSTGSIGTSTLSVITHNPDKYQVFALVGGRNVELM------FQQCLTFQPSFAALDDDVAAKMLAEKLKAHQSQTTVLAGQQAICELAAHPEADMVMAAIVGAAGLLPTLSAVKAGKRVLLANKEALVTCGQLFIDAVRESQAQLLPVDSEHNAIFQSLPPEAQRQIGFCPLSELGISKIVLTGSGGPFRYTPLEQFEQITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAETMA-YPSRTVAGVEPLDFYQLNGLTFIEPDYQRYPCLKLAIDAFSAGQYAT-TAMNAANEIAVASFLDNKIKFTDIARLNQLVVSKLQPQKIHCIEDVLEVDKKARE 393
>gi|110639370|ref|YP_679579.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cytophaga hutchinsonii ATCC 33406] >gi|110282051|gb|ABG60237.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cytophaga hutchinsonii ATCC 33406] (391 aa)
Score = 544, Expect = 1.1e-53, Identities = 138/367 (37%), Positives = 214/367 (58%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRF-PNALVFSPS--------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFR 376
           +KK + + G+TG+IG  +LE+I   K+ + +   +  NN    +E    F PN +V                  +K    V +   ++E  + D++L ALVG++GL  T+ A+K    +ALANKE+LVVAG ++  L R     I PVDSEHS+++  L      EI+++I+T SGGPF   +  +L ++    A+KHPNW+MG KI+IDSA++MNK  E+IEA +LF  +  +I V  H QSIIHSM++F D S  A M +PDMKL IQ  L+  E   +      F     LTF + D + +  +  AYD L      +  I+NAANE A+  F +++I FL++ ++I + +  +    V  L D +  +  TR     +++ K +
  S:     5 QKKYIAILGSTGSIGTQALEVIRNNKDRFVVEVLTAENNAALLIEQAVEFRPNVVVIGNEGLYSNVQHALEPLDIKVYCGVKALASVVEMEDIDVVLTALVGYAGLIPTIHAIKAGKHIALANKETLVVAGDIVTALARQHRVAILPVDSEHSAIFQCLPGEGMNEIEKIILTASGGPFRGMKRADLEHVTKKQALKHPNWSMGAKITIDSASLMNKGLEVIEAKWLFGLEADQIDVVVHPQSIIHSMVQFQDGSIKAQMGLPDMKLPIQYALAFPERLKSDYPRFDFTQYPALTFDKPDTETFHNLSLAYDALRKGGN-MACILNAANEIAVEKFLQDEIAFLEMPDLIAECMAKVPYIVVPTLDDYIQTDTQTRALARAYTQVKVK 391
>gi|114331995|ref|YP_748217.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosomonas eutropha C91] >gi|122313300|sp|Q0AEI0|DXR_NITEC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|114309009|gb|ABI60252.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosomonas eutropha C91] (413 aa)
Score = 542, Expect = 1.9e-53, Identities = 125/354 (35%), Positives = 213/354 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVF-----SPSVKTK-----------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + G+TG+IG S+L+++ +  + ++ V  + + N EK  E   RF P+  V      +  ++ K           + + S E++      D ++ A+VG +G+  TL A +    + LANKE+LV+AG +  D  R   + + P+DSEH++++ SL  +      +  ++ +++T SGGPF+K +   L  +    A  HPNW MG+KIS+DSATMMNK  E+IEA++LFN   +KI+V  H QS+IHSM+++ D S +A +  PDM+  I   L   E   + +  +  F    L F   D +++  +  AY+ L ++   +P ++NAANE A+ +F   KI F  I  IIE  + +++  E+ DL+D+L  +   R+
  S:     5 RHLTILGSTGSIGESTLDVVARHPDRFQAVALTADKNVEKMFEQCKRFYPSYAVMLNAQSAEQLEAKLRVAGLGTMVLSGIESLEKVASLPEIDTVMAAIVGAAGIRPTLSAAQAGKHILLANKETLVMAGRIFMDTIRQYHATLLPIDSEHNAIFQSLPQHYNGDLISSGVRRILLTASGGPFHKADLQTLSTVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVEPEKIQVVVHPQSVIHSMVEYIDGSVLAQLGNPDMRTPIAHALGYPERIESGVQSMDIFKIAQLNFEAPDFERFPCLRLAYEAL-SKGGNMPAVLNAANEVAVEVFLAGKIPFTVIPAIIEHVMESIDRQEITDLEDVLAADLRARE 385
>gi|110601149|ref|ZP_01389348.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Geobacter sp. FRC-32] >gi|110548145|gb|EAT61372.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Geobacter sp. FRC-32] (384 aa)
Score = 542, Expect = 1.9e-53, Identities = 133/354 (37%), Positives = 217/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE------------------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG S+LEI+    E ++++  +   N +   E I+ F   LV   +VK +      E +L                    ++ ++++ A+VG +GL  T  A++   D+ALANKE+LV AG LI D+ ++   ++YPVDSEHS+++ SL+ + KE ++ +I+T SGGPF      +L  +   DA+ HPNW+MG+KI+IDSA+MMNK  E+IEA +LF+   +KI V  H QSIIHSM+++ D   +A M +PDMK  I   L+        +  L    L+ LTF   D+ ++  +  AY  +++   ++P +MNAANE A+  F   +IKF DI   IEK +       ++ ++D++ +++  R+
  S:     2 KNLTILGSTGSIGVSTLEIVAAHPEKFKIIALTAGENIDLLKEQIDAFAPQLV---AVKNEELALKLEGMLSCRKTAVMYGVEGMIAAATASDTNMVVAAIVGAAGLLPTSAAIEAGKDIALANKETLVTAGRLIMDMVKTRGVKLYPVDSEHSAVFQSLQGHRKEDVRRIILTASGGPFLNLSGEKLAQVTVKDALNHPNWSMGQKITIDSASMMNKGLEVIEASWLFDMPAEKISVNIHPQSIIHSMVEYNDGCVMAQMGIPDMKAPIAYALTYPGRVPTGVKPLDLTTLSGLTFFNPDVVRFPALQLAYRAMKD-GESMPTVMNAANEVAVAAFLSGRIKFTDIARSIEKTMDLHHPRSLSSIEDVIEIDQWGRE 375
>gi|88798263|ref|ZP_01113849.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Reinekea sp. MED297] >gi|88779039|gb|EAR10228.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Reinekea sp. MED297] (391 aa)
Score = 542, Expect = 2.0e-53, Identities = 123/359 (34%), Positives = 214/359 (59%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV---------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE--IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           M    + + + GATG+IG ++L++I +  E Y +   S ++N  +    ++RF   +V  P+ + +  +                +  ++   ++ D ++ A+VG +GL  ++ A +    L LANKESLVVAG L+ +  ++  + + P+DSEH++++  L     +  ++ +++T SGGPF      +L+++    AV HPNW+MG+KIS+DSAT+MNK  E+IEA +LF  +   I+V  H QS+IHSM+++ D S IA M  PDM+  I  GL+  E   +  + L+FN  L+L F + D +++  +  A +  +    A P I+NAANEE +  F E  I F DI  I E  +   E+ +V+ ++ +  +++  R+
  S:     1 MATSVQNITILGATGSIGQNTLDVIHRHPERYRVHALSGHSNMTQLARDVDRFAPDVVIVPTAERRKELLDRLSRPAPEIRTGEQALVDVAGSSDADAVMAAIVGAAGLESSIAAARAGRKLLLANKESLVVAGRLLMEAVQAGGATLLPIDSEHNAIFQCLPEGRVQSGVESVLLTASGGPFRDASMEQLIHVTPDQAVAHPNWSMGRKISVDSATLMNKGLELIEACWLFGLQPSDIEVVIHPQSVIHSMVRYVDGSVIAQMGAPDMRTPIAYGLAYPERIASGSDRLAFNELLSLNFDQPDRERFPCLRLAEEAFDAGGTA-PAILNAANEETVAAFLEGYIGFTDIGRINEAVLCETEHQQVHSVEQLRAVDQMARE 380
>gi|71066086|ref|YP_264813.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychrobacter arcticus 273-4] >gi|81170456|sp|Q4FRH9|DXR_PSYA2 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|71039071|gb|AAZ19379.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychrobacter arcticus 273-4] (402 aa)
Score = 540, Expect = 3.1e-53, Identities = 133/355 (37%), Positives = 216/355 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFE----------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL-----------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN---TEVNDLKDILNLNKNTRKY 366
           +++ V GATG+IG S+L I+  + + Y++   S  +  +K L +  +F    V  P+    +                      ++   +  D ++ A+VG +GL  TL A +    + LANKE+LV+AG ++ +  ++  + + P+DSEH++++  L             +N  +++L +T SGGPF ++ F ++   + A+AVKHPNW+MG+KIS+DSATMMNK  E+IEA +LF+    KI V  H QSIIHSM++++D S++A +  PDMK  I   LS  +   +    L    LN L F E DL K+  +  A + ++    A  II+NAANE A+  F  NKI+  DI +I E+A+  ++    TE  D+ +IL ++   R+Y
  S:     5 QRIAVLGATGSIGDSTLAILAAQPQYYDVYALSGYHRLDKLLALCQQFAPKRVGVPTTAVDDFAKRLSAAGLDIEVVGGDAGLVDIATDSQTDTVVAAIVGAAGLPSTLAAARAGKRILLANKEALVMAGQVMINAVKTHHATLLPLDSEHNAIFQCLPFAIQQDNTQIHRSNHGVRKLWLTASGGPFLQQSFTQMQQASVAEAVKHPNWSMGQKISVDSATMMNKGLELIEACHLFDLPENKINVVIHPQSIIHSMVEYSDGSFLAQLGSPDMKTPIAHALSYPDRIDSGSQPLDLFALNGLEFIEPDLQKFACLRLAREAMQAGTHAT-IILNAANEIAVSAFLNNKIRLTDIADINEQALNEIQVPLLTETADIDEILAIDNLARQY 393
>gi|121604666|ref|YP_981995.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Polaromonas naphthalenivorans CJ2] >gi|120593635|gb|ABM37074.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Polaromonas naphthalenivorans CJ2] (395 aa)
Score = 537, Expect = 6.9e-53, Identities = 127/359 (35%), Positives = 214/359 (59%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------PNALVFSPSVKTKN-------TVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           M  +K+++ V G+TG+IG S+L++I +  + +E+   S     +  L    +F          P+A + +  +K            ++ E +    + D ++ A+VG +GL   + A +    L LANKE+LVV G +     R+  +R+ P+DSEHS+++ SL ++     + ++++I+T SGGPF  +E   L ++   +A  HPNW MG+KIS+DSATMMNK  E+IEA YLF     +I+V  H QSIIHSM+++ D S +A +  PDM++ I  GL+  E  ++    L F NL N+TF   D  ++  +  A+D L+    +   ++NAANE A+  F + +I+F  I ++    + A+   +V D+  +L L+   R+
  S:     1 MTLQKQRITVLGSTGSIGVSTLDVIARHPDRFEVFALSAATQVDLMLAQCAKFKPRFAVMVSEPHARLLAEKIKANGLSAQVLYAQDALEMIASHDSVDAVMAAIVGAAGLSPCMAAARAGKRLLLANKEALVVGGDVFMQAVRAGGARLLPIDSEHSAIFQSLPDDQASWPQRVEKIILTASGGPFRTREPASLRHVTPDEACAHPNWVMGRKISVDSATMMNKALEVIEAKYLFGVTPAQIEVVIHPQSIIHSMVQYYDTSVVAQLGTPDMRVPIAYGLAWPERISSGAQALDFKNLANMTFEVPDEARFPGLRLAWDVLKAPVGSTA-VLNAANEIAVAAFLDGRIRFDHIHQVNHATLEAVSVFDVFDIDGLLALDAQARR 384
>gi|91202697|emb|CAJ72336.1| strongly similar to 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Candidatus Kuenenia stuttgartiensis] (380 aa)
Score = 537, Expect = 8.5e-53, Identities = 132/331 (39%), Positives = 204/331 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRF-PNALVFS--------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           K V + G+TG+IG ++L ++   K+++ + G S ++ +E        F P+ +  S                ++  +  N  +E++ K+  DI+++A+VG  GL   +  ++    LALANKE+LV+AG ++  L + +  +I PVDSEHS+++ +L++  + EI+ +IIT SGGPFY    + L ++  A A+KHP W MG+KI+IDSAT+MNK  EIIEA +LFN +  +I V  H QSIIHSM++F D S IA M +PDMK+ IQ  L+  E        L    + NLTF + D +K+  +   Y     +   I   +NAANE A+  F E KI+F +I   +EK I
  S:     2 KNVAILGSTGSIGKNALHVVRNLKDSFRVTGLSSHSQWEFLARQAEEFNPSHIALSDLQLAGKLKQHLSGKQIEVISGNNCLKEIVLKSEADIVVSAVVGAIGLSAAIATVQAGKILALANKEALVMAGNIVIPLAKKN--QILPVDSEHSAIFQALQSGRQNEIRRIIITASGGPFYDFPADTLADVTPAQALKHPTWRMGQKITIDSATLMNKALEIIEAKWLFNLEADQIDVVVHPQSIIHSMVEFCDGSVIAQMGMPDMKVPIQYALTFPERACLNAEPLDLPRIENLTFKKPDREKFPALKLGY-LAVREGGTIGATLNAANEVAVQAFLEKKIRFTEIASFVEKVI 350
>gi|152995307|ref|YP_001340142.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Marinomonas sp. MWYL1] >gi|150836231|gb|ABR70207.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Marinomonas sp. MWYL1] (394 aa)
Score = 536, Expect = 9.3e-53, Identities = 133/356 (37%), Positives = 208/356 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN--------SFE-------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYD--FLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           + + GATG+IG S+L+II +  + + L+  S N + +K  +I  RF    V   S + ++ +         SFE        +   +  D ++ A++GF+GL  TL  ++    + LANKESLV AG L  D        + P+DSEH+++Y SL       + +++ ++I+T SGGPF      E+  +    A KHPNW+MG+KISIDSA++MNK  E+IEA +LF+    ++ V  H +SIIHSM+ + D S IA M  PDMK+ I  G+S        +  LS  ++  L F   DL+++  +  A D  F+     A   ++NA NE A+  F + +I FLDI  + EK ++A +   VNDL D+   ++ +R    D
  S:     7 ICLLGATGSIGQSTLDIIAQHPDKFVLINASANESVDKMADICRRFKPQRVVMGSQRARDELAQKCHDLAISFEWGEEALDSIASDSAVDQVMAAIMGFAGLKPTLAGIRAGKKILLANKESLVTAGKLFMDEVARHDVMLLPIDSEHNAIYQSLPQTARGAHKQDVSKVILTASGGPFRSWSLGEMATVTPEQACKHPNWSMGQKISIDSASLMNKGLELIEACWLFDITPNQVDVVVHPESIIHSMVSYLDGSVIAQMGNPDMKIPIAYGMSWPNRIETNVPPLSLIDIARLNFEAPDLNRFPNLRLAADAWFMGGTAMA---VLNATNEIAVAAFLKREIGFLDIARLNEKVLMAADIVAVNDLDDVFEADRYSRHLALD 386
>gi|89098605|ref|ZP_01171487.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus sp. NRRL B-14911] >gi|89086567|gb|EAR65686.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus sp. NRRL B-14911] (380 aa)
Score = 536, Expect = 1.1e-52, Identities = 140/356 (39%), Positives = 219/356 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLT------FSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND---LKDILNLNKNTRKYV 367
           K + + GATG+IG  +L++I +  E + L   S   N E   +I++ F   LV +             P +K         E       D+++NA++G  GL  TL A++    +A+ANKE+LV AG ++ D  R +   + PVDSEHS+++ +L+    K I +LI+T SGG F  K   EL ++    A+ HPNW+MG KI+IDSATMMNK  E+IEA++LF+   +KI+V  H +SIIHSM++F D+S IA +  PDM++ IQ  L+ Y  +   +   +   LNL       F E+D  +++ + +A+D    +   +P ++NAANE A+  F E KI FL I +++EK   A+E   V+D   L++I  +++ TR+ V
  S:     2 KYISLMGATGSIGTQTLDVIREHPEQFRLASMSIGRNLELGRKIMSEFKPELVAAAEKNDADTLAGEFPGIKFAYGQEGLIETAVHPKADVLVNAVLGSVGLQPTLQAIEAKKTIAIANKETLVTAGHIVMDAARRNGVELLPVDSEHSAIFQALQGEKEKNIDKLILTASGGSFRDKTREELKDVTVEQALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFSIAYEKIEVLLHKESIIHSMVEFHDSSVIAQLGTPDMRVPIQYALT-YPDR---LPHRTGKKLNLAEIGQLHFQEMDYSRFRCLQFAFD-AGRRGGTLPAVLNAANEAAVAAFLEGKITFLQIEDLVEK---AMEKHAVSDNPGLEEIQEVDRQTRQLV 376
>gi|91792917|ref|YP_562568.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella denitrificans OS217] >gi|91714919|gb|ABE54845.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella denitrificans OS217] (401 aa)
Score = 535, Expect = 1.2e-52, Identities = 136/367 (37%), Positives = 209/367 (56%)
  Q:     2 LEGEKMENKKKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALE-------IINRFPN---------ALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVY 368
           +  E M+N    V++ GATG+IG S+L ++  + + Y + G   N N +K L        +I    N         AL     V      N+  +L+       ++ A+VG +GL  T  A+K    + LANKE+LV++G L  D  R S + + PVDSEH++++  L  + +            +  +++T SGGPF       L ++  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT   ++KV  H QS+IHSM+++ D S +A M  PDM+  I   LS  +  T+ +  L F  L +L+F E D+ ++  +H A    E+   A   ++NAANE A+  F   +I F  I  I E  +  +  + +  + DIL L+  TR++ +
  S:     1 MPSESMQN----VVILGATGSIGASTLSVMSAQTQRYRVYGLVANTNVDKMLALCLAHKPVIAHMVNEQAAMTLKAALPPHIGVTVTTGENALIDLVTSNQIHTVMAAIVGAAGLLSTFAAVKAGKRVLLANKEALVMSGALFMDACRQSGATLLPVDSEHNAIFQCLPESVQTNLGHCSLDAAGVSSILLTGSGGPFLTAPLESLASVTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTNAAQLKVVVHPQSVIHSMVQYRDGSVLAQMGNPDMRTPIAHCLSYPQRITSGVEALDFFKLGDLSFCEADIARFPCLHLAMQACEHGQEAT-TVLNAANEVAVDAFLAGQIGFTQIAAINESCLAQVSQSSLKSIDDILQLDSLTRQHAW 394
>gi|152976187|ref|YP_001375704.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024939|gb|ABS22709.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus cereus subsp. cytotoxis NVH 391-98] (380 aa)
Score = 534, Expect = 1.8e-52, Identities = 135/358 (37%), Positives = 216/358 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV----------FSPSVKTKNTVNSFEELLE---KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K + + GA+G+IG  +L+++    + + LV FS   N + A+++I  F   LV                    V+  E LLE       ++++NA+VG  GL  TL A++    + +ANKE+LV AG ++ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI++DSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F ++D ++++ + +AY+       ++P +MNAANE A+  F + KI FL + ++IEKA+          L++I  ++  TR++V +
  S:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPELVSVQREDDVIKLQAIAGNTKVVHGNEGLLEVALHPRAEVVINAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHIVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITVDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLADTKQLNLWEIGTLHFEKMDQNRFRCLRFAYE-AGKMGGSMPAVMNAANEVAVAAFLQKKIGFLTVEDLIEKAMHHHNVIARPSLEEIQEIDAATRRFVME 378
>gi|89209768|ref|ZP_01188163.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Halothermothrix orenii H 168] >gi|89160837|gb|EAR80490.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Halothermothrix orenii H 168] (384 aa)
Score = 533, Expect = 2.0e-52, Identities = 141/354 (39%), Positives = 216/354 (61%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNN--------------------NYEKALEIINRFPN--ALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           KKK++V G+TG+IG  +LE++   ++ +E++  S N                     N   ALE+ +R  +  + V S  ++   T++S EE       D+++NALVG  GL  T+ AL++   L LANKESLV+ G +I+    +   R+ PVDSEH++++  L  +N+KE++ LI+T SGGPF +       +++  DA+KHPNW+MG KI+IDSAT+MNK  E+IEA+YLF      I V  H +SIIHSM++F D S IA M   DM++ IQ  L+      +L   L    L  LTF + D  K+  +  AY+    Q   +P+++NAANE A+  F   KI F  I  +IE+ +   +     DL+D++ ++   R
  S:     2 KKKLVVLGSTGSIGTQTLEVLSHLEDQWEILALSANKSTGLIEKQARKFKPRYLVMMNERAALELKHRLSDMSSEVLS-GMEGLITISSLEE------ADLVINALVGAVGLKPTVAALQSGNTLGLANKESLVIGGEIIKSY-LNEEGRVLPVDSEHNAIFQLLNGHNDKEVERLILTASGGPFLELPRERFKDVSVKDALKHPNWDMGGKITIDSATLMNKGLEVIEAHYLFRQPYHNINVVVHPESIIHSMVEFVDKSVIAEMGSADMRMPIQYVLTYPRKVKSLAKRLDLTELGYLTFKKPDTVKFPALKLAYE-AGQQGGTMPVVLNAANEIAVSAFMNEKITFDKIPVVIERVMENHQIISSPDLEDVIEVDNWAR 374
>gi|46143603|ref|ZP_00134846.2| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (398 aa)
Score = 532, Expect = 2.7e-52, Identities = 141/354 (39%), Positives = 212/354 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSP---SVKTKNTVNSFEELLEKTNP--------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNLN-LTFSEIDLDKWKPIHWAYD-FLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           KK+++ G+TG+IG S+L ++E  K  YE+ G     N E            L+F P   ++  +N   + EE L + N                     D+++ A+VG +GL  TL A+K    + LANKESLV  G +  D  R S +++ PVDSEH++++ SL  + ++           + ++I+T SGGPF  K  +E   I  A AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   +++++  H QSIIHSM+++ D S IA M  PDM   I   ++ Y  + N  +  L F  L  LTF E D  ++  +  A D F E Q       MNAANE A+  F   +I+F+DI  +    +  +   +V ++ D+L+++K  R+
  S:     4 KKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMA------AQCLLFQPKFAALDDENAAKALEEQLRQLNVKTEVLSGQKAICELSAHPEVDMVMAAIVGAAGLLPTLSAVKAGKKVLLANKESLVTCGQIFIDEARKSGAQLLPVDSEHNAIFQSLPPDAQQKVGFCPLAELGVSKIILTGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMCTPIAHTMA-YPKRINAGVAPLDFFKLKELTFIEPDFARYPNLKLAIDAFAEGQYATTA--MNAANEVAVEAFLNERIRFIDIVNVNRTVVENIAPVQVKEIADVLHIDKLARE 389
>gi|19704659|ref|NP_604221.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714965|gb|AAL95520.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (390 aa)
Score = 532, Expect = 2.8e-52, Identities = 157/358 (43%), Positives = 222/358 (62%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV--------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDL-KRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS----GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI----IALENTEVNDLKDILNLNKNTRKYV 367
           K KK+L+ G+TG+IG ++LE+I   +E Y++VG S N N +   + I  F    ++  S +    +              N   EL + ++ DIIL A+ G  G+  T+ A+K    +ALANKE++V AG  I  L K    + I PVDSEHS+L+ SL+   KE +K+LIIT SGG F  K+   L N+    A+KHPNW+MGKKI+IDS+T++NK  E+IEA+ LFN     I+V  H QS+IHSM+++ D S IA M V +MK  I    +     Y S  N + DL  NN NLTF E D    K I  AY      +  +P + NA+NE A+ LF + +IKFLDI+ IIE+A+    +   NT+ N L  I  +++  RK V
  S:     3 KMKKILILGSTGSIGTNALELIRNNREQYQVVGISGNKNIDLLKKQIEEFKPISIYVGSEQDAIYLKKEYSFIKEVYFGENGLAELSKNSDYDIILTAVSGAIGIDATVEAIKRGKRIALANKETMVSAGVYINKLLKEYPKAEIVPVDSEHSALFQSLQGFKKENLKKLIITASGGTFRGKDLAYLENVTVEQALKHPNWSMGKKITIDSSTLVNKGLEVIEAHELFNVDYDDIEVVIHPQSVIHSMVEYVDGSIIAQMGVANMKTPILYAFTYPEKEYNSSINFL-DLIKNN-NLTFEEADRKVLKGIDLAYRAGRTGD-TMPTVFNASNEIAVELFMKKQIKFLDIYRIIEEAMNSHQVLTLNTD-NALNVIKEVDREIRKKV 384
>gi|93006534|ref|YP_580971.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychrobacter cryohalolentis K5] >gi|122415112|sp|Q1QA16|DXR_PSYCK 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|92394212|gb|ABE75487.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychrobacter cryohalolentis K5] (402 aa)
Score = 531, Expect = 3.9e-52, Identities = 132/355 (37%), Positives = 218/355 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEE----------------LLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL-----KNN------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN---TEVNDLKDILNLNKNTRKY 366
           +++ V GATG+IG S+L I+  + ++Y++   S  +  +K L +  +F    V  P+           E                +   +  D ++ A+VG +GL  TL A +    + LANKE+LV+AG ++ +  ++  + + P+DSEH++++  L     ++N      N  +++L +T SGGPF ++ F ++   + A+AVKHPNW+MG+KIS+DSATMMNK  E+IEA +LF+    KI V  H QSIIHSM++++D S++A +  PDMK  I   LS  +   +    L    L+ L F E DL K+  +  A + ++    A  II+NAANE A+  F  N+I+  DI +I E+A+  ++    TE  D+ +IL ++   R++
  S:     5 QRIAVLGATGSIGDSTLAILAAQPQHYDVYALSGYHRLDKLLALCQQFAPKRVGVPTAAVDEFAKRLSEAGLDIEVVGGETGLVDIATDSQTDTVVAAIVGAAGLPSTLAAARAGKRILLANKEALVMAGQVMINAVKTHHATLLPLDSEHNAIFQCLPFAIQQDNTQIHRLNHGVRKLWLTASGGPFLQQSFTQMQQASVAEAVKHPNWSMGQKISVDSATMMNKGLELIEACHLFDLPENKINVVIHPQSIIHSMVEYSDGSFLAQLGSPDMKTPIAHALSYPDRIDSGSQPLDLFALSGLEFIEPDLQKFACLRLAREAMQTGTHAT-IILNAANEIAVSAFLNNQIRLTDIADINEQALNEIQVSALTETADIDEILAIDNLARQH 393
>gi|160880754|ref|YP_001559722.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium phytofermentans ISDg] >gi|189027755|sp|A9KMX2|DXR_CLOPH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|160429420|gb|ABX42983.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Clostridium phytofermentans ISDg] (388 aa)
Score = 530, Expect = 4.6e-52, Identities = 138/359 (38%), Positives = 214/359 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK-ENYELVGFSFNNNYEKALEIINRFPNALVF----SPSVKTKNTVNSFEELLE-----------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLIND-LSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           K + V G+TG+IG  +LE++   ++ ++   + ++N     E I  F   LV       +++ K  V+  E  +E           + + DI+++A+VG  G+   + A+    D+A ANKE+LV AG LI  L +  +  + PVDSEHS+++  L+ N +  +  +I+T SGGPF  K   EL N+   DA+KHPNW+MG+KI+IDSATM+NK  E++EA++LF+    KI+V    QSIIHS ++F D   IA +  PDMKL IQ  L   E +  L    L F ++  +TF + D+     +  AY+ + N   ++P + NAANE A+  F   +I FL I  +IEKA+  +   +   L +ILN+ + T    YDF
  S:     2 KIISVLGSTGSIGTQTLEVVRNNKDLKVSALAASSNITLLEEQIREFHPKLVCVYDREKALELKKRVSDLEVTVEAGMDGLIACATEESADIVVSAVVGMIGIKPVMEAILRGKDIAFANKETLVTAGHLIMPLVKKHNVNLLPVDSEHSAIFQCLQGNESSTVSRIILTASGGPFRGKSLAELKNVKVEDALKHPNWSMGRKITIDSATMVNKGLEVMEAHWLFHEPLNKIEVVIQPQSIIHSAVEFEDGGIIAQLGTPDMKLPIQYALYYPEKRRYLPGKRLDFFDIAKITFEKPDISNLPGLRLAYEAM-NTGHSVPTVFNAANELAVAKFLNREISFLSITALIEKAMENVTVVKRPTLDEILNVEQET----YDF 376
>gi|81175169|sp|Q8R622|DXR_FUSNN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (387 aa)
Score = 530, Expect = 5.1e-52, Identities = 156/356 (43%), Positives = 221/356 (62%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV--------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDL-KRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS----GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI----IALENTEVNDLKDILNLNKNTRKYV 367
           KK+L+ G+TG+IG ++LE+I   +E Y++VG S N N +   + I  F    ++  S +    +              N   EL + ++ DIIL A+ G  G+  T+ A+K    +ALANKE++V AG  I  L K    + I PVDSEHS+L+ SL+   KE +K+LIIT SGG F  K+   L N+    A+KHPNW+MGKKI+IDS+T++NK  E+IEA+ LFN     I+V  H QS+IHSM+++ D S IA M V +MK  I    +     Y S  N + DL  NN NLTF E D    K I  AY      +  +P + NA+NE A+ LF + +IKFLDI+ IIE+A+    +   NT+ N L  I  +++  RK V
  S:     2 KKILILGSTGSIGTNALELIRNNREQYQVVGISGNKNIDLLKKQIEEFKPISIYVGSEQDAIYLKKEYSFIKEVYFGENGLAELSKNSDYDIILTAVSGAIGIDATVEAIKRGKRIALANKETMVSAGVYINKLLKEYPKAEIVPVDSEHSALFQSLQGFKKENLKKLIITASGGTFRGKDLAYLENVTVEQALKHPNWSMGKKITIDSSTLVNKGLEVIEAHELFNVDYDDIEVVIHPQSVIHSMVEYVDGSIIAQMGVANMKTPILYAFTYPEKEYNSSINFL-DLIKNN-NLTFEEADRKVLKGIDLAYRAGRTGD-TMPTVFNASNEIAVELFMKKQIKFLDIYRIIEEAMNSHQVLTLNTD-NALNVIKEVDREIRKKV 381
>gi|42527843|ref|NP_972941.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Treponema denticola ATCC 35405] >gi|59797596|sp|Q73K78|DXR_TREDE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|41818671|gb|AAS12860.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Treponema denticola ATCC 35405] (381 aa)
Score = 529, Expect = 5.8e-52, Identities = 133/332 (40%), Positives = 198/332 (59%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEE-----LLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +K+V+V GA G+IG +SLEII +  + +EL GFS ++N   A  ++  F +A   S   K  N  +  +E     L+EK+  DI++N + G +GL  ++  +K+ +DLALANKE++V AG LI      S S I PVDSEH++++  +  + K  I+++IIT SGGPF      +L  I   DA+KHP W MG KISIDSA++ NK  E+IEA  LF+   +KI+V  H QSIIHSM++  +    A  S PDMK  I   LS  +   + +  L F+  + L F     D +  +   ++    +  A PI  N ANEEA+  F + KI F D+ +I ++ +
  S:     3 RKRVVVLGAGGSIGKNSLEIIRRFPDRFELAGFSVHSNSGFAKTLLAEFTDAQFVSTKKKNSNLKHEIDEEAVRRLIEKSKADIVINGIAGSAGLKASVEVIKSGLDLALANKETIVEAGELIFQDAEKSGSTIIPVDSEHAAIFQLINAHKKGNIEKIIITASGGPFLNTPREKLSTIKLEDALKHPTWKMGGKISIDSASLANKALEVIEAVKLFSFPPEKIEVTVHPQSIIHSMVQCKNGEIFAQASPPDMKNPILNALSFPKMPESFLKPLDFSQIIKLEFMPPRTDDFPMLALGFE-AAGKGGAYPIAFNVANEEAVDAFIKGKIGFTDLADITQEVL 344
>gi|94986830|ref|YP_594763.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lawsonia intracellularis PHE/MN1-00] >gi|166218266|sp|Q1MRD4|DXR_LAWIP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|94731079|emb|CAJ54442.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lawsonia intracellularis PHE/MN1-00] (402 aa)
Score = 529, Expect = 6.0e-52, Identities = 137/356 (38%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEK-ALEIINRFPNALV-----------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           + + + G+TG+IG ++L++I+  KE + +V      N +  A + I   P+ L                  + PS+        + +L        +L+A VG +GLH T+ A KN   + LANKE+LV+AG LI++L   S + I PVDSEH++++ +L   N K ++ +I+T SGGPF  K++  L N+    A+ HPNW MG KIS+DSATM+NK  EIIEA+YL+   +++IK+  H QS +HS+++FTD+S +A++   DM++ I   L+        +     + +  LTF E DLD +  I+ A D L     A  II+NAANE A+  F + +I F+DI  +I KA+ A    E   L+ I  L++ TR  +
  S:    19 RTISILGSTGSIGTNALDVIKSHKELFHIVALGGGKNVQLLAKQAIQWKPDYLAVQDETSKEALIPLLPINYKPSIFVGQ--QGYVKLASLPEVTTVLSAQVGAAGLHGTVAAAKNGKVICLANKETLVLAGKLIKNLCLQSGAVILPVDSEHNAIFQALYTRNPKTVQNIILTASGGPFRNKKYEFLKNVTPEQAINHPNWKMGTKISVDSATMINKGLEIIEAHYLYGLPSEQIKIVVHPQSYVHSLVEFTDHSLMAHLGTADMRMPIAHCLAWPNYLNVGVEPFVLSKIGTLTFEEPDLDSFPCINLARDALVAGTSA-QIILNAANEVAVDAFLKKQIGFMDIPILISKALEADSTPEPTTLESIEALDQQTRHTI 395
>gi|147677595|ref|YP_001211810.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelotomaculum thermopropionicum SI] >gi|189027757|sp|A5D2U3|DXR_PELTS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|146273692|dbj|BAF59441.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pelotomaculum thermopropionicum SI] (387 aa)
Score = 529, Expect = 6.2e-52, Identities = 129/353 (36%), Positives = 205/353 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTV---------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL-KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K +++ G+TG+IG  +LE+I    + +++VG     N+    E I  F P+A+  +   +  N                    E L      D+++ A+ GF+G++ T+ A++   D+ALANKE+LV AG L+  +     + I PVDSEHS+++  L   N+ E++++I+T SGGPF +    +L  +    A+KHPNWNMG KI+IDSAT+MNK  E+IEA +LF  N  +I+V  H QSI+HS ++F D S IA M +PDM+L IQ  L+  E        L   +L  LTF E D  ++  +  A++        +P ++NAANE A+  F +  + FL I  ++   +   E      L++I+  ++  R
  S:     2 KNIVLIGSTGSIGRQTLEVIGSLPDRFKVVGLGSGKNWRLMAEQIRVFRPSAVAMAGEREIMNLKELLAGSYCPELGWGRTGMESLASMPEADLVVVAVTGFAGIYPTIAAIQAGKDVALANKETLVAAGHLVMKMAERHRAAILPVDSEHSAVWQCLCGRNSGEVEKIILTASGGPFREMCLEKLEKVTVDMALKHPNWNMGSKITIDSATLMNKGLEVIEAKWLFGLNYSQIEVVIHPQSIVHSAVEFLDGSVIAQMGLPDMRLPIQYALTYPERLPGSFPKLKLASLQGLTFEEPDTRRFPCLSLAFE-AGLAGGTMPAVLNAANEVAVEFFLKGLLPFLGIPSVVRSVMEKHEMASDPGLEEIIEADRWAR 375
>gi|51245012|ref|YP_064896.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfotalea psychrophila LSv54] >gi|59797537|sp|Q6AP35|DXR_DESPS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|50876049|emb|CAG35889.1| probable 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfotalea psychrophila LSv54] (385 aa)
Score = 528, Expect = 7.7e-52, Identities = 133/354 (37%), Positives = 210/354 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV-----------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLIND-LSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           KK+ + GATG+IG S LE++ K  + Y +V  +   N +     I  F   LV                 F   +   N  N  EE+    +  I ++A+VG +GL  TL A++   D+ LANKE+LV+AG ++ +  R     + PVDSEHS+++ +L    + ++ ++I+T SGGPF+ +   EL  +  A A+ HPNW+MG+K+SIDSAT+MNK  E+IEA +LF+   + I+V  H QSI+HS++++ D S IA + V DM + I   LS Y ++  L +  LS  +   L F   D + +  +  A++ L     A P  +NAANE A+  F + KI+FLDI  ++   +  +   + N L DIL  ++ +R+
  S:     2 KKISLLGATGSIGTSVLEVVRKFSDQYRIVAMAAGRNIDLFARQIEEFSPDLVSVLDEEYAHCLQERLGGFRGKILWGNAGN--EEVAAYPSASITISAIVGAAGLLPTLAAIEAGKDIGLANKETLVMAGKIVMERARRKGVALLPVDSEHSAIFQALHAGKRADLAKIILTASGGPFHGRTAAELAQVTPAQALAHPNWSMGRKVSIDSATLMNKGLEVIEAKWLFDVEPENIEVVVHPQSIVHSLVEYHDGSLIAQLGVADMCIPIAYALS-YPNRLPLGHKRLSLTDCACLDFIRPDTENFPALPLAFEALRRGGVA-PAALNAANEIAVAAFLDGKIRFLDIARLVTDTVDVVSPGDENKLDDILAADRESRE 375
>gi|78356170|ref|YP_387619.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|123552887|sp|Q313H2|DXR_DESDG 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|78218575|gb|ABB37924.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfovibrio desulfuricans G20] (407 aa)
Score = 526, Expect = 1.5e-51, Identities = 131/360 (36%), Positives = 214/360 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYE--------------------KALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKD----ILNLNKNTRKYVYDFS 371
           + +++ G+TG+IG S+L ++E+  E + +   +   N                       A E+ +  P    + P + T      +E L      D +L+A VG +GL  T+ A +    +ALANKESLV+AG LI  L   + + + PVDSEH++++ +L+ ++  +++ +I+T SGGPF  ++   L ++    A+ HPNW+MG KISIDSAT+MNK  E+IEA +L+N   +K++V  H QSIIHS++++ D S IA+M  PDM+++I   L         +  L   ++ +LTF   D+  +  +  A       N  +P+++NAANE A+ LF +  I FLDI  +IE A+ A +     ++ D    IL L+K TR+   D +
  S:    19 RSLVLLGSTGSIGTSALRVVERQPELFRITALAGARNVRLLARQAAAYRPPHLAVINGNAADELASLLPAG--YRPRIHTGQ--EGYEFLAALPEADCVLSAQVGAAGLRATVAAARAGKTIALANKESLVLAGGLIRRLCHETGASVLPVDSEHNAIFQALQGHDAAQMRRIILTASGGPFRGRDRTFLQSVTREQALNHPNWSMGAKISIDSATLMNKGLEVIEACHLYNAPLEKVEVVVHPQSIIHSLVEYNDGSQIAHMGTPDMRIAIAYCLGWPRVMHTGVEPLDLLSVGSLTFESPDISLFPCLELARKAYAGGN-GLPVVLNAANEVAVDLFLQGAIAFLDIPRLIEAAMQAHDAAPHQNMYDEVESILTLDKTTRRVTADLA 403
>gi|87118620|ref|ZP_01074519.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Marinomonas sp. MED121] >gi|86166254|gb|EAQ67520.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Marinomonas sp. MED121] (391 aa)
Score = 525, Expect = 1.9e-51, Identities = 130/363 (35%), Positives = 208/363 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV---------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-----NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNK 374
           + + + GATG+IG S+L++I +  + + LV  + N + E+ +EI + F    V     K+++ V               ++   +      D ++ A+VGF+GL  TL A++    + LANKESLV AG L  D     +  + P+DSEH+++Y  L  N      + ++++++T SGGPF    + ++L +    A KHPNW+MG+KIS+DSA+MMNK  E+IEA +LF  +   I+V  H QSI+HSM+ + D S IA M  PDMK+ I  G++  +  T  +  L  F    L FS+ D++++  +  A D       A+   +NAANE A+  F +N I FLDI +I  + +       V+DL  +   +   R+   D    K
  S:     2 QNICLLGATGSIGTSTLDLIRQHPDRFNLVSVAANTSVERMVEICHAFKPETVVMGDEKSRDAVAEACLGLSIQFDFGADAMSAVAADAKVDQVVAAIVGFAGLTSTLAAIRAGKRILLANKESLVTAGQLFMDEVAKYNVTLMPIDSEHNAIYQCLPQNERGAVKRSVEKILLTASGGPFRDFSYEQMLAVTPEQACKHPNWSMGRKISVDSASMMNKGLELIEACWLFAVEPDDIEVVVHPQSIVHSMVSYDDGSVIAQMGNPDMKVPIAYGMTWPDRVTTQVKPLDLFEVSRLDFSQPDMERFPNLQLAADAWYIGGTAMA-SLNAANEIAVDAFLKNNIGFLDIAKINSEVLEQTAVFPVSDLDAVFEADNMARQKAKDIINTK 388
>gi|158320551|ref|YP_001513058.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alkaliphilus oremlandii OhILAs] >gi|166920128|sp|A8MHH5|DXR_ALKOO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|158140750|gb|ABW19062.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alkaliphilus oremlandii OhILAs] (381 aa)
Score = 523, Expect = 3.3e-51, Identities = 133/356 (37%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------PNALVFSPSVKTK-NTVNSFEELLEKT---NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K + + G+TG+IG  +L+++    E +++V  S + N +     I+ F            A + S  +  K   V+  E L+E     + DI++ ++VG  GL  T+ A++    +ALANKE+LVVAG LI+        +I PVDSEHS+++  L+  +   I  +I+T SGG F   E  ++ +    DA+KHP WNMG K++IDSA++MNK  E++EA +LFN +  KI V  H QSI+HSM+++ D S IA +  PDM+  IQ  LS      + I  L F  ++ LTF   D DK+  +  AY+ L+   + +P ++N ANE  +  F E++I F DI + IEKA+ A +     D++++L +++  R ++
  S:     2 KNISILGSTGSIGTQTLDVVRNHPEKFKIVALSASGNIDAIENQIHEFHPEIVAVFHREKAEILSARIGKKVKVVSGIEGLIEVATLDSADIVVTSVVGSIGLIPTVEAIRCGKTIALANKETLVVAGELIKKEAEKHKVQIIPVDSEHSAIFQCLQGEDIHNISRIILTASGGAFRNWEKQDIQHAKAQDALKHPTWNMGSKVTIDSASLMNKGLEVMEARWLFNVELDKIDVIVHPQSIVHSMVEYNDFSIIAQIGAPDMRGPIQYALSYPNRINSSIERLDFRKISALTFMAPDTDKFPCLSLAYESLK-IGKTMPCVLNGANEVLVEYFLEDRIGFYDIPKFIEKAMSAHKPWVYTDIEELLEVDRWVRNWI 376
>gi|34541050|ref|NP_905529.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Porphyromonas gingivalis W83] >gi|188995015|ref|YP_001929267.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Porphyromonas gingivalis ATCC 33277] >gi|39930821|sp|Q7MUW3|DXR_PORGI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|34397365|gb|AAQ66428.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Porphyromonas gingivalis W83] >gi|188594695|dbj|BAG33670.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Porphyromonas gingivalis ATCC 33277] (385 aa)
Score = 522, Expect = 4.0e-51, Identities = 132/355 (37%), Positives = 210/355 (59%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEK------------TNPDI--ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLD----IFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           KK + + G+TG+IG  +L+II    + +++   + NNN +  +     + P  +V +   K      +  +L  K            T PDI  ++ A+VG+SGL  T+ A++    +ALANKE+LVVAG LI  L + +   I PVDSEHS+++ +L    +  +++++T SGGPF      EL +     A++HPNWNMG K++IDSA++MNK FE+IEA +LF  +  +I++  H QSIIHSM++F D S  A + +PDM+L I   L       N    + F    LTF   DL+++  + +A+D +     A P  +NAANE A+  F  ++I F D    ++E++EK  +  E +    L   +  + NTR+
  S:     2 KKNIAILGSTGSIGTQTLDIIHLNPDLFDVYLLTANNNVDLLIRQAREYRPEIVVIANDQKYHLIQEALADLPIKVWCGAEAIADAVTAPDIDMVVTAMVGYSGLLPTIKAIEARKMIALANKETLVVAGELIMRLAQDNQVPILPVDSEHSAIFQALLGERQRPEKILLTASGGPFLHLTAEELQHATREQALRHPNWNMGAKVTIDSASLMNKGFEMIEAKWLFEMQPDEIEILVHPQSIIHSMVQFRDGSVKAQLGIPDMRLPISYALGITHRIPNDYPRVDFTATPLTFERPDLERFPNLSYAFDAIRLGGNA-PCALNAANEIAVTAFLRDEISFTDMSRLLYEVMEKHELFREVS----LPTFIETDSNTRR 374
>gi|16078718|ref|NP_389537.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus subtilis subsp. subtilis str. 168] >gi|3913544|sp|O31753|DXR_BACSU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|2634027|emb|CAB13528.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Bacillus subtilis subsp. subtilis str. 168] (388 aa)
Score = 522, Expect = 4.3e-51, Identities = 136/331 (41%), Positives = 205/331 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKT----KNTVNSFE-----------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           K + + GATG+IG  +L+++   ++ ++LV  SF  N +KA+ +I  F    V    + T    K    SFE           E       DI++NAL+G  GL  TL A++    +ALANKE+LV AG ++++  +     + PVDSEHS+++ +L+    K I+ LIIT SGG F  K   EL ++   DA+KHPNW+MG KI+IDSATMMNK  E+IEA++LF+   ++I V  H +SIIHSM++F D S IA +  PDM++ IQ  L+ Y  +  L +          +L F + D D+++ + +A++        +P ++NAANE A+  F   KI FL I + IEKA+
  S:     2 KNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLDTYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIALANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRDKTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHKESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALT-YPDRLPLPDAKRLELWEIGSLHFEKADFDRFRCLQFAFES-GKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKAL 353
>gi|67921900|ref|ZP_00515416.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera watsonii WH 8501] >gi|67856116|gb|EAM51359.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Crocosphaera watsonii WH 8501] (398 aa)
Score = 522, Expect = 4.5e-51, Identities = 130/356 (36%), Positives = 214/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFE--------------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL----NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL--ENTEVNDLKDILNLNKNTRKYV 367
           KK+ + G+TG+IG  +L+I+ +  E +++VG +  +N +     + +F   +V   +++ +N + + +                    E+    + + ++  +VG +GL  T+ A++   D+ALANKE+L+  G ++  L      ++ P DSEHS+++  L+   ++ ++ +I+T SGG F      +L  +   DA+KHPNW+MG+KI++DSAT+MNK  E+IEA++LF  + K I +  H QSIIHS+I+  D S +A +  PDM+L +   LS  E    +  D    +L    +LTF E D DK+  +  AY   E    A+  ++NAANE+A+ LF E KI FLDI ++IEK        N     L+DIL  +   RK V
  S:     2 KKISILGSTGSIGTQTLDIVNQYPEQFQVVGLATRSNVDLLATQVQQFRPEIV---AIRDENKLGTLKDAIATLDYSPIILAGEEGVIEVARHGDAESVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPEDGLRRIILTASGGAFRDWRVEKLKYVTVQDALKHPNWSMGQKITVDSATLMNKGLEVIEAHFLFGMDYKNIDIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPE---RIYTDWETLDLVKAGSLTFREPDHDKYPCMQLAYSAGE-AGGAMSAVLNAANEQAVALFLEEKIAFLDIPKVIEKTCDDFRDHNPYSPSLEDILEADNWARKTV 381
>gi|119946591|ref|YP_944271.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychromonas ingrahamii 37] >gi|166218276|sp|A1SYV7|DXR_PSYIN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|119865195|gb|ABM04672.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychromonas ingrahamii 37] (399 aa)
Score = 521, Expect = 5.4e-51, Identities = 133/353 (37%), Positives = 212/353 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTK----------------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSG---YESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDF-LENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           KK+ + GATG+IG S+L +     E Y++   + +++ +K L +   F P  +  S  +  K                +      ELL   + D ++ A+VG +GL  TL A+    ++ LANKE+LV++G L  D  + S ++++PVDSEH+++Y +L             + + + ++++T SGGPF +K   E   I  A AVKHPNW+MGKKISIDSATMMNK  E IEA +LFN  K  +++  H QS+IHSM+++ D S IA M  P+M++ I   L G    ES T+ ++   F   + +F+  D D++  +  A D   E Q      I+NAANE A+  F    IKF  I +++E+ +   E+  +  ++ +L ++   R
  S:     2 KKLAILGATGSIGDSTLSVCRSNPELYQITLLAASSSVDKMLALCREFTPLYVSMSSEISAKKLRGLLKRNNLSCHVLDDEQRLLELLASDHVDSVMAAIVGAAGLKTTLAAVDAGKEVFLANKEALVMSGALFIDAVKKSGAKLWPVDSEHNAIYQALSPKLQNTIGACDLSGEGVSKILLTGSGGPFLEKPLAEFAAITPAQAVKHPNWSMGKKISIDSATMMNKGLEYIEARWLFNANKEQLQIIIHPQSVIHSMVQYKDGSVIAQMGNPNMRIPIAYVLGGEQRIESGTDFLD--FFAAPDFSFTAPDFDRYPCLKLAIDACFEGQQST--TILNAANEIAVEAFLNQTIKFTQISQLVERVLNQHESAAIESVEHLLEIDTEAR 386
>gi|75760866|ref|ZP_00740880.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491650|gb|EAO54852.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] (325 aa)
Score = 521, Expect = 5.7e-51, Identities = 122/293 (41%), Positives = 186/293 (63%)
  Q:    77 EELLE-KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           E LLE   +PD  I++NA+VG  GL  TL A++    + +ANKE+LV AG L+ +  R  +  + PVDSEHS+++  L   N K I  LIIT SGG F  K  +EL ++   DA++HPNW+MG KI+IDSATMMNK  E+IEA++LF    ++I V  H +SIIHSM++F D S +A +  PDM++ IQ  L+ Y  +  L +    N      L F ++D ++++ + +AY+       ++P +MNAANE A+  F + +I FL + ++IEKA+          L++IL ++  TR++V +
  S:    24 EGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALT-YPDRLPLSDTKQLNLWEIGTLHFEKMDQERFRCLRFAYE-AGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARPSLEEILEIDAATRRFVME 323
>gi|30249674|ref|NP_841744.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosomonas europaea ATCC 19718] >gi|39930868|sp|Q82U01|DXR_NITEU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|30180711|emb|CAD85623.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosomonas europaea ATCC 19718] (413 aa)
Score = 520, Expect = 8.2e-51, Identities = 123/348 (35%), Positives = 202/348 (58%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRF--PNALVFSPS---------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           K + + + G+TG+IG S+L+++ +    Y++V  + + N EK  E   +F  P A++                    +  + + S E++      D ++ A+VG +G+  TL A +    + LANKE+LV+AG +  D  R   + + P+DSEH++++ SL  +         ++ +++T SGGPF   +   L  +    A  HPNW MG+KIS+DSATMMNK  E+IEA++LFN   +KI+V  H QS+IHSM+++ D S +A +  PDM+  I   LS  E   + +  L  F    L F   D  ++  +  AY+ L      +P ++NAANE A+ +F   +I F  I  +IE  + + E  +V DL+ +L
  S:     3 KTRHLTILGSTGSIGESTLDVVARHPGRYQVVALTADRNVEKMFEQCIQFHPPYAVMLDAQSAEQLEDRLHAAGLDTRVLSGIESLEKVASLPEIDTVMAAIVGAAGIRPTLAAARTGKHILLANKETLVMAGRVFMDTLRQHHATLLPIDSEHNAIFQSLPQHFNGDLAGSGVRRILLTASGGPFRTVDLKILETVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNAVPEKIQVVIHPQSVIHSMVEYIDGSVLAQLGNPDMRTPIAHALSYPERMESGVQSLDMFKVARLDFESPDFKRFPCLRLAYEALAAGGN-MPAVLNAANEVAVEVFLAGRIPFTAIPVMIEDVMKSTERRDVPDLEGVL 377
>gi|110004375|emb|CAK98713.1| putative 1-deoxy-d-xylulose 5-phosphate reductoisomerase transmembrane protein [Spiroplasma citri] (380 aa)
Score = 519, Expect = 8.9e-51, Identities = 135/363 (37%), Positives = 212/363 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFS-------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLAL-KNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTN--LINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNK 374
           + +++FGA+GNIG  +L+IIE    ++++   S  +N    ++I+ +     +               P++           +L      ++LNA+ GF+GL+ TL  L   N  L LANKESLVVAG LI  L   +++++YP+DSEH +++  L+  N    E+I+T SGG F  K   +L  I+   A++HP W MG+ I+IDS+TM+NK  EIIEAY+LF T KI V  H Q+I+HS +++ D S I  +S P M L +      Y ++ N   +  L+F  L  LTF + DL +WK +  AY  L N+N ++ I  NAANEE   LF   KIKF  I + IE  +  ++  ++ + ++I  LN   ++ + ++   K
  S:     2 QNIIIFGASGNIGQQALQIIESNPNDFQITAVSIYHNVPTLIKILEKHTTIRIVHLGDETQAILTAQYPNITFVTGETGINAMLAAFPTALVLNAISGFAGLYPTLQTLYGKNRTLLLANKESLVVAGDLINSLLTKNNNQLYPIDSEHCAIFQCLEQTNP-CSEIILTASGGMFANKTLTDLKTIDEQQALQHPTWKMGQNITIDSSTMVNKGLEIIEAYHLFKTSKITVVLHPQAILHSAVQYADYSIIGQLSKPSM-LQVLNYFLYYPTRKNSSFLKPLNFEELITLTFQKADLSRWKALQLAYRCL-NENNSLAIAFNAANEELRSLFVVGKIKFYQIVDYIEYFMDQIKPQKLVNYREIKELNDIIKRDIINYFSEK 380
>gi|17231843|ref|NP_488391.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc sp. PCC 7120] >gi|21263519|sp|Q8YP49|DXR_ANASP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|17133487|dbj|BAB76050.1| deoxyxylulose 5-phosphate reductoisomerase [Nostoc sp. PCC 7120] (399 aa)
Score = 518, Expect = 1.3e-50, Identities = 131/362 (36%), Positives = 213/362 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL----NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND--LKDILNLNKNTRKYVYDFSKN 373
           K + + G+TG+IG  +L+I+ +  + + +VG +  +N E   E I +F P     S + K      + ++L  +                 + + ++  +VG +GL  T+ A++   D+ALANKE+L+  G ++  L      ++ P DSEHS+++  L+   K  +K++++T SGG F   +   L  +  +DA+KHPNW+MG+KI++DSAT+MNK  E+IEA++LF  + + I++  H QSIIHS+I+  D S +A +  PDM+L +   LS  E    +  D    NL    NLTF E D  K+  +  AY        ++P ++NAANE+ + LF + KIKFLDI   IE      +N    +  L DIL  ++  R+ V   +KN
  S:     3 KSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAEKLPALQAAIKDLDPQPILLGGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKGGLKKILLTASGGAFRDWDVERLAEVTVSDALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYQDIEIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPE---RIYTDWERLNLVKAGNLTFREPDHQKYPCMQLAYA-AGRAGGSMPAVLNAANEQVVALFLDEKIKFLDIPRCIELVCDRHQNDNCANPSLDDILAADQWARQEVLTATKN 388
>gi|75907523|ref|YP_321819.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena variabilis ATCC 29413] >gi|123610176|sp|Q3MDL2|DXR_ANAVT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|75701248|gb|ABA20924.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anabaena variabilis ATCC 29413] (398 aa)
Score = 518, Expect = 1.4e-50, Identities = 131/362 (36%), Positives = 213/362 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL----NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND--LKDILNLNKNTRKYVYDFSKN 373
           K + + G+TG+IG  +L+I+ +  + + +VG +  +N E   E I +F P     S + K      + ++L  +                 + + ++  +VG +GL  T+ A++   D+ALANKE+L+  G ++  L      ++ P DSEHS+++  L+   K  ++++++T SGG F   +   L  +  ADA+KHPNW+MG+KI++DSAT+MNK  E+IEA++LF  + + I++  H QSIIHS+I+  D S +A +  PDM+L +   LS  E    +  D    NL    NLTF E D  K+  +  AY        ++P ++NAANE+ + LF + KIKFLDI   IE      +N    +  L DIL  ++  R+ V   +KN
  S:     2 KSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAEKLPALQAAIKDLDPQPILLGGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAFRDWDVERLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYQDIEIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPE---RIYTDWEPLNLVKAGNLTFREPDHQKYPCMQLAYA-AGRAGGSMPAVLNAANEQVVALFLDEKIKFLDIPRCIELVCDRHQNDNCANPSLDDILAADQWARQEVLTATKN 387
>gi|118602084|ref|YP_903299.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166218278|sp|A1AV71|DXR_RUTMC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|118567023|gb|ABL01828.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (383 aa)
Score = 516, Expect = 1.9e-50, Identities = 125/347 (36%), Positives = 209/347 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRF-PNALV---------FSPSVKTKNTVNSFEELLEKT----NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILN 358
           K + + GATG+IG S+L +++   + + +   S N N++  LE+ N++ PN  +          S  + T   + S  + L+K     + D ++ A+VG +G+   L A+K    + LANKESL++AG +        ++ + PVDSEHS+++  L++    + ++ +T SGGPF     ++   I    A  HPNW+MG+KIS+DSATMMNK  E+IEAYYLF+   ++I V  H QSI+HS + + D S ++ +  PDM+  I   +S  +   + +  L   N   L F + D +K+  +  A++ L     A+ I MNAANE A+  F  ++I FLDI +II++ + A+++T  N L++++N
  S:     2 KNITLLGATGSIGKSTLSVVDLHSDKFNIFTLSANTNWQLMLELCNKYQPNYAIMVDESSAEKLSTIITTDTQILSGTQALDKVVAHQDTDFVMAAIVGTAGMSSALCAVKAGKRIMLANKESLILAGDIFMKAVEEFNAELIPVDSEHSAIFQCLQSGRSGLNKIQLTASGGPFLHTPISKFKYITPNQACAHPNWSMGRKISVDSATMMNKGLEVIEAYYLFSLTPEQIDVVVHPQSIVHSSVYYKDGSTLSQLGKPDMRTVISYAMSYPQRINSGVTALDLTNTPALEFYQPDFEKFTCLKLAFETLNKGGNAM-ITMNAANEIAVEYFLNHQINFLDIPKIIDQTLSAMKHTTPNSLEEVVN 366
>gi|94500628|ref|ZP_01307158.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oceanobacter sp. RED65] >gi|94427183|gb|EAT12163.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oceanobacter sp. RED65] (386 aa)
Score = 515, Expect = 2.7e-50, Identities = 131/356 (36%), Positives = 214/356 (60%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNY-EKALEIINRFPNALVFSPSVKTKNTVNSFEELL-EKTNP-------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK--NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K+ V V GATG+IG ++L++I +  + Y++   + ++   E A + I   P   V    V   ++    ++LL +K N                    D ++ A+VG +GL  TL A +    + LANKE+LV++G L  D  R + +++ P+DSEH++++ SL    N++ ++++++T SGGPF      EL ++  A AVKHPNW+MG+KIS+DSAT+MNK  E+IEA +LF    K I+V  H +S++HSM+++ D S I  M  PDM+  I  G++  E     +  L F+++  L F     D +  +  A    E    A P I NAANE A+  F   +I FL I +++E+ + A+E     +L+ IL+ ++  RK+
  S:     2 KQWVTVLGATGSIGQNTLDVIARHHDRYQVFALTAHSRVDELAQDCIEHQPLYAV----VADASSAEKLQQLLLDKANKTEVLWGAEQLEWVASHDQVDQVMAAIVGAAGLLPTLAAARAGKRILLANKEALVMSGQLFMDAVRDNGAQLLPIDSEHNAIFQSLVGCENHQGVQKILLTASGGPFRAATLQELKSVTPAQAVKHPNWSMGQKISVDSATLMNKGLELIEACWLFGVTPKDIEVVVHPESVVHSMVQYVDGSVINQMGNPDMRTPIAYGMAWPERIDAGVPALDFSSIQQLNFEAPRHDVFPALKLAARAFEAGGTA-PAIFNAANEVAVSAFLREQISFLSISQLVERCLDAIEIEPAKNLEVILSADQKARKW 380
>gi|57168257|ref|ZP_00367396.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter coli RM2228] >gi|57020631|gb|EAL57300.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter coli RM2228] (358 aa)
Score = 515, Expect = 2.7e-50, Identities = 140/354 (39%), Positives = 215/354 (60%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-SGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           ++VFG+TG+IG ++L++   +N ++   +   N     E I +F    V   + K K+ V            EE+L     D++LNA+VGF+GL  TL A +    +ALANKESLVVAG  ++       ++  PVDSEHS+L   L    K+I +L +T SGG FYK +  +L +++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L+N K I      +S++H+M +F + +  A  S  DMKLSI + + S ++SK  ++  + F  L+ L F +I   K+ PI    D L N N  + +I+NAANE  +  F ++KI+FLDI  ++ KA+      +++ + ++   +  TR+Y+
  S:     1 MIVFGSTGSIGLNALKLATLKNIKISALACGENISLLNEQIEQFKPQFVAIKNSKDKHLVKHDKVFVGQEGLEEILSLCEDDLLLNAIVGFAGLKSTLKAKELGKKIALANKESLVVAGKFLK------GAKFLPVDSEHSAL-KFLLEGKKDIAKLYVTASGGAFYKHKIKDLSHVSVKDALKHPNWNMGSKITIDSATMANKLFEIIEAYHLYNFKNIDALIEPKSLVHAMCEFKNGASTAYFSRADMKLSISEAIFSKHDSK--ILEPVDFVKLSGLKFYKISTKKY-PIFKLKDELLN-NPDLGVIINAANEIGVQNFLDHKIQFLDIAHVVFKALDHFGVPKISSIDEVFEYDYKTREYL 354
>gi|57242206|ref|ZP_00370145.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter upsaliensis RM3195] >gi|57016886|gb|EAL53668.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter upsaliensis RM3195] (361 aa)
Score = 514, Expect = 3.2e-50, Identities = 135/358 (37%), Positives = 218/358 (60%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-SGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFS 371
           ++VFG+TG+IG ++L++   +N  +   +  +N +   + I RF    V     K ++ V            E +LE ++  ++LNA+VGF+GL  TL A K +  +ALANKESLVVAG  ++       + + PVDSEHS+L ++L    + +K+L I  SGG F+K +  +L ++  +DA+KHPNW+MG KI+IDSATM NK FE+IEAY+LFN ++I  +   QS++H++ +F + +  A  S PDMKL+I + +   YE    ++  L F  L +L F +I+L K+         L+N N  + +I+NAANE  +  F + K KFLDI + + K +      ++ +L++I   ++  R+Y  +FS
  S:     1 MIVFGSTGSIGLNALKLANLKNLRISALACGSNIKLLNQQIERFKPEFVCIKEQKDRHLVKHKNVFVGQEGLERILELSSDTLLLNAIVGFAGLKSTLKAYKLHKKIALANKESLVVAGEFLK------GANLIPVDSEHSAL-NALIKERQNVKKLYICASGGAFFKLKTKDLKSVKPSDALKHPNWSMGAKITIDSATMANKLFELIEAYHLFNIREIDAFIEPQSLLHALCEFQNGATSAYFSKPDMKLAIAEAIFDTYE--LEILPPLDFVKLSSLKFHKINLKKYPLFALKNALLKNPN--LGVIINAANEVMVEKFLKQKCKFLDISKGVFKTLEHFGEPKITELEEIFEYDRKVREYCENFS 358
>gi|114562454|ref|YP_749967.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella frigidimarina NCIMB 400] >gi|123321512|sp|Q085D6|DXR_SHEFN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|114333747|gb|ABI71129.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella frigidimarina NCIMB 400] (396 aa)
Score = 514, Expect = 4.0e-50, Identities = 126/353 (35%), Positives = 206/353 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEK--------------------ALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           + +++ GATG+IG S+L ++     ++ + G   N + +K                    A+E+ +  PN  V     +      +   L+  +  D ++ A+VG +GL  T  A+K    + LANKE+LV++G L     R+S + + PVDSEH++++  L  N +            I  +++T SGGPF   +   L  +  A A  HPNW+MG KIS+DSATMMNK  E IEA +LFNT+  ++KV  H QS+IHSM+++ D S IA M  PDM+  I   +S  +     +  L F  +  L+F E D D++  +  A    E Q +    ++NAANE A+  F + +I+F DI  +  + + +++ T ++ ++DIL L++  R
  S:     2 QNMVILGATGSIGASTLSVMVNNPADFHVYGLVANASVQKMLALCITHQPEYAHMVDENAAMELKSLLPNHCV----TQVTTGAEALNALVTDSRTDTVMAAIVGAAGLVPTFDAVKAGKRVLLANKEALVMSGELFMHTARASGATVLPVDSEHNAIFQCLPTNVQAQLGYCDLSANGISHILLTGSGGPFLNTDLATLSAMTPAQACNHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQAEQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRIGAGVEPLDFFKVGQLSFCEPDFDRFPCLRLAMQACE-QGQEATTVLNAANEIAVDSFLKGRIRFTDIANVNYRCLDSVQQTRLDSIEDILQLDEQAR 385
>gi|147668998|ref|YP_001213816.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dehalococcoides sp. BAV1] >gi|146269946|gb|ABQ16938.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dehalococcoides sp. BAV1] (377 aa)
Score = 513, Expect = 4.2e-50, Identities = 131/367 (35%), Positives = 206/367 (56%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS----FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTN-LINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKN 373
           M +  KKV++ G+TG+IG  +LE+I    ++++++G +   N     E    F    ++      ++  NS     EE+      D+I+ A  G +GL   L A K +  +ALANKESLV AG ++  + R + +++ PVDSEHS+++  L         +I+T SGGPF     NE+  +    A+KHP+W MG K++IDSA++MNK  EIIEA +LF+   + I+V  H QSIIHSM++F D S  A +S PDM+  IQ  L+  E   N  +  L++  +  L F   D+ ++  +  A    E + +  P  + AA+E A+ LF + KI F  I E+I K + A +     D+ DIL  +   R+ V + + N
  S:     1 MVHSIKKVVILGSTGSIGRQTLEVIRSLPDHFKVLGLAGGANVNLLKEQAGEFRPEYIYCRDCHKESACNSRFIPMEEMAALPEADVIVVATPGGAGLQPVLAAAKASKVIALANKESLVSAGEIVTGIVRENKAKLLPVDSEHSAIWQCLSGEVTPPSRIILTASGGPFRSLTKNEIDKVTPEQALKHPSWKMGLKVTIDSASLMNKGLEIIEARWLFDMHIQNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQYALTYPERVANHTLPRLNWAEVGKLDFEIPDMTRFPCLGLAISAGE-EGKTFPAALCAADEVAVDLFLKGKISFGQIPELIAKVLDAHQPVSKPDIDDILAADAWARQKVTELAGN 376
>gi|83757330|gb|ABC45443.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salinibacter ruber DSM 13855] (457 aa)
Score = 513, Expect = 4.7e-50, Identities = 131/359 (36%), Positives = 214/359 (59%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRF-PNALVF----------------SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLIND-LSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           ++ +++ + GATG+IG  +LE++    + +++   +   N E+    +  F P  +                  +P V+         E   +++ D++L A+VGF+GL   L A++    +ALANKE+LVV G L+         ++ PVDSEHS+++  L   + + ++EL++T SGGPF+ +  +   +I   +A+ HPNW+MG KI++DSATMMNK  E+IEA +LF+    +I+V  H QSI+HSM+ F D +  A + VPDMK+ IQ  LS Y S+    ++ L ++ L+ L F   DL+K+  +  AYD LE    A P ++NAANE A+  F E ++ FLDI   +E+ +  L       L D++  +   R+ V
  S:    68 SEPRRLALLGATGSIGTQTLEVVRLFPDRFDVRVLTCRQNVERLAAQVQEFRPECVAVGSAESAEAFKKTLPADAPDVRVLVGTEGLCEAATRSDVDVVLGAVVGFAGLRPILRAVRAGKQVALANKETLVVGGALVTQAVADGGGQLLPVDSEHSAIFQCLAGESERAVEELVLTASGGPFWDRPADTFGDITVEEALDHPNWSMGAKITVDSATMMNKGLEVIEAKWLFDVPVDRIQVLVHPQSIVHSMVSFADGAVKAQLGVPDMKVPIQYALS-YPSRWPASHERLDWDELSRLDFERPDLEKFPCLRLAYDALEAGGTA-PALLNAANEAAVGRFLEGQLGFLDIPRAVERVLEQLPVQASPTLDDLVAADTEARRRV 448
>gi|52425983|ref|YP_089120.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mannheimia succiniciproducens MBEL55E] >gi|59797516|sp|Q65R75|DXR_MANSM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|52308035|gb|AAU38535.1| Dxr protein [Mannheimia succiniciproducens MBEL55E] (411 aa)
Score = 511, Expect = 8.1e-50, Identities = 132/355 (37%), Positives = 206/355 (58%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-----------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           KK+ +++ G+TG+IG S+L +IE   E Y         N +  +E        + F P     +  N+ ++L EK                          D ++ A+VG +GL  TL A++ +  + LANKE+LV  G +  D  + + +R+ PVDSEH++++ SL    ++           I ++++T SGGPF   +  E  NI    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++ D S IA M  PDM+  I + ++      + +  L F  L+ LTF E D +++  +  A +       A    MNAANE A+  F    IKF DI  +  K +  ++  ++N + D+L ++K +R
  S:    13 KKQNLVILGSTGSIGKSTLSVIEHNPEKYHAFALVGGRNVDLMVE------QCVKFQPEFAALDDENAAKQLAEKLKSAGKKTKVLAGQKAICELAAHPEADQVMAAIVGAAGLLPTLSAVQASKTVLLANKETLVTCGQIFIDEVKRTKARLLPVDSEHNAIFQSLPPEAQQQIGFCPLKELGINKIVLTGSGGPFRYTDLTEFDNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNAGAEEMEVIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAETMAYPGRIVSGVTPLDFYQLSGLTFLEPDYERYPCLKLAIEAFAAGQYAT-TAMNAANEIAVEAFLNRMIKFTDIARVNAKVVELIQPQQINCIDDVLAVDKQSR 399
>gi|119471161|ref|ZP_01613693.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alteromonadales bacterium TW-7] >gi|119445817|gb|EAW27099.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alteromonadales bacterium TW-7] (406 aa)
Score = 509, Expect = 1.2e-49, Identities = 128/359 (35%), Positives = 218/359 (60%)
  Q:     6 KMENKKKKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEI-INRFPNALVFSP-------SVKTKNTV---------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYD----SLKNNNKE-------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K  + K+++++ GATG+IG S+L+++ K +  +++   +   N +K  E+ I   P   V +        S+  K T           +  +L    + DI+++A+VG +GL  TL A++    + LANKESLV++G L  D  +   + + P+DSEH++++     SL+N   +       + ++++T SGGPF  ++   L ++  ++AV HPNW+MG+KIS+DSATMMNK  E IEA +LF  N+  I V  H QSIIHSM+++ D S +A M  PDM+  I   L+  +     +  L+F+++ + +F++ D  ++  +  A D       A   + NAANE A+  F + KI F DI++I  + + + + T V  L +IL  ++  R
  S:     4 KFMSHKQQLVILGATGSIGLSTLDVVAKNSDLFDVFALTAGQNAKKMAELCIKHSPLYAVMATQSAAEELSLHLKGTACQTLIMHSQQAMSDLCAHPDVDIVMSAIVGAAGLLPTLSAVEAGKKVLLANKESLVMSGQLFIDKVKKHKATLLPIDSEHNAIFQCLPRSLQNAQSDKNLQDNGVSKILLTGSGGPFLTRDIRTLKDVTVSEAVAHPNWSMGQKISVDSATMMNKGLEFIEAKWLFNCNSDDIDVVIHPQSIIHSMVQYHDGSILAQMGNPDMRTPIAHALAFPKRIDAGVKPLNFSDICDFSFTKPDFTRYPNLQLAIDACSAGQGATTTV-NAANEIAVAAFLKGKIGFTDIYKINAQTLESAQYTNVQSLDEILQCDELAR 394
>gi|15837650|ref|NP_298338.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa 9a5c] >gi|13124146|sp|Q9PEI0|DXR_XYLFA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|9105992|gb|AAF83858.1|AE003942_2 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa 9a5c] (396 aa)
Score = 509, Expect = 1.3e-49, Identities = 126/362 (34%), Positives = 211/362 (58%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIIN--RFPNALVFSPSVKT--KNTVNS-------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVY 368
           M    + V V GATG+IG ++L+++ +    + +   +     +  L + +  R  +A++   ++ T  ++ +N+               EL+  T  D ++ A+VG +GLH TL A +    L LANKESLV+AG L+      S + I P+DSEH++++  L++   + +  + +T SGGPF       L  I    A+ HP W+MG KIS+DSAT+MNK  E+IEA++LF   +++I V  H QS++HS+++F D S +A +S+PDM+ ++  GLS  E   + +  L     N L F   D + +  +  A D ++    A P ++NAANE A+  F + +I FL I  +IE A+  L   E + L+ +L ++  TR+  +
  S:     1 MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCHTYRPDHAVIGDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAAIVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQCLRSRTTDGVHRITLTASGGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQIDVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLSWPERIGSGVPGLDLMKHNRLDFERPDTETFSCLRLARDAMQTGGTA-PAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTTLPRYEADTLETLLTVDTETRRITH 384
>gi|127513557|ref|YP_001094754.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella loihica PV-4] >gi|166198583|sp|A3QG97|DXR_SHELP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|126638852|gb|ABO24495.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella loihica PV-4] (395 aa)
Score = 509, Expect = 1.4e-49, Identities = 125/354 (35%), Positives = 210/354 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF---------PNA-------LVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K+++ GATG+IG S+L +IE+  E Y+      + + +K L++  ++         P A       L    ++   +  +    ++     D ++ A+VG +GL  TL A+K    + LANKESLV++G L  D  + S++++ PVDSEH++++  L    ++           I  +++T SGGPF   + + L  +    A KHPNW+MG+KIS+DSA+MMNK  E IEA +LFN  K  +KV  H QS+IHSM+++ D S +A M  PDM+  I   ++  +  +  +  L F  +  L+F E D +++  +  A D  E Q +    ++NAANE ++  F    I+F DI  + E  +  +E   ++ ++DIL L+   R+
  S:     2 QKMVILGATGSIGASTLSVIEQNPEAYKAFALVAHKSVDKMLDLCIKYNPSIAHMVDPQAAAELQRRLPAHMAIAVSSGEDELAAIVALPEVDCVMAAIVGAAGLPATLAAVKAGKRVLLANKESLVMSGRLFIDAMQGSNAKVLPVDSEHNAIFQCLPEPAQQAIGACDLAGAGISHILLTGSGGPFLTSDLDSLSQMTPDQACKHPNWSMGRKISVDSASMMNKGLEYIEARWLFNATKEQLKVVVHPQSVIHSMVQYKDGSVLAQMGNPDMRTPIAHCMAYPQRISAGVEPLDFFKVGQLSFLEPDFNRFPCLKLAIDACE-QGQEATTVLNAANEVSVEAFLAGLIRFTDIARVNEYCLSHVEQRSLDTIEDILALDGLARR 386
>gi|68249402|ref|YP_248514.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae 86-028NP] >gi|81170448|sp|Q4QM93|DXR_HAEI8 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|68057601|gb|AAX87854.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae 86-028NP] (397 aa)
Score = 509, Expect = 1.5e-49, Identities = 134/356 (37%), Positives = 205/356 (57%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-----------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K+ +++ G+TG+IG S+L +IE    +   F+      K +E +  F   + F P     + VN+ + L EK                        + D I+ ++VG +GL  TL A+K    + LANKESLV  G L  D  ++  S++ PVDSEH++++ SL    +E           + ++I+T SGGPF      +  NI    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++ D S IA M  PDM+  I + ++        +  L F  +  LTF E D +++  +  A D       A    MNAANE A+  F + +I F+DI +I  K I  +    + ++ D+L ++   R+
  S:     2 QKQNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGG--KNVEAM--FEQCIKFRPHFAALDDVNAAKILREKLIAHHIPTKVLAGRRAICELAAHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKNYGSKLLPVDSEHNAIFQSLPPEAQEKIGFCPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPHRTFAGVEPLDFFKIKELTFIEPDFNRYPNLKLAIDAFAAGQYAT-TAMNAANEIAVQAFLDRQISFMDIAKINSKTIERISPYTIQNIDDVLEIDAQARE 389
>gi|37521821|ref|NP_925198.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Gloeobacter violaceus PCC 7421] >gi|39930827|sp|Q7NID1|DXR_GLOVI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|35212820|dbj|BAC90193.1| deoxyxylulose 5-phosphate reductoisomerase [Gloeobacter violaceus PCC 7421] (392 aa)
Score = 508, Expect = 1.7e-49, Identities = 126/356 (35%), Positives = 207/356 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS----VKTKNTVNSFEELLE-------------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K + + G+TG+IG  +L+I+ +  E + + G + ++N E   E I RF   +V   S          +  F+ + E             +   ++++  +VG +GL  TL A+    DLALANKE+LV  G ++    R+   ++ PVDSEHS+++  L+      +K +++T SGG F      +L     ADA+KHPNW MG KI++DSAT+MNK  E+IEA++LF  +  +I++  H QSI+HS+++  D S +A +  PDM+L I   LS  E        L    +  LTF E D +++  +  AY       RA    P ++NAANEEA+  F + K++FL++  ++E  + A ++    DL D+   ++  R++V
  S:     2 KHIALLGSTGSIGTQTLDIVAEYPERFAVTGMTAHSNMELLAEQIRRFRPQVVAVGSEARRAALAALLAGFDGMPEMFVGEKGCCTVASQAPAEVVVTGIVGCAGLMPTLAAVDAGRDLALANKETLVAGGPVVMPRIRARGVKLLPVDSEHSAIFQCLQGVPEGALKRILLTASGGAFRDWPVEKLAEATTADALKHPNWVMGAKITVDSATLMNKGLEVIEAHWLFGLDYDRIEIVIHPQSIVHSLVELADTSVVAQLGWPDMRLPILYALSWPERLATPWKPLDLARVGTLTFKEPDHERYPNMRLAY----QAGRAGGTYPTVLNAANEEAVAQFLQEKVRFLEMSRLLEATLEAHKSAGEPDLDDVCGADRWAREHV 379
>gi|116749219|ref|YP_845906.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Syntrophobacter fumaroxidans MPOB] >gi|116698283|gb|ABK17471.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Syntrophobacter fumaroxidans MPOB] (390 aa)
Score = 508, Expect = 1.8e-49, Identities = 127/331 (38%), Positives = 197/331 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELL--EKTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + + G+TG+IG S+LE++ +  + + ++      N +   E I  F      S SV   N  +  +  L  +   P+I+                  ++A+VG +GL  TL A++    LALANKE+LVVAG ++  L       I PVDSEHS+++ SL+ N+++ +K +++T SGGPF  K   EL  +    A+ HPNW+MG+KI+IDSAT+MNK  E+IEA +LF     +I V+ H +SI+HSM+++ D S IA M +PDMK+ I   L+  E        L    L  L+F   D +++  +  A+D    +    P ++NAANE A+  F + KI F DI  +IE A+
  S:     4 RTISILGSTGSIGESTLEVVRQFPDRFRVIALGAGRNIKLLREQIRAFRP---LSVSVLDSNLADELDRSLKGDAYRPEILFGSDGYDRVAAHPEAGTLVSAMVGAAGLLPTLTAIRAGKRLALANKETLVVAGEIVMALAAEHEVEILPVDSEHSAIFQSLQGNHRDALKRILLTASGGPFLNKTREELAMVTPQAALCHPNWSMGRKITIDSATLMNKGLEVIEARWLFGVPVDRIAVHVHPESIVHSMVEYVDGSVIAQMGIPDMKIPIAYALTYPERLPVRSPSLDLFRLQKLSFYPPDEERFPCLRLAFDACR-KGSTYPAVLNAANEVAVGAFLDEKIAFPDIPGVIETAM 356
>gi|24373203|ref|NP_717246.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella oneidensis MR-1] >gi|32171388|sp|Q8EGG9|DXR_SHEON 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|24347424|gb|AAN54690.1|AE015609_9 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella oneidensis MR-1] (396 aa)
Score = 508, Expect = 1.8e-49, Identities = 130/359 (36%), Positives = 209/359 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEK--------------------ALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + +++ GATG+IG S+L +I      Y +     N + +K                    AL +  + P AL    +++  +  +    L+     D ++ A+VG +GL  TL A+K    + LANKE+LV++G L  +  R+S + + PVDSEH++++  L    +            I  +++T SGGPF   E + L  +  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT+K  +KV  H QS+IHSM+++ D S IA M  PDM+  I   +S  +   + +  L F  +  L+F E D +++  +  A +   +Q +    ++NAANE A+  F + KI F  I +I E  ++++    +  ++DI+ L+  TR Y  + 
  S:     2 QNMVILGATGSIGASTLSVISANPTAYRVYALVANASVDKMLTLCLAHRPQVAHMVDHKAALALKAQLPAAL----NIQVTSGEDELIALVTAPAVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATRASGATLLPVDSEHNAIFQCLPEEVQSNLGRCDLAASGISHILLTGSGGPFLTAELSNLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQKDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRIRSGVEPLDFFKVGQLSFCEPDFNRFPCLALAIEAC-SQGQEATTVLNAANEIAVEAFLQGKIGFTHIGKINEDCLLSVPKQAMASIEDIIALDAQTRIYAREL 391
>gi|89075414|ref|ZP_01161831.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photobacterium sp. SKA34] >gi|89048830|gb|EAR54400.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photobacterium sp. SKA34] (398 aa)
Score = 508, Expect = 1.8e-49, Identities = 129/364 (35%), Positives = 214/364 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PN-ALVFSPSVKTK-----------NTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKF 375
           +K+ + GATG+IG S+L ++ K  E +E+V  +  +N EK   +  ++ P  A +F      +            TV + E    E+    + D ++ A+VG +GL  T+ A+K    + LANKE+LV+ G +  D      + + PVDSEH++++ SL  N ++           + ++++T SGGPF      EL ++  A A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   +++ V  H QS+IHSM+++ D S IA M +PDM+  I   ++  E     +  L F+ +   TF + D D++  +  A D    Q +A    +NAANE A+  F  ++I F DI ++ +K +      E +++ +++ ++K  R+   D    +F
  S:     2 RKLTILGATGSIGSSTLNVVAKNPERFEVVALAAGSNVEKMFALCQQWRPKFAAMFDTQAAAELMTLLKRQEIATTVLAGEQGVCEVAALDDVDTVMAAIVGAAGLLPTMAAVKKGKRILLANKEALVMTGQMFIDACEQYGAELLPVDSEHNAIFQSLPTNIQQRMGRCDLSASGVSKVLLTGSGGPFRYTNIVELDDVTPAMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFNASREQMDVIIHPQSVIHSMVQYKDGSVIAQMGLPDMRTPIACAMAYPERVDAGVAPLDFSQIGEFTFMKPDFDRYPCLKLAIDACY-QGQAATTTLNAANEMAVAAFLASEICFTDIAKVNQKVLEIAVLVEPHNIAEVMEIDKQARQLASDVITKEF 397
>gi|77164332|ref|YP_342857.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosococcus oceani ATCC 19707] >gi|123757908|sp|Q3JCW9|DXR_NITOC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|76882646|gb|ABA57327.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosococcus oceani ATCC 19707] (393 aa)
Score = 508, Expect = 2.0e-49, Identities = 124/352 (35%), Positives = 208/352 (59%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFS----------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS---GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           V + G+TG+IG S+L+++ +  E Y +   S N +  +  +   +F P+ +V                  P ++  +   + E ++   + D ++ A+VG +GL  TL A +    + LANKESLV++G L       S + + P+DSEH++L+  +    +E       ++ +++T SGGPF ++  +EL N+   +A  HPNW+MG+KIS+DSATMMNK  E+IEA +LF+    +I+V  H QS+IHSM+ + D S +A +  PDM+  I  GL+     ES   L++  +     LTF + DL ++  +  AY  LE +      I+NAANE A+  F + +I+F  I ++IE  +  +  T  + L  +L  +   R+
  S:     4 VSILGSTGSIGMSTLDVLARYPERYRVQALSANRSVAQIYQQCLQFRPSQVVMVDPDAAEQLRQRLHPVVPEIEVSSGSEALETIVTSPDTDYVMAAIVGAAGLLPTLAAARAGKRILLANKESLVMSGQLFMSAVSESGAELLPIDSEHNALWQCMPAEGRELPLHRKGVRRILLTASGGPFRERALSELDNVTPDEACAHPNWSMGRKISVDSATMMNKGLEVIEACWLFDAAACQIEVVLHPQSVIHSMVDYVDGSVLAQLGNPDMRTPIAYGLAWPERMESGVTLLDLFAIG--QLTFCQPDLQRFPCLGLAYAALE-RGGTCSTILNAANEVAVQAFLDQRIQFTQIPKLIEWTLGRVTPTVADSLPAVLESDAVARQ 383
>gi|119510858|ref|ZP_01629982.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nodularia spumigena CCY9414] >gi|119464467|gb|EAW45380.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nodularia spumigena CCY9414] (410 aa)
Score = 508, Expect = 2.0e-49, Identities = 130/356 (36%), Positives = 209/356 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNA--------------------LVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL----NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND--LKDILNLNKNTRKYV 367
           K + + G+TG+IG  +L+I+ +  + + +VG +  +N E     I +F  ++    ++  +  +   +E ++  +P  IL A                    +VG +GL  T+ A++   D+ALANKE+L+  G ++  L      ++ P DSEHS+++  L+   K  ++ +++T SGG F   +  +L  +  ADA+KHPNW+MG+KI++DSAT+MNK  E+IEA++LF  +   I +  H QSIIHS+I+  D S +A +  PDM+L +   LS  E    +  D    +L    NLTF E D  K+  +  AY        ++P ++NAANE+ + LF E KIKFLDI   IE      +N    +  L DIL  +K  R+ V
  S:    10 KAITLVGSTGSIGTQTLDIVTQYPDQFRIVGLAAGSNVEILAAQIRQFRPSIA---AISAEEKLPELQEAIKDLDPQPILLAGISGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGIPKGGLRRILLTASGGAFRDWDVEKLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYPDIDIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPE---RIYTDWERLDLVKAGNLTFREPDHQKYPCMQLAYA-AGKAGGSMPAVLNAANEQVVALFLEEKIKFLDIPRCIELVCDRHQNDNCTNPSLDDILAADKWARQEV 389
>gi|72382590|ref|YP_291945.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. NATL2A] >gi|123620971|sp|Q46JT6|DXR_PROMT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|72002440|gb|AAZ58242.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. NATL2A] (412 aa)
Score = 507, Expect = 2.1e-49, Identities = 136/361 (37%), Positives = 221/361 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL--------EIINRFPNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN----NNKEI---------KELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN---DLKDILNLNKNTRKYVYDFSK 372
           K + V G+TG+IG  +L+I E+  E +++V  +   N +  +        E+++    +L+   S +  N++   +++++K                 + D+++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+     +N  +         K + +T SGG F   +  +L+     DA  HPNW+MGKKI++DSAT+MNK  E+IEA+YLF  +  +I++  H QSIIHSM++  D+S +A +  PDMKL I   LS           L    + NLTF E D  K+  +  AY         +P ++NAANE+A+ LF E + KF+DI ++IE AI      ++N    L +IL ++   R+ V D+S+
  S:     2 KAISVLGSTGSIGTQTLQIAEEFPEQFKIVALTAGKNLDLVIKQIETHQPEVVSLADESLLSELSSRI-NSLTENKKIVKKPLLMAGAEGLNTAAAWGSADLVVTGIVGCAGLLPTLAAIEAGKDLALANKETLIAAGPVVIPALKKSGSRLLPADSEHSAIFQCLQGTPWADNARLSTGMPTPGFKSIQLTASGGAFRDWKAEDLVKATVEDATSHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGLSYDQIEIIIHPQSIIHSMVELDDSSVLAQLGWPDMKLPILYCLSWPSRLKTPWPRLKLTQIGNLTFKEPDTKKYPCMELAYS-AGKSGGTMPAVLNAANEKAVELFLEERFKFIDIPKVIE-AICEKHKCDLNLNPSLSEILEIDNWAREEVLDYSE 404
>gi|94263223|ref|ZP_01287040.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [delta proteobacterium MLMS-1] >gi|93456441|gb|EAT06561.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [delta proteobacterium MLMS-1] (401 aa)
Score = 507, Expect = 2.2e-49, Identities = 126/353 (35%), Positives = 207/353 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSF---------------EELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLT------FSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           KK+ + G+TG+IG + L+++ +    + ++G +  NN     E I  F P  +  + +      V S                EE+      D++++A+VG +GL  T+ A+    D+ALANKE+LV+AG L+ +       R+ P+DSEH+++  +L+   +++I  LI+T SGGPF +    EL  +    A+ HPNW+MG+KISIDSATMMNK  E+IEA +LF    ++I+V  H QSI+HSM+++ D S +A M +PDM++ I   L+ Y  +      L    LNLT      F+  D  ++  +  AY   + +   +P  +NAANE A+  F E KI+F +I  ++ + +   E+     +  +L+ +   R
  S:     3 KKISLLGSTGSIGRNVLDVVRQYPGRFRVLGLAAGNNIALLKEQIEAFHPQLVSVTDADLAGELVQSLPPGWGERVLVGKSGNEEVARLRESDLVVSAIVGAAGLTPTMAAISAGKDIALANKETLVMAGDLVMNEVARQRVRLLPIDSEHNAIAQALEAGRHQDISRLILTASGGPFRQTPARELWEVQPEQALAHPNWSMGRKISIDSATMMNKGLEVIEARWLFGVGVEQIEVLLHPQSIVHSMVEYIDGSVVAQMGIPDMRIPIVYALA-YPERLR----LGLPRLNLTKCGDLSFTPPDFQRFPALQLAYKACK-RGGTMPAALNAANEVAVEAFLEGKIRFPEIALVVAETLNRAEHQRAERIATVLSADLAAR 376
>gi|71899403|ref|ZP_00681562.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Ann-1] >gi|71730812|gb|EAO32884.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Ann-1] (394 aa)
Score = 507, Expect = 2.2e-49, Identities = 127/362 (35%), Positives = 210/362 (58%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKE----NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKT--KNTVNS-------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVY 368
           M    + V V GATG+IG ++L+++ +     +  L+      +   AL    R  +A++   ++ T  ++ +N+               EL+  T  D ++ A+VG +GLH TL A +    L LANKESLV+AG L+      S + I P+DSEH++++  L++   + +  + +T SGGPF       L  I    A+ HP W+MG KIS+DSAT+MNK  E+IEA++LF   +++I V  H QS++HS+++F D S +A +S+PDM+ ++  GL+  E   + +  L     N L F   D + +  +  A D ++    A P ++NAANE A+  F + +I FL I  +IE A+  L   E + L+ +L ++  TR+  +
  S:     1 MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCRTYRPDHAVIGDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAAIVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQCLRSRTTDGVHRVTLTASGGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQINVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWPERIGSGVQGLDLMKHNRLDFEHPDTETFSCLRLARDAMQTGGTA-PAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTTLPRYEADTLETLLTVDTETRRITH 384
>gi|28198249|ref|NP_778563.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Temecula1] >gi|182680886|ref|YP_001829046.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa M23] >gi|32129499|sp|Q87EH9|DXR_XYLFT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|28056319|gb|AAO28212.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Temecula1] >gi|182630996|gb|ACB91772.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa M23] (394 aa)
Score = 507, Expect = 2.6e-49, Identities = 127/362 (35%), Positives = 210/362 (58%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKE----NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKT--KNTVNS-------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVY 368
           M    + V V GATG+IG ++L+++ +     +  L+      +   AL    R  +A++   ++ T  ++ +N+               EL+  T  D ++ A+VG +GLH TL A +    L LANKESLV+AG L+      S + I P+DSEH++++  L++   + +  + +T SGGPF       L  I    A+ HP W+MG KIS+DSAT+MNK  E+IEA++LF   +++I V  H QS++HS+++F D S +A +S+PDM+ ++  GL+  E   + +  L     N L F   D + +  +  A D ++    A P ++NAANE A+  F + +I FL I  +IE A+  L   E + L+ +L ++  TR+  +
  S:     1 MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCRTYRPDHAVIGDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAAIVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQCLRSRTTDGVHRVTLTASGGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQIDVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWPERIGSGVQGLDLMKHNRLDFEHPDTETFSCLRLARDAMQTGGTA-PAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTTLPRYEADTLETLLTVDTETRRITH 384
>gi|77360954|ref|YP_340529.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudoalteromonas haloplanktis TAC125] >gi|76875865|emb|CAI87086.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudoalteromonas haloplanktis TAC125] (401 aa)
Score = 506, Expect = 2.8e-49, Identities = 128/356 (35%), Positives = 211/356 (59%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEI-INRFPNALVFSPSVKTK-------NTV---------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYD----SLKNNNKE-------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++K+++++ GATG+IG ++L+++ +  + + +   +   N +K  E+ I   P   V +     K       NT           +  EL      D +++A+VG +GL  TL A++    + LANKESLV++G L  D  +   + + P+DSEH++++     SL+N   +       + ++++T SGGPF  ++ N L ++  A+AV HPNW+MG+KIS+DSATMMNK  E IEA +LFN     I V  H QSIIHSM+++ D S +A M  PDM+  I   L+  E     +  L+F+++ + +F++ D  ++  +  A D       A   + NAANE A+  F   +I F DI+ I  + + A   T V  L +IL  ++  R
  S:     2 SEKQQLVILGATGSIGLNTLDVVARNTQQFSVFALAAGKNAKKMAELCIAHQPRYGVMATQSAAKQLSLYLSNTPCKTQIMHGEQAMSELCGHPEVDAVMSAIVGAAGLLPTLSAVEAGKKVLLANKESLVMSGQLFIDKVKQHKATLLPIDSEHNAIFQCLPYSLQNAQGDQHLQSHGVSKILLTGSGGPFLTRDINTLKDVTIAEAVAHPNWSMGQKISVDSATMMNKGLEFIEAKWLFNCDPSDIDVVIHPQSIIHSMVQYHDGSILAQMGNPDMRTPIAHALAYPERINAGVKPLNFSDISDFSFTKPDFSRYPNLQLAIDACSAGQGATTTV-NAANEIAVSAFLNGEIGFTDIYTINAQTLEAATYTNVQSLDEILECDRLAR 389
>gi|71280222|ref|YP_268301.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Colwellia psychrerythraea 34H] >gi|81170441|sp|Q485G4|DXR_COLP3 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|71145962|gb|AAZ26435.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Colwellia psychrerythraea 34H] (411 aa)
Score = 506, Expect = 3.4e-49, Identities = 125/356 (35%), Positives = 218/356 (61%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIE--KENYELVGF----SFNNNYEKALE------IINRFPNALVFSPSVKTKN----TVNSFEELL----EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K+++ + G+TG+IG S+L+++    E ++++      S +  +E+ +E      ++    +A + +  +   N    TV S E+ L    E  N D ++ ++VG SGL  TL A+     + LANKE+LV +G +     ++S + + P+DSEH++++  L +  +            I ++++T SGGPF  +  + L ++  + A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   + I+V  H QS IHSM+++ D S IA M  PDM+  I   LS  E   + +  L  FN  +  F  +D +++  +  A +  + Q +A    +NAANE A+  F + KIKF DI++I E ++    + +V+++ +++ L++  R +
  S:     3 KRQLCILGSTGSIGCSTLDVVRLHPERFQVISLAAYTSVDVIFEQCIEFKPQQVVLVSSEHAALLTQKLNDANVSNITVLSGEQALIDIAECQNSDTVMASIVGASGLLPTLAAVNAGKRVLLANKEALVTSGAIFMAAVKASGAELLPIDSEHNAIFQCLPSQQQAEIGECQLLANGISKILLTGSGGPFRTRAIDTLESVTPSQACAHPNWDMGRKISVDSATMMNKGLEFIEAKWLFNVEAEDIQVVLHPQSTIHSMVQYKDGSVIAQMGNPDMRTPIAHALSFPERIESGVAPLDFFNTPSFEFQPVDFERYPNLELAIEACK-QGQAACTALNAANEIAVAAFLDEKIKFTDIYKINETSVKKFVSQKVDNINEVIALDEQARSF 391
>gi|71275618|ref|ZP_00651903.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Dixon] >gi|71899515|ref|ZP_00681672.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Ann-1] >gi|71163509|gb|EAO13226.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Dixon] >gi|71730735|gb|EAO32809.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xylella fastidiosa Ann-1] (394 aa)
Score = 505, Expect = 3.5e-49, Identities = 125/362 (34%), Positives = 211/362 (58%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIIN--RFPNALVFSPSVKT--KNTVNS-------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVY 368
           M    + V V GATG+IG ++L+++ +    + +   +     +  L + +  R  +A++   ++ T  ++ +N+               EL+  T  D ++ A+VG +GLH TL A +    L LANKESLV+AG L+      S + I P+DSEH++++  L++   + +  + +T SGGPF       L  I    A+ HP W+MG KIS+DSAT+MNK  E+IEA++LF   +++I V  H QS++HS+++F D S +A +S+PDM+ ++  GL+  E   + +  L     N L F   D + +  +  A D ++    A P ++NAANE A+  F + +I FL I  +IE A+  L   E + L+ +L ++  TR+  +
  S:     1 MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCHTYRPDHAVIGDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAAIVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQCLRSRTTDGVHRVTLTASGGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQIDVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWPERIGSGVPGLDLMKHNRLDFEHPDTETFSCLRLARDAMQTGGTA-PAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTTLPRYEADTLETLLTVDTETRRITH 384
>gi|46133139|ref|ZP_00156662.2| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae R2866] >gi|145638391|ref|ZP_01794001.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae PittII] >gi|145272720|gb|EDK12627.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae PittII] (397 aa)
Score = 505, Expect = 3.6e-49, Identities = 135/356 (37%), Positives = 202/356 (56%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-----------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K+ +++ G+TG+IG S+L +IE   E Y         N E   E        + F P     + VN+ + L EK                        + D I+ ++VG +GL  TL A+K    + LANKESLV  G L  D  ++  S++ PVDSEH++++ SL    +E           + ++I+T SGGPF      +  NI    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++ D S IA M  PDM+  I + ++        +  L F  +  LTF E D +++  +  A D       A    MNAANE A+  F + +I F+DI +I  K I  +    + ++ D+L ++   R+
  S:     2 QKQNIVILGSTGSIGKSTLSVIENNPEKYHAFALVGGKNVEAMFE------QCIKFRPHFAALDDVNAAKILREKLIAHHIPTEVLAGRRAICGLAAHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKNYGSKLLPVDSEHNAIFQSLPPEAQEKIGFCPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPHRTFAGVEPLDFFKIKELTFIEPDFNRYPNLKLAIDASAVGQYAT-TAMNAANEIAVQAFLDRQISFMDIAKINLKTIEKISPYTIQNIDDVLEIDAQARE 389
>gi|86604917|ref|YP_473680.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. JA-3-3Ab] >gi|123507986|sp|Q2JXQ9|DXR_SYNJA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|86553459|gb|ABC98417.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. JA-3-3Ab] (392 aa)
Score = 505, Expect = 3.9e-49, Identities = 129/356 (36%), Positives = 207/356 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV------FSPSVKTKNT-VNSFEELLEKTN----------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           + + + G+TG+IG  +L+++ +  E + +VG +  +N     E + RF   +V        P +++  T +    EL+  T              ++  +VG +GL  TL A++   D+ALANKE+LV  G ++  L R    ++ PVDSEHS+++  L+      ++ +++T SGG F      +L  +  ADA+KHPNW MG+KI+IDSAT+MNK  E+IEA++LF  +  +I+V  H QSI+HS+I+  D S +A +  PDM L I  GLS  E      + L    L +LTF   D  K+  +  AY         +P ++NAANE A+ LF + +I+FLDI  ++E+     +      L+DIL ++   R+ V
  S:     2 QAITLLGSTGSIGTQTLDLVAQYPERFRVVGLTSYSNVTLLAEQVWRFRPQIVAIGREELLPELRSLLTGMRPLPELVAGTEGLCQVAAHPAAQRVVTGIVGCAGLLPTLAAIRAGKDIALANKETLVAGGPVVLPLVREYGVKLIPVDSEHSAIFQCLQGVPPGSLRRILLTASGGAFRDWPAEKLDQVTLADALKHPNWVMGRKITIDSATLMNKGLEVIEAHWLFGLDYDRIEVLIHPQSIVHSLIELADTSVLAQLGWPDMHLPILYGLSWPERLATPWDPLDLVKLGSLTFKAPDHRKYPCLQLAYA-AGQAGGTLPAVLNAANEAAVALFLQERIRFLDIPRLLEQVCERHQVIPAPSLEDILEVDAWARQQV 379
>gi|90580977|ref|ZP_01236778.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio angustum S14] >gi|90437855|gb|EAS63045.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio angustum S14] (398 aa)
Score = 505, Expect = 3.9e-49, Identities = 131/364 (35%), Positives = 212/364 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PN-ALVFSPSVKTK-----------NTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKF 375
           +K+ + GATG+IG S+L ++ K  E +E+V  +  +N EK   +  ++ P  A +F      +            TV S E    E+    + D ++ A+VG +GL  T+ A+K    + LANKE+LV+ G +  D      + + PVDSEH++++ SL  N ++           + ++++T SGGPF   +  EL N+  A A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   +++ V  H QS+IHSM+++ D S IA M +PDM   I   ++  E     +  L F+ +   TF + D D++  +  A D    Q +A    +NAANE A+  F   +I F DI ++ +K +      E  ++ +++ ++K  R+   D    +F
  S:     2 RKLTILGATGSIGSSTLNVVAKNPELFEVVALAAGSNVEKMFALCQQWQPKFAAMFDSKAAAELASLLKQQEIATTVLSGEQGVCEVAALDDVDTVMAAIVGAAGLLPTMAAVKKGKRILLANKEALVMTGQMFIDACEQYGAELLPVDSEHNAIFQSLPTNIQQRMGRCDLSASGVSKVLLTGSGGPFRYTDIAELDNVTPAMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFNASREQMDVIIHPQSVIHSMVQYKDGSVIAQMGLPDMCTPIACAMAYPERVDAGVAPLDFSLIGEFTFMKPDFDRYPCLKLAIDACY-QGQAATTTLNAANEMAVAAFLAGEICFTDIAKVNQKVLEIAVLVEPQNIAEVMEIDKQARQLASDVITKEF 397
>gi|16272748|ref|NP_438967.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae Rd KW20] >gi|1175511|sp|P44055|DXR_HAEIN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|1573819|gb|AAC22466.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20] (397 aa)
Score = 505, Expect = 4.3e-49, Identities = 133/356 (37%), Positives = 204/356 (57%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-----------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K+ +++ G+TG+IG S+L +IE    +   F+      K +E +  F   + F P     + VN+ + L EK                        + D I+ ++VG +GL  TL A+K    + LANKESLV  G L  D  ++  S++ PVDSEH++++ SL    +E           + ++I+T SGGPF      +  NI    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++ D S I  M  PDM+  I + ++        +  L F  +  LTF E D +++  +  A D       A    MNAANE A+  F + +I F+DI +I  K I  +    + ++ D+L ++   R+
  S:     2 QKQNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGG--KNVEAM--FEQCIKFRPHFAALDDVNAAKILREKLIAHHIPTEVLAGRRAICELAAHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKNYGSKLLPVDSEHNAIFQSLPPEAQEKIGFCPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYVDGSVITQMGNPDMRTPIAETMAYPHRTFAGVEPLDFFKIKELTFIEPDFNRYPNLKLAIDAFAAGQYAT-TAMNAANEIAVQAFLDRQIGFMDIAKINSKTIERISPYTIQNIDDVLEIDAQARE 389
>gi|42630365|ref|ZP_00155909.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus influenzae R2846] (397 aa)
Score = 504, Expect = 4.9e-49, Identities = 134/356 (37%), Positives = 201/356 (56%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-----------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K+ +++ G+TG+IG S+L +IE   E Y         N E   E        + F P     + VN+   L EK                        + D I+ ++VG +GL  TL A+K    + LANKESLV  G L  D  ++  +++ PVDSEH++++ SL    +E           + ++I+T SGGPF      +  NI    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++ D S IA M  PDM+  I + ++        +  L F  +  LTF E D +++  +  A D       A    MNAANE A+  F + +I F+DI +I  K I  +    + ++ D+L ++   R+
  S:     2 QKQNIVILGSTGSIGKSTLSVIENNPEKYHAFALVGGKNVETMFE------QCIKFRPHFVALDDVNAARILREKLIAHHIPTEVLAGQRAICELAAHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKNYGAKLLPVDSEHNAIFQSLPPEAQEKIGFCPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASAEEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPHRTFAGVEPLDFFKIKELTFIEPDFNRYPNLKLAIDAFSAGQYAT-TAMNAANEIAVQAFLDRQISFMDIAKINLKTIEKISPYTIQNIDDVLEIDAQARE 389
>gi|90408928|ref|ZP_01217063.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychromonas sp. CNPT3] >gi|90309956|gb|EAS38106.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychromonas sp. CNPT3] (400 aa)
Score = 503, Expect = 6.0e-49, Identities = 132/341 (38%), Positives = 210/341 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEI--INRFPNALVFSPSVK-----------TKNTV-NSFEELLE---KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND 352
           K + V GATG+IG S+L++       Y +V  +   + +K L +  +++     +F P  +           +K+ V +S EELL+       D ++ A+VG +GL  TL ++    ++ LANKE+LV++G L  D  +SS ++++PVDSEH+++Y +L    ++           + ++++T SGGPF  K   E   I  A A+KHPNW+MG+KISIDSATMMNK  E IEA +LFNT   +++V  H QS+IHSM+++ D S IA M   DM++ I   + G +   +   +   F + +LTF E DL ++  +  A D      +A   ++NA+NE A+  F   KIKF  I E++E+ +    N  +ND
  S:     2 KNLAVLGATGSIGSSTLDVCSANPTLYRVVLLAAFKSVQKMLSLCLLHQPKYVSMFCPHARLELRELLKQADSKSIVLDSEEELLQLLGSNEIDSVMAAIVGGAGLTSTLASVHAGKEIFLANKEALVMSGQLFIDAVKSSGAKLWPVDSEHNAIYQALSPRLQDTLGYCDLSAEGVNKILLTGSGGPFLNKPLTEFSTITPAQAIKHPNWSMGQKISIDSATMMNKGLEYIEARWLFNTSSDQLQVILHPQSVIHSMVQYKDGSVIAQMGNQDMRIPIAYVMGGTQRIESHAGNFDFFKSPSLTFMEPDLKRYPCLQLAIDACYAGQKAT-TMLNASNEVAVDAFLTGKIKFTQIAELVERVL----NKPLND 370
>gi|113461128|ref|YP_719196.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus somnus 129PT] >gi|170717711|ref|YP_001784783.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus somnus 2336] >gi|112823171|gb|ABI25260.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus somnus 129PT] >gi|168825840|gb|ACA31211.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus somnus 2336] (402 aa)
Score = 502, Expect = 8.1e-49, Identities = 133/362 (36%), Positives = 207/362 (57%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVF----SPSVKTKNTVNSFE-------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           N K+K+++ G+TG+IG S+L +I K  E Y+ +      N E  L+ I +F    V     S + K +  +   E             EL      D ++ A+VG +GL  TL A++    + LANKE+LV  G +  D  R + +++ PVDSEH++++ SL    ++           I ++++T SGGPF   +     +I    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN    +++V  H QSIIHSM+++ D S IA M  PDM+  I + ++        +  L F  L+ LTF + D  ++  +  A +       A    +NAANE A+  F   +IKF DI +I    +  +E+  +  ++D+L ++K  R+    F
  S:     2 NNKQKLVILGSTGSIGTSTLSVIAKNPEQYQALALVGGKNVELMLQQIIKFQPHFVAMNDESAAKKLREKLAFLESKTEVLSGQKAICELAAHPEADQVMAAIVGAAGLLPTLSAVQAGKRILLANKETLVTCGKIFIDEVRKNKAQLLPVDSEHNAIFQSLPPQAQQQIGFCPLTQLGISKIVLTGSGGPFRYTDLKAFEHITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASADEMEVIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAETMAYPHRTFAGVEPLDFYQLSGLTFLKPDYQRYPCLKLAIEAFSAGQYAT-TALNAANEMAVEAFLNKRIKFTDIAKINTAVLEKIESQVITSIEDVLLVDKQARELANSF 395
>gi|186686008|ref|YP_001869204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc punctiforme PCC 73102] >gi|186468460|gb|ACC84261.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nostoc punctiforme PCC 73102] (398 aa)
Score = 502, Expect = 8.3e-49, Identities = 128/356 (35%), Positives = 213/356 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNA--------------------LVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL----NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND--LKDILNLNKNTRKYV 367
           K + + G+TG+IG  +L+I+ +  + + +VG +  NN E     I +F   +    ++ +++ + + +E +   +P  IL A                    +VG +GL  T+ A++   D+ALANKE+L+    ++  L      ++ P DSEHS+++  L+   K  ++++++T SGG F   +   L ++  ADA+KHPNW+MG+KI++DSAT+MNK  E+IEA++LF  +   I++  H QSIIHS+I+  D S +A +  PDM+L +   LS  +    +  D    +L    NLTF E D  K+  +  AY  +     ++P ++NAANE+A+ LF + KI+FLDI   IE      +N    +  L DIL  +K  R+ V
  S:     2 KAITLVGSTGSIGTQTLDIVTQYPDQFRIVGLAAGNNVEMLAAQIRQFRPKIA---AICSEDKLPALKEAIIDLDPQPILLAGEAGVIEVARYGDAQTVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAGAPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKSGLRKILLTASGGAFRDWDVERLADVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDNIEIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPD---RIYTDWERLDLVKAGNLTFREPDHQKYPCMQLAYA-VGKAGGSMPAVLNAANEQAVALFLDEKIRFLDIPRCIEWVCDRHQNDNRANPSLDDILAADKWARQEV 381
>gi|56964001|ref|YP_175732.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus clausii KSM-K16] >gi|59797490|sp|Q5WFT4|DXR_BACSK 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|56910244|dbj|BAD64771.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bacillus clausii KSM-K16] (379 aa)
Score = 501, Expect = 1.2e-48, Identities = 129/354 (36%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV--------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLIND-LSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG  +L++I    + + L   +   N E     I  F   LV              F  S++        +E+   +  DI++ A+ G  GL  TL A+K    +A+ANKE+LV AG L+    + +   + PVDSEHS+++ +L     K +  LI+T SGG F  K   EL  +    A+ HPNW+MG K++IDSATMMNK  E+IEA +LF  +  +I V  H +SIIHSM+++ D S IA +  PDM++ IQ  L+  E      ++ L    L  L F ++D+++++ +  AY+      RA   +  ++NAANE A+  F + +I FL+I  IIE+A+ A        L++I  ++ + RK
  S:     2 KQISLLGSTGSIGTQTLDVIRDYPDQFTLSALACGTNLELCRNQIKEFQPKLVSVQRPEDAQTLAGEFGDSIEFLYGEEGLKEVARYSESDIVVTAITGSIGLLPTLSAIKAKKAVAIANKETLVSAGHLVVSAAKENDVPLIPVDSEHSAIFQALNGEPKKAVDRLILTASGGSFRDKSRAELDGVTVEQALAHPNWSMGAKVTIDSATMMNKGLEVIEAKWLFGLDYDQIDVLIHKESIIHSMVEYVDRSVIAQLGTPDMRVPIQYALTYPERFARPKHERLDLAELGKLHFEKMDMERFRCMKLAYE----AGRAGGTMTTVLNAANEVAVCRFLQGEITFLEIERIIEEALSAHSPIAHPSLEEIQAVDASIRK 375
>gi|159903757|ref|YP_001551101.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. MIT 9211] >gi|159888933|gb|ABX09147.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. MIT 9211] (412 aa)
Score = 501, Expect = 1.2e-48, Identities = 134/352 (38%), Positives = 207/352 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP--------------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND---LKDILNLNKNTRKYV 367
           + G+TG+IG  +L+I E+  E +++V  +   N    +E I +    +V   ++  +  V   +E L+  NP                          D+++  +VG +GL  TL A+K   D+ALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F     +EL N +  DA  HPNW+MGKKI++DSAT+MNK  E+IEA+YLF  N   I++  H QSIIHSMI+  D+S +A M  PDMKL I   +S           LS   + +LTF   D  K+  +  AY         +P ++NAANEEA+  F + KI FL I +IIE ++      ++N    L D++ +++  R+ V
  S:     1 MLGSTGSIGTQTLQIAEEFPEQFKVVSLTAGRNLTLLIEQIKKHSPEVV---ALAEECLVQELQERLDNINPSEKPKKFPKLFGGPEGLNIAASWDHSDLVVTGIVGCAGLLPTLAAIKAGKDIALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGVPTPGLRNIQLTASGGAFRDWSIDELRNASVKDATSHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGLNYNHIEIVIHPQSIIHSMIELGDSSVLAQMGWPDMKLPILYAMSWPNRIETPWKRLSLPEIGSLTFKSPDTAKYPCMELAYS-AGRSGGTMPAVLNAANEEAVAQFLKEKIHFLSIPKIIE-SVCEQHKNDLNQNPKLNDVIAVDEWARRVV 394
>gi|196156198|ref|YP_002125687.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alteromonas macleodii 'Deep ecotype'] >gi|88772817|gb|EAR04092.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alteromonas macleodii 'Deep ecotype'] >gi|196111977|gb|ACG65693.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alteromonas macleodii 'Deep ecotype'] (395 aa)
Score = 501, Expect = 1.2e-48, Identities = 127/365 (34%), Positives = 208/365 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINR-FPNALVFSPSVKTKNTV----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFR 376
           + V V GATG+IG ++L++I +  E Y +   + N+  E  ++   +  P  +V +     K                   ++ E++      D ++ A+VG +GL  TL A+K    + LANKE+LV++G L  D    S ++I P+DSEH++++  L ++          I++L++T SGGPF ++  +   +I   +A  HPNW+MG+KI+IDSATMMNK  E IEA +LF      I V  H QSIIHSM+++ D S IA M  PDM+  I  GL+        +  L F+++ N +F    L ++  +  A D  + + +     MNAANE ++  F + KI+F DI ++ E  + A+    V+ ++ IL  +   R    +  + KF+
  S:     2 QTVTVLGATGSIGCNTLDVINRHPEKYRVFAITGNSQLELLMQQAQKCAPRFVVIADDTHYKAACELASHYGVDAEILTGSHALEDVSSAPEVDAVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGKLFIDAANQSGAKILPIDSEHNAIFQCLPHDYEYGNFTTAGIRKLLLTGSGGPFRERPLDSFSSITIDEASTHPNWSMGRKITIDSATMMNKGLEFIEACWLFGAGADDIDVVIHPQSIIHSMVQYIDGSVIAQMGNPDMRTPIAYGLAHPARIEAGVKPLDFSDIANFSFQTPCLKRYPNLKLAIDACK-EGQCATTRMNAANEVSVAAFLDGKIQFCDIAKVNEATLNAMPYVSVSSIQQILEQDTLARVKADEIIRGKFQ 394
>gi|89895285|ref|YP_518772.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfitobacterium hafniense Y51] >gi|122482360|sp|Q24UG4|DXR_DESHY 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|89334733|dbj|BAE84328.1| hypothetical protein [Desulfitobacterium hafniense Y51] (381 aa)
Score = 501, Expect = 1.3e-48, Identities = 125/353 (35%), Positives = 197/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYE----KALEIINRFPNALVFSPSVKTKN--------TVNSFEELLEKTN---PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG  +L+I+ +  E  E+   +   N +    +A E   R    +    + + K          V+  E LL       PD ++ A+ G  GL  T+ ALK   D+ALANKE+LV  G L+    +     I PVDSEHS+++  L+ + + + ++I+T SGGPF      +L  +    A++HPNW MG KI+IDSATMMNK  E+IEA++LF+ +  +I V  H QS+IHSM+++ D S +A    PDM+L IQ  L+      N    L      LTF + +   +  +  AY     +   +P +MNAANE A+  F   ++ +L+I  +++K     +  +  DL+ ILN +   R
  S:     2 KRLTILGSTGSIGTQTLDIVRQNPEQLEVFALAAGKNVQEIELQAREFKPRIIGLMEEKAARELKQRVADLDIEVVSGMEGLLRTVTDEVPDTVVTAISGRIGLEPTMEALKVGKDIALANKETLVAGGDLVMGTAQRLGRTILPVDSEHSAIFQCLEEDPRTLDKIILTASGGPFRGWSEEQLQEVTPERALQHPNWAMGAKITIDSATMMNKGLEVIEAHHLFHMEYDQIDVLIHPQSVIHSMVQYCDGSVLAQCGRPDMRLPIQYALTYPTRWPNPFERLDLRGKTLTFFDPEDYDFPALKLAYA-CGKRGGTLPAVMNAANEVAVHAFLARRVAYLEIIGLVDKVCSEHDVLDATDLETILNADHWAR 372
>gi|109645630|ref|ZP_01369550.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfitobacterium hafniense DCB-2] >gi|109643579|gb|EAT53132.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfitobacterium hafniense DCB-2] (381 aa)
Score = 501, Expect = 1.3e-48, Identities = 123/353 (34%), Positives = 197/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV------FSPSVKTK------NTVNSFEELLEKTN---PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG  +L+I+ +  E  E+   +   N ++       F   ++       +  +K +        V+  E LL       PD ++ A+ G  GL  T+ ALK   D+ALANKE+LV  G L+    +     I PVDSEHS+++  L+ + + + ++I+T SGGPF      +L  +    A++HPNW MG KI+IDSATMMNK  E+IEA++LFN +  +I V  H QS+IHSM+++ D S +A    PDM+L IQ  L+      N    L      L+F + +   +  +  AY     +   +P +MNAANE A+  F   ++ +L+I  +++K     +  +  DL+ ILN +   R
  S:     2 KRLTILGSTGSIGTQTLDIVRQNPEQLEVFALAAGKNVQEIELQAREFKPQIIGLMEEKAARELKQRVADLDIEVVSGMEGLLRTVTDEVPDTVVTAISGRIGLEPTMEALKAGKDIALANKETLVAGGDLVMGTAQRLGRTILPVDSEHSAIFQCLEEDPRTLDKIILTASGGPFRGWSEEQLREVTPERALQHPNWAMGAKITIDSATMMNKGLEVIEAHHLFNMEYDQIDVLIHPQSVIHSMVQYCDGSVLAQCGRPDMRLPIQYALTYPTRWPNPFERLDLRGKTLSFFDPEDYDFPALKLAYA-CGKRGGTLPAVMNAANEVAVHAFLARRVAYLEIIGLVDKVCSEHDVLDATDLETILNADHWAR 372
>gi|46579279|ref|YP_010087.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|59797580|sp|Q72DR3|DXR_DESVH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|46448693|gb|AAS95346.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (408 aa)
Score = 500, Expect = 1.4e-48, Identities = 127/358 (35%), Positives = 215/358 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFP----NALVFSPSVKTKNTV------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS------GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           + + + G+TG+IG S+L ++E     +++V  +   N EK      R+       L  + + K ++ +              +  +        +L+A VG +GL  T  A ++   + LANKESLV+AG +I      S + I PVDSEH++++ +L+ ++   ++ +I+T SGGPF  +  ++L  ++  DA+ HPNWNMG KISIDSAT+MNK  E+IEA +L+      + V  H QSI+HS++++ D S IA++  PDM+++I   L+          + +L+   S     LTF E DL  +  +  A      + R +P+++NAANE A+ LF  ++I+FLDI +II +A+   + T  +D++ I  L++ TR+ VY+
  S:    19 RTLALLGSTGSIGTSALRVVEAHPHRFKVVALAGARNVEKLAAQAARWRPEHLGVLDATGAAKLRDLLPAGYAPHIHIGPEGYATMATLPEAGTVLSAQVGAAGLRATEAAARHGKVICLANKESLVLAGDIIRRHCAGSGAVILPVDSEHNAIFQALQGHDPASVRRIILTASGGPFRGRSRDDLAAVSCRDALAHPNWNMGAKISIDSATLMNKGLEVIEACHLYGVGIDDVGVVVHPQSIVHSLVEYEDGSQIAHLGTPDMRIAIAYCLTWPGVVDAGVPRLDLVKAGS-----LTFEEPDLHSFPCLELARRAYR-EGRGMPVVLNAANEVAVSLFLSDRIRFLDIPDIIARALDMHDGTTPHDIEGIEALDEATRRTVYE 397
>gi|57234846|ref|YP_181117.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dehalococcoides ethenogenes 195] >gi|57225294|gb|AAW40351.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dehalococcoides ethenogenes 195] (377 aa)
Score = 500, Expect = 1.4e-48, Identities = 125/365 (34%), Positives = 203/365 (55%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS----FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFS 371
           M +  K +++ G+TG+IG  +LE+I    + ++++G +   N     E   +F    ++  +    N   +     EE+      DI++ A  G +GL   L A +    +ALANKESLV AG ++    + + ++I PVDSEHS+++  L         +I+T SGGPF     +E+  +    A+KHP+W MG K++IDSA++MNK  EIIEA +LF+   + I+V  H QSIIHSM++F D S  A +S PDM+  IQ  L+  E  TNL +  L++  +  L F   D+D++  +  A    E + +  P  + AA+E A+ +F + +I F  I ++I K + A +      L DIL  +   R+ V + +
  S:     1 MVHSIKNIVILGSTGSIGRQTLEVIHSLPDRFKVLGLAGGTNANLLKEQTEQFRPKYIYCQNCHDTNACTARFIPMEEMAALPEADIVVVATPGSAGLQPVLAAARAGKVIALANKESLVSAGEIVTATAQENRAKILPVDSEHSAIWQCLSGEVTPPARIILTASGGPFRSLTKDEIAKVTPEQALKHPSWKMGTKVTIDSASLMNKGLEIIEARWLFDMPVRNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQCALTYPERLTNLTLPRLNWAEIGKLDFEMPDMDRFPCLKLAISAGE-EGKTFPAALCAADELAVEMFLKGEIGFGQIPQLIAKVLDAHQAVASPSLDDILAADAWARRKVTELA 374
>gi|117921250|ref|YP_870442.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. ANA-3] >gi|166198584|sp|A0KZ17|DXR_SHESA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|117613582|gb|ABK49036.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. ANA-3] (396 aa)
Score = 500, Expect = 1.5e-48, Identities = 130/355 (36%), Positives = 204/355 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEI-INRFPN---------ALVFS----PSVKTKNTVNSFE--ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           + +++ GATG+IG S+L +I    + Y +     N + +K L + +   P          AL       P +  + T    E   L+  T  D ++ A+VG +GL  TL A+K    + LANKE+LV++G L  +  ++S + + PVDSEH++++  L    +            I  +++T SGGPF   E   L ++  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT+K  +KV  H QS+IHSM+++ D S IA M  PDM+  I   +S  +   + +  L F  +  L+F E D +++ P          Q +    ++NAANE A+  F + +I F  I ++ E  + ++    +  + DI+ L+  TR Y
  S:     2 QNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCVTHRPQVAHMVDSQAALALQAKLPPELNIQVTSGEDELIALVTATEVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATKASGATLLPVDSEHNAIFQCLPEEVQANLGRCDLAASGISHILLTGSGGPFLTAELASLASMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQKDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRIRSGVEPLDFFKVGQLSFCEPDFNRF-PCLALAIAACAQGQEATTVLNAANEIAVEAFLQGQIGFTHIAKVNEACLSSVPKRAMTSIDDIIALDAQTRIY 387
>gi|86608709|ref|YP_477471.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123502632|sp|Q2JM39|DXR_SYNJB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|86557251|gb|ABD02208.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. JA-2-3B'a(2-13)] (392 aa)
Score = 500, Expect = 1.7e-48, Identities = 127/354 (35%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV------FSPSVKTKNT-VNSFEELLEKTN----------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + G+TG+IG  +L+++ +  E +++VG +  +N     E + RF   +V        P +++  T +    EL+  T              ++  +VG +GL  TL A++   D+ALANKE+LV  G ++  L R     + PVDSEHS+++  L+      ++ +++T SGG F      +L  +  ADA+KHPNW MG+KI+IDSAT+MNK  E+IEA++LF  +   I +  H QSI+HS+I+  D S +A +  PDM L I  GLS  E      + L    L +LTF   D  K+  +  AY     +   +P ++NAANE A+ LF + +I+FLDI  ++E+     +      L+DIL  +   R+
  S:     2 QAITLLGSTGSIGTQTLDLVAQYPERFQVVGLTSYSNVALLAEQVRRFRPQMVAIGREELLPELRSLLTGIRPLPELVAGTEGLCQVAAHPAAQRVVTGIVGCAGLLPTLAAIRAGKDIALANKETLVAGGPVVLPLVREYGVNLIPVDSEHSAIFQCLQGVPAGSLRRILLTASGGAFRDWPAEKLDQVTLADALKHPNWVMGRKITIDSATLMNKGLEVIEAHWLFGLDYDHIDILIHPQSIVHSLIELADTSVLAQLGWPDMHLPILYGLSWPERLATPWDPLDLVKLGSLTFKAPDHRKYPCMELAYA-AGRRGGTLPAVLNAANEAAVALFLQERIRFLDIPRLLERVCERHQVIADPSLEDILQADAWARR 377
>gi|134299817|ref|YP_001113313.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfotomaculum reducens MI-1] >gi|172044306|sp|A4J5Y5|DXR_DESRM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|134052517|gb|ABO50488.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfotomaculum reducens MI-1] (387 aa)
Score = 499, Expect = 1.8e-48, Identities = 135/362 (37%), Positives = 209/362 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELL--EKTNPDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKN 373
           K++ + G+TG+IG  +LE++    E   +V  +   N E  LE    +   LV   S++ +      +E L  EK  P+I                  ++ AL G  GL  T  A+K +  +ALANKE+LV AG  +  L       I PVDSEHS+++  L   N+  I+++ +T SGGPF +    EL N+    A+KHPNW+MG+KI+IDSAT+MNK  E+IEA +LF  +   I V  H QS+IHSM+++ D S +A++ +PDM++ IQ  LS  E   N +  L+   L  LTF E D +++  +  AY   +    A P ++NAANE A+  F   +IKF+ I  I+++ +   +      L++IL ++   R+      +N
  S:     3 KQISILGSTGSIGRQTLEVVNSFPEELNVVALAAGRNRELFLEQCKAYKPLLV---SLQLEEDALWLKEHLIKEKLRPEIRYGLDGLVAVATCHEAVVVVTALSGAIGLVPTCAAIKASKKIALANKETLVAAGQYVTKLAEEYKVEILPVDSEHSAIWQCLHGENRSAIRKIQLTASGGPFRQLNRQELENVTPEMALKHPNWSMGQKITIDSATLMNKGLEVIEAKWLFGVDYDDINVVVHPQSVIHSMVEYGDGSLLAHLGMPDMRIPIQYALSYPERWFNHLPKLNLTELKGLTFEEPDTNRFPSLSLAYQAGKIGGTA-PAVLNAANEVAVHAFLAGQIKFMQIPSIVKRTLNEHQFQGSPVLEEILEIDGWAREEANKIIRN 386
>gi|110165339|gb|ABG49879.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Trichodesmium erythraeum IMS101] (559 aa)
Score = 499, Expect = 1.9e-48, Identities = 134/359 (37%), Positives = 207/359 (57%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP--------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND---LKDILNLNKNTRKYV 367
           N  K + + G+TG+IG  +L I+      + ++G +  +N E   + + +F   +V   ++  K+     +E +    P                    ++++  +VG +GL  T+ A++   D+ALANKE+L+ AG ++  L      ++ P DSEHS+++  L+    E ++ +I+T SGG F      +L  +  ADA+KHPNW+MGKKI++DSATMMNK  E+IEA+YLF  N   I +  H QSIIHS+I+  D S +A +  PDM+L +   LS  E        L      +LTF E D  K+  I  AY        ++P ++NAANE+A+ LF E KI FLDI ++IE  +    N+   +   L DIL  +K  RK V
  S:    17 NNMKPITILGSTGSIGTQTLNIVAHNPNKFRVIGLAAGSNVEILAQQVRQFCPQIV---AINDKSKFRELQEAIADLQPQPILVADQDGVIQVARYGESEVVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAAGPVVNPLIEKYRVKLLPADSEHSAIFQCLQGLPLEGLRRIILTASGGAFRDWPIEKLSKVKVADAIKHPNWSMGKKITVDSATMMNKGLEVIEAHYLFGLNYDNIDIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWKQLDLVKAGSLTFKEPDNLKYPCIQLAYT-AGRMGGSMPGVLNAANEQAVALFLEEKIAFLDIPKLIE-YVCEKHNSNYQENPSLDDILAADKWARKEV 399
>gi|120610509|ref|YP_970187.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120588973|gb|ABM32413.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acidovorax avenae subsp. citrulli AAC00-1] (392 aa)
Score = 498, Expect = 2.3e-48, Identities = 127/354 (35%), Positives = 206/354 (58%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRF-PN-ALVFSP---------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIP---IIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K+++ V G+TG+IG S+L+++ +    YE+   S     +       RF P  A++ SP               S +  +T ++ + +      D+++ A+VG +GL   L A +    L LANKE+LVV G +     R   + + P+DSEHS+++  L  +     + +  +++T SGGPF  +E   L ++    A  HPN++MG+KIS+DSATMMNK  E+IEA +LFN   ++I+V  H Q IIHSM++F D S +A +  PDM++ I  GL+  E   +    L F +L  LTF E D  ++  +H ++  L    RA P    ++NAANE A+  F E +I+F  I  +    + A+  +  + L  +L+L+   R
  S:     2 KQRLTVLGSTGSIGTSTLDVVARHPGRYEIFALSAATQVDAMAAQCLRFGPRYAVMASPEHARALREALAAQGSSTEVMDTPDALQAISAHPEVDVVMAAIVGAAGLAPCLAAARAGKRLLLANKEALVVGGEVFMSAVREGGATLLPIDSEHSAIFQCLPEDASSWPRRVDHILLTASGGPFRTREPATLRDVTPEQACAHPNFSMGRKISVDSATMMNKALEVIEARWLFNLAPEQIQVVIHPQQIIHSMVQFKDASVLAQLGTPDMRVPIACGLAWPERIESGTPRLDFRSLAALTFEEADATRFPGLHLSWQAL----RAAPGTTAVLNAANEVAVASFLERRIRFDQIHRLNLATLEAVSPSNPDSLCALLDLDAQAR 380
>gi|148653595|ref|YP_001280688.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychrobacter sp. PRwf-1] >gi|172048548|sp|A5WGE7|DXR_PSYWF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|148572679|gb|ABQ94738.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Psychrobacter sp. PRwf-1] (411 aa)
Score = 498, Expect = 2.8e-48, Identities = 133/354 (37%), Positives = 218/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT------------------NP--DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL----KNNNKEI-------KELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDI----FEIIEKAI---------IALENTEVNDLKDILNLNKNTRK 365
           +++ V GATG+IG S+L I+    E+Y++   S +   +K  E+  +F  + V  P    +N V+ F   L                     +P  D ++ A+VG +GL  TL A K    + LANKE+LV+AG L+    R + + + P+DSEH++++  L    + NN  I       K+L +T SGGPF  K + ++   + ++AVKHPNW+MG+KIS+DSATMMNK  E+IEA +LF+    +I V  H QSIIHS++++ D S++A M  PDM+  I   L+     +  +  L    L +L F + DL K+  +  A + +++  +A  I +NAANE A+  F + ++   DI     ++++K +          A+   ++ +L DIL ++K  R+
  S:     3 QRIAVLGATGSIGDSTLSILAAHPEHYQVYALSGHGRLDKLFELCQQFRPSRVAVP----ENKVDDFATRLAAAQIACEVVGGQAGLDDIALDPQVDTVVAAIVGAAGLASTLSAAKAGKRVLLANKEALVMAGSLMMQAVRDNGATLLPLDSEHNAIFQCLPPQIQQNNTAIHDASHGVKKLWLTASGGPFLNKTWEQMQAASVSEAVKHPNWSMGQKISVDSATMMNKGLELIEACHLFDLAESQINVVIHPQSIIHSLVEYCDGSFLAQMGSPDMRTPIAHALAYPNRISAGVESLDLYQLSSLEFIKPDLKKFACLKLAREAMQS-GQAASITLNAANEVAVEAFIKQQVSLTDIALINAQVLDKMLGKDKSVAGHAAISVRQITELNDILMIDKIARE 400
>gi|91775877|ref|YP_545633.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylobacillus flagellatus KT] >gi|122985513|sp|Q1H145|DXR_METFK 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|91709864|gb|ABE49792.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylobacillus flagellatus KT] (394 aa)
Score = 498, Expect = 2.8e-48, Identities = 123/361 (34%), Positives = 200/361 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEI-INRFPNALVFSPS--------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           + V + GATG IG ++L++I +    Y +   + N+  ++  E+ +   P   V   S               +  + + + EE+       +++ A+VG +GL   + A      + LANKE+LV+AG L         + + P+DSEH++++  +         +  I+ +++T SGGPF K  F EL+ +  A A+ HPNW MG KI+IDSAT+MNK  E+IEA++LFN    KI+V  H QS+IHSM+++ D S +A M  PDM+  I  GL   E     +N L  F    L F   D  ++  +  A+D L +   A P I+NAANE A+  F    I F DI  +IE  + A++   V  +  ++ ++   R +  ++ +
  S:     5 QNVTILGATGTIGLNTLDVISRHPGRYRVFALTANSRVDELAELCLQHRPRYAVMLDSGAAEKLQQKLKGLETQVLSGLAALEEVAAHPEAHVVMAAIVGAAGLKPAMAAAYAGKRILLANKETLVMAGKLFMQAVEEGGATLLPIDSEHNAIFQVMPPARLSALADGGIRRILLTASGGPFRKSSFAELMAVTPAQALNHPNWVMGPKITIDSATLMNKGLEVIEAHWLFNAPADKIEVVVHPQSVIHSMVEYIDGSVLAQMGNPDMRTPIAYGLGYPERLKAGVNALDLFKVGRLDFEAPDTARFPCLRLAFDALRHGGTA-PAILNAANEVAVDAFLNGNIGFQDIPRLIEAVLTAMDIEAVTSISQLIEVDALARAHALEWRQ 390
>gi|59712563|ref|YP_205339.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio fischeri ES114] >gi|75431539|sp|Q5E3E5|DXR_VIBF1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|59480664|gb|AAW86451.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio fischeri ES114] (400 aa)
Score = 498, Expect = 2.8e-48, Identities = 129/355 (36%), Positives = 206/355 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELL--------------------EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIE----KAIIALENTEVNDLKDILNLNKNTRKY 366
           +K+ + GATG+IG S+L + ++  + +E+V      N +K LE+   +    V   ++ T+   +  +ELL                    +    D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D      + + PVDSEH++++  L  + +            +  +++T SGGPF   + +EL  +    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN  K  +KV  H QS+IHSM+++ D S +A M +PDM+  I   +S  +     +  L F  +   TF   D  ++  +  A D       A    +NAANE+A+  F  NKIKF DI  I E    K     +N E++ L+ +++L++  R+Y
  S:     2 RKLTILGATGSIGSSTLSVAKQNSDQFEVVALGAGTNVDKMLELCLEWKPKYV---AMATQPAADELKELLSAHAINAEVFSGEDGLCHIAQLDEVDTVMAAIVGAAGLLPTMSAVKAGKRILLANKEALVMSGQLFIDAVEKYGAELLPVDSEHNAIFQCLPQSIQTNLGRCDLEEHGVSSILLTGSGGPFRYTDVSELEAVTPEMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFNASKDQLKVVIHPQSVIHSMVQYKDGSVLAQMGLPDMRTPIACTMSYPKRVDAGVEPLDFTKVGEFTFIAPDFARYPCLKLAIDACYLGQHAT-TGLNAANEQAVAAFLANKIKFTDIARINEAVLHKVCANFQNLELDSLESLIDLDRMARRY 392
>gi|113970970|ref|YP_734763.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. MR-4] >gi|123130245|sp|Q0HGW1|DXR_SHESM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|113885654|gb|ABI39706.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. MR-4] (396 aa)
Score = 498, Expect = 2.9e-48, Identities = 127/355 (35%), Positives = 204/355 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEI-INRFPN---------ALVFSP------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           + +++ GATG+IG S+L +I    + Y +     N + +K L + I   P          AL          +++  +  +    L+  T  D ++ A+VG +GL  TL A+K    + LANKE+LV++G L  +  ++S + + PVDSEH++++  L    +            I  +++T SGGPF   E   L  +  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT+  ++KV  H QS+IHSM+++ D S IA M  PDM+  I   +S  +  ++ +  L F  +  L+F E D +++ P          Q +    ++NAANE A+  F + +I F  I ++ E  + ++    +  + DI+ L+  TR Y
  S:     2 QNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCITHRPQVAHMVDSQAALALQAKLPPELNIQVSSGEDELIALVTATEVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATKASGATLLPVDSEHNAIFQCLPEEVQANLGRCDLAASGISHILLTGSGGPFLTAELASLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQNDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRISSGVEPLDFFKVGQLSFCEPDFNRF-PCLALAIAACAQGQEATTVLNAANEIAVEAFLQGQIGFTHIAKVNEACLSSVPKRAMTSIDDIIALDAQTRIY 387
>gi|15616851|ref|NP_240064.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131983|sp|P57329|DXR_BUCAI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|25323801|pir||F84957 1-deoxy-D-xylulose 5-phosphate reductoisomerase [imported] - Buchnera sp. (strain APS) >gi|10038915|dbj|BAB12950.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (398 aa)
Score = 497, Expect = 3.5e-48, Identities = 137/353 (38%), Positives = 216/353 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNY-------------------EKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL-----KNNNK------EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           KK+ + G+TG+IG ++L II+K  + ++++    N N+                   EK+  I+ +       +  V T          LE+T  D +++A+VG +GL  TL A+     + LANKESL+ +G+       SS ++I P+DSEH++++  L     KN  K       IK L++T SGGPFYK   ++L N+    A  HPNW MGKKIS+DSATMMNK  E  EA +LFN    +IK+  H +SIIHSM+++ D S +A +SVPD++ SI   +S  +     ++ L+F  + NLTF E D  ++  +  A D   +Q +A   ++NAANE A+  F ++KI F  I+EI  + +++   +E   ++DIL +++  R
  S:     2 KKITILGSTGSIGINALSIIQKNPDLFKVIALVANKNFSIMLRQCELFSPDWVAMRDEKSAHILRKKLKHSKINTQVLTGEKDICALAALEET--DHVISAIVGMAGLLPTLSAIHAGKTILLANKESLITSGYFFMKALSSSGAKIIPIDSEHNAIFQVLPLEIQKNLGKTTLEKNSIKHLVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVDSATMMNKGLEYAEARWLFNALESEIKILIHPESIIHSMVQYYDGSLLAQLSVPDIRTSISYAMSWPDRICTEVDYLNFYKINNLTFFEPDFTQFPCLKLAIDAF-SQGQASMTVLNAANEIAVSSFLDSKISFTKIYEINMEILMSSCFSEPKCIQDILEIDRKVR 386
>gi|73748216|ref|YP_307455.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dehalococcoides sp. CBDB1] >gi|73659932|emb|CAI82539.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dehalococcoides sp. CBDB1] (377 aa)
Score = 497, Expect = 3.6e-48, Identities = 130/367 (35%), Positives = 205/367 (55%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS----FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTN-LINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKN 373
           M +  KKV++ G+TG+IG  +LE++    ++++++G +   N     E    F    ++      ++  NS     EE+      D+I+ A  G +GL   L A K    +ALANKESLV AG ++  + R + +++ PVDSEHS+++  L         +I+T SGGPF     NE+  +    A+KHP+W MG K++IDSA++MNK  EIIEA +LF+   + I+V  H QSIIHSM++F D S  A +S PDM+  IQ  L+  E   N  +  L++  +  L F   D+ ++  +  A    E + +  P  + AA+E A+ LF + KI F  I E+I K + A +     D+ DIL  +   R+ V + + N
  S:     1 MVHSIKKVVILGSTGSIGRQTLEVVRSLPDHFKVLGLAGGANVNLLKEQAGEFRPEYIYCRDCHKESACNSRFIPMEEMAALPEADVIVVATPGGAGLQPVLAAAKAGKVVALANKESLVSAGEIVTGIVRENKAKLLPVDSEHSAIWQCLSGEVTPPSRIILTASGGPFRSLTKNEIDKVTPEQALKHPSWKMGLKVTIDSASLMNKGLEIIEARWLFDMHIQNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQYALTYPERVVNHTLPRLNWAEVGKLDFEIPDMTRFPCLGLAISAGE-EGKTFPAALCAADEVAVDLFLKGKISFGQIPELIAKVLDAHQPVSKPDIDDILAADAWARQKVTELAGN 376
>gi|160874604|ref|YP_001553920.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella baltica OS195] >gi|189027761|sp|A9KUL1|DXR_SHEB9 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|160860126|gb|ABX48660.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella baltica OS195] (396 aa)
Score = 497, Expect = 3.8e-48, Identities = 124/355 (34%), Positives = 204/355 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEII----------------NRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           + +++ GATG+IG S+L +I      Y + G   N + +K L +                  +    L  + +++    +N    L+     D ++ A+VG +GL  TL A+K    + LANKE+LV++G L  +  + S + + PVDSEH++++  L    +            I  +++T SGGPF + +   L  +  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT+  ++KV  H QS+IHSM+++ D S IA M  PDM+  I   ++  +   + +  L F  +  L+F E D +++  +  A +    Q +    ++NAANE A+  F + +I F  I ++ E  ++ +    +  ++DIL L+  TR Y
  S:     2 QNMVILGATGSIGASTLSVISANPFAYSVYGLVANASVDKMLALCVAHKPKVAHMVDEAAAKQLRAVLPATLNIQVTTGMNDLLGLVTAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVLLANKEALVMSGELFIEATKRSGAVLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHILLTGSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQAEQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFKVGQLSFYEPDFERFPCLALAMEACA-QGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNEACLVTVPKRPMGSIEDILALDAQTRVY 387
>gi|114048194|ref|YP_738744.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. MR-7] >gi|123326337|sp|Q0HT68|DXR_SHESR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|113889636|gb|ABI43687.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. MR-7] (396 aa)
Score = 496, Expect = 4.1e-48, Identities = 126/355 (35%), Positives = 204/355 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEK--------------------ALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           + +++ GATG+IG S+L +I    + Y +     N + +K                    AL +  + P  L    +++  +  +    L+  T  D ++ A+VG +GL  TL A+K    + LANKE+LV++G L  +  ++S + + PVDSEH++++  L    +            I  +++T SGGPF   E   L  +  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT+  ++KV  H QS+IHSM+++ D S IA M  PDM+  I   +S  +  ++ +  L F  +  L+F E D +++ P          Q +    ++NAANE A+  F + +I F  I ++ E  + ++    +  + DI+ L+  TR Y
  S:     2 QNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCVTHRPQVAHMVDSQAALALQAKLPPEL----NIQVSSGEDELIALVTATEVDTVMAAIVGAAGLVPTLAAVKAGKRVLLANKEALVMSGELFIEATKASGATLLPVDSEHNAIFQCLPEEVQANLGRCDLAASGISHILLTGSGGPFLTAELASLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQNDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRISSGVEPLDFFKVGQLSFCEPDFNRF-PCLALAIAACAQGQEATTVLNAANEIAVEAFLQGQIGFTHIAKVNEACLSSVPKRAMTSIDDIIALDAQTRIY 387
>gi|34497657|ref|NP_901872.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chromobacterium violaceum ATCC 12472] >gi|39930830|sp|Q7NVY8|DXR_CHRVO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|34103513|gb|AAQ59875.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Chromobacterium violaceum ATCC 12472] (394 aa)
Score = 496, Expect = 4.7e-48, Identities = 125/357 (35%), Positives = 219/357 (61%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PN--------------ALVFSPSVKTK--NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K + + V GATG++G ++L+++ +  E Y +V  + +   +K  E   RF P+              A +    ++++  +  ++  ++      D ++ ++VG +GL   L A +    + LANKESLVVAG L  D  R+S S + PVDSEHS+++ SL        +   ++++I+T SGGPF  +   +L ++   +A +HPNW+MG+KIS+DSAT+MNK  E+IEA +LFN    +I+V  H QS+IHSM+++ D S +A +  PDM+  I   L+  E     +  + F +L +LTF + DL+++  +  A+D LE    A P ++NAANE A+  F   +++F+DI  ++  ++  +     + L+ +L  ++  R++
  S:     3 KPQGIAVLGATGSVGCNTLDVVARHPERYRVVALTAHRQLDKLFEQARRFCPDYLVVADADAAARLRARLAEAGLRSEVLHGADALVQVAALPEVDAVMASIVGAAGLPSALAAARAGKRILLANKESLVVAGRLFMDAVRASGSALLPVDSEHSAIFQSLPADYAGNPDGAGVRKIILTASGGPFRNRPAADLAHVTPDEACRHPNWSMGRKISVDSATLMNKGLEVIEARWLFNVPPSRIEVAVHPQSVIHSMVQYRDGSVMAQLGSPDMRTPIACALAWPERIDAGVEPMDFFSLSDLTFEKPDLERFPCLQLAFDALEMGGDA-PAVLNAANEVAVAAFLAGRLRFVDIPRVVAASLSGVSCAASDSLEGLLARDEEARRF 386
>gi|86152437|ref|ZP_01070642.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843322|gb|EAQ60532.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni HB93-13] (356 aa)
Score = 496, Expect = 4.9e-48, Identities = 134/354 (37%), Positives = 208/354 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++FG+TG+IG ++L++   +N  +   +  +N     E I RF    V     K K+ V            E++L +    ++LNA+VGF+GL  TL A +   ++ALANKESLVVAG  ++       ++  PVDSEH++L   L    K I +L IT SGG FYK +  +L  ++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L++ K+I      +S++H+M +F + +  A  S  DMKL+I   +  +E + T ++  + FN +  L F  I   K+        FL+  N  + +I+NAANE  +  F ENK  FLDI + I KA+      +++ ++++   +  TR+Y+
  S:     1 MILFGSTGSIGVNALKLAALKNIRISALACGDNIALLNEQIARFKPKFVAIKDSKNKHLVKHNRVFIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLK------GAKFLPVDSEHAAL-KFLLEGKKNIAKLYITASGGAFYKYKIKDLNQVSVKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKEIDALIEPRSLVHAMCEFKNGASTAYFSKADMKLAISDAI--FEKQDTPILEAVDFNKMPALKFHPISTKKYPIFKLKNAFLKEPN--LGVIINAANEVGVYNFLENKSGFLDITKCIFKALDYFGVPKISSIEEVFEYDFKTREYL 354
>gi|119492300|ref|ZP_01623647.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya sp. PCC 8106] >gi|119453185|gb|EAW34352.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lyngbya sp. PCC 8106] (394 aa)
Score = 495, Expect = 5.1e-48, Identities = 128/356 (35%), Positives = 206/356 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKT---KNTVNSFE-------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII--ALENTEVNDLKDILNLNKNTRKYV 367
           K + + G+TG+IG  +L+I+    + + +VG +   N     E I  F P         K    K  + + +             E+    + + ++  +VG +GL  TL A+K   D+ALANKE+L+  G ++  L +    ++ P DSEHS+++  L+    K ++ +I+T SGG F      +L ++  ADA+KHPNW+MG+KI++DSATMMNK  E+IEA++LF  +   I +  H QSIIHS+I+  D S +A +  PDM+L +   +S  E        L      NLTF   D  K+  +  AY       RA   +P ++NAANE+A+ LF + KI FL+I ++IE        +N++   L+DI+ +++  R+ V
  S:     2 KAITLLGSTGSIGTQTLDIVNDHPDKFRIVGLAARRNVTLLAEQIRTFRPQIAAICDESKLPELKAAIANLDPQPILLAGESGVVEVARYGDSEAVVTGIVGCAGLLPTLAAIKAGKDIALANKETLIAGGPVVNPLIQEYGVKLLPADSEHSAIFQCLQGVPEKGLRRIILTASGGAFRDWPVEKLADVKVADAIKHPNWSMGRKITVDSATMMNKGLEVIEAHFLFGLDYDNIDIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYAMSWPERIYTNWEPLDLVKAGNLTFKAPDNHKYPCMSLAY----AAGRAGGTMPAVLNAANEQAVALFLDEKIGFLEIPKVIEYVCDRHQTDNSQNPSLEDIIAVDQWARQEV 381
>gi|160900374|ref|YP_001565956.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Delftia acidovorans SPH-1] >gi|160365958|gb|ABX37571.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Delftia acidovorans SPH-1] (392 aa)
Score = 495, Expect = 5.1e-48, Identities = 122/362 (33%), Positives = 204/362 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRF----------PNALVFSPSVKTK-------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           K+K+ V G+TG+IG ++L+++   +E+YE+   S     +  L     F          P+A + +  +++         + ++ E++      D ++ A+VG +GL   L A +    L LANKE+LVV G L  D  +   + + P+DSEHS+++  L  +       +  L++T SGGPF  ++   L  I    A  HPN++MG+KIS+DSATMMNK  E+IEA +LF+    KIKV  H Q I+HSM++F D S +A +  PDM++ I  GL+      +    L F  L+ LTF E D  ++  +H ++  L   +     ++NA+NE A+  F E ++ F  I  +  + +  L    +  L D+L L+   R+  +  ++
  S:     2 KQKITVLGSTGSIGTNTLDVVARHREHYEVFALSAATQVDLMLRQCAEFKPRYAVMASAPHAKLLAEQLRSNGLATEVLQSPDALEQIASHPEVDAVMAAIVGAAGLAPCLAAARAGKRLLLANKEALVVGGALFMDTVKRHGATLLPIDSEHSAIFQCLPEDRASWPDRVDSLLLTASGGPFRLRDPATLSEITPEQACAHPNFSMGRKISVDSATMMNKALEVIEARWLFDMAPDKIKVVIHPQQIVHSMVQFKDASVLAQLGTPDMRVPIASGLAWPRRIASGAAPLDFAKLSALTFEEADAVRFPGLHLSWQALL-ASEGTTAVLNASNEVAVAAFLERRLAFDRIHAVNLRTLETLLPPTLGSLDDLLALDAQAREIAHTVAR 388
>gi|33152294|ref|NP_873647.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus ducreyi 35000HP] >gi|39930850|sp|Q7VM27|DXR_HAEDU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|33148517|gb|AAP96036.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Haemophilus ducreyi 35000HP] (396 aa)
Score = 495, Expect = 5.1e-48, Identities = 131/354 (37%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYE-------------------KALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K +++ GATG+IG S+L +IE   + Y++       N E                   KA +++     AL  +  V T     +  EL    + +I++ A+VG +GL  TL A+K    + LANKESLV  G +  D  R S + + PVDSEH++++ SL    ++           +  +I+T SGGPF +K   E  +I    A+ HPNW+MGKKIS+DSATMMNK  E IEA +LFN   +++++  H QSIIHSM+++ D S IA M  PDM+  I   ++      + +  L F  L  LTF E D  ++  +  A +    + +     +NAANE A+  F   +I+F +I  I    +  +    VND+ D+L++++  R+
  S:     2 KNIVILGATGSIGQSTLSVIEHNPDQYQVFALVGGKNVELMATQCSQFKPKFAALVDEKAAKLLAEQLKALNLTTQVLTGE--QAICELAAHPDANIVMAAIVGAAGLLPTLAAVKAGKQILLANKESLVTCGQIFIDEARKSGATLLPVDSEHNAIFQSLPLVAQQKIGFCPLAELGVSRIILTGSGGPFREKSLAEFDSITPEQAIAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNASVEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAHTMAYPNRIPSGVMPLDFGKLTELTFIEPDFKRYPNLKLAIE-ASAEGQYATTALNAANEIAVDAFLNRQIRFTEIERINSTVVENIAPLRVNDVADVLHIDQLARE 387
>gi|57238389|ref|YP_179520.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni RM1221] >gi|73919258|sp|Q5HT65|DXR_CAMJR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|57167193|gb|AAW35972.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni RM1221] (356 aa)
Score = 495, Expect = 6.4e-48, Identities = 133/354 (37%), Positives = 208/354 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++FG+TG+IG ++L++   +N  +   +  +N     E I RF    V     K K+ V            E++L +    ++LNA+VGF+GL  TL A +   ++ALANKESLVVAG  ++       ++  PVDSEH++L   L    K I +L IT SGG FYK +  +L  ++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L++ K+I      +S++H+M +F + +  A  S  DMKL+I   +  +E + T ++  + F+ +  L F  I   K+        FL+  N  + +I+NAANE  +  F ENK  FLDI + I KA+      +++ ++++   +  TR+Y+
  S:     1 MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFKPKFVAIKDSKNKHLVKHDRVFIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLK------GAKFLPVDSEHAAL-KFLLEGKKNIAKLYITASGGAFYKYKIKDLNQVSLKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKEIDALIEPRSLVHAMCEFKNGASTAYFSKADMKLAISDAI--FEKQDTPILEAVDFSKMPALKFHPISTKKYPIFKLKNTFLKEPN--LGVIINAANEVGVYNFLENKSGFLDIAKCIFKALDHFGVPKISSIEEVFEYDFKTREYL 354
>gi|117925143|ref|YP_865760.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Magnetococcus sp. MC-1] >gi|117608899|gb|ABK44354.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Magnetococcus sp. MC-1] (386 aa)
Score = 494, Expect = 6.7e-48, Identities = 122/353 (34%), Positives = 196/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS---------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLT--FSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + + G+TG+IG ++L++  +  + Y +V  S   N  + +     F   +V     K    V                   E+    +  + ++A+VG +GL  TL A++   D+ALANKE LV+AG L          R+ PVDSEHS+++   +N+N  ++ L++T SGGPF      +L  +  A AV HPNW+MG+KIS+DS+TMMNK  E+IEA++LF    ++I V  H QSI+HSM+++ D S +A M VPDM+  I   L+  E     +  L    L     + + D   +  +  AY+ L     A P+++NAANE A+  F E  I +L+I ++I K +  L +  +  +  +  ++   R
  S:     4 KGIAILGSTGSIGVNTLDVCAQHPDRYRVVALSAGQNSARMIAQAKHFRPEVVAMADTKAAAEVTEALAGENIRVLAGEEGVIEVASWASAQMTVSAIVGGAGLRPTLAAIRARKDIALANKECLVMAGSLFMAEIGRYQVRLIPVDSEHSAIFQVFQNSN-WMRRLVLTASGGPFRGWRRQQLHGVTPAQAVAHPNWSMGRKISVDSSTMMNKGLEVIEAHWLFGLPAEQIDVVVHPQSIVHSMVEYQDGSVLAQMGVPDMRTPIAVALAWPERIPTTVKSLDLPKLGQLDFYDKPDKRDFPCLELAYEALRRGGIA-PVVLNAANEIAVAAFLEGAIGYLEIADLIVKTMDYLGHAPIESIDHLFAVDLQAR 375
>gi|121612425|ref|YP_001001003.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005906|ref|ZP_02271664.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 81-176] >gi|166218252|sp|A1W0W2|DXR_CAMJJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|87249929|gb|EAQ72888.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 81-176] (356 aa)
Score = 494, Expect = 7.4e-48, Identities = 133/354 (37%), Positives = 208/354 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++FG+TG+IG ++L++   +N  +   +  +N     E I RF    V     K K+ V            E++L +    ++LNA+VGF+GL  TL A +   ++ALANKESLVVAG  ++       ++  PVDSEH++L   L    K I +L IT SGG FYK +  +L  ++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L++ K+I      +S++H+M +F + +  A  S  DMKL+I   +  +E + T ++  + F+ +  L F  I   K+        FL+  N  + +I+NAANE  +  F ENK  FLDI + I KA+      +++ ++++   +  TR+Y+
  S:     1 MILFGSTGSIGVNALKLAALKNIRISALACGDNIALLNEQIARFKPKFVAIKDSKNKHLVKHNRVFIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLK------GAKFLPVDSEHAAL-KFLLEGKKNIAKLYITASGGAFYKYKIKDLNQVSLKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKEIDALIEPRSLVHAMCEFKNGASTAYFSKADMKLAISDAI--FEKQDTPILEAIDFSKIPALKFHPISTKKYPIFKLKNTFLKEPN--LGVIINAANEVGVYNFLENKSGFLDITKCIFKALDHFGVPKISSIEEVFEYDFKTREYL 354
>gi|78045003|ref|YP_360598.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Carboxydothermus hydrogenoformans Z-2901] >gi|123575927|sp|Q3AB86|DXR_CARHZ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|77997118|gb|ABB16017.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Carboxydothermus hydrogenoformans Z-2901] (384 aa)
Score = 493, Expect = 8.7e-48, Identities = 141/359 (39%), Positives = 213/359 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVF---SPSVKT-----KN-----TVNSFEELLEKTNP--DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           KK+++ G+TG+IG  SLE+IE   + + +V  +   N +  LE   RF     F     S KT     KN     T  S E L     P  D I+ A+ G   L  T+ ALK    + LANKE++V AG +I  L +   + + PVDSEHS+++ +L+      +K+L+IT SGGPF +    +L N+  A+A+KHP W MG KI+IDSAT+MNK  EIIEA++LF    +KI+   H QS+IHS+++F D S +A + +PDM+  IQ  L+  E   N +  L+   +  L+F + D +++  +  A    +  N   P ++NAANE A+  F   KIKFL+I +I+EK +      ++ DL+ IL ++   R+    F
  S:     2 KKLVILGSTGSIGRQSLEVIEFFPDKFSVVALAAAKNGKLLLEQCLRFKVKHAFLADEESYKTYYQEFKNHGILLTTGSKELLNLALLPGVDGIITAIPGTICLLPTIEALKAGKIIYLANKETMVAAGEIITPLMKLGEN-LLPVDSEHSAIFQALRGEKLAWVKKLLITASGGPFREYTLEQLKNVTVAEALKHPRWKMGNKITIDSATLMNKGLEIIEAHFLFQIPYEKIEPVIHPQSVIHSLVEFYDGSVLAQLGLPDMRHPIQYALTYPERFPNNLPGLNLTEIGVLSFEKPDYERFPALKLAIQAGKAGN-IYPAVLNAANEIAVEAFLAGKIKFLEIAQIVEKVLNCFSPVKM-DLETILEVDFRARELARKF 378
>gi|33240686|ref|NP_875628.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|39930845|sp|Q7VB62|DXR_PROMA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|33238214|gb|AAQ00281.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (412 aa)
Score = 493, Expect = 8.8e-48, Identities = 135/326 (41%), Positives = 201/326 (61%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFS------------PSVKTKNTVNSFEELLEKTN----------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAG-WLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           + G+TG+IG  +LEI ++  E +++V  +   N +  ++ I    P  +  +             S+  K   N+   L+   +           D+++  +VG +GL  TL A+K   D+ALANKE+L+ AG  +I +LKRS S R+ P DSEHS+++  L+                  ++ + +T SGG F      +L + +  DA  HPNW+MGKKI++DSAT+MNK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A M  PDMKL I   +S      N IN  S+  LN      LTF E D  K+  +  AY   +     +P ++NAANEEA+ LF E KI FL+I ++IE A
  S:     1 MLGSTGSIGTQTLEIAKECPEQFKVVALTAGRNLDLLIKQIQEHQPEVVALARKDILPELQERLNSLTGKERPNALPHLVAGNDGLNIAASWHSADLVVTGIVGCAGLLPTLAAIKAGKDIALANKETLIAAGPVVIPELKRSGS-RLLPADSEHSAIFQCLQGTPWPENARLSTGIPTPGLRNIQLTASGGAFRDWATEDLKHASIKDATSHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMIELNDSSVLAQMGWPDMKLPILYAMSW----PNRINT-SWRRLNLSEIGKLTFHEPDTSKYPCMELAYAAGKAAG-TMPAVLNAANEEAVALFLEEKIHFLNIPKVIEAA 366
>gi|82701796|ref|YP_411362.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosospira multiformis ATCC 25196] >gi|123544949|sp|Q2YBA1|DXR_NITMU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|82409861|gb|ABB73970.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrosospira multiformis ATCC 25196] (395 aa)
Score = 493, Expect = 1.1e-47, Identities = 118/354 (33%), Positives = 203/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------PNALVFSPSVKTKNT-------VNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + G+TG+IG S+L+++ +  + + +V  + N + +K LE   RF           +A +    ++           V+S E++    + D ++ A+VG +G+  T  A      + LANKE++V+AG +  D+ + + + + P+DSEH++++ SL  +         ++ +++T SGGPF +     L N+    A  HPNW MG+KIS+DSATMMNK  E+IEA++LF    ++I+V  H QSIIHSM+++ D S +A +  PDM+  I   L   E     +N L  F    L F   D +++  +  AY  L +   A P ++NAANE A+  F +  + F  I  +IE  +  +   ++  L D+L  +   R+
  S:     5 RHLTILGSTGSIGVSTLDVVARHPDRFRVVALTANKSVQKILEQCRRFEPRYAVLLDEASAELLQVEIRRAGLATEVLWGVDSLEKVASLPDVDTVMAAIVGAAGIRPTFAAAATGKRVLLANKETMVMAGRIFTDVVKENHATLLPIDSEHNAIFQSLPQHFSGDLRAVGVRRILLTASGGPFRQMPLAALENVTPGQACAHPNWVMGQKISVDSATMMNKGLEVIEAHWLFEASPEQIEVVVHPQSIIHSMVEYVDGSVLAQLGNPDMRTPIAHALGFPERIETGVNPLDMFKVARLDFEAPDFERFPCLRLAYQALASGGSA-PAVLNAANEVAVDSFLKCLMPFTSIPAMIEDVMQTIGRRDIATLDDVLAADGMARE 385
>gi|108804241|ref|YP_644178.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rubrobacter xylanophilus DSM 9941] >gi|108765484|gb|ABG04366.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rubrobacter xylanophilus DSM 9941] (377 aa)
Score = 492, Expect = 1.2e-47, Identities = 128/324 (39%), Positives = 187/324 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEE---------LLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEI--DLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDI 334
           +++VL+ G+TG+IG  +LE+I    E +E+VG S ++N       +  F        S +  +      E         LL     D++LNA+VGF+GL  T+ AL+    LALANKES+V  G  + +L R  +  + PVDSEHS+L+  L+   +E +  L++T SGGPF+  + + L  +   DA++HP W MG KI++DSATMMNK  E+IEA++LF    ++I+V  H QS +H  + FTD S I + +  DM+L I   L  Y  +  L   L F     TF E   DL +  P+  A        RA    P  +NAANE A+  F + +IKFL I
  S:     2 RRRVLILGSTGSIGTQALEVIRARPERFEVVGLSASSNAALLRRQVEEFAPRYAALESGEAGSLAGLGAEVLSGPGATALLAAVPADVVLNAVVGFAGLAATVSALRAGNRLALANKESVVAGGEWVMELARKGA--LIPVDSEHSALFQCLEGRRREEVDGLLLTASGGPFFDLDASRLAGVGPEDALRHPTWRMGAKITVDSATMMNKGLEVIEAHHLFGVPYERIRVAVHRQSAVHGGVLFTDGSAILHAAPTDMRLPIAYALL-YPERLPLARPLPFAGERWTFEEPRNDLFRCLPLAVA------AGRAGGPYPAALNAANEVAVRAFLDRRIKFLQI 335
>gi|88809006|ref|ZP_01124515.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. WH 7805] >gi|88786948|gb|EAR18106.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. WH 7805] (425 aa)
Score = 492, Expect = 1.2e-47, Identities = 130/330 (39%), Positives = 196/330 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--------KTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           K + V G+TG+IG  +L+I+E   E + +V  S   N    +E I R    LV   ++  ++ +   E+ L+        K  P                  D+++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F      +L N   ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDMKL I   +S           L    +  LTF + D  K+  +  AY       RA   +P ++NAANEEA+  F E +I FLDI ++IE +
  S:    10 KAISVLGSTGSIGTQTLDIVEGFPEQFRVVALSAGRNLSLLVEQIQRHSPELV---ALADESLLPELEQRLQALPAEHQPKRKPQLVGGPSGLNVAASWDTADLVVTGIVGCAGLLPTLAAIRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGIPTPGLRRIQLTASGGAFRDWAAADLENATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMIELADSSVLAQLGWPDMKLPILYCMSWPSRLETPWRRLDLTEVGQLTFKKPDPAKYPCMELAY----AAGRAGGTMPAVLNAANEEAVAQFLEERIHFLDIPDLIEAS 379
>gi|39930842|sp|Q7V6J8|DXR_PROMM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|33640880|emb|CAE21336.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. MIT 9313] (412 aa)
Score = 492, Expect = 1.3e-47, Identities = 131/326 (40%), Positives = 191/326 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKTNP----------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLI-EDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           + G+TG+IG  +LEI E+  E + +V  +   N    +E I R  P  +  + +            L  +  P                      D++++ +VG +GL  TL A+K   DLALANKE+L+ A  ++  +LKRS S R+ P DSEHS+++  L+                  ++ + +T SGG F      +L     ADA  HPNW+MG+KI++DSAT+MNK  E+IEA+YLF  +  +I++  H QSIIHSMI+  D+S +  +  PDMKL I   LS  E        L+   +  LTF   D  K+  +  AY       RA   +P ++NAANEEA+  F E +I FLDI E+IE A
  S:     1 MLGSTGSIGTQTLEIAEEFPERFRVVALTAGTNVSLVVEQIQRHHPEVVALADASLLPELKQQLNALPSEQQPPHLPQLLAGPEGLNVAASWDSADLVVSGIVGCAGLLPTLAAIKAGKDLALANKETLIAAAPVVLPELKRSGS-RLLPADSEHSAIFQCLQGTPWAENARLSTGVPTPGLRHIQLTASGGAFRDWSAKDLEKATIADATSHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGIDYNQIEIVIHPQSIIHSMIELADSSVLGQLGWPDMKLPILYCLSWPERLETPWRRLNLAEVGELTFRAPDTKKYPCMKLAY----AAGRAGGTMPAVLNAANEEAVAQFLEERIHFLDIPEVIEAA 366
>gi|118590005|ref|ZP_01547409.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stappia aggregata IAM 12614] >gi|118437502|gb|EAV44139.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stappia aggregata IAM 12614] (403 aa)
Score = 492, Expect = 1.3e-47, Identities = 128/355 (36%), Positives = 209/355 (58%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNN------YEKALEIINRFPNALVFSPSVKTK------NTVNSFEELLEKT--NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL----ENTEVNDLKDILNLNKNTRK 365
           K ++ V GATG+IG S  ++IE+  E YE+V    N N        K L+  +         P +K +       T      +LE    + DI++ A+VG +GL  T+ A+++   +ALANKE LV AG L  +  R++ + + PVDSEH++++   + +  + ++++I+T SGGPF      ++  +    A+KHPNW+MG +I+IDSATMMNK FE+IEA +LF  +  ++ V  H QS +H ++++ D S +A +  PDM+  I   L+ +  + N+ +  L    L  LTF   DLD++  +H A + +     A P  +NAA+E A+  F   +I F+DI   IE  + A+       E  D++D+L L+   R+
  S:    13 KTRITVLGATGSIGQSLADLIERNPELYEVVALVSNRNAAGLADMAKTLKAGSAILADEACYPELKDRLSGTGIKTGAGEAAVLEAVDQDTDIVVGAIVGAAGLKPTMAAIRSGRRIALANKECLVCAGDLFMEKIRATGAELLPVDSEHNAVFQVFETDKADMVEKVILTASGGPFRTLSKADMKRVTPQQALKHPNWDMGARITIDSATMMNKGFEVIEASHLFPVSHDQLGVLVHPQSTVHGLVQYKDGSLLAQLGSPDMRTPIAHCLA-FPRRMNVPVKRLDLAELGTLTFEAADLDRFPALHLALEAMRAGGMA-PAALNAADEIAVEAFLTGRIGFMDIPGAIETVLEAMGAGGRLREATDVEDVLALDAEARQ 390
>gi|59802117|ref|YP_208829.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria gonorrhoeae FA 1090] >gi|75432365|sp|Q5F5X0|DXR_NEIG1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|59719012|gb|AAW90417.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria gonorrhoeae FA 1090] (394 aa)
Score = 492, Expect = 1.4e-47, Identities = 125/355 (35%), Positives = 207/355 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS---------VKTKNT----VNSFEELLEKTNPDII---LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + G+TG+IG S+L+++ +  E + +   + +   EK       F P   V + +         +K   T    ++  + L++  + D +   + A+VG +GL   L A +    + LANKE+LVV+G L  +  R++ + + PVDSEH++++  L      + N   I  +I+T SGGPF   + +   +I    AVKHPNW MG+KIS+DSATM NK  E+IEA++LFN    K++V  H QS+IHSM+++ D S +A +  PDM+  I   L   E   + +  L F  L+ LTF + D  ++  + +AY+ + N   A P ++NAANE A+  F + +IKF DI + +   +    +  + D++ +L  +  TR     F
  S:     8 ILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFRPEYAVVADAEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIVGAAGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAIFQVLPRDYTDRLNEHGIDSIILTASGGPFLTTDLSTFDSITPEQAVKHPNWRMGRKISVDSATMANKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGKLDFGALSALTFQKPDFGRFPCLKFAYETI-NAGGAAPCVLNAANETAVAAFLDGQIKFTDIAKTVAHCLAQDFSNGMGDIEGLLAQDARTRAQARAF 389
>gi|152978336|ref|YP_001343965.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Actinobacillus succinogenes 130Z] >gi|150840059|gb|ABR74030.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Actinobacillus succinogenes 130Z] (395 aa)
Score = 491, Expect = 1.5e-47, Identities = 126/361 (34%), Positives = 202/361 (55%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP-----------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           KK+ +++ G+TG+IG S+L +IE  + +   F+    +   L         + F P     +  ++ ++L EK                          D I+ A+VG +GL  TL A++    + LANKESLV  G +  D  +   +++ PVDSEH++++ SL    ++           + ++++T SGGPF   + +E   I    AV HPNW+MGKKIS+DSATMMNK  E IEA +LFN     ++V  H QSIIHSM+++ D S IA M  PDM+  I + ++      + +  L F  LN LTF + D  ++  +  A D       A    MNAANE  +  F   +IKF DI ++    +  ++   ++ + D+L++++  R+    F
  S:     2 KKQNLVILGSTGSIGTSTLSVIEHNSEKYRAFALVGGHNADLMA----EQCVKFQPEFAALDDESAAKKLHEKLTALGCKTQVLSGQKAICELAAHPEADQIMAAIVGAAGLLPTLSAVQAGKRVLLANKESLVTCGQIFIDAVKKYGAQLLPVDSEHNAIFQSLPPQAQQKIGFCPLSELGVSKIVLTGSGGPFRYTDLSEFDGITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNAGADDMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPNRIVSAVAPLDFYQLNGLTFLQPDFSRYPNLKLAIDAFAAGQYAT-TAMNAANEVTVEAFLNRQIKFTDIAKVNATVVEKIQPQIISCVDDVLDVDRQARELAESF 394
>gi|15792669|ref|NP_282492.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149995|ref|ZP_01068223.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|13124151|sp|Q9PMV3|DXR_CAMJE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|85839441|gb|EAQ56702.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|112360661|emb|CAL35458.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni NCTC 11168] (356 aa)
Score = 491, Expect = 1.5e-47, Identities = 132/354 (37%), Positives = 208/354 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++FG+TG+IG ++L++   +N  +   +  +N     E I RF    V     K K+ V            E++L +    ++LNA+VGF+GL  TL A +   ++ALANKESLVVAG  ++       ++  PVDSEH++L   L    K I +L IT SGG FY+ +  +L  ++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L++ K+I      +S++H+M +F + +  A  S  DMKL+I   +  +E + T ++  + F+ +  L F  I   K+        FL+  N  + +I+NAANE  +  F ENK  FLDI + I KA+      +++ ++++   +  TR+Y+
  S:     1 MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFKPKFVSIKDSKNKHLVKHDRVFIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLK------GAKFLPVDSEHAAL-KFLLEGKKNIAKLYITASGGAFYRYKIKDLNQVSVKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKEIDALIEPRSLVHAMCEFKNGASTAYFSKADMKLAISDAI--FEKQDTPILEAVDFSKMPALKFHPISTKKYPIFKLKNTFLKEPN--LGVIINAANEVGVYNFLENKSGFLDIAKCIFKALDHFGVPKISSIEEVFEYDFKTREYL 354
>gi|53805185|ref|YP_113092.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylococcus capsulatus str. Bath] >gi|59797502|sp|Q60BA4|DXR_METCA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|53758946|gb|AAU93237.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylococcus capsulatus str. Bath] (394 aa)
Score = 491, Expect = 1.6e-47, Identities = 120/354 (33%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIIN----RFPNALVFSPSVKTKNTV--------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS---GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG S+L+++ +  + Y +V  S N N ++  E       R+   +    +   +  +               + E++      D ++ A+VG +GL  TL A +   D+ LANKE+LV++G L       S +R+ P+DSEH++++  +    +       ++ +++T SGGPF      EL  +    AV HPNW MG+KIS+DSATMMNK  E+IEA  LFN K   ++V  H QS+IHSM+ + D + +A M  PDM++ I   L+    +ES    ++  +   LN  F   DL ++  +  AY+ +     A P I+NAANE A+  F + ++ F  I  +IE  +  +     + ++ +L  +  TRK
  S:     2 KGICILGSTGSIGVSTLDVLARHPDRYRVVALSANGNVDRLFEQCRAHRPRYAAVIRAEAAACLRERLMAAGLGGIEVLAGPEALEQIASLPEVDSVMAAIVGAAGLLPTLAAARAGKDVLLANKEALVMSGPLFMAEVARSGARLLPIDSEHNAVFQCMPAAYRAGSRAVGVRRILLTASGGPFLHTPLAELETVTPEQAVAHPNWVMGRKISVDSATMMNKGLEVIEACLLFNAKPDDVQVVVHRQSVIHSMVDYVDGTVLAQMGTPDMRIPIAHALAWPDRFESGAESLDLFAVRQLN--FERPDLARFPCLRLAYEAVGAGGTA-PAILNAANETAVAAFLDRRLAFTGIPRVIEHCMARVAPNAADAIESVLQADAETRK 383
>gi|91788551|ref|YP_549503.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Polaromonas sp. JS666] >gi|91697776|gb|ABE44605.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Polaromonas sp. JS666] (395 aa)
Score = 490, Expect = 2.0e-47, Identities = 127/358 (35%), Positives = 211/358 (58%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------PNALVFSPSVKTKN-------TVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           M  KK+++ V G+TG+IG ++L++I    E +E+   S     +  L    +F          P+A + +  VK            ++ E +      D ++ A+VG +GL   + A +    L LANKE+LVV G +     R+  +++ P+DSEHS+++ SL  +     + ++++I+T SGGPF  +E   L ++   +A  HPNW MG+KIS+DSATMMNK  E+IEA YLF    ++I+V  H QSIIHSM+++ D S +A +  PDM++ I  GL+  +  T+    L F  L  +TF   D +++  +  A++ L N       ++NAANE A+  F + +I+F  I  +    + A+  ++VND++ +L L+   R
  S:     1 MSFKKQRITVLGSTGSIGVNTLDVIASHPERFEVFALSAATQVDLMLAQCMQFRPQYAVMVSEPHARLLAEKVKENQLPVQVLWVPDALEMIASHELVDTVMAAIVGAAGLAPCMAAARAGKRLLLANKEALVVGGEVFMQAVRAGGAQLLPIDSEHSAIFQSLPEDPASWPQRVEKIILTASGGPFRTREPGSLRHVTPDEACAHPNWVMGRKISVDSATMMNKALEVIEAKYLFGLTPQQIEVVIHPQSIIHSMVQYRDTSVVAQLGTPDMRVPIAYGLAWPDRITSGARALDFTALATMTFEVPDHERFPGLPLAWEVL-NAPVGSTAVLNAANEAAVAAFLDRRIRFDHIHHVNHATLDAMAVSDVNDIEGLLALDARAR 383
>gi|116073142|ref|ZP_01470404.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. RS9916] >gi|116068447|gb|EAU74199.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. RS9916] (446 aa)
Score = 490, Expect = 2.2e-47, Identities = 134/356 (37%), Positives = 207/356 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFS-----PSVKTKNTVNSFEELLEKT---------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND---LKDILNLNKNTRKYV 367
           K + V G+TG+IG  +L+I     + Y++V  +   N    +E I  + P  +  +     P ++ +      +E                    + D+++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F   +  +L     ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDMKL I   LS  E +      L    +  L+F + D  K+  +  AY       RA   +P +MNAANEEA+  F E KI FLDI  +IE A      T++ D   L D+L +++  R+ V
  S:    34 KAISVLGSTGSIGTQTLDIARDFPDQYKVVALTAGRNLALLVEQIQEYRPEVVALADTALLPELQKRLKAAGVDEAATPQLVGGPDGLNVAASWESADLVVTGIVGCAGLLPTLAAIRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWADNARLSTGVPTPGLRRIQLTASGGAFRDWDARDLEKATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMIELADSSVLAQLGWPDMKLPILYCLSWPERQETPWRRLDLTEVGQLSFRKPDPAKYPCMELAY----AAGRAGGTMPAVMNAANEEAVAQFLEEKIHFLDIPVVIEAA-CERHKTDLIDHPQLDDVLAVDQWARQAV 429
>gi|120603159|ref|YP_967559.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166218260|sp|A1VFB6|DXR_DESVV 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|120563388|gb|ABM29132.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Desulfovibrio vulgaris subsp. vulgaris DP4] (408 aa)
Score = 490, Expect = 2.3e-47, Identities = 125/358 (34%), Positives = 213/358 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFP----NALVFSPSVKTKNTV------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS------GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           + + + G+TG+IG S+L ++E     + +V  +   N EK      R+       L  + + K ++ +              +  +        +L+A VG +GL  T  A ++   + LANKESLV+AG +I      S + I PVDSEH++++ +L+ ++   ++ +I+T SGGPF  +   +L  ++  DA+ HPNW+MG KI+IDSAT+MNK  E+IEA +L+      + V  H QSI+HS++++ D S IA++  PDM+++I   L+          + +L+   S     LTF E DL  +  +  A      + R +P+++NAANE A+ LF  ++I+FLDI +II +A+   + T  +D++ I  L++ TR+ VY+
  S:    19 RTLALLGSTGSIGTSALRVVEAHPHRFRVVALAGARNVEKLAAQAARWRPEHLGVLDAAGAAKLRDLLPAGYAPHIHIGPEGYATMATLPEAGTVLSAQVGAAGLRATEAAARHGKVICLANKESLVLAGDIIRRHCAGSGAVILPVDSEHNAIFQALQGHDPASVRRIILTASGGPFRGRSREDLAAVSCRDALAHPNWDMGAKITIDSATLMNKGLEVIEACHLYGVGIDDVGVVVHPQSIVHSLVEYEDGSQIAHLGTPDMRIAIAYCLTWPGVVDAGVPRLDLVKAGS-----LTFEEPDLHSFPCLELARRAYR-EGRGMPVVLNAANEVAVSLFLSDRIRFLDIPDIIARALDMHDGTTPHDIEGIEALDEATRRTVYE 397
>gi|56419790|ref|YP_147108.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Geobacillus kaustophilus HTA426] >gi|81170446|sp|Q5L0J6|DXR_GEOKA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|56379632|dbj|BAD75540.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) [Geobacillus kaustophilus HTA426] (382 aa)
Score = 490, Expect = 2.3e-47, Identities = 139/356 (39%), Positives = 215/356 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV----------FSPSVKTKNTVNSFEE-LLEKT---NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL--INDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K + + GA+G+IG  +L++I    + + L   S   N E A  +I  F  +LV               + + T+   EE L+E       D+++ A+VG  GL  TL A++    +ALANKE+LVVAG L+    +     + PVDSEHS+++  L+    E + +LI+T SGG F  K   EL ++   +A+ HPNW+MG KI+IDSATMMNK FE+IEA++LF    ++I+V  H +SIIHS+++F D S +A +  PDM++ IQ  L+ Y  +  L     L F +L  L F+ +D D+++ +  AY+    +  ++P ++NAANEEA+  F   +I FL I E IE+A+          L+DI  ++ + R YV
  S:     2 KYISILGASGSIGTQTLDVIRAHPDEFRLAAASVGKNIEAARRLIAEFSPSLVAVADRDAYKVLYREYRGRTTIVYGEEGLIEAAVCPQADVVVTAVVGSVGLVPTLKAIEAGKAIALANKETLVVAGHLVMAAAKRRGVPLLPVDSEHSAIFQCLQGERMEHVDKLILTASGGSFRDKTRRELAHVTVEEALCHPNWSMGAKITIDSATMMNKGFEVIEAHWLFGLPYERIEVVLHRESIIHSLVQFRDTSVLAQLGTPDMRVPIQYALA-YPKRLPLPSAKPLDFISLGALHFAPVDFDRYRCLRLAYE-AGKRGGSLPTVLNAANEEAVAAFLAGRIPFLAIEEWIERALERHRPVSNPQLEDIREIDADARAYV 377
>gi|21242168|ref|NP_641750.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas axonopodis pv. citri str. 306] >gi|24211662|sp|Q8PML1|DXR_XANAC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21107584|gb|AAM36286.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas axonopodis pv. citri str. 306] (396 aa)
Score = 489, Expect = 3.2e-47, Identities = 122/354 (34%), Positives = 205/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELVG--FSFNNNYEKALEI--INRFPNALVFSPSV---------------KTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK--NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++V VFGATG+IG S+L++I +    L     S  +  ++ L +   +R  +AL+   ++               +      + + L      D ++ A+VG +GL  TL A +    L LANKESLV+AG L+     ++ + I P+DSEHS+++  L+  + ++ ++ +I+T SGGPF  ++   L  +  A AV HP W+MG KIS+DSAT+MNK  E+IEA++LF    ++I V  H QS++HS+++F D S +A + +PDM+ ++  GL+  E   + +  L   +   L F   D   +  +  A+D L     A P I+NAANE A+  F + ++ FL I  ++E  +  L+    + L  +L  +   R+
  S:     7 RQVAVFGATGSIGTSALDVIARHPERLRASVLSAGSKVDELLALCATHRPAHALIADATLYPALRDGLRARGLATQAHAGAEALDALASSDACDTVVAAIVGAAGLPSTLAAARAGKRLLLANKESLVLAGELLTRTAAAAGAEIIPIDSEHSAIFQCLRSCDASRGVRRVILTASGGPFRGRDRAALAAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGEQIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVESGVGGLDLLSQGRLDFEAPDTAAFPCLRLAWDALRAGGTA-PAILNAANEVAVSAFLQGQVGFLAIPALVEHTLTTLQRHNADSLDTLLFADAQARQ 383
>gi|88857971|ref|ZP_01132613.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudoalteromonas tunicata D2] >gi|88819588|gb|EAR29401.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudoalteromonas tunicata D2] (405 aa)
Score = 489, Expect = 3.2e-47, Identities = 119/354 (33%), Positives = 211/354 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN-YELVGFSFNNNYEKALE----------IINRFPNALVFSPSVKT---KNTV----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-----------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +++ V G+TG+IG ++L+++ + +  E+   + + NY+   +          ++   P A +    + T   K  V     +  ++   +  D+++ A+VG +GL  TL A++    + LANKE+LV++G L  +  +  ++ + P+DSEH++++ +L  +            + + ++++T SGGPF  +  + L ++   +AV HPNW+MG+KIS+DSATMMNK  E IEA ++FN +   I+V  H QSIIHSM+++ D S IA M  PDM+  I   L+        +  L F+ L   +F + D  ++  +  A D   +  +A    +NAANE ++  F   KI+F DI+ I    + AL  TE N L++I+ ++   R+
  S:    10 QRLCVLGSTGSIGVNTLDVVSRNSGIEVFALTAHYNYQLMCQQCLAFKPKYAVMADEPTAKLLQEQLNTHDCKTQVLFGPQALCDVASASEVDVVMAAIVGAAGLAPTLAAVEQGKKILLANKEALVMSGRLFIEKVKQHNAILLPIDSEHNAIFQALPLDAHTPCYTKTLTEQGVSKILLTGSGGPFLTRALDTLADVTVEEAVSHPNWSMGQKISVDSATMMNKGLEFIEAKWMFNCQADDIEVIIHPQSIIHSMVQYQDGSVIAQMGNPDMRTPIAHALAFPNRIDAGVAPLDFSKLAQFSFCKPDFARYPNLKLAIDACAD-GQAATTTLNAANEVSVAAFLAKKIRFTDIYTINAAVLSALVCTEPNTLEEIMAIDFAARQ 394
>gi|57241717|ref|ZP_00369662.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter lari RM2100] >gi|57017610|gb|EAL54387.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter lari RM2100] (359 aa)
Score = 488, Expect = 3.3e-47, Identities = 131/354 (37%), Positives = 211/354 (59%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           ++V G+TG+IG ++L I +++N  +   S   N +   E I  F    V     K K+ V+           ++++ +     ++NA+VGF+GL+ +L+A K    LALANKESLVVAG      K   +S+I  +DSEH++L   L +  K+IK+L IT SGG FYK +  +L N++  +A+KHPNW+MG KI+IDSA+M NK FEIIEAY+L+  K+I      +S++H++ +F D    A  S  +M+LSI Q +   E   + I +L    + +L F +I L K+       + L+N +  + +++NAANE  +  F +N++ FLDI + I KA+      ++N ++D+   +K  R Y+
  S:     1 MIVLGSTGSIGVNTLFIAKEKNISIEALSCGKNIKLLNEQIALFKPKFVCIQDEKDKHLVDHKNIFCAQDGLKKMISECKSKFVVNAIVGFAGLNSSLIAQKLGKTLALANKESLVVAG------KFFDTSKIKAIDSEHAAL-KCLIDKRKDIKKLFITASGGAFYKYKIKDLKNVSVKEALKHPNWSMGAKITIDSASMCNKLFEIIEAYHLYGIKQIDAVIEKKSLVHALCEFKDGGISAYFSHANMRLSIAQAILD-EHDQSFIENLDLLAMPSLKFEKISLKKYPIFMLKDELLKNPD--LGVVINAANEYLVYKFLKNQMGFLDISKGIFKALDHFGVPKINQIEDVFEYDKRVRLYL 354
>gi|160872275|ref|ZP_02062407.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rickettsiella grylli] >gi|159121074|gb|EDP46412.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rickettsiella grylli] (405 aa)
Score = 488, Expect = 3.8e-47, Identities = 138/354 (38%), Positives = 216/354 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNN----YEKALEIINRFPNALVFSPS-----------VKTKNTVNSFEELL----EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAG-WLIEDLKRSSSSRIYPVDSEHSSLYDSLK------NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + GATG+IG  +L++I +   ++++V  S + N    +++ L+   R+  A+V S S           V  K  V   EE L         D ++ A+VG +GL  TL A+++   + LANKE+L++AG  LIE+  R+  S I P+DSEH++++  L       N    +K++I+T SGG    K F++L     A A +HPNW MG+KISIDSAT+MNK FE+IEAY+LF  +  KI+V  H QSI+HS I+F D S +A +  PDM++ I   L+  E  +N    L+   +  L F  +D +++  +  AY  L+    A   I+NAANE A+  F E KI F DI ++ ++ +  + +  ++DL  IL  +   R+
  S:     2 KSLCILGATGSIGTHTLDVIREHPLHFKVVALSAHYNIDLLFQQCLKFTPRY--AVVSSQSLAEDLRKRLLAVALKTEVLFGEEALNFIASLDTVDTVVAAIVGAAGLFPTLAAIQSKKQVLLANKEALIMAGPLLIEEALRAKISLI-PIDSEHNAIFQCLHGQVTPGNCGNTLKKIILTASGGALRHKPFDQLQRATPAQASQHPNWTMGQKISIDSATLMNKGFEVIEAYFLFGLSPDKIEVVLHPQSIVHSFIEFLDGSLLAQLGHPDMRIPISYALAFPERLSNAAFSLNLLKVGRLDFLPVDENRYPCLGLAYRALQIGGTAT-TILNAANEIAVQAFLEGKIYFTDIAKLNQEVLEKIHSRPISDLHVILEDDNLARE 382
>gi|114566424|ref|YP_753578.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337359|gb|ABI68207.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (409 aa)
Score = 487, Expect = 4.5e-47, Identities = 120/355 (33%), Positives = 202/355 (56%)
  Q:     3 EGEKMENKKKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL----LEKTNP--------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           EG  M  K+  V++ G+TG+IG  +L++I    +++ ++G +  +  +   E I  +    +   S+  K ++    EL    ++K  P              DI+L AL G  G+  TL A++    +ALANKE+LV AG ++    R   + I PVDSEHS+++  L    + +  + +T SGGPF      ++  ++   A++HPNW+MG KI+IDSAT+MNK  E+IEA++LF     +I+V    +SIIHSM++  D +++A++  PDM++ IQ  L+  E   + +  L F  L  + F   D   +  +  AY+        +P ++NAANE A+  F + +I F  I  ++E+ +   +  +  DL  IL
  S:    22 EGFIMNKKQSNVIILGSTGSIGIQALDVIRMHSDSFRVLGLAAKDEVQLLREQIELYQPEYI---SLADKESIKKLGELGGSGVKKALPGVEGLCELASLPEADIVLVALSGAIGILPTLAAIEARKRVALANKETLVAAGDIVMQEARQQGALIIPVDSEHSAIFQCLAGEARHLHRIWLTASGGPFRDFTREQMKAVDLEMALQHPNWSMGPKITIDSATLMNKGLEVIEAHHLFGVGYNEIEVLLQAESIIHSMVELQDGAFLAHLGRPDMRIPIQYALTYPERMESPVERLDFRTLGAIHFGRPDTQAFPALALAYE-AGKAGGTMPAVLNAANEVAVNSFMQRRIDFARIPLLVERVMEMHDMVKQPDLDSIL 395
>gi|15642252|ref|NP_231885.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|147674244|ref|YP_001217769.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae O395] >gi|153221270|ref|ZP_01952285.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae MAK 757] >gi|153823580|ref|ZP_01976247.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae B33] >gi|194533257|ref|YP_002068675.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae MO10] >gi|172047608|sp|A5F615|DXR_VIBC3 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|13124139|sp|Q9KPV8|DXR_VIBCH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|9656815|gb|AAF95398.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|124119799|gb|EAY38542.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae MAK 757] >gi|125619309|gb|EAZ47838.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae MO10] >gi|126518896|gb|EAZ76119.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae B33] >gi|146316127|gb|ABQ20666.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae O395] (402 aa)
Score = 487, Expect = 4.8e-47, Identities = 132/363 (36%), Positives = 212/363 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKT-------KNTVNSFEELLEKT---------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYD--FLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI--IALENTEVN--DLKDILNLNKNTRKYVYDFSKNK 374
           +K+ + GATG+IG S+L++I +  + + +V      N  K  ++  ++ P   V + +          KN   + E L  +          + D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D    S + + PVDSEH++++  L             +   I  +++T SGGPF   +   L ++    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFNT  +++KV  H QS+IHSM+++ D S IA +  PDM   I   ++  E  T  +  L F  L  LTF E+D  ++  +  A D  FL    +     +NAANE A+  F + KI+F DI  I ++ +  +   NT+++  DL+ +L L+   R + +   K +
  S:     2 RKLTILGATGSIGASTLKVIAQNPQQFSIVALVAGVNVAKMYQLCQQWRPKYAVMATASAASELQGLLKNQAMATEVLYGEEAMCQVAALDDVDTVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVAQSGAELMPVDSEHNAIFQCLPTEIQTQLGRCDLSQHGIDHILLTGSGGPFRYSDLATLDSVTPEQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNTSREQLKVLIHPQSVIHSMVQYQDGSVIAQLGEPDMATPISYAMAYPERVTAGVPALDFTRLQQLTFMEVDFARYPCLQLAMDACFL---GQHATTSLNAANEVAVDAFLKRKIRFTDIALINDQVLSKVCATNTQLHCRDLESLLELDTMARHFAHQVLKER 400
>gi|87301068|ref|ZP_01083909.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. WH 5701] >gi|87284036|gb|EAQ75989.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. WH 5701] (432 aa)
Score = 487, Expect = 5.1e-47, Identities = 130/328 (39%), Positives = 194/328 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF---------PNAL--------VFSPS---VKTKNTVNSFEELLEKT---NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           K + V G+TG+IG  +L I+E+  E + +V  +   N +  ++ I R          P AL           PS    +    V   E L       + ++++  +VG +GL  TL A+K   DLALANKE+L+ AG ++    ++S SR+ P DSEHS+L+  L+                  ++ + +T SGG F     ++L     ADA  HPNW+MG+KI++DSAT+MNK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L +   LS  E        L    +  LTF   D  K+  +  AY       RA   +P ++NAANE+A+ LF E +I FLDI  +IE
  S:    21 KAISVLGSTGSIGTQTLAIVEEFPERFRVVALTAGRNLDLLIDQIRRHAPEVVALAEPEALPELRRRLEALEPSQQPARQPELVGGSEGLCAAAAWPSAELVVTGIVGCAGLLPTLAAIKAGKDLALANKETLIAAGPVVLPALKASGSRLLPADSEHSALFQCLQGTPWADTARLSTGVPTPGLRRIQLTASGGAFRDWPASDLAKATVADATSHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMVELADSSVLAQLGWPDMRLPLLYCLSWPERLETPWRRLDLTEVGQLTFRAPDEQKYPCMGLAY----AAGRAGGTMPAVLNAANEQAVALFLEERIAFLDIPLLIE 388
>gi|86150958|ref|ZP_01069174.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 260.94] >gi|88596178|ref|ZP_01099415.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 84-25] >gi|85842128|gb|EAQ59374.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 260.94] >gi|88191019|gb|EAQ94991.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. jejuni 84-25] (356 aa)
Score = 487, Expect = 5.4e-47, Identities = 131/354 (37%), Positives = 207/354 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++FG+TG+IG ++L++   +N  +   +  +N     E I RF    V     K K+ V            E++L +    ++LNA+VGF+GL  TL A +   ++ALANKESLVVAG  ++       ++  PVDSEH++L   L    K I +L IT SGG FY+ +  +L  ++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L++ K+I      +S++H+M +F + +  A  S  DMKL+I   +  +E + T ++  + F+ +  L F  I   K+        FL+  N  + +I+NAANE  +  F ENK  FL I + I KA+      +++ ++++   +  TR+Y+
  S:     1 MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFKPKFVAIKDSKNKHLVKHDRVFIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLK------GAKFLPVDSEHAAL-KFLLEGKKNIAKLYITASGGAFYRYKIKDLNQVSVKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKEIDALIEPRSLVHAMCEFKNGASTAYFSKADMKLAISDAI--FEKQDTPILEAVDFSKMPALKFHPISTKKYPIFKLKNTFLKEPN--LGVIINAANEVGVYNFLENKSGFLGITKCIFKALDHFGVPKISSIEEVFEYDFKTREYL 354
>gi|153951073|ref|YP_001397573.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. doylei 269.97] >gi|166218251|sp|A7H243|DXR_CAMJD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|152938519|gb|ABS43260.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter jejuni subsp. doylei 269.97] (356 aa)
Score = 487, Expect = 5.4e-47, Identities = 131/354 (37%), Positives = 207/354 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN---------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK-TNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++FG+TG+IG ++L++   +N  +   +  +N     E I RF    V     K K+ V            E++L +    ++LNA+VGF+GL  TL A +   ++ALANKESLVVAG  ++       ++  P+DSEH +L   L    K I +L IT SGG FYK +  +L  ++  DA+KHPNWNMG KI+IDSATM NK FEIIEAY+L++ K+       +S++H+M +F + +  A  S  DMKL+I   +  +E + T ++  + F+ +  L F +I   K+        FL+  N  + +I+NAANE  +  F ENK  FLDI + I KA+      +++ ++++   +  TR+Y+
  S:     1 MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFKPQFVAIKDSKNKHLVKHDRVFIGQEGLEQILTECQDRLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGSFLK------GAKFLPIDSEHVAL-KFLLEGKKNIAKLYITASGGAFYKYKIKDLNQVSVKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKESDALIEPRSLVHAMCEFKNGASTAYFSKADMKLAISDAI--FEKQDTPILEAVDFSKMPALKFHKISTKKYPIFKLKNAFLKEPN--LGVIINAANEVGVYNFLENKSGFLDIAQCIFKALDHFGAPKISSIEEVFEYDFKTREYL 354
>gi|172060961|ref|YP_001808613.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia ambifaria MC40-6] >gi|171993478|gb|ACB64397.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia ambifaria MC40-6] (398 aa)
Score = 486, Expect = 5.9e-47, Identities = 124/355 (34%), Positives = 200/355 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKT---KNTVNSFEELLEKTNP--------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +E        L F+P V      NT    E  L                         D ++ A+VG +GL  +L A +    + LANKESLV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA+++F     +I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     ++ L    +  L+F + D  ++  +  A   LE    A    +NAANE A+  F E +I F+ I   ++  + AL N   N L D+L  +   R+
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVE------QCLRFAPEVAVVGDANTAAHVEAKLRAAGSKTIVLYGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKESLVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDENEHGGISKIILTASGGPFRTREPATLADVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSFEKPDYTRFPCLALALKALEEGGIA-SAALNAANEIAVEAFLERRIGFMAIAATVDAVLNALPNRSPNGLDDVLAADAEARR 380
>gi|115352097|ref|YP_773936.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia ambifaria AMMD] >gi|122322844|sp|Q0BE21|DXR_BURCM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115282085|gb|ABI87602.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia ambifaria AMMD] (398 aa)
Score = 486, Expect = 5.9e-47, Identities = 124/355 (34%), Positives = 200/355 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKT---KNTVNSFEELLEKTNP--------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +E        L F+P V      NT    E  L                         D ++ A+VG +GL  +L A +    + LANKESLV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA+++F     +I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     ++ L    +  L+F + D  ++  +  A   LE    A    +NAANE A+  F E +I F+ I   ++  + AL N   N L D+L  +   R+
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVE------QCLRFAPEVAVVGDANTAAHVEAKLRAAGSKTIVLYGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKESLVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDENEHGGISKIILTASGGPFRTREPATLADVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLAGDRIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIVQLSFEKPDYTRFPCLALALKALEEGGIA-SAALNAANEIAVEAFLERRIGFMAIAATVDAVLNALPNRSPNGLDDVLAADAEARR 380
>gi|21230824|ref|NP_636741.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769177|ref|YP_243939.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas campestris pv. campestris str. 8004] >gi|24211660|sp|Q8PAV9|DXR_XANCP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|81170463|sp|Q4USQ4|DXR_XANC8 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21112427|gb|AAM40665.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66574509|gb|AAY49919.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas campestris pv. campestris str. 8004] (396 aa)
Score = 486, Expect = 6.1e-47, Identities = 122/354 (34%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEK----ALEIINRFPNALV----FSPSVKTKNTVNSFEELLEKTNP-----------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK--NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++V VFGATG+IG S+L++I +    L     +   +     AL +++R  +A++      P+++               +            D ++ A+VG +GL  TL A      L LANKESLV+AG L+     ++ + I P+DSEHS+++  L+  + ++ ++ +I+T SGGPF  ++  +L  +  A AV HP W+MG KIS+DSAT+MNK  E+IEA++LF    ++I V  H QS++HS+++F D S +A + +PDM+ ++  GL+  E   + +  L       L F   D + +  +  A+D L     A P I+NAANE A+  F + K+ FL I  ++E  +  L+    + L  +L  +   R+
  S:     7 RRVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVDALLALCVLHRPAHAVIADAALYPALRDGLRAAGLTTQAHAGDQALDALAASDACDTVVAAIVGAAGLSSTLAAAAAGKRLLLANKESLVLAGELLTRTAAAAGAEIIPIDSEHSAIFQCLRSCDASRGVRRVILTASGGPFRGRQRAQLAEVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGEQIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVESGVGGLDLLQQGRLDFEAPDTEAFPCLRLAWDALRAGGTA-PAILNAANEVAVSAFLQGKVGFLAIPALVEHTLTTLQRQNADTLNALLFADAEARR 383
>gi|88855349|ref|ZP_01130013.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine actinobacterium PHSC20C1] >gi|88815256|gb|EAR25114.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine actinobacterium PHSC20C1] (360 aa)
Score = 486, Expect = 6.3e-47, Identities = 117/340 (34%), Positives = 195/340 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFP-NALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQ-------NRAI-------PIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN 351
           +K+++ G+TG+IG  +LE+I+  ++ +E+VG +  +N E       RF  + + F              EL+     D+++N + G  GL  TL AL +   LALANKESL+V G L+  + R+   +I PVDSEHS++  +L++  + E++ L++T SGGPF  +    L  +   +A+ HP W+MG  ++ +S+T++NK  E+IEA+ LF     +I V  H QSI+HSM++F D S +A  S PDM+L I  GL                   +  + + LD      W +D L+N+        +A+       P + NAANE+A+  F    I +LDI +++E+ + + +  E++
  S:     2 RKIILLGSTGSIGTQTLEVIDANRDRFEVVGLAAGSNRELVERQAARFGVSHIAFG--------AEQAAELVRDVPADVVVNGITGSVGLGPTLAALDSGAVLALANKESLIVGGALV--MSRAKPGQIVPVDSEHSAIAQALRSGEHSEVRRLVLTASGGPFRGRTRESLRAVTPQEALAHPTWDMGLVVTTNSSTLVNKGLEVIEAHLLFGVPYDRIAVTVHPQSIVHSMVEFVDGSTLAQASPPDMRLPISLGLDWPH--------------RVAGAGVPLDWTTASTWNFDPLDNEVFPAVEMAKAVGAAGLTYPAVFNAANEQAVYAFHAGTIGYLDILDVVEQVVESHDAAELS 337
>gi|48869191|gb|AAT47184.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Taxus cuspidata] (477 aa)
Score = 485, Expect = 8.8e-47, Identities = 128/373 (34%), Positives = 219/373 (58%)
  Q:     3 EGEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEV--NDLKDILNLNKNTRKYVYDFSKNKF 375
           E  K+ +  K   + G+TG+IG  +L+I+ +  + +++V  +  +N     E +  F   LV   SV+ ++     +E L   +  P+I+                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YL+  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   +S  E      +++++  L+      LTF   D  K+  +  AY    +  RA   +  +++AANE+A+ LF + +I +LDIF+++EK      N  V    L++I++ +   RKY    +++  
  S:    73 EDRKVWDGPKPFSIIGSTGSIGTQTLDIVAEHPDKFKVVALAAGSNVTLLAEQVRMFKPKLV---SVRNESLATELKEALADIEHKPEIVYGDEGMVEVAQHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGSFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLYGVDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVP--CSEITWPRLDLCKLGSLTFKAPDCVKYPSMDLAY----SAGRAGGTMTGVLSAANEKAVELFIDERISYLDIFKVVEKTCDKHRNELVLRPSLEEIIHYDLWARKYAASLAQSSL 472
>gi|50954881|ref|YP_062169.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|59797535|sp|Q6AEY1|DXR_LEIXX 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|50951363|gb|AAT89064.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Leifsonia xyli subsp. xyli str. CTCB07] (361 aa)
Score = 484, Expect = 9.6e-47, Identities = 117/335 (34%), Positives = 194/335 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK---TNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE 346
           ++V++ G+TG+IG  +LE++    + +++VG +  ++  +  E   RF          +T       E L+   + D++LN + G  GL  TL AL++   LALANKESL+V G L++  + ++  ++ PVDSEHS+L  +L++    E+  L++T SGGPF  +    L  +  A+A+ HP W+MG  ++ +S+T++NK  E+IEA+ LF     +I+V  H QS++HSM++F D S IA  S PDM+L I  GL G+  +   T L  D +  +   TF  +D + +  +  A   +       P + NAANE+A+  F    I +LDI + +E+ + A E
  S:     4 RRVVILGSTGSIGMQALEVVAANPDRFQVVGLTAGSSAGQLAEQAERFG-------VRETALGAGDSERLVRSVDADVVLNGITGSVGLGPTLAALESGRTLALANKESLIVGGELVK--RAAAPGQLIPVDSEHSALAQALRSGAAGEVSRLVLTASGGPFRGRSRESLRQVTPAEALAHPTWDMGLVVTTNSSTLVNKGLEVIEAHLLFGVPYDRIEVTVHPQSVVHSMVEFVDGSTIAQASPPDMRLPISLGL-GWPDRVPGTGLPLDWTRAH-TWTFEPLDGEAFPAVALA-KCVGVAGGTYPAVFNAANEQAVAAFHAGAIGYLDIVDTVERVVDAHE 334
>gi|71030000|ref|XP_764642.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Theileria parva strain Muguga] >gi|68351598|gb|EAN32359.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative [Theileria parva] (401 aa)
Score = 484, Expect = 1.0e-46, Identities = 123/340 (36%), Positives = 200/340 (58%)
  Q:    18 GATGNIGFSSLEIIEKEN---------YELVGFSFNNNYEKALEIINRF--------PNALVFSPSVKTK----NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-----------------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND--LKDIL 357
           G+TG++G  +L++I   N         +E+V  + N+NY+   + +N F         N       +KTK    N  +   +L    + DIIL A+ G  G+  TL A K+   +AL+NKES+V AG L+  + + S + + PVDSEH++++  L +                    ++K LI+T SGGPF  K++ E  N+   D + HP W MG KI++DS+TMMNK  E++EA++LF      IK+  H + ++HS+++F DNS +  M +PDMKL I   L       N +  L     NL+F E D + +  +   Y+ +       P + NAAN+ A  LF  NKI +  +++I+ + + +    +++D  L+DIL
  S:     2 GSTGSVGTQALDVIRNINKLESNSGPKFEVVALTANSNYKLLSQQVNEFRPEVCHILKNYEKMPELLKTKCKILNEKSDLMDLCRNFDYDIILMAISGCDGIEPTLAAAKSGKKIALSNKESVVSAGSLLSKVVKKSKTTVLPVDSEHNAIFQCLDDGTVDTRKSTYVCSISSQALAKVKNLILTSSGGPFNGKKYTEYKNLRSTDNINHPVWQMGSKITVDSSTMMNKALEVLEAHHLFGLPLDSIKILVHKECVVHSLVEFIDNSVLCQMYLPDMKLPISHALHWPNRTKNALPSLDLRGRNLSFKEADYENFPFLGLGYE-VGRMGGLYPAVFNAANDVANGLFRSNKIDYEKLYQIVRETVESFNKPDLSDDILQDIL 382
>gi|121729976|ref|ZP_01682394.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae V52] >gi|121628280|gb|EAX60792.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio cholerae V52] (402 aa)
Score = 484, Expect = 1.0e-46, Identities = 131/363 (36%), Positives = 211/363 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKT-------KNTVNSFEELLEKT---------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYD--FLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI--IALENTEVN--DLKDILNLNKNTRKYVYDFSKNK 374
           +K+ + GATG+IG S+L++I +  + + +V      N  K  ++  ++ P   V + +          KN   + E L  +          + D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D    S + + PVDSEH++++  L             +   I  +++T SGGPF   +   L ++    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFNT  +++KV  H QS+IHSM+++ D S IA +  PDM   I   ++  E     +  L F  L  LTF E+D  ++  +  A D  FL    +     +NAANE A+  F + KI+F DI  I ++ +  +   NT+++  DL+ +L L+   R + +   K +
  S:     2 RKLTILGATGSIGASTLKVIAQNPQQFSIVALVAGVNVAKMYQLCQQWRPKYAVMATASAASELQGLLKNQAMAIEVLYGEEAMCQVAALDDVDTVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVAQSGAELMPVDSEHNAIFQCLPTEIQTQLGRCDLSQHGIDHILLTGSGGPFRYSDLATLDSVTPEQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNTSREQLKVLIHPQSVIHSMVQYQDGSVIAQLGEPDMATPISYAMAYPERVNAGVPALDFTRLQQLTFMEVDFARYPCLQLAMDACFL---GQHATTSLNAANEVAVDAFLKRKIRFTDIALINDQVLSKVCATNTQLHCRDLESLLELDTMARHFAHQVLKER 400
>gi|194365037|ref|YP_002027647.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stenotrophomonas maltophilia R551-3] >gi|194347841|gb|ACF50964.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stenotrophomonas maltophilia R551-3] (396 aa)
Score = 484, Expect = 1.2e-46, Identities = 121/354 (34%), Positives = 206/354 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSP----------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEI-----KELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL---SGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++V VFGATG+IG S+L++I +  + Y     +     +  L +  +  P   V +                 S +      + ++L      D ++ A+VG +GL  TL A      + LANKESLV+AG L+    + + + I P+DSEHS+++  L++ +  +     + +++T SGGPF  +   +L  +  A AV HP W+MG KIS+DSAT+MNK  E+IEA++LF    ++I V  H QS++HS+++F D S +A M +PDM+ ++  GL      ES    ++ L+   L+  F   D + +  +  A+  ++    A P ++NAANEEA+  F + +I FL I E++  A+  L     + L+ +L+ ++  R+
  S:     8 RRVAVFGATGSIGASTLDVIARHPQRYRATVLAAGRQVQALLALCRQHQPEHAVIADESLFAELRDGLRQAGLSTEAHAGHAALDQLAASDACDTVVAAIVGAAGLSSTLAAAAAGKRILLANKESLVLAGELLTRTAQQAGAEIIPIDSEHSAIFQCLRSRDASVDGAGVRRILLTASGGPFRGRSRADLAAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGVPGERIDVLVHPQSLVHSLVEFVDGSTLAQMGLPDMRTTLAVGLGWPQRIESGVAGLDLLAQGRLD--FEAPDTEAFPCLALAWQAMQAGGTA-PAVLNAANEEAVSAFLQGRIGFLTIPELVANALSTLPTQAADTLEVLLSADQRARQ 387
>gi|116256299|sp|Q9XES0|DXR_MENPI 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor (1-deoxyxylulose-5-phosphate reductoisomerase) (DXP reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|77378042|gb|AAD24768.2|AF116825_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Mentha x piperita] (470 aa)
Score = 483, Expect = 1.4e-46, Identities = 122/328 (37%), Positives = 203/328 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAY---DFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           K + V G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   SVK ++ ++  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L +  + +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   LS  E      +++++  L+L   ++DL   KP +  Y   D      RA   +  +++AANE+A+ +F + KI +LDIF+++E
  S:    75 KPISVIGSTGSIGTQTLDIVAENPDKFRIVALAAGSNVTLLADQVKAFKPKLV---SVKDESLISELKEALAGFEDMPEIIPGEQGMIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPERI--YCSEITWPRLDLC--KVDLTFKKPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVE 426
>gi|116175431|gb|ABJ80680.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Salvia miltiorrhiza] (474 aa)
Score = 483, Expect = 1.6e-46, Identities = 123/328 (37%), Positives = 202/328 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAY---DFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           K + V G+TG+IG  +L+I  +  + + +V  +  +N     + +  F   LV   SV+ ++ V+  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L +  + +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   LS  E      +++S+  L+L   ++DL   KP +  Y   D      RA   +  +++AANE+A+ +F + KI +LDIF+++E
  S:    79 KPISVIGSTGSIGTHTLDIFAENPDKFRIVALAAGSNVTLLADQVRAFKPKLV---SVRDESLVSELKEALADFEDKPEIIPGEQGMIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPERI--YCSEISWPRLDLC--KVDLTFKKPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVE 430
>gi|78184266|ref|YP_376701.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. CC9902] >gi|78168560|gb|ABB25657.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. CC9902] (417 aa)
Score = 482, Expect = 1.7e-46, Identities = 126/330 (38%), Positives = 194/330 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP--------------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           K + V G+TG+IG  +L+I++   + + +V  +   N    +E I R    LV   ++  +  +   ++ LE  +P                          ++++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F      +L     ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDMKL I   LS           L    +  L+F   D +K+  +  AY       RA   +P +MNAANEEA+  F E +I FLDI E+IE A
  S:     2 KAISVLGSTGSIGTQTLQIVDDFPDQFRVVALTAGRNLALLVEQIQRHQPELV---ALADEALLPELKQRLEALDPSDRPAQCPEMVGGPDGLEVAASWGSAELVVTGIVGCAGLLPTLAAVRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWADTARLSTGVPTPGLRRIQLTASGGAFRDWNAADLEKATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMVEMADSSVLAQLGWPDMKLPILYCLSWPSRLETPWRRLDLTEVGQLSFRAPDPNKYPCMELAY----AAGRAGGTMPAVMNAANEEAVAQFLEERIHFLDIPEVIEAA 371
>gi|162463886|ref|NP_001105139.1| dxr protein [Zea mays] >gi|9801280|emb|CAC03581.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Zea mays] (472 aa)
Score = 482, Expect = 1.8e-46, Identities = 127/363 (34%), Positives = 218/363 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKY 366
           G +  +  K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   +V+ ++ V+  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++  +   ++ +I+T SGG F     + L ++  ADA+KHPNWNMG+KI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   LS  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ LF + KI +LDIF+++E    A  N  V    L++I++ +   R+Y
  S:    68 GRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPKLV---AVRNESLVDELKEALADCEEKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLSEGALRRIILTASGGAFRDWPVDRLKDVKVADALKHPNWNMGRKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRI--YCSEVTWPRLDLCKLGSLTFRAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVELFIDEKISYLDIFKVVELTCNAHRNELVTSPSLEEIVHYDLWARRY 457
>gi|33865232|ref|NP_896791.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. WH 8102] >gi|39930835|sp|Q7U8C3|DXR_SYNPX 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|33638916|emb|CAE07213.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. WH 8102] (409 aa)
Score = 482, Expect = 1.9e-46, Identities = 129/326 (39%), Positives = 192/326 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV------FSPSVKTK--------------------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           + G+TG+IG  +L+I E+  E + +V  +   N +  ++ I R    LV        P ++ +                    N   S+E      + D+++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F   +  +L N   ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDMKL I   LS           L    +  L+F   D  K+  +  AY       RA   +P +MNAANEEA+  F E KI FLDI  +IE A
  S:     1 MLGSTGSIGTQTLQIAEEFPEQFRVVALTAGQNLDLLVQQIQRHQPELVALANADLLPELQQRLDALGTDRKRPQLVGGPDGLNIAASWE------SADLVVTGIVGCAGLLPTLAAVRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGVPTPGLRRIQLTASGGAFRDWKAEDLENATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMIELADSSVLAQLGWPDMKLPILYCLSWPSRLETPWRRLDLTEVGQLSFRAPDPAKYPCMQLAY----AAGRAGGTMPAVMNAANEEAVAQFLEEKIHFLDIPVVIEAA 363
>gi|16331385|ref|NP_442113.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechocystis sp. PCC 6803] >gi|2496789|sp|Q55663|DXR_SYNY3 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|1001556|dbj|BAA10183.1| sll0019 [Synechocystis sp. PCC 6803] (394 aa)
Score = 482, Expect = 2.0e-46, Identities = 126/360 (35%), Positives = 203/360 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT-----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA--IIALENTEVNDLKDILNLNKNTRKYVYDFS 371
           K++ + G+TG+IG  +L+I+    + +++VG +   N     + +  F P  +    + K ++   +  EL +                   + + ++  +VG +GL  T+ A+    D+ALANKE+L+    ++  L      ++ P DSEHS+++  L+      ++ +I+T SGG F       L  +   DA+KHPNW+MG+KI+IDSAT+MNK  E+IEA+YLF  +   I +  H QSIIHS+I+  D S +A +  PDM+L +   LS  E        L      +L+F E D DK+ P             A+P ++NAANE+A+ LF + KI FLDI  +IEK   +   +NT   DL+ IL  ++  R+ V + S
  S:     3 KRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQAEKLEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGKDIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGGAFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDIVIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSLSFREPDHDKY-PCMQLAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYVGQNTASPDLETILAADQWARRTVLENS 387
>gi|78047028|ref|YP_363203.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|123585496|sp|Q3BVL0|DXR_XANC5 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|78035458|emb|CAJ23103.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas campestris pv. vesicatoria str. 85-10] (396 aa)
Score = 482, Expect = 2.0e-46, Identities = 124/354 (35%), Positives = 203/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEII----EKENYELVGFSFNNNYEKALEIINRFPNALV----FSPSVK-----------TKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK--NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++V VFGATG+IG S+L++I    E+    L+      +   AL   +R  +A++      P+++                 + + L      D ++ A+VG +GL  TL A +    L LANKESLV+AG L+     ++ + I P+DSEHS+++  L+  + ++ ++ +I+T SGGPF  ++   L  +  A AV HP W+MG KIS+DSATMMNK  E+IEA++LF    ++I V  H QS++HS+++F D S +A + +PDM+ ++  GL+  E   + +  L       L F   D   +  +  A+D L     A P I+NAANE A+  F + ++ FL I  ++E  +  L     + L  +L  +   R+
  S:     7 RQVAVFGATGSIGASALDVIARHPERLRASLLSAGSKVDELLALCATHRPAHAVIADAALYPALRDGLRALGLATQAHAGAEALDALASGDVCDTVVAAIVGAAGLPSTLAAARAGKRLLLANKESLVLAGELLTRTAAAAGAEIIPIDSEHSAIFQCLRSCDASRGVRRVILTASGGPFRGRDRAALAAVTPAQAVAHPKWSMGPKISVDSATMMNKGLEVIEAHHLFGLPGEQIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVDSGVGGLDLLRQGRLDFEAPDTAAFPCLRLAWDALRAGGTA-PAILNAANEVAVSAFLQGQVGFLAIPALVEHTLTTLPRHNADSLDTLLFADAQARQ 383
>gi|15241970|ref|NP_201085.1| DXR (1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE) [Arabidopsis thaliana] >gi|12644032|sp|Q9XFS9|DXR_ARATH 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor (1-deoxyxylulose-5-phosphate reductoisomerase) (DXP reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|8131928|gb|AAF73140.1|AF148852_1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis thaliana] >gi|10177457|dbj|BAB10848.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis thaliana] >gi|15010666|gb|AAK73992.1| AT5g62790/MQB2_90 [Arabidopsis thaliana] >gi|15292737|gb|AAK92737.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase DXR [Arabidopsis thaliana] >gi|15451204|gb|AAK96873.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis thaliana] >gi|20148249|gb|AAM10015.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arabidopsis thaliana] >gi|20259653|gb|AAM14344.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXR) [Arabidopsis thaliana] >gi|20466081|gb|AAM19962.1| AT5g62790/MQB2_90 [Arabidopsis thaliana] >gi|21537002|gb|AAM61343.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase DXR [Arabidopsis thaliana] (477 aa)
Score = 481, Expect = 2.3e-46, Identities = 125/355 (35%), Positives = 216/355 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN------------------PD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKY 366
           K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + + RF  ALV   +V+ ++ +N  +E L   +                  P+   ++  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L    + +I P DSEHS+++  ++      ++++I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDM+L I   +S  +      +++++  L+      LTF + D  K+  +  AY       RA   +  +++AANE+A+ +F + KI +LDIF+++E       N  V    L++I++ +   R+Y
  S:    81 KPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVRRFKPALV---AVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVP--CSEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFIDEKISYLDIFKVVELTCDKHRNELVTSPSLEEIVHYDLWAREY 462
>gi|4886307|emb|CAB43344.1| 1-deoxy-d-xylulose-5-phosphate reductoisomerase [Arabidopsis thaliana] (406 aa)
Score = 481, Expect = 2.3e-46, Identities = 125/355 (35%), Positives = 216/355 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN------------------PD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKY 366
           K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + + RF  ALV   +V+ ++ +N  +E L   +                  P+   ++  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L    + +I P DSEHS+++  ++      ++++I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDM+L I   +S  +      +++++  L+      LTF + D  K+  +  AY       RA   +  +++AANE+A+ +F + KI +LDIF+++E       N  V    L++I++ +   R+Y
  S:    10 KPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVRRFKPALV---AVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCIQGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRVP--CSEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFIDEKISYLDIFKVVELTCDKHRNELVTSPSLEEIVHYDLWAREY 391
>gi|17546129|ref|NP_519531.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia solanacearum GMI1000] >gi|21263513|sp|Q8XZI5|DXR_RALSO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|17428425|emb|CAD15112.1| probable 1-deoxy-d-xylulose 5-phosphate reductoisomerase (dxpreductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-c-methyl-d-erythritol 4-phosphate synthase). oxidoreductase protein [Ralstonia solanacearum] (393 aa)
Score = 481, Expect = 2.5e-46, Identities = 115/326 (35%), Positives = 187/326 (57%)
  Q:    13 KVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE----IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS---GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEII 338
           ++ V GATG+IG S+L+++ +  + Y +   + N   +K   +   F  A+    S      +                  + EE     + D ++ A+VG +GL  TL A++    + LANKE+LV++G L  D  R   + + P+DSEH++++  L          +  +++T SGGPF  +    L  +    A  HPNW MG+KIS+DSATMMNK  E+IEA++LFN   ++++V  H QS+IHSM+ + D S +A +  PDM+  I  GL+     E+   L+ DL+     L F   DL ++  +  A+D L     A P ++NAANE A+  F + +I+F +I  ++
  S:     3 RITVLGATGSIGDSTLDVVRRHPDRYRVFALTANTQVDKLAALCRVFRPAMAVVGSATAAEVLRDQLGAEATGIDIRFGPEALEEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRVLLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPSFGHGVARIVLTASGGPFRTRAVETLAEVTPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVERLEVLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPERIEAGVPLL-DLAATG-TLAFEAPDLHRFPCLALAFDALRAGGTA-PAVLNAANEVAVEAFLQRRIRFTEIAAVV 353
>gi|58581593|ref|YP_200609.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84623517|ref|YP_450889.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|123522273|sp|Q2P4B2|DXR_XANOM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|75435659|sp|Q5H1E7|DXR_XANOR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|58426187|gb|AAW75224.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84367457|dbj|BAE68615.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Xanthomonas oryzae pv. oryzae MAFF 311018] (396 aa)
Score = 481, Expect = 2.5e-46, Identities = 124/354 (35%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELVG--FSFNNNYEKALEII--NRFPNALV----FSPSVK-----------TKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK--NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++V VFGATG+IG S+L++I +    L     S  +  E  L +   ++  +AL+      P+++                 + + L      D ++ A+VG +GL  TL A +    L LANKESLV+AG L+     ++ + I P+DSEHS+++  L+  +  + ++ +I+T SGGPF  ++   L  +  A AV HP W+MG KIS+DSAT+MNK  E+IEA++LF    ++I V  H QS++HS+++F D S +A + +PDM+ ++  GL+  E   + +  L   +   L F   D   +  +  A+D L     A P I+NAANE A+  F + ++ FL I  ++E A+  L     + L  +L  +   R+
  S:     7 RQVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVEDLLALCAAHQPAHALIADAALYPALRDGLRALGLATQAHAGAEALDALAGSDACDTVVAAIVGAAGLPSTLAAARAGKRLLLANKESLVLAGELLTRTATAAGAEIIPIDSEHSAIFQCLRSCDAGRGVRRVILTASGGPFRGRDRAGLAAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGEQIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVESGVGGLDLLSQGRLDFEAPDTAAFPCLRLAWDALRAGGTA-PAILNAANEVAVSAFLQGQVGFLAIPALVEHALTTLPRHNADTLDTLLFADAQARQ 383
>gi|15966741|ref|NP_387094.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sinorhizobium meliloti 1021] >gi|21263531|sp|Q92LP6|DXR_RHIME 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|15076013|emb|CAC47567.1| Probable 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sinorhizobium meliloti 1021] (391 aa)
Score = 480, Expect = 2.8e-46, Identities = 121/338 (35%), Positives = 196/338 (57%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEIIEK----ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL 345
           ++ K+++ + G+TG+IG S+L++IE+    + +E+   + N N     E   R    L  +                 ++     +   E  E+ +   ++ A+VG +GL  TL A +   D+ALANKE LV AG L  D       R+ PVDSEH++++  L+N+ +  ++ +++T SGGPF  K  +E+ ++    A  HPNW+MG KISIDSA+M NK  E+IEA +LF  +  +I+V  H QS++HSM+ +TD S +A +  PDM+ +I   LS Y  + +L +  L F  L  L F   D  ++  I  A   +E +      ++N A E A+  F + +I FL + EI+EK +  L
  S:     5 DDLKRRLTILGSTGSIGTSTLDVIERLGGRDRFEIAALTGNGNIPLLAEQARRIGAELAVTADEDRYGELKDALSGSGIEVAAGRSGLTEAAER-DAGWVMAAIVGNAGLGPTLAAARRGADIALANKECLVSAGSLFIDAVAEGGGRLLPVDSEHNAIFQVLENDQRHAVERIVLTASGGPFRTKTLDEMRHVTADVARAHPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPEQIEVIVHPQSVVHSMVGYTDGSVLAQLGCPDMRTAIGYALS-YPKRCDLPVERLDFARLARLDFEAPDEVRFPAIKLARRAME-EGGVQGAVLNGAKETALDAFIKGRIGFLAMAEIVEKVMDGL 363
>gi|28899086|ref|NP_798691.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839488|ref|ZP_01992155.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio parahaemolyticus AQ3810] >gi|31340048|sp|Q87ME3|DXR_VIBPA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|28807310|dbj|BAC60575.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio parahaemolyticus RIMD 2210633] >gi|149746993|gb|EDM57981.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio parahaemolyticus AQ3810] (401 aa)
Score = 480, Expect = 2.8e-46, Identities = 128/353 (36%), Positives = 204/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVF----------------SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIE----KAIIALENTEVNDLKDILNLNKNTR 364
           +K+ + GATG+IG S+L+++E+  E + +V  +   N EK + +  ++ P   V                 SP+ +    V++   +      D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D      + + PVDSEH++++  L             +   I  +++T SGGPF   +  +L ++  A A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN  +  +KV  H QS+IHSM+++ D S +A M  PDM   I   +S Y S+ +  +  L F  +  LTF + D  ++  +  A D       A    +NAANE A+  F  N++ F DI  I E    K   + +    N L+ +L L++ +R
  S:     2 QKLTILGATGSIGASTLKVVEQNPELFSVVALAAGTNVEKMVALCRQWQPKFAVMADKAAAVALQSEIHTISPNTEVLGGVDALCHVASLEEVDSVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVEQYGAELLPVDSEHNAIFQCLPQQVQTNLGRCNLDEHGISSILLTGSGGPFRYADIADLDSVTPAQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNAARDQLKVIIHPQSVIHSMVQYRDGSVLAQMGEPDMATPIALTMS-YPSRVDAGVKPLDFTQVGELTFLQPDFARYPCLKLAIDACYEGQHAT-TALNAANEVAVDAFLNNRLGFTDIARINELVLHKITASCKPENANSLESLLELDRMSR 390
>gi|7621710|gb|AAF65154.1|AF250235_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Catharanthus roseus] (474 aa)
Score = 480, Expect = 2.9e-46, Identities = 128/370 (34%), Positives = 214/370 (57%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKYVYDFSKN 373
           G K    +K + + G+TG++G  +L+I+ +  + + +V  +  +N     + +  F   LV   SV+ ++ VN  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+     +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I +  H QSIIHSM++  D+S +A +  PDM+L I   LS  +  +   +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ LF + KI +LDIF+++E      +   V    L +I++ +   R Y   F  +
  S:    70 GYKTWEGQKPISIVGSTGSVGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPQLV---SVRNESLVNELKEALSDVDDKPEIIPGEQGVVEVVRHSDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGXPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIS--CSEITWPRLDLCKLGSLTFKTPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVELFIDEKISYLDIFKVVELTCAKHQAELVTSPSLDEIIHYDLGARDYAASFQNS 466
>gi|57239203|ref|YP_180339.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58579161|ref|YP_197373.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia ruminantium str. Welgevonden] >gi|81170444|sp|Q5HB55|DXR_EHRRW 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|57161282|emb|CAH58203.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58417787|emb|CAI26991.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia ruminantium str. Welgevonden] (387 aa)
Score = 480, Expect = 3.0e-46, Identities = 132/358 (36%), Positives = 209/358 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNA----------------LVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K V +FG+TG IG   +++I    ++Y++      +N +  L    +  NA                L+F  +VK  +  +   ++    N D ++ A+VG + L   +  +   V  +ALANKES+V  G L+ +L R  +  + PVDSEH++++  L +N++E I ++ IT SGG     +++++ NI   + +KHP W MGKKIS+DSATM+NK  EIIEAY+LF+ K  K+ V  H ++I+H ++ + D + IA MSVPDMK+SI   LS     + L   L+  + + LTF + D++K+  I   ++ L   N  A  II N ANE A+  F   KI FLDI  +I   +  ++   +N L DIL  +   R+   D
  S:     2 KTVSIFGSTGAIGQMIIDVILASSDSYQVKALVAKSNVQ-LLAFQAKIVNAEMVVIADVGLYKELKDLLFGTNVKI-SVGDVGMQMAASLNVDYVMMAIVGIAALVPMVYLISAGVKVIALANKESVVCGGTLLFNLAREKNVNVIPVDSEHNAIFQILHSNDRENIDKITITGSGGALLYMDYDQMRNITVQETIKHPVWKMGKKISVDSATMVNKSLEIIEAYHLFSVKPEKLDVIIHPEAIVHGIVSYVDGACIAFMSVPDMKISIMYTLSWPNRMSMLYKKLNLASYHQLTFMKPDINKFPGIRLGFEILRTSNIHANSIIFNTANEIAVDAFLNRKIGFLDIVNVIYSTLDMVDCLHINSLSDILECDSIARRVASD 381
>gi|34996397|emb|CAE47438.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hordeum vulgare subsp. vulgare] (484 aa)
Score = 480, Expect = 3.0e-46, Identities = 127/363 (34%), Positives = 218/363 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKY 366
           G +     K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   +++ ++ +N  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L    + +I P DSEHS+++  ++  +   ++ +I+T SGG F      +L ++  ADA+KHPNW+MGKKI++DSAT+ NK  E+IEA+YLF  +   I +  H QSIIHSMI+  D+S +A +  PDM+L I   LS  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ LF + KI +LDIF+++E    A  N  V    L++I++ ++  RK+
  S:    79 GRRSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPKLV---ALRDESLLNELKEALAGCEEMPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLSEGSLRRVILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRV--YCSEVTWPRLDLCKLGSLTFKAPDNVKYPSVDLAY----AAGRAGGTMTGVLSAANEKAVELFIDEKISYLDIFKVVEMTCDAHRNELVTSPSLEEIIHYDQWARKF 468
>gi|150398077|ref|YP_001328544.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sinorhizobium medicae WSM419] >gi|166198585|sp|A6UDH9|DXR_SINMW 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|150029592|gb|ABR61709.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sinorhizobium medicae WSM419] (391 aa)
Score = 480, Expect = 3.1e-46, Identities = 118/332 (35%), Positives = 192/332 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK----ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           K+++ + G+TG+IG S+L++IE+    + +E+   + N N         R    L  +                 ++         E  E+ +   ++ A+VG +GL  TL A +   D+ALANKE LV AG L  D       R+ PVDSEH++++  L+N+ +  ++ +++T SGGPF  K  +E+ ++    A  HPNW+MG KISIDSA+M NK  E+IEA +LFN +  +I+V  H QS++HSM+ + D S +A +  PDM+ +I   LS Y  + +L +  L F  L  L F   D  ++  +  A   +E +      ++N A E A+  F E ++ FLD+ EI+E+ +
  S:     8 KRRLTILGSTGSIGTSTLDVIERLGGRDRFEVAALTGNGNIPLLAAQARRMGAELAVTADGDRYGELKDALSGSGIEVAAGRTGLSEAAER-DAGWVMAAIVGNAGLGPTLAAARRGADIALANKECLVSAGSLFIDAVAEGGGRLLPVDSEHNAIFQVLENDQRHAVERIVLTASGGPFRTKSLDEMQHVTAEAARAHPNWSMGLKISIDSASMFNKALEMIEARHLFNLRPDQIEVIVHPQSVVHSMVGYADGSVLAQLGCPDMRTAIGYALS-YPRRCDLPVERLDFARLARLDFEAPDEVRFPALRLARRAME-EGGLQGAVLNGAKETALGAFIEGRVGFLDMAEIVEEVM 360
>gi|84389786|ref|ZP_00991338.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio splendidus 12B01] >gi|84376887|gb|EAP93761.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio splendidus 12B01] (402 aa)
Score = 480, Expect = 3.5e-46, Identities = 124/331 (37%), Positives = 194/331 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP--------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN--------NKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + + GATG+IG S+L+++E+  + Y +V  +  +N EK L ++ ++  + +   ++   +  +   E+L    P                    D ++ A+VG +GL  T+ A++    + LANKE+LV++G L  D      + + PVDSEH++++  L  N        N E   I  +++T SGGPF   +  EL ++  A A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   +++KV  H QS+IHSM+++ D S +A M  PDM   I   +S  E     +  L F  +  LTF E D  ++  +  A +       A   I NAANE A+  F  N++KF DI  I E  +
  S:     2 RNLTILGATGSIGASTLKVVEQNPDLYSVVALAAGSNVEKMLALVEKWQPSYI---AMACPDAASQLTEILSSNYPNVTVLSGPEGMCQVASLEEVDTVMAAIVGAAGLLPTMAAVEAGKRILLANKEALVMSGQLFIDAVEKYGAELLPVDSEHNAIFQCLPQNVQTHLGRCNLEENGINHILLTGSGGPFRYTDVAELESVTPARAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNASQEQLKVIIHPQSVIHSMVQYKDGSVLAQMGEPDMATPIALTMSYPERTEAGVKPLDFTKVGELTFLEPDFSRYPCLRLAIEACYLGQHATTAI-NAANEIAVDAFLNNRVKFTDIAVINEHVM 364
>gi|78213487|ref|YP_382266.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. CC9605] >gi|78197946|gb|ABB35711.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. CC9605] (415 aa)
Score = 479, Expect = 3.8e-46, Identities = 125/330 (37%), Positives = 191/330 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT------------------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           K + V G+TG+IG  +L+I E+  E + +V  +   N +  +E + R    +V   ++   + +   +E L+                          + D+++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F      +L     ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDMKL I   LS           L    +  L+F   D  K+  +  AY    +    +P +MNAANEEA+  F E KI FLDI  +IE A
  S:     2 KAISVLGSTGSIGTQTLQIAEEFPEQFRVVALTAGRNLKLLVEQVQRHRPEVV---ALADSDLLPELQERLKDAGVTGADAPQLVGGADGLNVAAAWDSADLVVTGIVGCAGLLPTLAAIRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGVPTPGLRRIQLTASGGAFRDWTAADLEKATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMIELADSSVLAQLGWPDMKLPILYCLSWPSRLETPWRRLDLTEVGQLSFRAPDPAKYPCMELAYA-AGSAGGTMPAVMNAANEEAVAQFLEEKIHFLDIPTVIEAA 369
>gi|88658276|ref|YP_507369.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia chaffeensis str. Arkansas] >gi|123493369|sp|Q2GGR4|DXR_EHRCR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|88599733|gb|ABD45202.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia chaffeensis str. Arkansas] (386 aa)
Score = 479, Expect = 3.8e-46, Identities = 130/354 (36%), Positives = 209/354 (59%)
  Q:    12 KKVLVFGATGNIG-------FSSLE------IIEKENYELVGFSFNNNYEKALEIIN----RFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K V +FG+TG IG       F+ L+      ++ K N +L+ F       + + I N    +    L+   ++K  +  +S   +    + D  + A+VG + L      + + +  +ALANKES+V  G L+  L +  +  I PVDSEH+++Y  L ++ K ++++ +T SGGP    +++++ N+   D VKHP W MGKKIS+DSATM+NK  EIIEAYY F+ K  K+ +  H +SIIH+++ + D + IA MSVPDMK+ I   LS  +    L   L+  + N LTF + D+ K+  I   ++ L+  N  A  II+NAANE A+  F   KI+FLDI  ++ + +  +    +N L  IL+ +  +R+
  S:     2 KTVSIFGSTGAIGQMIIDIIFADLDKYQVKVLVAKSNVQLLAFQAKLINAERVVIANVDLYQELKDLLVGTNIKV-SAGDSGMVMATSLDVDYAMMAIVGMAALIPMTYLINSGIKVIALANKESIVCGGTLLLSLAKEKNVNIVPVDSEHNAIYQILSSSKKNLEKITLTASGGPLLSMDYDQIKNVTVQDTVKHPIWKMGKKISVDSATMINKSLEIIEAYYFFSIKAEKLDIIIHPESIIHAIVSYVDGASIAFMSVPDMKIPIMYTLSWPDRSAILCKKLNLASCNQLTFIKPDVYKFPGIKLGFEVLKTSNVHANSIILNAANEVAVDAFLNKKIRFLDIVSVVCETLNLVNYGRINSLSSILDCDLVSRR 376
>gi|121634059|ref|YP_974304.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria meningitidis FAM18] >gi|120865765|emb|CAM09494.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria meningitidis FAM18] (411 aa)
Score = 479, Expect = 3.9e-46, Identities = 130/355 (36%), Positives = 210/355 (59%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS---------VKTKNT----VNSFEELLEKTNPDII---LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + G+TG+IG S+L+++ +  E + +   + +   EK       F P   V + +         +K   T    ++  + L++  + D +   + A+VG  GL   L A +    + LANKE+LVV+G L  +  R++ + + PVDSEH++++  L      + N   I  +I+T SGGPF   + N   +I  A AVKHPNW+MG+KIS+DSATMMNK  E+IEA++LFN    K++V  H QS+IHSM+++ D S +A +  PDM+  I   L   E   + + DL F+ L+ LTF + D D++  +  AY+ + N   A P ++NAANE A+  F + +IKF DI + +   +    +  + D+  +L  +  TR     F
  S:    25 ILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFRPEYAVVADAEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLPRDYAGRLNEHGIASIILTASGGPFLTADLNTFDSITPAQAVKHPNWSMGRKISVDSATMMNKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGDLDFDALSALTFQKPDFDRFPCLKLAYEAM-NAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHCLSQDFSDGIGDIGGLLAQDARTRAQARAF 406
>gi|58617214|ref|YP_196413.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia ruminantium str. Gardel] >gi|75357019|sp|Q5FHA4|DXR_EHRRG 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|58416826|emb|CAI27939.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia ruminantium str. Gardel] (387 aa)
Score = 479, Expect = 4.0e-46, Identities = 134/358 (37%), Positives = 207/358 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEII-------------EKENYELVGFSFNNNYEKALEIIN----RFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           K V +FG+TG IG   +++I              K N +L+ F       + + I +    +    L+F  +VK  +  +   ++    N D ++ A+VG + L   +  +   V  +ALANKES+V  G L+ +L R  +  I PVDSEH++++  L +N++E I ++ IT SGG     + +++ NI   + +KHP W MGKKISIDSATM+NK  EIIEAY+LF+ K  K+ V  H ++I+H ++ + D + IA MSVPDMK+SI   LS     + L   L+  + + LTF + D++K+  I   ++ L   N  A  II N ANE A+  F   KI FLDI  +I   +  ++   +N L DIL  +   R+   D
  S:     2 KTVSIFGSTGAIGQMIIDVILASSDSYQVKALVAKSNVQLLAFQAKVVNAEMVVIADVGLYKELKDLLFGTNVKI-SVGDVGMQMAASLNVDYVMMAIVGIAALVPMVYLISAGVKVIALANKESVVCGGTLLFNLAREKNVNIIPVDSEHNAIFQILHSNDRENIDKITITGSGGALLYMDHDQMRNITVQETIKHPVWKMGKKISIDSATMVNKSLEIIEAYHLFSVKSEKLDVIIHPEAIVHGIVSYVDGACIAFMSVPDMKISIMYTLSWPNRMSMLYKKLNLASYHQLTFMKPDINKFPGIRLGFEILRTSNIHANSIIFNTANEVAVDAFLNRKIGFLDIVNVIYSTLDMVDCLHINSLSDILECDSIARRVASD 381
>gi|114768801|ref|ZP_01446427.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [alpha proteobacterium HTCC2255] >gi|114549718|gb|EAU52599.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [alpha proteobacterium HTCC2255] (389 aa)
Score = 479, Expect = 4.1e-46, Identities = 139/356 (39%), Positives = 220/356 (61%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNY-EKALEIINRFPNALVFSP-----SVKTKNTVNSF------EELLEKTN--PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND---LKDILNLNKNTRKYV 367
           K + +FG+TG+IG ++++I+  +K ++ +V  +   N  E A + I   P  +V S       +K     + F      E LL   +   D+ L +++GF+G+  +L+A K++  LALANKESLV AG L++ + R +++ + PVDSEHS+++  L   N K ++ +I+T SGGPF   +  +LLNI    A  HP WNMGK+ISIDSA+M NK  E+IEA  LF+ +  KI+V  H QSIIHSM+ F D S IA +   DMK +I   ++ Y ++T L +  L F  +  L F  +D  K+  I+ A   +E    A     NAA E+A+  F E KI FLD+++ +E A+    N + ++   + ++++ + +TR  V
  S:     2 KNISIFGSTGSIGSNAVKILLNQKNDFNVVVLTGGKNLKELAKQSILLKPKHIVISDHELLGDLKELLIGHDFDITGGKEALLNAASIPVDVSLQSIIGFAGVECSLIAAKHSRILALANKESLVCAGLLLKQICRDNNTALVPVDSEHSAIFQCLNGENIKTVERIILTGSGGPFLNTKLKDLLNITPNQASNHPKWNMGKRISIDSASMFNKAMELIEANELFDIEASKIEVLIHPQSIIHSMVGFNDGSIIAQLGPADMKGAIGFAIN-YPNRTELQVERLDFTKIKQLDFVSVDHIKFPSINLAIQAIELGGLA-GTAFNAAKEQALDAFLEGKISFLDMYKFVEFALTEYTNNKTDNYTLISEVISQDSHTRSVV 379
>gi|15676111|ref|NP_273242.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria meningitidis MC58] >gi|13124131|sp|Q9K1G8|DXR_NEIMB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|7225403|gb|AAF40641.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria meningitidis MC58] (394 aa)
Score = 478, Expect = 4.8e-46, Identities = 130/355 (36%), Positives = 208/355 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS---------VKTKNT----VNSFEELLEKTNPDII---LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + G+TG+IG S+L+++ +  E + +   + +   EK       F P   V + +         +K   T    ++  + L++  + D +   + A+VG  GL   L A +    + LANKE+LVV+G L  +  R++ + + PVDSEH++++  L      + N   I  +I+T SGGPF   + N    I  A AVKHPNW MG+KIS+DSATMMNK  E+IEA++LFN    K++V  H QS+IHSM+++ D S +A +  PDM+  I   L   E   + + DL F+ L+ LTF + D D++  +  AY+ + N   A P ++NAANE A+  F + +IKF DI + +   +    +  + D+  +L  +  TR     F
  S:     8 ILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFHPEYAVVADAEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLPRDYAGRLNEHGIASIILTASGGPFLTADLNTFDRITPAQAVKHPNWRMGRKISVDSATMMNKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGDLDFDALSALTFQKPDFDRFPCLRLAYEAM-NAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHCLAQDFSDGIGDIGGLLAQDARTRAQARAF 389
>gi|56752507|ref|YP_173208.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus elongatus PCC 6301] >gi|81300322|ref|YP_400530.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus elongatus PCC 7942] >gi|123556787|sp|Q31N26|DXR_SYNP7 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|13124155|sp|Q9RCT1|DXR_SYNP6 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|6689330|emb|CAB65435.1| deoxyxylulose 5-phosphate reductoisomerase [Synechococcus elongatus PCC 6301] >gi|56687466|dbj|BAD80688.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Synechococcus elongatus PCC 6301] >gi|81169203|gb|ABB57543.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus elongatus PCC 7942] (402 aa)
Score = 478, Expect = 4.9e-46, Identities = 128/356 (35%), Positives = 204/356 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKTNP-------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII--ALENTEVNDLKDILNLNKNTRKYV 367
           K V + G+TG+IG  +L+I+E+  + + LVG +   N     E I R  P  +    + +      +  +L    NP                   +I++  +VG +GL  T+ A++   D+ALANKE+L+ AG ++  L +     I P DSEHS+++  ++  +             ++ +++T SGG F       L  +  ADA+KHPNW+MG+KI++DSAT+MNK  E+IEA+YLF  +   I +  H QSIIHS+I+  D S +A +  PDM+L +   LS  +  +   + L      +L F E D  K+  +  AY     +   +P ++NAANE+A+ LF E +I F DI  +IE+A      E  +   L DIL  +   R++V
  S:     2 KAVTLLGSTGSIGTQTLDILEQYPDRFRLVGLAAGRNVALLSEQIRRHRPEIVAIQDAAQLSELQAAIADL---DNPPLILTGEAGVTEVARYGDAEIVVTGIVGCAGLLPTIAAIEAGKDIALANKETLIAAGPVVLPLLQKHGVTITPADSEHSAIFQCIQGLSTHADFRPAQVVAGLRRILLTASGGAFRDWPVERLSQVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGLDYDYIDIVIHPQSIIHSLIELEDTSVLAQLGWPDMRLPLLYALSWPDRLSTQWSALDLVKAGSLEFREPDHAKYPCMDLAYA-AGRKGGTMPAVLNAANEQAVALFLEEQIHFSDIPRLIERACDRHQTEWQQQPSLDDILAYDAWARQFV 391
>gi|9800656|gb|AAD56391.2|AF182287_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Artemisia annua] (472 aa)
Score = 478, Expect = 5.0e-46, Identities = 121/336 (36%), Positives = 208/336 (61%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K  +  K + + G+TG+IG  +L+I+ +  + +++V  +  +N     E I  F   LV   S+K ++ V   +E L  ++  P+II                  +  +VG +GL  T+ A++   ++ALANKE+L+  G  +  L    + +I P DSEHS+++  ++      ++ +I+T SGG F      +L ++  ADA+KHPNW+MG+KI++DSAT+ NK  E+IEA+YL+ +    I +  H QSIIHSM++  D+S +A +  PDM+L I   LS +  +    +++++  L+      LTF   D  K+  +H AY    +  RA   +  +++AANE+A+ +F + KI +LDIF+++E
  S:    67 GTKNWSGPKPISIIGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLAEQIKAFKPQLV---SIKNESLVAELKEALAGSDYMPEIIPGDEGVVEVARHPDCVTVVTGIVGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGFPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGRKITVDSATLFNKGLEVIEAHYLYGSSYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLS-WPDRVQ-CSEITWPRLDLCKLGSLTFKAPDNVKYPSMHLAY----SAGRAGGTMTGVLSAANEKAVEMFLDEKIGYLDIFKVVE 427
>gi|56785666|gb|AAW28998.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Antirrhinum majus] (471 aa)
Score = 478, Expect = 5.1e-46, Identities = 124/336 (36%), Positives = 204/336 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELL--EKTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K     K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + I  F   LV   SV+ ++ +N  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDM+L I   LS +  + +  +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F + KI +LDIF+++E
  S:    67 GHKRWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQIRTFKPQLV---SVRDESLINELKEALFDVEDKPEIIPGEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRVILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPILYTLS-WPDRVH-CSEITWPRLDLCKLGSLTFKVPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFIDEKISYLDIFKVVE 427
>gi|115434044|ref|NP_001041780.1| Os01g0106900 [Oryza sativa (japonica cultivar-group)] >gi|110808217|sp|Q8W250|DXR_ORYSJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor (1-deoxyxylulose-5-phosphate reductoisomerase) (DXP reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|10945254|dbj|BAB16915.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oryza sativa Japonica Group] >gi|17385653|dbj|BAB78606.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oryza sativa Japonica Group] >gi|113531311|dbj|BAF03694.1| Os01g0106900 [Oryza sativa (japonica cultivar-group)] (473 aa)
Score = 478, Expect = 5.1e-46, Identities = 127/363 (34%), Positives = 218/363 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKY 366
           G +  +  K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   +V+ ++ V+  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L +    +I P DSEHS+++  ++      ++ +I+T SGG F     ++L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDM++ I   +S  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ LF + KI +LDIF+++E    A  N  V    L++I++ +   R+Y
  S:    69 GRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPKLV---AVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRI--YCSEVTWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVELFIDEKIGYLDIFKVVELTCDAHRNELVTRPSLEEIIHYDLWAREY 458
>gi|120599546|ref|YP_964120.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. W3-18-1] >gi|146292457|ref|YP_001182881.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella putrefaciens CN-32] >gi|120559639|gb|ABM25566.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella sp. W3-18-1] >gi|145564147|gb|ABP75082.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella putrefaciens CN-32] (393 aa)
Score = 478, Expect = 5.2e-46, Identities = 125/353 (35%), Positives = 200/353 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEI-INRFPNALVFSPSVKTK------------NTVNSFEELLE---KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           +++ GATG+IG S+L +I      Y + G   N + +K L + I   P       +V  K                  +ELL     +  D ++ A+VG +GL  TL A+     + LANKE+LV++G L  +  + S + + PVDSEH++++  L    +            I  +++T SGGPF + +   L  +  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT+  ++KV  H QS+IHSM+++ D S IA M  PDM+  I   ++  +   + +  L F  +  L+F E D +++ P          Q +    ++NAANE A+  F + +I F  I ++ E  +  + +  +  ++DI+ L+  +R Y
  S:     1 MVILGATGSIGASTLSVISANPLAYCVYGLVANASVDKMLALCITHQPKVAHMVDAVAAKALRAQLPAALNIQVTTGNDELLALVTSSKVDTVMAAIVGAAGLVPTLAAVNAGKRVLLANKEALVMSGELFIEATKRSGATLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHILLTGSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQANQLKVVVHPQSVIHSMVQYIDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFKVGQLSFYEPDFERF-PCLALAMAACAQGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNETCLAFVPSGTMTSIEDIIALDTQSRIY 384
>gi|87306772|ref|ZP_01088919.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Blastopirellula marina DSM 3645] >gi|87290951|gb|EAQ82838.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Blastopirellula marina DSM 3645] (388 aa)
Score = 478, Expect = 5.5e-46, Identities = 125/361 (34%), Positives = 197/361 (54%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYE------KALEIINRF-----PNALV------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           M    + V + GATG+IG S+L++I       V      + +       A + + R+     P A             + +   ++  EL+   + DI++ A+VG +GL  T  AL+    +ALANKE+LV+AG L   L    +++I PVDSEHS+++ +L+     E+  +I+T SGGPF      +L  +  A+A+ HP W MG KI++DSATMMNK  E+IEA +LF+    KI V  H QS++HS++++ D S +A +S PDMKL IQ  +S  E        L F    +  F   DLD++  +    +  E +      ++NAANE A+  F + +I F DI      A+ + +      +  +L L+   R+ V
  S:     1 MTASPQSVALLGATGSIGRSTLDVIAASEGRYVCHLLTAHQKLDELAAAARQFVPRYIVATDPTAAAARDWSDLPEETELRIGPDAIAELVSHADVDIVVAAIVGRAGLEGTWAALEAGKRVALANKETLVLAGGLAMRLAAERNAQILPVDSEHSAIFQALQAGQQSEVARIILTASGGPFRHHSQAQLEQVTTAEALNHPTWKMGPKITVDSATMMNKALEVIEARWLFDMPADKIDVVVHPQSVVHSLVEYVDGSVMAQLSPPDMKLPIQYAMSFPERFPGPARRLDFTVASSWEFEPPDLDRFPALRLGKEAAE-RGGTTGAVLNAANEAAVQSFLDGEISFTDISRACRAALDSHDFDPTPTIDQLLALDAWARREV 381
>gi|94310383|ref|YP_583593.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia metallidurans CH34] >gi|166920132|sp|Q1LNF2|DXR_RALME 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|93354235|gb|ABF08324.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia metallidurans CH34] (392 aa)
Score = 478, Expect = 5.6e-46, Identities = 116/354 (32%), Positives = 197/354 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE----IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +++ + GATG+IG S+L+++ +  + Y +   S +   +K       F  A     S +    +                  + E + E    D ++ A+VG +GL  +L A +    + LANKESLV++G +  D  R   + + P+DSEH++++  L  ++      + ++++T SGGPF  ++ + L +I    A  HP W MG+KIS+DSATMMNK  E+IEA++LF    +KI+V  H QSI+HSM+ + D S +A +  PDM+  I  G++  E   + +  L       L F   DL+++  +  A+D L     A P ++NAANE A+  F   KI+F DI  ++   +    +   + L+ +L  +   R+
  S:     2 QRITILGATGSIGESTLDVVRRHPDRYSVHALSAHRQVDKLAAACVEFRPARAVVGSAEAARELEAKLRAAGVPTEVSYGETALESIAEDAGTDAVMAAIVGAAGLRSSLAAARAGKRVLLANKESLVMSGGIFMDAVREHGATLLPIDSEHNAIFQCLPTSDPRYGAGVSKVLLTASGGPFRTRDPSTLHDITPDQACAHPKWVMGRKISVDSATMMNKGLEVIEAHWLFGAPAEKIEVLIHPQSIVHSMVAYADGSVLAQLGNPDMRTPIAYGMAYPERIDSGVTPLDLTVAGGLHFETPDLERFPCLGLAFDALRAGGVA-PAVLNAANEVAVEAFLNGKIRFTDIARVVATVLEQPADGSADTLEGVLAADSAARR 380
>gi|28572266|ref|NP_789046.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Tropheryma whipplei TW08/27] >gi|39930877|sp|Q83IC8|DXR_TROW8 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|28410397|emb|CAD66783.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Tropheryma whipplei TW08/27] (368 aa)
Score = 478, Expect = 6.0e-46, Identities = 132/328 (40%), Positives = 185/328 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV---NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWA----YDFL---ENQNRAI-------------PIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           ++V++ G+TG+IG  +++ I   ++++ +VG + +       E       A VF     TKNT    +   EL+E T  D++LNA+ G +GL  T   LK    LALANKESL++ G    D+  S   +I PVDSEHS++  ++K+    E+ +LI+T SGGPFY +E   L  I   DA+ HP WNMG  ISI+SATM NK  EIIEA+ LF     +I V  H QSI+HSM+++ D S IA  SV DM L I   LS      N +                    +P+ W     +DFL   EN  R+I             P ++NA+NE A+  F   KI F  I  + E
  S:     2 QRVIIVGSTGSIGTQAIDFILKNRDSFLVVGLAASTQTSLLRE------QAQVFG----TKNTAQGASEAAELIEATEADVVLNAITGAAGLLSTYATLKTGKRLALANKESLIMGGKYFLDMT-SFKGQITPVDSEHSAIAQAMKSGKFSEVNKLILTASGGPFYDRE--SLEGITLKDALDHPTWNMGPMISINSATMFNKGLEIIEAHLLFGIPYSQIDVVIHPQSIVHSMVEYKDGSVIAQASVADMTLPIGYALSWPNRALNAV--------------------RPLEWGARQRWDFLPPTENSMRSINLARRAGEAGGVYPAVLNASNECAVEAFMAGKISFARIIHVTE 324
>gi|41059105|gb|AAR99081.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Plectranthus barbatus] (469 aa)
Score = 478, Expect = 6.1e-46, Identities = 125/336 (37%), Positives = 203/336 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSG----YESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K     K + V G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   S+K ++ V+  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L    +++I P DSEHS+++  ++      ++ +I+T SGG F      +L ++  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   LS     Y S+      L    ++LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F  N+I +LDIF+++E
  S:    66 GRKTWEGPKPISVIGSTGSIGTQTLDIVAESPDKFRVVALAAGSNVALLADQVKAFKPKLV---SIKDESLVSELKEALADVEDKPEIIPGEQGMIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNAKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRVYCSEVTWPR-LDLCKVSLTFKTPDHVKYPSMALAY----AAGRAGGTMTGVLSAANEKAVEMF-INEIGYLDIFKVVE 424
>gi|87299431|dbj|BAE79548.1| 1-deoxyxylulose 5-phosphate reductoisomerase [Chrysanthemum x morifolium] (487 aa)
Score = 477, Expect = 6.6e-46, Identities = 121/336 (36%), Positives = 208/336 (61%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K  +  K + + G+TG+IG  +L+I+ +  + +++V  +  +N     E I  F   LV   S+K ++ V   +E L  ++  P+II                  +  +VG +GL  T+ A++   ++ALANKE+L+  G  +  L    + +I P DSEHS+++  ++      ++ +I+T SGG F      +L ++  ADA+KHPNW+MG+KI++DSAT+ NK  E+IEA+YL+ +    I +  H QSIIHSM++  D+S +A +  PDM+L I   LS +  +    +++++  L+      LTF   D  K+  +H AY    +  RA   +  +++AANE+A+ +F + KI +LDIF+++E
  S:    67 GTKNWSGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLAEQIKAFKPQLV---SIKNESLVAELKEALAGSDYMPEIIPGDEGVVEVARHPDCVTVVTGIVGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGFPEGALRRIILTASGGAFRDWPVEKLKDVKVADALKHPNWSMGRKITVDSATLFNKGLEVIEAHYLYGSSYDNIDIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLS-WPDRVE-CSEITWPRLDLCKLGSLTFKAPDNVKYPSMHLAY----SAGRAGGTMTGVLSAANEKAVEMFLDEKIGYLDIFKVVE 427
>gi|86359421|ref|YP_471313.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhizobium etli CFN 42] >gi|123510590|sp|Q2K3K0|DXR_RHIEC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|86283523|gb|ABC92586.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase protein [Rhizobium etli CFN 42] (396 aa)
Score = 477, Expect = 6.9e-46, Identities = 127/361 (35%), Positives = 199/361 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE----KENYELVGFSFNNNYEK------------ALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRKYVYDFSK 372
           +++ +FG+TG+IG ++L +IE    +EN+E+   + N N E             A+   +R   +L    S       +    L+E  +   D ++ A+VG +GL  TL A +   D+ALANKE LV AG L     R    R+ PVDSEH++++  L+ N +  I+ +I+T SGGPF      E+ ++    A  HPNW+MG KISIDSA+M NK  E+IEA +LF  N  +I+V  H QSIIHSM+ +TD S +A +  PDM+ +I   LS        +  L F  L  L F   D  ++  +  A+     +      ++N A E A+  F E ++ FL + EI E+ +  L +      + D+ + ++  R+   +  K
  S:     9 RRLSIFGSTGSIGRNTLNVIEHLGGRENFEISVLTGNGNVELLARQARSSGARLAVTASDRHYESLKRELSGSGIAVASGKSGLMEAADRDADWVMAAIVGTAGLAPTLAAARRGADIALANKECLVSAGDLFIKAIREGGGRLLPVDSEHNAIFQVLEENQRHAIERVILTASGGPFRNASLEEMKHVTAETARAHPNWSMGLKISIDSASMFNKALEMIEARHLFSLNPDQIEVIFHPQSIIHSMVGYTDGSVLAQLGAPDMRTAIGYALSFPRRPKLPVERLDFAKLARLDFEAPDEVRFPALRLAH-LAMTRGGVQGAVLNGAKEVALEAFIEGRLAFLAMAEITERVMDDLAHLPPAAGMDDVFSADRQARQRAAELMK 391
>gi|118474641|ref|YP_891414.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter fetus subsp. fetus 82-40] >gi|166218249|sp|A0RMI1|DXR_CAMFF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|118413867|gb|ABK82287.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter fetus subsp. fetus 82-40] (360 aa)
Score = 477, Expect = 6.9e-46, Identities = 133/357 (37%), Positives = 202/357 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPD-------------IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL--INDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           +++ G++G+IG +   +  K   +L   +   +Y++    I++F    V+    K KN V        K   D             +++N+LVGFSGL  +L++ K    LALANKESLV  G  ++      +  I P+DSEH  L   LKN    +K++IIT SGG FY    NEL  +    A+KHPNW+MG KI+IDSATM NK FE++EAY+L+  K I  +    S IH++I F D S  A++S  DMKL+I   + G E K  L  I+ LS    N++F+ I+L K+       D L N +  + +I+NAANEE +  F  N+I FLDI   + K++    + +++D   +  ++K  R++   F
  S:     1 MILLGSSGSIGKNVAFLAMKYGIKLDALACKTDYKELNSQISKFNPKFVYIEDNKLKNLVEHSRVFTSKDGIDKFLEACYDEFGSTVVINSLVGFSGLRPSLVSQKLGFKLALANKESLVAGGKFLD------TKSINPIDSEHFGLKFLLKNR-PAVKKMIITASGGAFYDMHINELEFVTAKSALKHPNWSMGAKITIDSATMANKLFEVLEAYHLYGIKDIDAFIERTSCIHALISFMDGSTTAHISRTDMKLAIAHAI-GLEEKEILEPIDILSLK--NISFNTINLKKYPIFTLKKDVLNNPD--LGVIINAANEEMVYKFLNNEISFLDINRAVFKSLDKFGSVKIDDEDTVFEIDKKVREFCKGF 360
>gi|22797429|emb|CAD22156.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Stevia rebaudiana] (473 aa)
Score = 477, Expect = 7.0e-46, Identities = 121/336 (36%), Positives = 207/336 (61%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K  +  K + + G+TG+IG  +L+I+ +  + + +V  +  +N     E I  F   LV   S++ ++ V   +E L   +  P+II                  +  +VG +GL  T+ A++   ++ALANKE+L+  G  +  L R  + +I P DSEHS+++  ++      ++ +I+T SGG F      +L ++  ADA+KHPNW+MGKKI++DSAT+ NK  E+IEA+YL+ +    I++  H QSIIHSM++  D+S +A +  PDM+L I   LS  +  +   +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F + KI++LDIF+++E
  S:    68 GTKNWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLAEQIKAFKPQLV---SIQNESLVGELKEALADADYMPEIIPGDQGIIEVARHPDCVTVVTGIVGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLARKHNVKILPADSEHSAIFQCIQGFPEGALRRIILTASGGAFRDLPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLYGSDYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIS--CSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFIDEKIQYLDIFKVVE 428
>gi|116071089|ref|ZP_01468358.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. BL107] >gi|116066494|gb|EAU72251.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. BL107] (417 aa)
Score = 477, Expect = 7.1e-46, Identities = 126/330 (38%), Positives = 188/330 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKTNPD----------------------IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           K + V G+TG+IG  +L+I++   + + +V  +   N    +E I R  P  +  + +          E L     PD                      +++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F      +L     ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDMKL I   LS           L    +  L+F   D  K+  +  AY       RA   +P +MNAANEEA+  F E +I FLDI E+IE A
  S:     2 KAISVLGSTGSIGTQTLQIVDDFPDQFRVVALTAGRNLALLVEQIQRHQPELVALADAALLPELKQRLEALDPSDRPDQFPQMVGGADGLEVAASWGSAELVVTGIVGCAGLLPTLAAVRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWADTARLSTGIPTPGLRRIQLTASGGAFRDWNATDLEKATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMVEMADSSVLAQLGWPDMKLPILYCLSWPSRLETPWRRLDLTEVGELSFRAPDPKKYPCMELAY----AAGRAGGTMPAVMNAANEEAVAQFLEERIHFLDIPEVIEAA 371
>gi|86146883|ref|ZP_01065202.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio sp. MED222] >gi|85835335|gb|EAQ53474.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio sp. MED222] (402 aa)
Score = 476, Expect = 8.3e-46, Identities = 124/331 (37%), Positives = 195/331 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI--------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + + GATG+IG S+L+++E+  E Y +V  +  +N EK L ++ ++  + V   ++   +  +   E+L   +P+I                    ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D      + + PVDSEH++++  L  N +            I  +++T SGGPF   +  EL ++    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   +++KV  H QS+IHSM+++ D S +A M  PDM   I   +S  +     +  L F  +  LTF E DL ++  +  A +       A   I NAANE A+  F  N++KF DI  I E  +
  S:     2 RNLTILGATGSIGASTLKVVEQNPELYSVVAMAAGSNVEKMLALVEKWQPSYV---AMACPDAASKLTEVLSTNHPNIKVLSGSEGMCQVASLDEVDTVMAAIVGAAGLLPTMSAVKAGKRILLANKEALVMSGQLFIDAVEKYGAELLPVDSEHNAIFQCLPQNVQTKLGRCDLEENGINHILLTGSGGPFRYTDVAELDSVTPERAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNASQEQLKVIIHPQSVIHSMVQYKDGSVLAQMGEPDMATPIALTMSYPDRTEAGVKPLDFTKVGELTFLEPDLTRYPCLRLAIEACYLGQHATTAI-NAANEIAVDAFLNNQVKFTDIAIINEHVM 364
>gi|41411210|emb|CAF22092.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Linum usitatissimum] (476 aa)
Score = 476, Expect = 8.8e-46, Identities = 124/336 (36%), Positives = 204/336 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K+ +  K + + G+TG+IG  +L+I+ +  + +++V  +  +N     + I  F   LV   SVK ++     +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L ++  ADA+KHPNW+MGKKI++DSAT+ NK  E+IEA+YLF  +   I +  H QSIIHSMI+  D+S +A +  PDM+L I   +S  +      +++++  L+      LTF   D  K+  ++ AY       RA   +  +++AANE+A+ LF + KI +LDIF+I+E
  S:    72 GRKIWDGPKPISIVGSTGSIGTQTLDIVSENPDKFKVVALAAGSNIALLADQIRTFKPQLV---SVKNESLAKELKEALAGLEVMPEIIPGEEGIVEVARHPDAATVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGSFRDLPVEKLKDVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGADYDNIDIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDQVP--CSEVTWPRLDLCKLGSLTFRAPDNVKYPSMNLAY----AAGRAGGTMTGVLSAANEKAVELFIDEKIAYLDIFKIVE 432
>gi|78066792|ref|YP_369561.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia sp. 383] >gi|123568182|sp|Q39F49|DXR_BURS3 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|77967537|gb|ABB08917.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia sp. 383] (398 aa)
Score = 476, Expect = 1.0e-45, Identities = 119/355 (33%), Positives = 205/355 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVK------------TKNTV----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +E   RF P   V   +              +K TV     +  ++ +    D ++ A+VG +G+  +L A +    + LANKE+LV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L+++   +A KHPNW MG+KIS+DSATMMNK  E+IEA+++F     +I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     ++ L    +  L+F + D  ++  +  A   LE    A    +NAANE A+  F E +I F+ I   ++  +  L N   + L+D+L  +   R+
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLRAAGSKTTVLHGPQALVDVSKSDGCDTVVAAIVGAAGMAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGISKIILTASGGPFRTREPATLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAYALAFPERVDAGVDQLDLAQIAQLSFEKPDYARFPCLALALKALEEGGIA-SAALNAANEVAVEAFLERRIGFMAIAATVDAVLNTLPNRTPDGLEDVLAADAEARR 380
>gi|90022236|ref|YP_528063.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Saccharophagus degradans 2-40] >gi|122996057|sp|Q21HH8|DXR_SACD2 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|89951836|gb|ABD81851.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Saccharophagus degradans 2-40] (392 aa)
Score = 475, Expect = 1.2e-45, Identities = 123/366 (33%), Positives = 206/366 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFP-------NALVFSPSVKTKNTVNSFEELL----------EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKFRY 377
           +++ V G+TG+IG S+L+++    + + +   + N++ +  +E   +F        +  ++ P  +   ++N   E+L               D ++ A+VG +GL  TL A++    + LANKESLV++G L     +++S+ + P+DSEH++++  L        +  ++++++T SGGPF      +L       A  HPNW+MG+KIS+DSATMMNK  E IEA +LF+   ++I++  H QSIIHSM+++ D S +A M  PDM+  I   L       + +  L F  L  L F   D  ++  +  A   +++     P+ +NAANE A+ LF E KIKF DI  II   +   E  E + +  +   +   RK  Y  +  KF Y
  S:     2 QQICVLGSTGSIGISTLDVLASHPDKFSVYALTANSSIDLLVEQCLKFSPQYAVIRDEALYLPLKQRIESLNCTTEVLAGEQALCDVASAVQVDSVMAAIVGAAGLAPTLAAVEAGKRVLLANKESLVMSGKLFMQAAKAASALVLPIDSEHNAIFQCLPQPYTSLADAGVQKILLTGSGGPFRDTPLADLSAKTPDQACAHPNWSMGRKISVDSATMMNKGLEFIEACWLFDATPEQIEIVVHPQSIIHSMVQYVDGSVLAQMGNPDMRTPIAHCLDWPRRIDSGVASLDFFALQGLDFCRPDYQRFPALALATSAIKSGG-TYPVALNAANEVAVALFLEEKIKFTDIAAIIAAVLEDWETCEPDTIAAVKEADAIARKLAYSVAA-KFGY 392
>gi|82775563|ref|YP_401910.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella dysenteriae Sd197] >gi|81239711|gb|ABB60421.1| putative ATP-binding component of a transport system [Shigella dysenteriae Sd197] (398 aa)
Score = 473, Expect = 1.9e-45, Identities = 118/354 (33%), Positives = 198/354 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ L F+  D D++  +  A +  E Q +A    +N ANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALAFAAPDYDRYPCLKLAMEAFE-QGQAATTALNTANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANARE 387
>gi|50084554|ref|YP_046064.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acinetobacter sp. ADP1] >gi|59797549|sp|Q6FCG9|DXR_ACIAD 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|49530530|emb|CAG68242.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Acinetobacter sp. ADP1] (398 aa)
Score = 473, Expect = 2.0e-45, Identities = 118/359 (32%), Positives = 204/359 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS-----------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN----------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + V + G TG+IG S+L+++ +  + Y +   + ++  ++ +EI  +F    V  P                  +   +       + +    D+++ A+VG +GL  TL A+K    + LANKE+LV++G ++    R   + + PVDSEH++++ SL +N             +  +++T SGGPF      +L  +    A KHPNW+MG+KIS+DSAT+MNK  E+IEA +LF+  +  + V  H QSIIHSM+++ D S +A M  PDM   I   L+  +     +  L  F + +L F E D +K+  ++ A   +     + P I+NAANE A+  F + +IKF  I E+IE  +  ++N    +++ +L  +   R+  + +
  S:     3 QSVCILGVTGSIGQSTLKVLAQHPDKYSIYAITAHSRIQELVEICKQFKPKRVVVPDEHIDQLRQLLLQAGLADIDILSGTTGLVSVAQDEAVDVVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGNIMMQAARDHQALLLPVDSEHNAIFQSLPSNYLTLENTGQPQLGVSRILLTASGGPFLDYPLEQLSEVTPQQACKHPNWSMGQKISVDSATLMNKGLELIEACHLFSISEHFVTVVVHPQSIIHSMVQYIDGSTLAQMGNPDMCTPIAHALAWPDRLQTHVPALDLFTHTHLDFREPDTNKFPALNLARQAMRAGGLS-PCILNAANEIAVDAFLKLQIKFTVIPEVIEHVLNHVQNDTAVNIEQVLETDMIARQIAHQY 392
>gi|161524436|ref|YP_001579448.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia multivorans ATCC 17616] >gi|189350809|ref|YP_001946437.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Burkholderia multivorans ATCC 17616] >gi|160341865|gb|ABX14951.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia multivorans ATCC 17616] >gi|189334831|dbj|BAG43901.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Burkholderia multivorans ATCC 17616] (398 aa)
Score = 473, Expect = 2.1e-45, Identities = 119/355 (33%), Positives = 201/355 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVK------------TKNTV----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +E   RF P   V   +              ++ TV     +  ++ +    D ++ A+VG +GL  +L A +    + LANKESLV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L+++   +A KHPNW MG+KIS+DSATMMNK  E+IEA+++F     +I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     +  L    +  L+F + D  ++ P          +       +NAANE A+  F E +I F+ I   +E  + AL N   + L D+L  +   R+
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVEARLRAAGSRTTVLYGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKESLVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGIAKIILTASGGPFRTREPATLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVEQLDLAQIAQLSFEKPDYARF-PCLALALKALAEGGIASAALNAANEVAVEAFLERRIGFMAIAATVEAVLDALPNRAPDGLDDVLAADAEARR 380
>gi|85712044|ref|ZP_01043098.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Idiomarina baltica OS145] >gi|85694230|gb|EAQ32174.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Idiomarina baltica OS145] (399 aa)
Score = 473, Expect = 2.2e-45, Identities = 125/349 (35%), Positives = 209/349 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVF-----SPSVKTKNTVNSFEELLEKTNP----------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLN 360
           + + + GATG+IG ++L+++ +  + Y L   + + N    L+I+ R+ P   V      +  ++ +  +++  E+L   +           D+I+ A+VG +GL  TL A+     + LANKE+LVV+G L  +  R S ++I PVDSEH++++  L +           NN  I +L++T SGGPF     +EL+N     A  HPNW+MG+KIS+DSATM+NK  E IEA +LFN ++  + +  H QS+IHSM+++ D S +A M  PDM+  I   L   E   + +  L F  L  L+F  +D  ++  +  A D   +   A    +NAANE A+  F + +I+F DI E+ + A+  L +  V+ +  ++ ++
  S:     3 QSITILGATGSIGQNTLDVVARHPDTYSLFAVTAHGNVSAMLDIVCRYQPQYAVMVDEHAASQLRAQLPMDTRTEVLGGASALSDVSACAEVDVIMAAIVGAAGLAPTLAAINCGKRVLLANKEALVVSGELFINAARESGAQILPVDSEHNAIFQCLPDSAQQQVGYMQLNNHGIDKLLLTGSGGPFRHTPIDELVNQTPQQACNHPNWSMGQKISVDSATMLNKGLEYIEARWLFNCRREQLDIVIHPQSVIHSMVQYVDGSVMAQMGEPDMRTPIAHVLGFPERICSGVKGLDFMTLGELSFMPVDFARYPCLKLAIDSCWHGQSAT-TTLNAANEVAVAAFLKGQIRFTDIAEVCDSALQNLVSAHVDSVDALMAID 382
>gi|68536244|ref|YP_250949.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium jeikeium K411] >gi|81170442|sp|Q4JV26|DXR_CORJK 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|68263843|emb|CAI37331.1| ispC [Corynebacterium jeikeium K411] (408 aa)
Score = 472, Expect = 2.4e-45, Identities = 132/352 (37%), Positives = 197/352 (55%)
  Q:     6 KMENKKKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV---------------NSFEELLEKTNP-----DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE--NTEVNDLKDIL 357
           +++  K +V+V G+TG+IG  +LE++    E +ELVG S + +    L    R     +   +V +++T                +S  EL+E   P     D+ILNALVG  GL  TL  L     LALANKESLV  G L+  LK +   ++ PVDSEHS++   L++    E+  L++T SGGPF      +L ++    A  HP W+MG+  +++SATM+NK  E+IEA  LF    +KI V  H QSI+HSM+ F D + IA  S P MKL I   L   +   +    L F    +  F  +D + +  +  A   +      +P + NAANEEA V F   ++ F  I + +   + A +  + E NDL+D+L
  S:    12 RIDRVKTRVVVLGSTGSIGTQALEVMADNPERFELVGISAHGSKPDVLAQQVRDFGLDLGRVAVASEHTAEWLDGEFGAHCIRGKDSARELVEAVGPELGECDVILNALVGSLGLDATLATLGTKAKLALANKESLVAGGQLV--LKAADEGQLIPVDSEHSAMAQCLRSGRVDEVDSLVLTASGGPFRGYTRAQLEDVTPLQAANHPTWSMGQMNTLNSATMVNKGLELIEASLLFGIPAEKIDVTVHPQSIVHSMVTFIDGATIAQASPPSMKLPISLALGWPDRIADAQPKLDFTEATDWHFEPLDDEVFPAVILARQAV-TAGGTMPAVYNAANEEAAVEFLNGRLSFPRIVDTVAATMEACQHLSAEPNDLEDVL 388
>gi|83749792|ref|ZP_00946766.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia solanacearum UW551] >gi|83723549|gb|EAP70753.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia solanacearum UW551] (393 aa)
Score = 472, Expect = 2.4e-45, Identities = 115/330 (34%), Positives = 190/330 (57%)
  Q:    13 KVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVF----------------SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE----IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS---GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ V GATG+IG S+L+++ +  + Y +   + N   +K   +   F P   V                 +  +  +    + EE     + D ++ A+VG +GL  TL A++    + LANKE+LV++G L  D  R   + + P+DSEH++++  L     +    +  +++T SGGPF  +    L  +    A  HPNW MG+KIS+DSATMMNK  E+IEA++LFN    +++V  H QS+IHSM+ + D S +A +  PDM+  I  GL+     E+   L+ DL+     L F   DL ++  +  A+D L     A P ++NAANE A+  F + +I+F +I  +++  +
  S:     3 RITVLGATGSIGDSTLDVVRRHPDRYRVFALTANAQVDKLAALCRDFHPAMAVVGSAAAAAALRDQLGAEAAGIDIRFGPEALEEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRVLLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPQFGRGVARIVLTASGGPFRTRAIETLAEVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVTQLEVLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPDRIEAGVPLL-DLAATG-TLAFEAPDLHRFPCLALAFDALRAGGTA-PAVLNAANEVAVEAFLQRRIRFTEIAAVVDDTL 357
>gi|104783189|ref|YP_609687.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas entomophila L48] >gi|95112176|emb|CAK16903.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas entomophila L48] (404 aa)
Score = 472, Expect = 2.5e-45, Identities = 115/334 (34%), Positives = 196/334 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS-------FEELLE----------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ +++ V GATG+IG S+L++I +  + Y++   S  +  ++ L +  R   A    PS      +           E+LE           +  D ++ A+VG +GL  TL A++    + LANKE+LV++G L  D  R S + + P+DSEH++++  +  +      N  ++ +++T SGGPF +     L ++    A  HPNW+MG+KIS+DSA+M+NK  E+IEA +LF+ K  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D  ++  +  A    E  N A P ++NAANE A+  F + +I+F +I  +IE+ +
  S:    10 SRLQRITVLGATGSIGLSTLDVIARHPDRYQVFALSGYSRLDELLALCERHRPAYAVVPSADAAARLREGLARAGCATEVLEGEAGLCQVAAASEVDTVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMDAVRRSGAVLLPIDSEHNAIFQCMPTDFARGLGNVGVRRILLTASGGPFRETPVAALQDVTPEQACAHPNWSMGRKISVDSASMLNKGLELIEACWLFDAKPAQVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPITNALAWPERIDSGVAPLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSA-PAVLNAANEVAVDAFLQRRIRFPEIAGMIEQVL 370
>gi|91784113|ref|YP_559319.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia xenovorans LB400] >gi|123358680|sp|Q13XC2|DXR_BURXL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|91688067|gb|ABE31267.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia xenovorans LB400] (401 aa)
Score = 472, Expect = 2.6e-45, Identities = 118/347 (34%), Positives = 205/347 (59%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS--------------VKTKNTV--NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN---NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           +K++ + G+TG+IG S+L+++ +  E + +   S + N +K +E   RF P   V   +               KT+ T    +  ++ E    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D  R + + + PVDSEH++++  L      +  + ++I+T SGGPF  +E   L+++   +A KHPNW MG+KIS+DSATMMNK  E+IEA++LF+   ++I V  H QS+IHS++ + D S +A +  PDM+  I   L+  +   + +  L    + +L+F + D  ++  +  A   L     A    +NAANE A+  F   +I F+ I ++++  +  L N   + L+D+L
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALSAHRNGDKLVEQCLRFEPEVAVVGDADTAARVAAKLREAGCKTEVTYGPQALVDVSESDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDNGAVLLPVDSEHNAIFQCLPREAALHGGVSKIILTASGGPFRTREPATLVDVTPEEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFDLPGERIDVLIHPQSVIHSLVSYADGSVLAQLGNPDMRTPIAHALAFPDRVDSGVAQLDLAQIASLSFEKPDYARFPCLALAMKALAEGGVA-SAALNAANEIAVEAFLSRQIGFMAIAQVVDAVLNTLPNRSAHALEDVL 372
>gi|15793112|ref|NP_282934.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria meningitidis Z2491] >gi|13124128|sp|Q9JX33|DXR_NEIMA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|121051131|emb|CAM07402.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Neisseria meningitidis Z2491] (394 aa)
Score = 472, Expect = 2.9e-45, Identities = 129/355 (36%), Positives = 208/355 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS---------VKTKNT----VNSFEELLEKTNPDII---LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           + G+TG+IG S+L+++ +  E + +   + +   EK       F P   V + +         +K   T    ++  + L++  + D +   + A+VG  GL   L A +    + LANKE+LVV+G L  +  R++ + + PVDSEH++++  L      + N   I  +I+T SGGPF   + N   +I    AVKHPNW MG+KIS+DSATMMNK  E+IEA++LFN    K++V  H QS+IHSM+++ D S +A +  PDM+  I   L   E   + + DL F+ L+ LTF + D D++  +  AY+ + N   A P ++NAANE A+  F + +IKF DI + +   +    +  + D+  +L  +  TR     F
  S:     8 ILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAAQCQTFHPEYAVVADAEHAARLEALLKRDGTATQVLHGAQALVDVASADEVSGVMCAIVGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLPRDYTGRLNEHGIASIILTASGGPFLTADLNTFDSITPDQAVKHPNWRMGRKISVDSATMMNKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGDLDFDALSALTFQKPDFDRFPCLKLAYEAM-NAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHCLSQDFSDGIGDIGGLLAQDARTRAQARAF 389
>gi|111227950|gb|ABH08964.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Nicotiana tabacum] (473 aa)
Score = 471, Expect = 3.1e-45, Identities = 122/337 (36%), Positives = 201/337 (59%)
  Q:     3 EGEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           E  K  +  K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   +V+ ++ V   ++ L   +  P+II                  +  +VG +GL  T+ A+K   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   LS  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ LF   +I +LDIF+I+E
  S:    68 EARKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPKLV---AVRNESLVEELKDALADMEDKPEIIPGEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIKAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRI--YCSEVTWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVELFISERISYLDIFKIVE 429
>gi|116669960|ref|YP_830893.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrobacter sp. FB24] >gi|166218235|sp|A0JUS3|DXR_ARTS2 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|116610069|gb|ABK02793.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrobacter sp. FB24] (394 aa)
Score = 471, Expect = 3.5e-45, Identities = 117/333 (35%), Positives = 191/333 (57%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKE--------------NYELVGFSFNNNYEKALEIINRFPNALV--------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + +++++ G+TG+IG  ++++++                N EL+     +   KA+   +    AL               + P + T    ++    + +   D++LN + G  GL  TL ALK+   LALANKESL+V G L++   R    +I PVDSEHS++   L++    E+  LI+T SGGPF  +   EL N++  +A+ HP W+MG  ++ +SA+++NK  E+IEA+ LF+    +I V  H QS++HSM++F D S IA  S PDM+L I  GL   +          +    + TF  +D + +  ++ A D    Q    P + NAANEEA++ F   +I+F DI + IE  +
  S:     2 QPRRIVLLGSTGSIGTQAIDVVDGAPHLFEVVALSAGGGNLELLARQAVHTKAKAVGTASGDATALQRLIDDAARATGVAGYRPEIITGPDAST---RIAEIEADVVLNGITGSIGLAPTLAALKSGATLALANKESLIVGGALVKAAAREG--QIVPVDSEHSAIAQCLRSGTAAEVDRLILTASGGPFRGRTREELHNVSPEEALAHPTWDMGLMVTTNSASLVNKGLEVIEAHLLFDIPLDRIDVVVHPQSVVHSMVQFVDGSIIAQASPPDMRLPIALGLGWPDRVPKAATPCDWTQATSWTFEPLDAEAFPAVNLAKD-AAKQGSTYPAVFNAANEEAVMAFHAGRIRFTDIVDTIEAVL 360
>gi|17225989|gb|AAL37560.1|AF367205_1 1-deoxy-D-xylulose 5-phosphate reductoisomerase precursor [Oryza sativa] (473 aa)
Score = 471, Expect = 3.5e-45, Identities = 126/363 (34%), Positives = 217/363 (59%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN--DLKDILNLNKNTRKY 366
           G +  +  K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F    V   +V+ ++ V+  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L +    +I P DSEHS+++  ++      ++ +I+T SGG F     ++L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDM++ I   +S  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ LF + KI +LDIF+++E    A  N  V    L++I++ +   R+Y
  S:    69 GRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPKHV---AVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRI--YCSEVTWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVELFIDEKIGYLDIFKVVELTCDAHRNELVTRPSLEEIIHYDLWAREY 458
>gi|73667092|ref|YP_303108.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia canis str. Jake] >gi|123614907|sp|Q3YRZ5|DXR_EHRCJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|72394233|gb|AAZ68510.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ehrlichia canis str. Jake] (387 aa)
Score = 471, Expect = 3.6e-45, Identities = 135/354 (38%), Positives = 205/354 (57%)
  Q:    12 KKVLVFGATGNIG-------FSSLE------IIEKENYELVGFSFN--NNYEKALEIIN--RFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K V VFG+TG IG       FS L+      ++ K N +L+ F     N     +  +N  R    L+   ++K     +    +    + D  + A+VG + L      + +NV  +ALANKES+V  G L+  L +    +I P+DSEH+++Y  L +  +K+++++ +T SGGP    ++ ++  +   D VKHP W MGKKIS+DSATM+NK  EIIEAYYLF+ K  K+ V  H +S++H +I + D + IA MSVPDMK+ I   LS       L   L+    N LTF + D+ K+  I   ++ L+  N  A  II+NAANE A+  F   KI FLDI  I+ + +  +    +N L +IL+ +  +RK
  S:     2 KTVSVFGSTGAIGQMIIDIIFSELDKYQVKVLVAKSNIQLLAFQAKLVNAERVVITDVNLYRELKDLLLDTNIKVSAGDDGMI-MATSLDVDYAMMAIVGIAALVPMTYLINSNVKVIALANKESIVCGGALLLSLAKEKDVKIIPLDSEHNAIYQILADKGHKDLEKITLTASGGPLLSMDYEQMKYVTVQDTVKHPVWKMGKKISVDSATMINKSLEIIEAYYLFSIKAEKLDVIIHNESVVHGIISYIDGTSIAFMSVPDMKIPIMYSLSWPNRSAALCKKLNLALYNQLTFMKPDIYKFPGIKLGFEVLKTSNVHANGIILNAANEIAVNAFLAKKIGFLDIVNIVYETLNLVNYGRINSLSNILDCDAISRK 377
>gi|194538290|ref|YP_002073406.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio sp. Ex25] >gi|151936845|gb|EDN55754.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio sp. Ex25] (401 aa)
Score = 471, Expect = 3.7e-45, Identities = 129/353 (36%), Positives = 204/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVF----------------SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL---------KNNNKE--IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENT----EVNDLKDILNLNKNTR 364
           +K+ + GATG+IG S+L+++E+  E + +V  + + N EK + +  ++ P   V                 SP+ +    V++   +      D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D      + + PVDSEH++++  L         + N +E  I  +++T SGGPF   +  EL  +    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   +++KV  H QS+IHSM+++ D S +A M  PDM   I   +S Y S+    +  L F  +  LTF + D  ++  +  A D       A    +NAANE A+  F  N + F DI  I E  +  +  +      N L+ +L L++  R
  S:     2 QKLTILGATGSIGASTLKVVEQNPELFSVVALAASTNVEKMIGLCRQWQPKYAVMADKAAAIQLQSELHLVSPNTEVLGGVDALCHISSLDEVDSVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVEEFGAELLPVDSEHNAIFQCLPQQVQTNLGRCNLQEHGISHILLTGSGGPFRYTDIAELEKVTPEQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNAAREQLKVIIHPQSVIHSMVQYRDGSVLAQMGEPDMATPIALTMS-YPSRVEAGVKPLDFTQIGELTFLQPDFARYPCLKLAIDACYEGQHAT-TALNAANEVAVDAFLNNSLGFTDIARINESVLNKINASCKAENANSLESLLELDRMAR 390
>gi|113952920|ref|YP_730133.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. CC9311] >gi|113880271|gb|ABI45229.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. CC9311] (416 aa)
Score = 470, Expect = 4.1e-45, Identities = 125/330 (37%), Positives = 187/330 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKTNP----------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           K + V G+TG+IG  +L I+E   + + +V  S   N    +  I R  P+ +  +         +    L   T P                      D+++  +VG +GL  TL A++   DLA+ANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F      +L     ADA  HPNW+MGKKI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDMKL I   +S           L    +  L+F   D  K+  +  AY       RA   +P ++NAANEEA+  F E KI FLDI ++IE A
  S:     2 KAISVLGSTGSIGTQTLAIVEDFPDQFRVVALSAGRNLSLLVSQIQRHRPDVVALADQALLAELKDRLMALPADTRPEPLPHLVGGPEGLDVVASWDSADLVVTGIVGCAGLLPTLAAIRAGKDLAVANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWSDTARLSTGVPTPGLRRIQLTASGGAFRDWSAADLEKATVADATSHPNWSMGKKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMVELADSSVLAQLGWPDMKLPILYCMSWPSRLETPWRRLDLTEVGQLSFRAPDPAKYPCMDLAY----AAGRAGGTMPAVLNAANEEAVAQFLEEKIHFLDIPKMIEGA 371
>gi|28493056|ref|NP_787217.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Tropheryma whipplei str. Twist] >gi|39930874|sp|Q83GY8|DXR_TROWT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|28476096|gb|AAO44186.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Tropheryma whipplei str. Twist] (368 aa)
Score = 470, Expect = 4.7e-45, Identities = 130/328 (39%), Positives = 184/328 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV---NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWA----YDFL---ENQNRAI-------------PIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           ++V++ G+TG+IG  +++ I   ++++ +VG + +       E       A V      TKNT    +   EL+E T  D++LNA+ G +GL  T   LK    LALANKESL++ G    D+  +   +I PVDSEHS++  ++K+    E+ +LI+T SGGPFY +E   L  I   DA+ HP WNMG  ISI+SATM NK  EIIEA+ LF     +I V  H QSI+HSM+++ D S IA  SV DM L I   LS      N +                    +P+ W     +DFL   EN  R+I             P ++NA+NE A+  F   KI F  I  + E
  S:     2 QRVIIVGSTGSIGTQAIDFILKNRDSFLVVGLAASTQTSLLRE------QAQVLG----TKNTAQGASEAAELIEATEADVVLNAITGAAGLLSTYATLKTGKRLALANKESLIMGGKYFLDMT-TFKGQITPVDSEHSAIAQAMKSGKFSEVNKLILTASGGPFYDRE--SLEGITLKDALDHPTWNMGPMISINSATMFNKGLEIIEAHLLFGIPYSQIDVVIHPQSIVHSMVEYKDGSVIAQASVADMTLPIGYALSWPNRALNAV--------------------RPLEWGARQRWDFLPPTENSMRSINLARRAGEAGGVYPAVLNASNECAVEAFMAGKISFARIIHVTE 324
>gi|134296022|ref|YP_001119757.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia vietnamiensis G4] >gi|166218247|sp|A4JF69|DXR_BURVG 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|134139179|gb|ABO54922.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia vietnamiensis G4] (398 aa)
Score = 470, Expect = 4.7e-45, Identities = 119/341 (34%), Positives = 197/341 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVK------------TKNTV----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN 351
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +E   RF P   V   +              +K TV     +  ++      D ++ A+VG +GL  +L A +    + LANKESLV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA+++F    ++I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     ++ L    +  L+F + D  ++  +  A   LE    A    +NAANE A+  F E +I F+ I   ++  + AL N   N
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVEAKLRAAGSKTTVLYGPQALVDVSASDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKESLVMSGGIFMDAVRDHGAILLPVDSEHNAIFQCMPRDENEHGGISKIILTASGGPFRTREPATLADVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGERIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSFEKPDYARFPCLALALKALEEGGIA-SAALNAANEVAVEAFLERRIGFMAIAATVDAVLNALPNRSPN 366
>gi|109897580|ref|YP_660835.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudoalteromonas atlantica T6c] >gi|109699861|gb|ABG39781.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudoalteromonas atlantica T6c] (397 aa)
Score = 470, Expect = 4.8e-45, Identities = 123/354 (34%), Positives = 208/354 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSF------EELLEKTNP----------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + GATG+IG S+++++ +    Y++   + ++  +K LE      P  LV S S + +N   +        ELL               D+++ A+VG +GL  T+ A+K    + LANKESLV++G L  +  +   + I P+DSEH++++  L ++ +        I  +++T SGGPF +   N L  +  A A  HPNW+MG+KIS+DSATMMNK  E IEA +LF   T  IKV  H QSIIHSM+++ D S +A M  PDM+  I  GL+  +   + +  L F N+ N +F E +  ++  ++ A +   +  +     +NAANE A+  F   +I F  I ++ ++ +  ++  +++D+  I+  +K  R+
  S:     2 QNICILGATGSIGQSTIDVVLRHPGLYQVYALTAHSQIDKLLEQAKLCQPKYLVLSDSTRYQNAKQALLASGIKTELLSGAQALADVASADEVDVVMAAIVGGAGLLPTIAAVKAGKKVLLANKESLVMSGELFINAAKEHGATILPIDSEHNAIFQCLPHDFQYGDLAASGISSILLTGSGGPFRETPLNRLSEMTPAQACAHPNWDMGQKISVDSATMMNKGLEFIEARWLFGLQTSDIKVVLHPQSIIHSMVQYCDGSVLAQMGNPDMRTPIAHGLAFPKRIDSGVKPLDFQNVSNFSFDEPEPQRYPNLYLAIE-ASDAGQYATTALNAANEVAVAAFLSGQIGFSQIAQVNQQCVAKMQGCQLDDINAIVEWDKECRR 383
>gi|52839879|gb|AAU87836.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Taxus x media] (477 aa)
Score = 470, Expect = 4.9e-45, Identities = 125/373 (33%), Positives = 217/373 (58%)
  Q:     3 EGEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEV--NDLKDILNLNKNTRKYVYDFSKNKF 375
           E  K+ +  K   + G+TG+IG  +L+I+ +  + +++V  +  +N     E +  F   LV   SV+ ++     +E L   +  P+I+                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  +DA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YL+  +   I++  H QSI HSM++  D+S +A +  PDM+L I   +S  E      +++++  L+      LTF   D  K+  +  AY    +  RA   +  + ++ANE+A+ LF + +I +LDIF+++EK      N  V    L++I++ +   RKY    +++  
  S:    73 EDRKVWDGPKPFSIIGSTGSIGTQTLDIVAEHPDKFKVVALAAGSNVTLLAEQVRMFKPKLV---SVRNESLATELKEALADIEHKPEIVYGDEGMVEVAQHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVGKLKEVKVSDALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLYGADYDNIEIVIHPQSIAHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVP--CSEVTWPRLDLCKSGSLTFKAPDCVKYPSMDLAY----SAGRAGGTMTGVFSSANEKAVELFIDERISYLDIFKVVEKTCDKHRNELVPRPSLEEIIHYDLWARKYAASLAQSSL 472
>gi|87124849|ref|ZP_01080697.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. RS9917] >gi|86167728|gb|EAQ68987.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Synechococcus sp. RS9917] (417 aa)
Score = 470, Expect = 5.0e-45, Identities = 129/330 (39%), Positives = 198/330 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALE-IINRFPNALVFS-----PSVKTK--------------NTVNSFEELLEKT---NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-------------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA 341
           K + V G+TG+IG  +LEI  +  + + +V  +   N    +E I+   P  +  +     P ++ +                V   E L E     + D+++  +VG +GL  TL A++   DLALANKE+L+ AG ++    + S SR+ P DSEHS+++  L+                  ++ + +T SGG F   +  +L     ADA  HPNW+MG+KI++DSA++MNK  E+IEA+YLF  +   I++  H QSIIHSMI+  D+S +A +  PDMKL I   LS + S+     D  +  LN      LTF   D  K+  +  AY       RA   +P ++NAANEEA+  F + +I FLDI ++I+ A
  S:     2 KAISVLGSTGSIGTQTLEIAREFPDQFRVVSLTAGRNLPLLVEQIVEHQPEVVALADADLLPELRARLEALEANQTPKLLPQLVGGREGLNEAAAWESADLVVTGIVGCAGLLPTLAAVRAGKDLALANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGIPTPGLRRIQLTASGGAFRDWKAADLEKATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFGLDYDHIEIVIHPQSIIHSMIELADSSVLAQLGWPDMKLPILYCLS-WPSRL----DTPWRRLNLTEVGQLTFRSPDPAKYPCMELAY----AAGRAGGTMPAVLNAANEEAVAQFLQERIHFLDIPDLIDAA 371
>gi|91241600|gb|ABD92702.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] >gi|94421688|gb|ABF18928.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] (471 aa)
Score = 469, Expect = 5.2e-45, Identities = 121/336 (36%), Positives = 203/336 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K  +  K + V G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   +V+ ++ V+   E L   +  P+II                  +  +VG +GL  T+ A++   D+ LANKE+L+  G  +  L    + +I P DSEHS+++  ++   +  ++ +I+T SGG F     ++L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   +S  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F   KI +LDIF+I+E
  S:    67 GRKTWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKPQLV---AVRNESLVHELREALADVEEKPEIIPGEQGVVEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQGLPDGALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRI--YCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFINEKIGYLDIFKIVE 427
>gi|91223479|ref|ZP_01258744.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio alginolyticus 12G01] >gi|91191565|gb|EAS77829.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio alginolyticus 12G01] (401 aa)
Score = 469, Expect = 5.8e-45, Identities = 128/353 (36%), Positives = 204/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVF----------------SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL---------KNNNKE--IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENT----EVNDLKDILNLNKNTR 364
           +K+ + GATG+IG S+L+++E+  + + +V  + + N EK + +  ++ P   V                 SP  +    V++   +      D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D      + + PVDSEH++++  L         + N +E  I  +++T SGGPF   +  EL  +  A A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   +++KV  H QS+IHSM+++ D S +A M   DM   I   +S Y S+    +  L F  +  LTF + D  ++  +  A D       A    +NAANE A+  F  N++ F DI  I E  +  +  +      N L+ +L L++  R
  S:     2 QKLTILGATGSIGASTLKVVEQNPDLFSVVALAASTNVEKMIGLCRQWQPKYAVMADKAAASQLQAELHSVSPGTEVLGGVDALCHIASLDEVDSVMAAIVGAAGLLPTMAAVKAGKRVLLANKEALVMSGQLFIDAVEEFGAELLPVDSEHNAIFQCLPQQVQTSLGRCNLQEHGISHILLTGSGGPFRYTDIAELEQVTPAQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNADREQLKVVIHPQSVIHSMVQYRDGSVLAQMGEADMATPIALTMS-YPSRVEAGVKPLDFTKVGELTFLQPDFARYPCLKLAIDACYEGQHAT-TALNAANEVAVDAFLNNRLGFTDIARINESVLNKINASCKAENANSLESLLELDRMAR 390
>gi|118594907|ref|ZP_01552254.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylophilales bacterium HTCC2181] >gi|118440685|gb|EAV47312.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylophilales bacterium HTCC2181] (389 aa)
Score = 469, Expect = 6.5e-45, Identities = 128/353 (36%), Positives = 206/353 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE----KTNPDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN--NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K V + G+TG+IG S+L+++  ++ N+++   S ++N +   +        + F P +   N+ N  E +L     K NPDI                  ++ A+ G +GL  T  A      + LANKES+V+AG LI      S   I P+DSEH++++  L    +NK I+++I+T SGGPF       +  +    A+KHP W+MG+KISIDSATMMNK  E+IEA +LF    +KI+V  H QSI+HS ++F D S +  +  PDM++ I   L   E   + +  ++   + +L+FS  +   +  ++ AY  LE   +A  + +NAANE A+  F E  I F+ I E+I + +  +     ++L  I++L+KN R
  S:     2 KVVSILGSTGSIGQSTLDVLRLDRINFKVFALSCHSNIKLLAQ------QTIEFQPDIIVVNSANDREVILTYLEGKANPDILFGPNGHKMIVEADEVTDVVAAISGAAGLTSTYHAALKGKRILLANKESMVMAGSLIMRQAELSHGLIIPIDSEHNAIFQVLNGARDNKAIQKIILTASGGPFRNFSAEMIKAVTVEQALKHPKWSMGRKISIDSATMMNKGLEVIEASFLFQLPAEKIEVVIHPQSIVHSFVEFVDGSLLTQLGCPDMRVPISFALGYPERIPSGVQGINLTEHESLSFSNPNHALFPCLNLAYQALE-AGQARCVALNAANEIAVEAFLECAIGFMQIHEVIAEVMEGVIPQTNDELDAIIDLDKNIR 376
>gi|107028807|ref|YP_625902.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia cenocepacia AU 1054] >gi|116690034|ref|YP_835657.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia cenocepacia HI2424] >gi|170733369|ref|YP_001765316.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia cenocepacia MC0-3] >gi|123070964|sp|Q1BHH6|DXR_BURCA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218241|sp|A0K8D7|DXR_BURCH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|105897971|gb|ABF80929.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia cenocepacia AU 1054] >gi|116648123|gb|ABK08764.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia cenocepacia HI2424] >gi|169816611|gb|ACA91194.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia cenocepacia MC0-3] (398 aa)
Score = 468, Expect = 7.2e-45, Identities = 116/347 (33%), Positives = 198/347 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS-----------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +E   RF   +       T   V++                   ++ +    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L+++   +A KHPNW MG+KIS+DSATMMNK  E+IEA+++F     +I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     ++ L    +  L+F + D  ++  +  A   LE    A    +NAANE A+  F E +I F+ I   ++  +  L N   + L D+L
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDAATAAHVDAKLRAAGSKTVVLHGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGISKIILTASGGPFRTREPATLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSFEKPDYARFPCLALALKALEEGGIA-SAALNAANEVAVEAFLERRIGFMAIAATVDAVLNTLPNRAPDGLDDVL 372
>gi|73541564|ref|YP_296084.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia eutropha JMP134] >gi|123624827|sp|Q470E3|DXR_RALEJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|72118977|gb|AAZ61240.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia eutropha JMP134] (395 aa)
Score = 468, Expect = 8.4e-45, Identities = 122/353 (34%), Positives = 199/353 (56%)
  Q:    13 KVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEK-ALEIINRFPNALVFSPSVK------------TKNTVNSFEELLEKT----NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE----IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++ + GATG+IG S+L+++ +  + Y +   + +   +K A   I   P   V   S               K  V+  E  LE        D ++ A+VG +GL  TL A +    + LANKE+LV++G +  D  R   + + P+DSEH++++  L  N++     + ++++T SGGPF  ++   L +I    A  HPNW MG+KIS+DSATMMNK  E+IEA++LF    + I+V  H QSI+HSM+ + D S +A +  PDM+  I  GL+  E     ++ L       L F + DL ++  +  A+D L     A P ++NAANE A+  F +  I+F DI  I+   +    +   + L+ +L  ++  R+
  S:     3 RITILGATGSIGESTLDVVRRHADRYAVHALTAHRQVQKLAASCIEFRPARAVVGTSEAAAELEALLRMAGVKTEVSHGEAALESVASDAQTDSVMAAIVGAAGLRPTLAAARAGKRVLLANKEALVMSGRIFMDAVREHGATLLPIDSEHNAIFQCLPANDQRYRAGVAKVVLTASGGPFRTRDPATLHDITPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGAPAEHIEVLIHPQSIVHSMVAYRDGSVLAQLGNPDMRTPIAYGLAYPERIDAGVSPLDLTLAGALNFEKPDLVRFPCLALAFDALRAGGVA-PAVLNAANEVAVEAFLQGGIRFTDIARIVGNVLEKAPHGAADSLECVLEADQLARQ 380
>gi|22298584|ref|NP_681831.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermosynechococcus elongatus BP-1] >gi|32171384|sp|Q8DK30|DXR_SYNEL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|22294764|dbj|BAC08593.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermosynechococcus elongatus BP-1] (413 aa)
Score = 468, Expect = 8.8e-45, Identities = 123/361 (34%), Positives = 206/361 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI--IALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           K + + G+TG+IG  +L+I+ +  + + +VG +   N E+ +  I +F P  +  +   +      +  +L +K                 + ++++  +VG +GL  T+ A+K   D+ALANKE+L+  G ++  L +    ++ P DSEHS+++  L+      ++++I+T SGG F      +L  +  ADA+KHPNW+MG KI++DSAT+MNK  E+IEA+YLF  +   I++  H QSIIHS+I+  D S +A +  PDM+L +   LS  E      + L      +LTF   D  K+ P             A+P ++NAANE+A+ LF    I FL+I  +IE      + +N     L+DIL  ++  R  V + ++
  S:    20 KALNLLGSTGSIGTQTLDIVAQYPDRFRVVGLAAGRNLERLIPQIRQFQPEIVSIADPEQLPELEAALADLPQKPQLVAGEAGIAAVAAYGDAEVVVTGIVGCAGLVPTIAAIKAGKDIALANKETLIAGGPVVLPLLQEYGVKLLPADSEHSAIFQCLQGVPEGGLRKIILTASGGAFRDWPVEKLAQVTVADALKHPNWSMGPKITVDSATLMNKGLEVIEAHYLFGMDYDNIEIVIHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIPTNWSPLDLVKAGDLTFRSPDHQKY-PCMGLAYAAGRAGGAMPAVLNAANEQAVALFIAEAIAFLEIPRLIEMVCDRYSAQNIPNPTLEDILAADRWARATVQELAQ 404
>gi|26988329|ref|NP_743754.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas putida KT2440] >gi|24983077|gb|AAN67218.1|AE016348_10 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas putida KT2440] (404 aa)
Score = 467, Expect = 9.1e-45, Identities = 114/334 (34%), Positives = 194/334 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS-------FEELLE----------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ +++ V GATG+IG S+L++I +  + Y+    +  +  ++ L +  R   A    PS +    + +         E+LE              D ++ A+VG +GL  TL A++    + LANKE+LV++G L  +  R   + + P+DSEH++++  +  +         ++ +++T SGGPF +     LL++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+    K++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D  ++  +  A    E  N A P ++NAANE A+  F E +I+F +I  +IE+ +
  S:    10 SRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRHRPAFAVVPSTEAAVRLRASLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYARGLSAVGVRRILLTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAVPSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSA-PAVLNAANEVAVQAFLERRIRFPEIAGMIEQVL 370
>gi|32171377|sp|Q88MH4|DXR_PSEPK 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (400 aa)
Score = 467, Expect = 9.1e-45, Identities = 114/334 (34%), Positives = 194/334 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS-------FEELLE----------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ +++ V GATG+IG S+L++I +  + Y+    +  +  ++ L +  R   A    PS +    + +         E+LE              D ++ A+VG +GL  TL A++    + LANKE+LV++G L  +  R   + + P+DSEH++++  +  +         ++ +++T SGGPF +     LL++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+    K++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D  ++  +  A    E  N A P ++NAANE A+  F E +I+F +I  +IE+ +
  S:     6 SRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRHRPAFAVVPSTEAAVRLRASLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYARGLSAVGVRRILLTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAVPSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSA-PAVLNAANEVAVQAFLERRIRFPEIAGMIEQVL 366
>gi|40849971|gb|AAR95700.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ginkgo biloba] (477 aa)
Score = 467, Expect = 9.3e-45, Identities = 123/364 (33%), Positives = 216/364 (59%)
  Q:     3 EGEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEV--NDLKDILNLNKNTRKY 366
           E  K+ +  K   + G+TG+IG  +L+I+ +  + + +V  +  +N     + + +F   LV   +++ ++ +   +  L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  +DA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YL+  +   I++  H QSI+HSM++  D+S +A +  PDM+L I   +S  E      +++++  L+      LTF   D  K+  +  AY    +  RA   +  +++AANE+A+ LF E KI +LDIF+++E      +N  V    L++I+  ++  R+Y
  S:    73 EDRKVWDGPKPFSIVGSTGSIGTQTLDIVAEHPDKFRVVALAAGSNVALLADQVRQFKPKLV---AIRNESLITELKAALSDFEPKPEIISGEEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGGLRRIILTASGGAFRDWPVGKLKEVKVSDALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLYGADYDNIEIVIHPQSIVHSMVETQDSSVLAQLGWPDMRLPILYTMSWPERVP--CSEVTWPRLDLCKSGSLTFKAPDCVKYPSMDLAY----SAGRAGGTMTGVLSAANEKAVELFIEEKISYLDIFKVVEMTCDKHKNELVLQPSLEEIIYYDQWARQY 463
>gi|148549386|ref|YP_001269488.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas putida F1] >gi|166218274|sp|A5W844|DXR_PSEP1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|148513444|gb|ABQ80304.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas putida F1] (400 aa)
Score = 467, Expect = 9.7e-45, Identities = 114/334 (34%), Positives = 194/334 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS-------FEELLE----------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++ +++ V GATG+IG S+L++I +  + Y+    +  +  ++ L +  R   A    PS +    + +         E+LE              D ++ A+VG +GL  TL A++    + LANKE+LV++G L  +  R   + + P+DSEH++++  +  +         ++ +++T SGGPF +     LL++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+    K++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D  ++  +  A    E  N A P ++NAANE A+  F E +I+F +I  +IE+ +
  S:     6 SRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRHRPAFAVVPSTEAAVRLRAGLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYARGLSAVGVRRILLTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAVPSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSA-PAVLNAANEVAVEAFLERRIRFPEIAGMIEQVL 366
>gi|94968447|ref|YP_590495.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acidobacteria bacterium Ellin345] >gi|94550497|gb|ABF40421.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acidobacteria bacterium Ellin345] (418 aa)
Score = 466, Expect = 1.2e-44, Identities = 126/354 (35%), Positives = 198/354 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-------------------TNP--DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K+V + G+TG+IG S+L+I+E   E +E+V  +  +N +   E   R+   +V   SV T+    +  E L+                    T P  D +++A+VG  GL  T  A+K    + LANKE++V AG LI    R     I P+DSEH++++ +++    KE++ + +T SGGPF      +  +I    A+ HP W MG++I+IDSAT+MNK FE+IEA  LF+    +++V  H QS IHSM++F D S +A +SV DM+L I   L        + ++L F  L   +L F   D +K+  +  AY+  E +     I +NAA+E A+  F E  I F DI   I   +          +  +L+ +   R+
  S:    25 KRVAILGSTGSIGTSTLKIVEAYPELFEVVSLAAGSNLDLVTEQTVRWHPKVV---SVATEEVAETLRERLKHAGVKGTRVISGEAGTVECATLPEVDFVVSAIVGVGGLKATYEAVKAGKSIGLANKETMVAAGELITAEARKQGKPILPIDSEHNAIHQAMRGGRLKEVERVWLTASGGPFLHTPKADFEHITVEQALNHPTWKMGRRITIDSATLMNKGFEVIEACRLFDLPASRVEVIVHPQSTIHSMVEFVDGSLLAQLSVTDMRLPI---LYAMTFPDRIPSNLKFPVLELKHLDFYPPDPEKFPCLQLAYEAAE-KGGTKSIALNAADEVAVAAFLEGGIPFNDIPATIRHVLDETPEAHPESIDQVLSADAAARE 400
>gi|86749939|ref|YP_486435.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris HaA2] >gi|123292530|sp|Q2IW86|DXR_RHOP2 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|86572967|gb|ABD07524.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris HaA2] (407 aa)
Score = 466, Expect = 1.3e-44, Identities = 120/333 (36%), Positives = 181/333 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA 344
           + + V GATG+IG S+++++    E Y +   + N N     ++   F    V   +V     +      L  T+                  D ++ A+ G +GL   L A+     +ALANKE LV AG        ++ S I P DSEH++L+ +L + N+ E+  +IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA YLF  +  +I V  H QSI+H M++F D+S +A +  PDM++ I   L   +        L    +  LTF   D +++  +  AYD L   N A   + NAANE A+  F   KI+F  I  ++E  + A
  S:    17 RSISVLGATGSIGDSTMDLLRAAPEKYRVEALTGNANVAGLAKLAKEFNARFV---AVADPARLGELRAALAGTDIAYGAGESAVIEAAARPADWVMAAISGAAGLKPALAAVDRGATVALANKECLVCAGDFFMSRAVAAGSCILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWSAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYLFALSPDEIDVLVHPQSIVHGMVEFADHSVVAQLGAPDMRIPIAHCLGWPDRIVGRAARLDLAKIGQLTFEAPDFERFPGLRLAYDALRAGNGAT-TVYNAANEIAVAAFIAQKIRFGAIARLVEDTLNA 368
>gi|85700244|gb|ABC74566.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Picrorhiza kurrooa] (475 aa)
Score = 466, Expect = 1.3e-44, Identities = 123/336 (36%), Positives = 200/336 (59%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K     K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + I  F   LV   SV+ ++ ++  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +  L    + +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I +  H QSIIHSMI+  D+S +A +  PDM+L I   LS  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F   KI +LDIF++ E
  S:    71 GHKSWEGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNITLLADQIKTFKPELV---SVRDESLIDELKEALADLEHKPEIIPGEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGALRRVILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIDIVIHPQSIIHSMIETQDSSILAQLGWPDMRLPILYTLSWPDRI--YCSEITWPRLDLCKLESLTFKSPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFIAEKIGYLDIFKVAE 431
>gi|91977321|ref|YP_569980.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris BisB5] >gi|123735357|sp|Q136B0|DXR_RHOPS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|91683777|gb|ABE40079.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris BisB5] (407 aa)
Score = 464, Expect = 2.1e-44, Identities = 123/354 (34%), Positives = 189/354 (53%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA----IIALENTEVNDLKDILNLNKNTRK 365
           + + V GATG+IG S+++++    E Y +   + N N     ++   F    V   +V     +      L  T                   D ++ A+ G +GL   L A+     +ALANKE LV AG        ++ +RI P DSEH++L+ +L + N+ E+  +IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA YLF  +  +I V  H QSI+H +++F D+S +A +  PDM++ I   L   +        L    +  LTF   D  ++  +  AYD L   N A   + NAANE A+  F   KI+F  I  ++E      + A     ++   D + ++ N RK
  S:    17 RTISVLGATGSIGDSTMDLLRAAPEKYRVESLTGNANVAGLAKLAKEFSAKFV---AVADPARLGELRAALADTEIACGAGESAVIEAASRPADWVMAAISGAAGLKPALAAVDRGATVALANKECLVCAGDFFMSRAVAAGARILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYLFALSPDEIDVLVHPQSIVHGLVEFADHSVVAQLGAPDMRIPIAHCLGWPDRIAGRAARLDLAKIGQLTFEAPDFVRFPGLRLAYDALRTGNGAT-TVYNAANEIAVAAFIAQKIRFGAIARLVEDTLNGWVRAGNLAPLSSADDAIAVDHNARK 393
>gi|46410854|gb|AAS94121.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] (471 aa)
Score = 464, Expect = 2.2e-44, Identities = 122/336 (36%), Positives = 201/336 (59%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVF----SPSVKTKNTVNSFEELLE-----------KTNPDII--LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K  +  K + V G+TG+IG  +L+I+ +    + +V  +  +N     + +  F   LV     S + + K+ +   EE  E             +PD +  +  +VG +GL  T+ A++   D+ LANKE+L+  G  +  L    + +I P DSEHS+++  ++   +  ++ +I+T SGG F     + L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   +S  E      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F + KI +LDIF+I+E
  S:    67 GRKTWDGPKPISVVGSTGSIGTQTLDIVAENPGKFRVVALAAGSNVTLLADQVKTFKPQLVAVRNESLADELKDALADLEEKPEIIPGEEGVVEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAVFQCIQGLPDGALRRIILTASGGAFRDWPVDRLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGADYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILCTMSWPERI--YCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----AAGRAGGTMTGVLSAANEKAVEMFIDEKISYLDIFKIVE 427
>gi|83718433|ref|YP_442557.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia thailandensis E264] >gi|123536965|sp|Q2SWZ2|DXR_BURTA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|83652258|gb|ABC36321.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia thailandensis E264] (398 aa)
Score = 464, Expect = 2.3e-44, Identities = 116/347 (33%), Positives = 198/347 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           +K++ + G+TG+IG S+L+++ +  E + +   + + N +K +    RF   +      +T   V                  +  ++ +    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA++LF   +++I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     +  L    +  LTF + D  ++  +  A D LE    A    +NAANE A+  F   +I+F  I + ++  +  L N   + L D++
  S:     2 QKRLTLLGSTGSIGDSTLDVVTRHPERFAVHALTAHRNGDKLVAQCLRFAPDVAVVGDAETAARVEAQLRAAGSKTQVAYGKQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGIAKIIVTASGGPFRTREPVTLASVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGLPSERIDVLIHPQSVIHSLVSYCDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQIATLTFEKPDYARFPCLALAIDALEAGGVA-SAALNAANEIAVDAFLSRRIRFTAIAQTVDAVLSGLSNRTPSGLDDVI 372
>gi|118051133|ref|ZP_01519682.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Comamonas testosteroni KF-1] >gi|118001804|gb|EAV15959.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Comamonas testosteroni KF-1] (392 aa)
Score = 464, Expect = 2.4e-44, Identities = 122/355 (34%), Positives = 205/355 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------PNALVFSPSVKTK-------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K+K+ V G+TG+IG ++L+++ +  + YE+   S     +  L    +F          P+A   +  ++            N+ E +    + D ++ A+VG +GL   L A +    L LANKE+LVV G L  D  +   + + P+DSEHS+++  L  ++    + +  L++T SGGPF +++   L  I    A  HPN++MG+KIS+DSATMMNK  E+IEA +LF+   +KIKV  H Q I+HSM++F D+S +A +  PDM++ I  GL+  E   +    L F  L  LTF E D  ++  +H ++  L         ++NAANE A+  F   ++ F  I  +  + + +++   V+ L+D++ L+   R+
  S:     2 KQKITVLGSTGSIGTNTLDVVARHPDQYEIFALSAATQVDLMLSQCAQFKPQFAVMASAPHAQQLAEKIQLHGLQTQVLQERNALEAIASHPDVDAVMGAIVGAAGLSPCLAAARAGKRLLLANKEALVVGGALFMDTVKRHGATLLPIDSEHSAIFQCLPEDSSTWAERVDSLLLTASGGPFRQRDPATLSAITPEQACSHPNFSMGRKISVDSATMMNKALEVIEARWLFDMAPEKIKVVIHPQQIVHSMVQFKDSSVLAQLGTPDMRVPIACGLAWPERIESGAPVLDFAKLAALTFEEADAHRFPGLHLSWQALR-APEGTTTVLNAANEVAVAAFLARRLSFDRIHAVNLQTLESVQPGAVSSLEDLMALDARARE 381
>gi|53719762|ref|YP_108748.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei K96243] >gi|76809793|ref|YP_333969.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 1710b] >gi|126441123|ref|YP_001059463.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 668] >gi|126454965|ref|YP_001066746.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 1106a] >gi|134277046|ref|ZP_01763761.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 305] >gi|161355334|ref|ZP_02101214.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 1106b] >gi|161373973|ref|ZP_02113524.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 1710a] >gi|167739164|ref|ZP_02411938.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 14] >gi|167816375|ref|ZP_02448055.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 91] >gi|167824754|ref|ZP_02456225.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 9] >gi|167846286|ref|ZP_02471794.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei B7210] >gi|167894867|ref|ZP_02482269.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 7894] >gi|167911498|ref|ZP_02498589.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 112] >gi|167919507|ref|ZP_02506598.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei BCC215] >gi|194510813|ref|YP_002023343.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei Pasteur 52237] >gi|194514415|ref|YP_002050921.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei S13] >gi|194570728|ref|YP_002105728.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 406e] >gi|123598732|sp|Q3JR34|DXR_BURP1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218245|sp|A3NWM5|DXR_BURP0 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218246|sp|A3NAU2|DXR_BURP6 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|59797511|sp|Q63T18|DXR_BURPS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|52210176|emb|CAH36155.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei K96243] >gi|76579246|gb|ABA48721.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 1710b] >gi|126220616|gb|ABN84122.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 668] >gi|126228607|gb|ABN92147.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 1106a] >gi|134250696|gb|EBA50775.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 305] >gi|157806987|gb|EDO84157.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei 406e] >gi|157936966|gb|EDO92636.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei Pasteur 52237] >gi|169654023|gb|EDS86716.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia pseudomallei S13] (398 aa)
Score = 463, Expect = 3.1e-44, Identities = 117/347 (33%), Positives = 196/347 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           +K++ + G+TG+IG S+L+++ +  E + +   + + N EK +    RF   +      +T   V                  +  ++ +    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA++LF   +++I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     +  L    +  LTF + D  ++  +  A D LE    A    +NAANE A+  F   +I+F  I + +   +  L N     L D++
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLRAAGSRTQVAYGKQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGIAKIIVTASGGPFRTREPATLASVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGLPSERIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQIATLTFEKPDYARFPCLALAIDALEAGGVA-SAALNAANEIAVDAFLSRRIRFTAIAQTVGAVLDGLSNRTPGGLDDVI 372
>gi|50119975|ref|YP_049142.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pectobacterium atrosepticum SCRI1043] >gi|59797544|sp|Q6D8D9|DXR_ERWCT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|49610501|emb|CAG73946.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Erwinia carotovora subsp. atroseptica SCRI1043] (398 aa)
Score = 463, Expect = 3.1e-44, Identities = 125/354 (35%), Positives = 199/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---------------------VKTK--NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG SSL +I+   + + +   S   N +  LE        L F P+                      KT+    V +  EL      D ++ A+VG +GL  TL A+     + LANKESLV  G L  D    S +++ P+DSEH++++ SL    +            ++ +I+T SGGPF +   + L ++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A +  PDM+  I   ++  E   +    L F  +  LTF   D  ++  +  A D   N  ++    +NAANE A+  F +++I+F DI  + +  I  L   E   + D+L ++   R+
  S:     2 KQLTILGSTGSIGVSSLAVIKANPDKFTVRALSAGYNVKLMLE------QCLTFQPTYASMADEASATALRQQLAEYGCKTEVLAGVQAACELAALDGVDQVMAAIVGAAGLLPTLAAIHAGKQVLLANKESLVTCGRLFMDAVEQSDAQLLPIDSEHNAIFQSLPEQIQRQLGYASLSKHGVERIILTGSGGPFRETPVSALADMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQMEVIIHPQSVIHSMVRYRDGSVLAQLGSPDMRTPIAHAMAYPERVASGAKALDFCQIGALTFLAPDYARYPCLQLAIDAC-NHGQSATTTLNAANEIAVAAFLQSQIRFTDIAAVNQHVIEQLTLPEPTSVDDVLFIDSWARQ 387
>gi|116254105|ref|YP_769943.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhizobium leguminosarum bv. viciae 3841] >gi|166218277|sp|Q1MB26|DXR_RHIL3 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115258753|emb|CAK09859.1| putative 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Rhizobium leguminosarum bv. viciae 3841] (396 aa)
Score = 462, Expect = 4.1e-44, Identities = 121/354 (34%), Positives = 201/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE----KENYELVGFSFNNNYEK------------ALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI--ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRK 365
           +++ +FG+TG+IG ++L +++    +EN+E+   + + N E             A+   +R   +L    S       +    L+E  + D+  ++ A+VG +GL  TL A +   D+ALANKE LV AG L     R    R+ PVDSEH++++  L+ N +  ++ +I+T SGGPF      ++ ++    A  HPNW+MG KISIDSA+M NK  E+IEA +LF+ +  +I+V  H QSIIHSM+ +TD S +A +  PDM+ +I   LS +  + NL +  L F  L  L F   D  ++  +  A      +      ++N A E A+  F E ++ FL + E+ E+ +  L    +   + D+   ++  R+
  S:     9 RRLSIFGSTGSIGQNTLNVVDHLGGRENFEISVLTGSGNVELLARQAKSSGARLAVTANDRHYESLKSELSGTGIAVASGKSGLMEAADRDVDWVMAAIVGTAGLAPTLAAARRGADIALANKECLVSAGDLFIAAIREGGGRLLPVDSEHNAIFQVLEENQRHAVERVILTASGGPFRTASLRDMADVTVETARAHPNWSMGLKISIDSASMFNKALEMIEALHLFSLRPEQIEVIFHPQSIIHSMVGYTDGSVLAQLGAPDMRTAIGYALS-FPRRPNLPVERLDFAKLARLDFEAPDEVRFPALRLA-RLAMTRGGVQGAVLNGAKEVALEAFIEGRLSFLAMAEVTERVMDDLAGLPQAAGMDDVFAADREARQ 384
>gi|114569936|ref|YP_756616.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Maricaulis maris MCS10] >gi|114340398|gb|ABI65678.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Maricaulis maris MCS10] (396 aa)
Score = 462, Expect = 4.1e-44, Identities = 116/331 (35%), Positives = 187/331 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE---NYELVGFSFNNNYEKALEIINRFPNALVFS----------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++V + GATG++G ++L++I +     Y++V  +   N  +      RF    V                  P ++     ++  ++  + + D  + A+VG +GL  TL AL+    LA ANKE LV AG L  D      + + PVDSEH++++      ++E I+ + +T SGGPF +     +   + ADA+ HP W MG KISIDSATMMNK  E+IEA +LF+   ++++V  H QSI+H M+++ D S +A +  PDM+  I   L+  E     +  L   ++  L F   DL ++  I  A + +E    A P ++NAANE A+  F  ++I FLDI   +E+ +
  S:     4 RRVSILGATGSVGTATLDLIGRAAPGQYKVVALTAKTNAAELARQAIRFQAECVAIADPAAAPALQQALKDHPGIEIGVGEDAVCDVAAR-DADWTMAAIVGAAGLKPTLAALRQGRALAFANKECLVCAGSLFMDEAARCGTTLLPVDSEHNAVFQVFDRAHREAIRSITLTASGGPFREATREVMARASRADALAHPTWEMGAKISIDSATMMNKGLEVIEACWLFDLAPERVEVVVHPQSIVHGMVEYADGSLLAQLGSPDMRTPIASALAWPERMAAPVERLRLTDIARLDFEPPDLTRFPAIRLAREAMEAGGIA-PAVLNAANEIAVEAFLADRIGFLDIASGVEQVL 355
>gi|85716990|ref|ZP_01047953.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrobacter sp. Nb-311A] >gi|85696192|gb|EAQ34087.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrobacter sp. Nb-311A] (407 aa)
Score = 461, Expect = 4.6e-44, Identities = 121/336 (36%), Positives = 181/336 (53%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +E   + V V GATG+IG S+++++      Y +   + N+N E   ++   F    V   +V         ++ L  +                   D ++ A+ G +GL   L A+     +ALANKE LV AG         + + I P DSEH++L+ +L + N+ E+  +IIT SGGPF      ++ N   A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA  LF    ++I V  H QSIIH M++F+D S +A +  PDM+  I   L   E        L   ++  LTF   D  ++  +  AYD L   N A   + NAANE A+  F   KI+F  I  ++E  +
  S:    12 VEAGVRTVTVLGATGSIGDSTMDLLRGAPGRYRVEALTANSNVEGLAKLAREFDARFV---AVADTARFGELKDALAGSGIECGVGESAIIEAASRPTDWLMAAVSGAAGLKPALAAVDRGTTIALANKECLVCAGDFFMQRAAKAGACILPADSEHNALFQALSSGNRDELTRVIITASGGPFRTWAAADIENATLAQALKHPNWSMGRKITIDSASMMNKGLEVIEAACLFALEPEEIDVLVHPQSIIHGMVEFSDRSVVAQLGTPDMRTPIAHCLGWPERIAGPAVKLDLASIGQLTFEAPDFARFPALRLAYDALRTGNGAT-TVYNAANEIAVAAFIAEKIRFGAIARLVEATM 366
>gi|167646761|ref|YP_001684424.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Caulobacter sp. K31] >gi|167349191|gb|ABZ71926.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Caulobacter sp. K31] (401 aa)
Score = 461, Expect = 5.2e-44, Identities = 128/323 (39%), Positives = 186/323 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENY--ELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK--------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDI 334
           +KV+V G+TG+IG S+L++ E+ +   E++  +   N EK  E       AL + P V   +      EL E+                       D +++A+VG +GL  TL A +    +ALANKESLV AG  +  + R +   + PVDSEHS+++  L+ +    +  LI+T SGGPF   +   +       AV HPNW+MG KIS+DSATMMNK  E+IEA YLF+T  ++I V  H QS+IHS++++TD S +A +  PDM+  I    +     +     L      +LTF   DLD++  I  A + L     A P  MNAANE A+  F + +I FLDI
  S:    10 RKVVVLGSTGSIGVSTLDLFEQADVAIEILALTAGRNVEKLAE------QALRWKPQVAVIDDETLLPELRERLAGSGVRAAAGPAAVSEAAAMGADWVMSAIVGAAGLAPTLAAARTGAVIALANKESLVCAGPALLRIAREAGGSVIPVDSEHSAIFQVLQADCLDRVSRLILTASGGPFRTWDKTAMAGATPEQAVAHPNWSMGAKISVDSATMMNKGLEMIEASYLFDTSHERIDVVIHPQSVIHSLVEYTDGSTLAQLGPPDMRSPISCAFAWPRRLSWPAKSLDLAAYASLTFEAPDLDRFPSIAIAREALRLGGGA-PAAMNAANEVAVAAFLDRQIGFLDI 351
>gi|8134412|sp|O83610|DXR_TREPA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (376 aa)
Score = 461, Expect = 5.6e-44, Identities = 113/331 (34%), Positives = 183/331 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFP-NALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++V+V G TG+IG ++L+++ +  + + LVG S +   E A  +   F  + +  + S   +      + LL     ++++N + G +GL  +L  LK    LALANKES+V+A  L+    R S + I PVDSEH++++  +  +    + ++++T SGGPF       L ++   DA++HP W MGKKIS+DSAT+ NK  E+IEA   F     ++ V  H QSI+H++++       A +SVPDM   +   L   ++       L F + L+L F    +D +  +   +D    Q RA PI  NAANEEA+  F +  I FLDI  +  +A+
  S:     4 RRVVVLGITGSIGAAALKLLRRFPDRFLLVGASGHRQTEYARALAREFSLSDITMTGSCSEQEGRARIKRLLSSCEAEVVVNGIAGAAGLFASLEVLKTRCTLALANKESVVLAASLLHAAARESGATIVPVDSEHAAIFQLIAAHGAHAVAQVVLTASGGPFRTFSKECLAHVTVEDALQHPTWRMGKKISVDSATLANKALEVIEAVQFFRIPVDRVTVVVHPQSIVHALVQCHSGETYAQLSVPDMASPLLYALLYPDAPPAYQTPLDFTSGLSLHFEPPRVDDFPLLRMGFDVARAQ-RAYPIAFNAANEEAVRAFLQRNIGFLDIAHVTAQAL 340
>gi|15639589|ref|NP_219039.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025827|ref|YP_001933599.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Treponema pallidum subsp. pallidum SS14] >gi|3322895|gb|AAC65574.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018402|gb|ACD71020.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Treponema pallidum subsp. pallidum SS14] (383 aa)
Score = 461, Expect = 5.6e-44, Identities = 113/331 (34%), Positives = 183/331 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFP-NALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           ++V+V G TG+IG ++L+++ +  + + LVG S +   E A  +   F  + +  + S   +      + LL     ++++N + G +GL  +L  LK    LALANKES+V+A  L+    R S + I PVDSEH++++  +  +    + ++++T SGGPF       L ++   DA++HP W MGKKIS+DSAT+ NK  E+IEA   F     ++ V  H QSI+H++++       A +SVPDM   +   L   ++       L F + L+L F    +D +  +   +D    Q RA PI  NAANEEA+  F +  I FLDI  +  +A+
  S:    11 RRVVVLGITGSIGAAALKLLRRFPDRFLLVGASGHRQTEYARALAREFSLSDITMTGSCSEQEGRARIKRLLSSCEAEVVVNGIAGAAGLFASLEVLKTRCTLALANKESVVLAASLLHAAARESGATIVPVDSEHAAIFQLIAAHGAHAVAQVVLTASGGPFRTFSKECLAHVTVEDALQHPTWRMGKKISVDSATLANKALEVIEAVQFFRIPVDRVTVVVHPQSIVHALVQCHSGETYAQLSVPDMASPLLYALLYPDAPPAYQTPLDFTSGLSLHFEPPRVDDFPLLRMGFDVARAQ-RAYPIAFNAANEEAVRAFLQRNIGFLDIAHVTAQAL 347
>gi|53723733|ref|YP_103189.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei ATCC 23344] >gi|121600295|ref|YP_993366.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei SAVP1] >gi|124386204|ref|YP_001029197.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei NCTC 10229] >gi|126449763|ref|YP_001080873.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei NCTC 10247] >gi|167000556|ref|ZP_02266367.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei PRL-20] >gi|194314363|ref|YP_002010127.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei ATCC 10399] >gi|194525727|ref|YP_002061257.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei FMH] >gi|194529912|ref|YP_002065433.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei JHU] >gi|194574987|ref|YP_002109871.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei 2002721280] >gi|166218242|sp|A3MKT7|DXR_BURM7 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218243|sp|A2SB78|DXR_BURM9 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218244|sp|A1V563|DXR_BURMS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|59797505|sp|Q62JD0|DXR_BURMA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|52427156|gb|AAU47749.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei ATCC 23344] >gi|121229105|gb|ABM51623.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei SAVP1] >gi|124294224|gb|ABN03493.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei NCTC 10229] >gi|126242633|gb|ABO05726.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei NCTC 10247] >gi|147749737|gb|EDK56811.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei FMH] >gi|147753922|gb|EDK60987.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei JHU] >gi|148027239|gb|EDK85260.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei 2002721280] >gi|160699739|gb|EDP89709.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei ATCC 10399] (398 aa)
Score = 460, Expect = 7.1e-44, Identities = 117/347 (33%), Positives = 195/347 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           +K++ + G+TG+IG S+L+++ +  E + +   + + N EK +    RF   +      +T   V                  +  ++ +    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA++LF   ++ I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     +  L    +  LTF + D  ++  +  A D LE    A    +NAANE A+  F   +I+F  I + +   +  L N     L D++
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLRAAGSRTQVAYGKQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGIAKIIVTASGGPFRTREPATLASVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGLPSEHIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQIATLTFEKPDYARFPCLALAIDALEAGGVA-SAALNAANEIAVDAFLSRRIRFTAIAQTVGAVLDGLSNRTPGGLDDVI 372
>gi|113868028|ref|YP_726517.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia eutropha H16] >gi|123032960|sp|Q0KA22|DXR_RALEH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|113526804|emb|CAJ93149.1| 1-Deoxy-D-xylulose 5-phosphate reductoisomerase [Ralstonia eutropha H16] (393 aa)
Score = 459, Expect = 7.8e-44, Identities = 121/353 (34%), Positives = 203/353 (57%)
  Q:    13 KVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNA---------------LVFSPSVKTK--NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLT------FSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++ + GATG+IG S+L+++ +  + Y +   + +    K  +    F  A               L+    VKT+  +   + E +      D ++ A+VG +GL  TL A +    + LANKE+LV++G +  D  R   + + P+DSEH++++  L  ++    + +  +++T SGGPF  ++   L +I+   A  HPNW MG+KIS+DSATMMNK  E+IEA++LF    ++I+V  H QSI+HSM+ +TD S +A +  PDM+  I  GL+ Y  +     D     L+LT      F + DL ++  +  A+D L     A P  +NAANE A+  F    ++F DI  I+ + + A      + L+ +L+ +   R+
  S:     3 RITILGATGSIGESTLDVVRRHADRYVVHALTAHRQVRKLADQCVEFRPARAVVGTAEAALELETLLRDAGVKTEVSHGEAALESVAADAQTDSVMAAIVGAAGLRPTLAAARAGKRVLLANKEALVMSGRIFMDAVREHGATLLPIDSEHNAIFQCLPADDPRYGRGVARVLLTASGGPFRTRDPATLHDISPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGAPAERIEVLIHPQSIVHSMVAYTDGSVLAQLGNPDMRTPIAYGLA-YPERI----DAGVTPLDLTVAGGLHFEKPDLVRFPCLGLAFDALRAGGVA-PAALNAANEVAVEAFLGGTVRFTDIAGIVRQVLEATPQGPADTLEAVLSADALARE 380
>gi|157165697|ref|YP_001467264.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter concisus 13826] >gi|112801899|gb|EAT99243.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Campylobacter concisus 13826] (369 aa)
Score = 459, Expect = 8.7e-44, Identities = 129/353 (36%), Positives = 201/353 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFE------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           V++ G+TG+IG ++L + EK N E+   S   N +   E I +F    V     K    V + E            E+LE ++   ++NALVGF+GL  +L        LALANKESLVV G  ++      +  I P+DSEH  L   L+N     K LIIT SGG FYKK    L +   +DA+KHPNW+MG KI+IDSATM NK FE++EAY+L+  K I+      S IH++++F D S   ++S  +MKL+I   +   + + N+++  +  +L N+ F +I L K+       + L + +  + +++NAANE  +  F E K  FLDI  +I  +    ++ +++ + +I  ++K  R+Y
  S:     5 VVILGSTGSIGKNTLALCEKFNVEVEALSCAKNVDLLNEQILKFKPKFVCVGDEKLAKNVKNIEAKNIFFGETGLLEMLEISSSKKVINALVGFAGLAPSLKTQALGKRLALANKESLVVGGKFLK------TREILPIDSEHFGLKFLLENKTAPSK-LIITASGGAFYKKPIKFLKDATPSDALKHPNWDMGAKITIDSATMTNKLFEVMEAYWLYGIKDIEAVIEPTSAIHAVVEFVDGSSTMHLSRTNMKLAISHAIF-EKVEQNIVSHANLLDLKNIKFHKISLKKYPVFSLKDEVLASPD--LGVVINAANEVGVFSFLEKKCSFLDISRLILGSSKKFKSLKISSVDEIYEVDKEVREY 360
>gi|75676044|ref|YP_318465.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrobacter winogradskyi Nb-255] >gi|123613280|sp|Q3SRH8|DXR_NITWN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|74420914|gb|ABA05113.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrobacter winogradskyi Nb-255] (407 aa)
Score = 459, Expect = 9.1e-44, Identities = 118/336 (35%), Positives = 183/336 (54%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +E   + V V GATG+IG S+++++   +  Y +   + N+N E  +++   F    V   ++   +  +  +  L  T                   D ++ A+ G +GL   L A+     +ALANKE LV AG         + + + P DSEH++L+ +L + N+ E+  +IIT SGGPF      ++ N   A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA  LF    ++I V  H QSI+H M++F+D S +A +  PDM+  I   L   E        L   ++  LTF   D  ++  +  AYD L     A   + NAANE A+  F   KI+F  I  ++E  +
  S:    12 VEAGVRTVTVLGATGSIGDSTMDLLRGARGRYRVEALTANSNVEGLVKLAREFDARFV---ALADTSYFDELKNALAGTGIEYGVGESAIIEAASRPADWLMAAVSGAAGLKPALAAVDRGATIALANKECLVCAGDFFMQRAARAGACVLPADSEHNALFQALSSGNRDELTRVIITASGGPFRTWAAADIENATLAQALKHPNWSMGRKITIDSASMMNKGLEVIEAACLFALEPEEIDVLVHPQSIVHGMVEFSDRSVVAQLGAPDMRTPIAHCLGWPERIAGPAAKLDLVSIGQLTFEAPDFARFPALRLAYDALRTGQGAT-TVYNAANEIAVAAFIAEKIRFGAIARLVEATL 366
>gi|15605905|ref|NP_213282.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aquifex aeolicus VF5] >gi|3913547|sp|O66722|DXR_AQUAE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|2983081|gb|AAC06688.1| hypothetical protein aq_404 [Aquifex aeolicus VF5] (380 aa)
Score = 459, Expect = 9.5e-44, Identities = 126/363 (34%), Positives = 206/363 (56%)
  Q:    13 KVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPD-----------IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNKF 375
           K+ V G+TG++G  +L++ E  ++  ELVG   N   EK L+   ++    V S     K  + S  E ++    D            ++NA+ G  G+      +K    L  +NKES++  G +I    R +  R+ PVDSEH++L+  L +   +E+K + +T SGGPF  K   EL   +  +A++HP WNMG KI+IDSAT+MNK FE++EA++LF+   + IKV  H QS +H +++  DNS++ + S  DMK+ I   L   + K      +S   L+ +TF ++D  K+K I  A          IP+++  A+EEA+ LF   KI FLDI ++IE+A+  +   +   +++IL   +  R+ V +  + K+
  S:     2 KLGVLGSTGSVGSQTLQVYENFRDEIELVGILANRASEKLLQQAKKYKPKYVVSYQEPAKEWLESLPEGVKYLKGDEGLKAIIEESERLMNAISGIYGIKPAYEVIKAGKTLLASNKESILCLGEII----RKNRERVIPVDSEHNALFQLLSSVKREEVKHVYLTASGGPFKDKSLEELKTASVEEALRHPRWNMGAKITIDSATLMNKGFEMLEAHFLFDFPIENIKVVIHPQSFVHGILELIDNSFLMHTSQTDMKIPIMHALFYPKRKEYPFKKVSLLELSPITFEKVDTTKFKAIDLAKWAGFMGGVYIPVLV-GADEEAVNLFLNKKIGFLDIVDLIEQALSEVNIKDPQSVEEILEAVEWGRQKVREIYERKY 376
>gi|15679908|gb|AAK96063.2|AF331705_1 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Lycopersicon esculentum] (475 aa)
Score = 459, Expect = 9.8e-44, Identities = 119/336 (35%), Positives = 201/336 (59%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G +  +  K + + G+TG+IG  +L+I+ +  + + +V  +  +N     + +  F   LV   +V+ ++ V   ++ L   +  P+II                  +  +VG +GL  T+ A++   D+ALANKE+L+  G  +         +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+L I   LS  +      +++++  L+      LTF   D  K+  +  AY    +  RA   +  +++AANE+A+ LF   +I +LDIF+I+E
  S:    71 GRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFRPKLV---AVRNESLVEELKDALADMEDKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPPAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRV--YCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAY----SAGRAGGTMTGVLSAANEKAVELFISERISYLDIFKIVE 431
>gi|148269183|ref|YP_001243643.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermotoga petrophila RKU-1] >gi|166198586|sp|A5IIP4|DXR_THEP1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|147734727|gb|ABQ46067.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermotoga petrophila RKU-1] (376 aa)
Score = 458, Expect = 1.1e-43, Identities = 111/333 (33%), Positives = 198/333 (59%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK-ENYELVGFSFNNNYEKALEIINRF--PNALVFSPSVKTKNTVN------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLE--NQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +++ +++ GATG+IG  +L++++K +   L+G SF++N E A +I+  F   N  V        +++N      S EE+LE   PDI + A+ GFSGL   L +L+++  + LANKESLV  G+L++   +   + + PVDSEHS+++  ++    E++++++T SGG     E +++      D ++HP WNMG +I++DSATM+NK FE++EA  LF    +KI+V  H + ++H  +   D +    +S PDM++ I   L  +  +   +       ++L+F + D +K+     A+  L+    + A+    NAA+E A+  F + +I+F  I  +IEK +
  S:     2 EERTLVILGATGSIGTQTLDVLKKVKGIRLIGISFHSNLELAFKIVKEFNVKNVAVTGDVEFEDSSINVWKGPHSIEEMLEALKPDITMVAVSGFSGLRAVLSSLEHSKRVCLANKESLVCGGFLVKKKLKEKRTELIPVDSEHSAIFQVIE---PEVEKVVLTASGGALRDWEISKIDRARPEDVLRHPVWNMGARITVDSATMVNKAFEVLEAMELFELPFEKIEVKIHREGLVHGAVVLPDGNVKMVVSPPDMRIPISYAL--FYPRRVALEPFFLRTISLSFEDPDPEKYP----AFFLLKEIKDSYALRTAFNAADEVAVEAFLKGRIRFGGIHRVIEKTL 338
>gi|23013456|ref|ZP_00053349.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Magnetospirillum magnetotacticum MS-1] (387 aa)
Score = 458, Expect = 1.1e-43, Identities = 116/356 (32%), Positives = 193/356 (54%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           +K V + G+TG+IG ++++++E+  E Y +     N+  +   +        L     V  +    + +E L  T                   D ++ A+VG +GL  TL A++    + LANKE LV AG L+        + + PVDSEHS+++   + + +  I+++I+T SGGPF  K    + ++    AV HPNW+MG KIS+DSA+M NK  E+IEA++LF+    KI +  H QS+IHS++ + D S +A +  PDM+  I   L         +  L    +  LTF   D  ++  +  A + L     A   +MNAANE ++  F   +I FLDI  I+E+ +  + + E+  + D+L  +   R++
  S:     4 RKGVTILGSTGSIGCNTVDLVERNPELYRVEALVANSRVDILAQQAKTLRAKLAV---VADEGAYGALKEALAGTGIEAAAGPEAVVAAARMPADWVMAAIVGAAGLAPTLAAVRRGAVVGLANKECLVCAGQLMMAEVEKHGATLLPVDSEHSAIFQVFEADQHDRIEKIILTASGGPFRTKTREFMADVTPEQAVAHPNWSMGAKISVDSASMFNKGLELIEAHHLFDMPEDKIDIVVHPQSVIHSLVAYVDGSVLAQLGSPDMRTPIAYALGWPNRIEAPVPRLDLATIATLTFEAPDPVRFPSLRLAREALRAGGSA-AAVMNAANEVSVAAFLGRRIGFLDIASIVERTVAGVTHCELTSIDDVLAQDAEARRF 378
>gi|51490971|emb|CAE00491.2| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Populus alba x Populus tremula] (472 aa)
Score = 458, Expect = 1.2e-43, Identities = 117/336 (34%), Positives = 202/336 (60%)
  Q:     4 GEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLE--KTNPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSG----YESKTNLINDLSFNNLNL------TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           G K  +  K + + G+TG+IG  +L+I+ +  + +++V  +  +N     + +  F   L+   +V+ +  V+  +E L   +  P+II                  +  +VG +GL  T+ A++   D+ LANKE+L+  G  +  L    + +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNW+MGKKI++DSAT+ NK  E+IEA+YLF  +   I +  H QSIIHSMI+  D+S IA +  PDM+L I   +S     Y SK    +++ + +++L      T+  +DL K   + +           +  +++AANE+A+ +F + KI +LDIF+++E
  S:    68 GRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVALLADQVRTFKPQLI---AVRNELLVDELKEALADVEEKPEIIPGEQGVVEVARHPDAVSVVTGIVGCAGLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIDIVIHQQSIIHSMIETQDSSVIAQLGWPDMRLPILYTMSWPDRVYCSKAP--DNVKYPSMDLAYAAEITWPRLDLCKLGSLTFG-----RAGGTMTGVLSAANEKAVEMFIDEKISYLDIFKVVE 428
>gi|71907378|ref|YP_284965.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dechloromonas aromatica RCB] >gi|81170443|sp|Q47F86|DXR_DECAR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|71846999|gb|AAZ46495.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Dechloromonas aromatica RCB] (398 aa)
Score = 458, Expect = 1.2e-43, Identities = 127/358 (35%), Positives = 198/358 (55%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEKENYELVGFSF------NNNYEKALEIINRFP----NALVFSPSVKTKNT---------VNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           M +K + + V GATG+IG S+L++I +       F+       +  +E+ +E   RF      +L  + S + ++          V +  EL      D ++ A+VG +GL  TL A +    + LANKE LV+AG L     R   + + PVDSEH++++ SL  +         ++++++T SGGPF      +L N+    A  HPNW MG+KIS+DSATMMNK  E+IEA++LF      I+V  H QS+IHS +++ D S +A +  PDM+  I   ++  E     +  L  F    L FS  D ++++ +  AYD L     A P I+NAANE A+  F +  + FL I  + E  + A+       L D+L  +   R
  S:     1 MSSKLQNITVLGATGSIGVSTLDVIRRHPDRYRAFALCAHSQVDKLFEQCVEFRPRFAVLRDASLAATLSERCRSVGLDTEVRYGVEALIELSSLPEVDAVMAAIVGAAGLEPTLAAARAGKKVMLANKEVLVMAGELFMHAVREYGATLLPVDSEHNAIFQSLPADFARGLESCGVQKILLTASGGPFRNSPLADLANVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFAAPPDMIQVVVHPQSVIHSAVQYADGSVLAQLGNPDMRTPIAYAMAWPERIAAGVEPLDLFKIARLDFSAPDFERFRCLQLAYDVLREGGTA-PAILNAANEVAVAAFLDGHLPFLGIALLNEAVLQAMPAGPEGSLADVLAADAEAR 385
>gi|51892637|ref|YP_075328.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Symbiobacterium thermophilum IAM 14863] >gi|59797527|sp|Q67PA9|DXR_SYMTH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|51856326|dbj|BAD40484.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Symbiobacterium thermophilum IAM 14863] (387 aa)
Score = 458, Expect = 1.2e-43, Identities = 119/347 (34%), Positives = 199/347 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALV---------------------FSPSVKTKNTVNSFEELLEK-TNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           KK + + G+TG+IG  +L++I+     + +V  +     E+  E   RF  AL+                     + P +         E L+   T+P+  ++L ++VG  G+  TL A++   D+ALANKE+LV AG L+    ++   ++ PVDSEHS+++ SL   +   ++ +++T SGGPF  ++  +L  +   +A++HP W MG K++IDSAT+MNK  E+IEA++LF    ++I+V  H QSI+HS ++F D + IA +   DM+L IQ  L   E     +  L    L  LTF   D + +  + +A   +      +P ++NAANE A+  F   +I F  IF+++   +   +  +  DL  IL
  S:     2 KKGIAILGSTGSIGTQALDVIDHHPGRFRVVALAAGRQVERLAEQALRFRPALLSVADADAAAALRALLLAEAGDYRPEIAWGR-----EGLIRAATHPESGLVLTSVVGAMGVEPTLAAIEAGKDIALANKETLVAAGELVTAAAQARGVKLLPVDSEHSAIFQSLAGADPGSVRRILLTASGGPFRGRK--DLTGVTREEALRHPRWTMGAKVTIDSATLMNKALEMIEAHWLFGVPMEQIEVIVHPQSILHSAVEFCDGNIIAQLGPTDMRLPIQYALCYPERCRGFVEPLDLIALGALTFERPDEETFPSLRYARRAV-TMGGTMPAVLNAANEVAVQRFLAGEIPFTGIFQLVAGVMDRHDPVQRPDLAAIL 370
>gi|92117247|ref|YP_576976.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrobacter hamburgensis X14] >gi|122418004|sp|Q1QMN1|DXR_NITHX 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|91800141|gb|ABE62516.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrobacter hamburgensis X14] (407 aa)
Score = 457, Expect = 1.3e-43, Identities = 120/342 (35%), Positives = 182/342 (53%)
  Q:     1 LLEGEKMENKKKKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           L   + +E   + V V GATG+IG S+++++      Y +   + N+N E  +++   F    V   +V         ++ L  +                   D ++ A+ G +GL   L A+     +ALANKE LV AG         + + I P DSEH++L+ +L + N+ E+  +IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA  LF     +I V  H QSI+H M++F+D S +A +  PDM+  I   L   E        L   ++  LTF   D  ++  +  AYD L   N A   + NAANE A+  F   KI+F  I  ++E  +
  S:     6 LKNNKPVEAGVRTVTVLGATGSIGDSTMDLLRGAPGRYRVEALTANSNVEALVKLAREFAARFV---AVADPARFGELKDALAGSGIECGVGESAIIEAASRPADWLMAAVSGAAGLKPALAAVDRGTTIALANKECLVCAGDFFMQRAAKAGACILPADSEHNALFQALSSGNRDELTRVIITASGGPFRTWAAADIEKATLAQALKHPNWSMGRKITIDSASMMNKGLEVIEAACLFTLTPDEIDVLVHPQSIVHGMVEFSDRSVVAQLGTPDMRTPIAHCLGWPERIVGPAAKLDLASIGQLTFEAPDFTRFPALRLAYDALRTGNGAT-TVYNAANEIAVAAFIGEKIRFGAIARLVEATM 366
>gi|84995824|ref|XP_952634.1| 1-deoxy-D-xylulose 5-phosphate reducto-isomerase, putative [Theileria annulata] >gi|65302795|emb|CAI74902.1| 1-deoxy-D-xylulose 5-phosphate reducto-isomerase, putative [Theileria annulata] (442 aa)
Score = 457, Expect = 1.6e-43, Identities = 117/345 (33%), Positives = 201/345 (58%)
  Q:    13 KVLVFGATGNIGFSSLEIIEKEN---------YELVGFSFNNNYEKALEIINRF--------------PNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND--LKDIL 357
           KV + G+TG++G  +LE+I   N         +++V  +  +N++   + +N F              PN L     + +  +     +L  K + D+I+ A+ G  G+  T+ A ++   +AL+NKES+V AG L+  + +   + + PVDSEH++++  L +   +                 +K LI+T SGGPF  K++ E  N+  +D + HP W MG KI++DS+TMMNK  E++EA++LF  +   IK+  H + ++HS+++F DNS +  M +PDMKL I   L+      N +  L      LTF E D + +  +   Y+ +       P + NAAN+ A  LF  N I +  ++ I+ + +    N ++ND  L+DI+
  S:    38 KVAIMGSTGSVGTQALEVIRNLNNLEGGSEPKFKVVALAAKSNHKLLSQQVNEFKPQVCHILKNYEKLPNLLKRKCEILSDKS--DLLDLCRKLDYDLIIMAISGCDGIEPTMAAAESGKKIALSNKESVVSAGSLLSKVVKKYKTTVIPVDSEHNAIFQCLDDGQVDTTRITYVTSISSQVLAGVKNLILTTSGGPFLGKKYPEYKNLKTSDNISHPVWKMGSKITVDSSTMMNKALEVLEAHHLFGIHLDNIKILVHKECLVHSLVEFVDNSVLCQMYLPDMKLPISHSLNWPNRTKNSLLPLDLRGKALTFKEADFENFPFLCLGYE-VGRMGGLYPAVFNAANDVANDLFRSNMIDYDQLYHIVRETVEEFNNPDLNDDSLQDIM 423
>gi|119026176|ref|YP_910021.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium adolescentis ATCC 15703] >gi|118765760|dbj|BAF39939.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium adolescentis ATCC 15703] (392 aa)
Score = 456, Expect = 1.8e-43, Identities = 115/329 (34%), Positives = 194/329 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL-EIINRF--PNALVFSPSVKTKNTVNSFEELLEK--------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           V++ G+TG+IG   L++I +  + + + G +    + + L +   +F  P   +F      K  V +  E LE+                    +  D++LN + G  GL  ++ AL+    LALANKES+V  G L+    +    +I PVDSEHS+++ SL++  + E+ +L++T SGGPF   + +++ +I    A+ HP WNMG  ++I+S+T+MNK  E+IEA  LF+    +I V  H QSI+HSM++F D + IA  S PDM+L I  GLS  E   N+     +      TF  +D + +  ++ A   LE+  +    ++NAANE+A+  F E+++ +L I + + + +
  S:     6 VVILGSTGSIGTQGLDVISRHLDRFTVTGLAAGGAHVELLAQQAAKFHVPTVAIF-----YKEAVPALREALEQAGAGNVNITAGPDAVIAMAGSGADVVLNGITGSIGLEPSIAALQAGSQLALANKESVVAGGHLLFS-AQVRDKQINPVDSEHSAIWQSLRSGTHGEVSKLVVTASGGPFRGWKRDQMTDITPEQALNHPTWNMGPVVTINSSTLMNKGLEVIEASRLFDVPPSRIDVTVHPQSIVHSMVEFRDGATIAQASPPDMRLPIALGLSAPERLGNVAAACDWTKAATWTFEPLDNEAFPAVNLARHCLESSEKHTA-VLNAANEQAVHAFLEHRLPYLGIVDTVREVL 356
>gi|15643651|ref|NP_228697.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermotoga maritima MSB8] >gi|8134414|sp|Q9WZZ1|DXR_THEMA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|4981424|gb|AAD35970.1|AE001754_7 conserved hypothetical protein [Thermotoga maritima MSB8] (376 aa)
Score = 456, Expect = 1.8e-43, Identities = 110/333 (33%), Positives = 198/333 (59%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK-ENYELVGFSFNNNYEKALEIINRF--PNALVFSPSVKTKNTVN------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLE--NQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +++ +++ GATG+IG  +L++++K +   L+G SF++N E A +I+  F   N  +        +++N      S EE+LE   PDI + A+ GFSGL   L +L+++  + LANKESLV  G+L++   +   + + PVDSEHS+++  ++    E++++++T SGG     + +++      D +KHP WNMG +I++DSATM+NK FE++EA  LF    +KI+V  H + ++H  +   D +    +S PDM++ I   L  +  +   +       ++L+F + D +K+     A+  L+    + A+    NAA+E A+  F + +I+F  I  +IEK +
  S:     2 EERTLVILGATGSIGTQTLDVLKKVKGIRLIGISFHSNLELAFKIVKEFNVKNVAITGDVEFEDSSINVWKGSHSIEEMLEALKPDITMVAVSGFSGLRAVLASLEHSKRVCLANKESLVCGGFLVKKKLKEKGTELIPVDSEHSAIFQVME---PEVEKVVLTASGGALRDWKISKIDRARPEDVLKHPVWNMGARITVDSATMVNKAFEVLEAMELFELPFEKIEVKIHREGLVHGAVVLPDGNVKMVVSPPDMRIPISYAL--FYPRRVALEPFFLRTISLSFEDPDPEKYP----AFFLLKEIKDSYALRTAFNAADEVAVEAFLKGRIRFGGIHRVIEKTL 338
>gi|37903527|gb|AAP56242.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Agrobacterium tumefaciens] (397 aa)
Score = 456, Expect = 2.1e-43, Identities = 124/363 (34%), Positives = 197/363 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE----KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI-----------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLEN---QNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRKYVYDFSKNK 374
           +K+ + G+TG+IG S+L+++     ++ +E+   +   N     E    F   L  +      +   + +  L  T  ++                 ++ A+ G  GL  TL A +   D+ALANKE LV AG +     +    R+ PVDSEHS+++  L   +K+ ++ +++T SGGPF      E+ N+    A  HPNW+MG K+SI SA+M NK  E+IEA YLF+ +  +++V  H QSIIHSM+ +TD SYIA +  PDM+ +I   L+ Y  + NL +  L F  L  L F   D  ++  I  A   LE    Q  A    +NAA E A   F    I FLD+ EI+E  +  + +      ++D+   ++  R++  +    K
  S:     9 RKLTILGSTGSIGTSTLDVVRQLGGRDAFEITALTGAGNIALLAEQAREFGARLAVTAE---DDKYEALKSALAGTGIEVAAGKSGLEEAASMGAGWVMAAIAGTPGLAPTLTAARRGADIALANKECLVSAGDVFLRTVKQGGGRLIPVDSEHSAIFQCLTGEHKQAVERIVLTASGGPFRTWSRGEMANVTADIARAHPNWSMGLKVSIGSASMFNKGLEMIEAKYLFDLRPDQVEVIVHPQSIIHSMVGYTDGSYIAQLGSPDMRTAISYALT-YPQRGNLNVERLDFAKLARLDFEAPDEARFPAIRVARTALERGGLQGAA----LNAAEETAFHAFVAGGIGFLDMAEIVETVMDRMHDGRSAATIEDVFAADEEARRHARELIATK 393
>gi|21672510|ref|NP_660577.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25008397|sp|Q8K9S7|DXR_BUCAP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21623131|gb|AAM67788.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (398 aa)
Score = 455, Expect = 2.4e-43, Identities = 129/353 (36%), Positives = 211/353 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL---------KNNNKE--IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           KK+ V G+TG+IG S+L I++     ++++    N N    LE    F        + K+ + +                  +  +L      D++++A+VG +GL  TL A+     + LANKESL+V G +      S+ ++I+P+DSEH++++  L         K N K+  +K +I+T SGGPFY  +   L  +   +A  HPNW+MG+KISIDSATM+NK FE  EA  LFN  + +I +  H QSIIHSM+++ D + +A +SVPDMK++I   +S     ++    L+FN L NL+F + D  ++  +  A D   +Q +A   ++NA NE  +  F ++KI F  I EI    +++   +E   ++++L ++K TR
  S:     2 KKITVLGSTGSIGISTLSIVKNNPSLFKVIVLVANKNSSMMLEQCEYFSPDWAIMKNKKSAHILKKRLKDKKIKTQVLSGNKAICQLAALKESDLVISAIVGMAGLLPTLSAINAGKTILLANKESLIVCGIIFMKALSSNKAKIFPIDSEHNAIFQVLPKFVQKNLGKVNLKKNGVKSIILTASGGPFYNFKRENLSFVTPLEACSHPNWSMGRKISIDSATMINKGFEYAEARLLFNASSSEIDILIHPQSIIHSMVEYIDGTILAQLSVPDMKVAISYAMSWPNRISSGAKFLNFNKLSNLSFFKPDFIQFPCLKLAIDAF-SQGQAAMTVLNAVNEVTVSAFLDSKISFNKISEINTDILMSSSFSEPVSVEEVLEIDKKTR 386
>gi|15889868|ref|NP_355549.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Agrobacterium tumefaciens str. C58] >gi|22095589|sp|Q8UC86|DXR_AGRT5 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|15157812|gb|AAK88334.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Agrobacterium tumefaciens str. C58] (397 aa)
Score = 455, Expect = 2.4e-43, Identities = 123/363 (33%), Positives = 197/363 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE----KENYELVGFSFNNNYEKALEIINRFPNALVFSPS---------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLEN---QNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND-LKDILNLNKNTRKYVYDFSKNK 374
           +K+ + G+TG+IG ++L+++     ++ +E++  +   N     E    F   L  +                 +K    +   EE     +   ++ A+ G  GL  TL A +   D+ALANKE LV AG +     +    R+ PVDSEHS+++  L    K+ ++ +++T SGGPF     +E+ N+    A  HPNW+MG K+SI SA+M NK  E+IEA YLF+ +  ++ V  H QSIIHSM+ +TD SYIA +  PDM+ +I   L+ Y  + NL +  L F  L  L F   D  ++  +  A   LE    Q  A    +NAA E A   F    I FLD+ EI+E  +  + +    + + D+ + ++  R++  +    K
  S:     9 RKLTILGSTGSIGTNTLDVVRQLGGRDGFEIMALTGAGNIALLAEQAREFGAQLAVTADDDKYEALKSALAGTGIKVAAGMAGLEEA-ASMDAGWVMAAIAGTPGLAPTLTAARRGADIALANKECLVSAGDVFLRTVKQGGGRLIPVDSEHSAIFQCLTGEYKQAVERIVLTASGGPFRTWSRDEMSNVTADIARAHPNWSMGLKVSIGSASMFNKGLEMIEAKYLFDLRPDQVDVIVHPQSIIHSMVGYTDGSYIAQLGSPDMRTAISYALT-YPERGNLSVERLDFAKLARLDFEAPDEARFPALRLARMALERGGLQGAA----LNAAEETAFHAFVAGGIGFLDMAEIVETVMDRMHDGRTAETMDDVFSADEEARRHALELIATK 393
>gi|46445894|ref|YP_007259.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Candidatus Protochlamydia amoebophila UWE25] >gi|59797566|sp|Q6MEL5|DXR_PARUW 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|46399535|emb|CAF22984.1| probable 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Candidatus Protochlamydia amoebophila UWE25] (384 aa)
Score = 455, Expect = 2.7e-43, Identities = 121/354 (34%), Positives = 201/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNY--------EKALEIINRFPNALVF--SPSVKTKNTVNSFEELLEK---TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSF-NNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K + + G+TG+IG ++L++    KE  ++V  +   N         E   +II  F NA  +     +  K  +   E LL     +  D++++A+ G  GL  T+ A+K   D+ LANKE+LV  G +I  L +  +  + P+DSEHS+++  L     K ++ +I+T SGGPF      +L  +    A+ HP W+MG K++IDS+T+MNK  E+IEA++LF+   ++I V  H QSIIHS+++F D S +A MS P+M + IQ  L+  +    L     F  N  L F E +   ++ +  AY+ L+     +P  MNAANE  +  F + ++ + +I   +EK +    +  V+ L+ IL ++   R+
  S:     2 KHIAILGSTGSIGKNTLQVARHLKERIKVVAIAARENIDLLEAQSKEFCPDIIAVFNNAKAYELQKRLPGKTVLAGMEGLLAAASYSEADLVISAMTGTMGLQPTIEAIKAGKDVGLANKEALVSGGAIIMKLVKEKNINLLPIDSEHSAIFQCLNGEALKSVQRIILTSSGGPFRTWTQEQLETVTVEQALNHPTWSMGPKVTIDSSTLMNKGLEVIEAFWLFDVSPEQIDVIVHPQSIIHSLVEFCDGSMLAQMSEPNMIVPIQYSLTYPDRAPGLFKPFDFMKNSKLEFFEPNKKTFRCLALAYEALKCGG-TLPCYMNAANEVLVERFLKGELSWKNIGIQLEKLMDQHASISVDSLETILAVDALARE 373
>gi|61102698|gb|AAP56260.3| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Cistus incanus subsp. creticus] (486 aa)
Score = 454, Expect = 3.1e-43, Identities = 115/328 (35%), Positives = 196/328 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN--PDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIE 339
           K + + G+TG+IG  +L+I+ +  + +++V  +  +N     E + RF   LV   +++ +  +    E L   +  P+II                  +  +VG +GL  T+ A++   D+  ANKE+L+  G  +  L      +I P DSEHS+++  ++   +  ++ +I+T SGG F      +L  +  ADA+KHPNW+MGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A M  PDM+L I   +S  +      +++++  L+      LTF   D  K+  +  AY       RA   +  +++AANE+A+ +F   +I +LDIF+ +E
  S:    79 KSISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLAEQVRRFRPQLV---AIRNEALLGELREALADLDYKPEIIPGEEGVIEVARHPDAATVVTGIVGCAGLKPTVAAIEAGKDIXXANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPDGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIVIHPQSIIHSMVELQDSSILAQMGWPDMRLPILYTMSWPDRV--YCSEITWPRLDLCKLGSLTFKAPDTIKYPSMGLAY----AAGRAGGTMTGVLSAANEKAVEMFLNEEISYLDIFKFVE 431
>gi|145589626|ref|YP_001156223.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048032|gb|ABP34659.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Polynucleobacter sp. QLW-P1DMWA-1] (394 aa)
Score = 454, Expect = 3.3e-43, Identities = 124/361 (34%), Positives = 203/361 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEK-ALEIINRFPNALVFSP----------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           ++V + G+TG+IG ++L++I      + +V  +     E  A + +   P   V S                 S +     ++    + +++ D ++ A+VG +GL   L A K    + LANKE+LV++G L     +S    + P+DSEH++++  L N       N   ++EL +T SGGPF      +L  I    A  HPNW MG+KIS+DSATMMNK  E+IEA++LF    +KIKV  H QS++HSM+++ D S +A +  PDM+  I  GL+  E     +  L    L  L FSE +L ++  +  A+   +    A P ++NAANE A+  F +  + +L I +++EK + A+  T  + L+ IL ++   R   +D  +
  S:     4 RQVAILGSTGSIGVNTLDVIRAHPARFNVVALTAGKQIELLAQQCVEFKPMIAVVSEAGDAARLEKMLLEQGVSTQVMYGPDALVSAVTESSCDTVMAAIVGAAGLVPALAAAKAGKRVLLANKEALVMSGNLFMQAMKSGGGELLPIDSEHNAIFQCLPNEFTKSTHNGLGVEELWLTASGGPFRSTPIEQLAAITPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAFWLFGLPLEKIKVLIHPQSVVHSMVRYRDGSVLAQLGQPDMRTPIAYGLAWPERIEAGVAPLDLAQLAALNFSEPELARFPCLSLAFAAAKAGGTA-PAVLNAANEVAVAAFLDAGLPYLQIPQVVEKTLDAIAVTNADSLETILAIDAQARSVAHDLMR 392
>gi|110640392|ref|YP_668120.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli 536] >gi|191172755|ref|ZP_03034292.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli F11] >gi|110341984|gb|ABG68221.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli 536] >gi|190906905|gb|EDV66507.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli F11] (398 aa)
Score = 454, Expect = 3.3e-43, Identities = 121/356 (33%), Positives = 201/356 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+ V
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVARMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANAREVV 389
>gi|45656747|ref|YP_000833.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|59797589|sp|Q72U08|DXR_LEPIC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|45599983|gb|AAS69470.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase oxidoreductase protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (389 aa)
Score = 453, Expect = 4.1e-43, Identities = 117/329 (35%), Positives = 189/329 (57%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTV-------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           V + GA+G++G S+L+++    E + L  FS ++N EKA EI   F P+ +  S        +             +S  EL+ +   +I++ A+VG  GL  T+ A+     L +ANKE+LV +G LI+ L    ++++ PVDSEH++L+  L++ N   ++++I+T SGG F      +L ++    A+ HP WNMG KI+IDS  M+NK  E+IEA++LFN    KI V  H QSI H +++  D +     S PDM   I   L   E    ++      +   L F E D  ++  +  A++  +    A P I NAANE A+ LF +++I+F++I + I K +
  S:     5 VCLLGASGSVGESTLKVLRAYPEKFRLHSFSVHSNLEKAKEIQKEFSPDFICVSSDFADVGVLGNKLGRTQILYGESSLCELVREPEVEIVITAIVGSVGLRPTIAAITAGKRLGIANKETLVTSGPLIQSLIAKHNTKVVPVDSEHNALFQLLESLNPNSVEKIILTASGGAFRDLPVEQLSSVTKEQALHHPTWNMGPKITIDSNGMINKGLEVIEAHFLFNVPYDKIGVVIHPQSIAHGIVELKDGASFLYASYPDMIFPIAHSLFHPEPVPKVLRSYPAKDWGKLEFREPDFKRYPGLGLAFEAGKVGGTA-PCIFNAANEAAVELFLKDEIRFIEIPDYIRKTL 352
>gi|119774282|ref|YP_927022.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shewanella amazonensis SB2B] >gi|166198581|sp|A1S4P6|DXR_SHEAM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|119766782|gb|ABL99352.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Shewanella amazonensis SB2B] (395 aa)
Score = 453, Expect = 4.2e-43, Identities = 122/354 (34%), Positives = 203/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEII----------------NRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + +++ GATG+IG S+L++I++  E Y         + E+  ++                  R  +AL     ++  +   +   L+     D ++ A+VG +GL  TL A++    + LANKE+LV++G L  +  + S +++ PVDSEH++++  L    +            I  +++T SGGPF     + L  +  A A KHPNW+MG KIS+DSATMMNK  E IEA +LFNT +  +KV  H QS+IHSM+++ D S +A M  PDM+  I   ++  +  +  +  L F  + +L+F E D  ++  +  A D   +Q +    ++NAANE A+  F + +I F DI  I  + +  +  T ++ L  IL L+   R+
  S:     2 QNLVILGATGSIGKSTLDVIKRNPERYRAFALVAATSVERMRDLCIEHRPRYAHMVDESAAKRLADALPTGLGIEVSSGDEALLGLVTAAEVDTVMAAIVGAAGLLPTLAAVRAGKRVLLANKEALVMSGELFMEETKKSGAQLLPVDSEHNAIFQCLPEQVQREIGHCDLSAAGISHILLTGSGGPFLTSPLDTLATMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTARDELKVVIHPQSVIHSMVQYRDGSVLAQMGNPDMRTPIAHAMAYPQRISAGVEPLDFFKVGHLSFCEPDYSRFPCLKLAMDAC-HQGQEATTVLNAANEVAVAAFLDGRIGFTDIAVINGECLGKIAKTHLDSLDAILALDWEARR 386
>gi|35187000|gb|AAQ84168.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pueraria montana var. lobata] (465 aa)
Score = 452, Expect = 4.9e-43, Identities = 120/361 (33%), Positives = 216/361 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT--NPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN------LTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEV--NDLKDILNLNKNTRKYVYDFSK 372
           K + + G+TG+IG  +L I+ +  E +++V  +  +N     + I  F   +V    ++ ++ ++  +E L      P+II                  +  +VG +GL  T+ A++   D+ALANKE+++     +  L    + +I P DSEHS+++ S++   K  ++++++T SGG F +    ++ +I  ADA+KHP W++G+KI+IDSAT+ NK  E+IEA+YLF      I++  H QSIIHS+++  D+S IA + +PDM+L +   LS  E      +++++  L+      LTF   D  K+  ++  Y       RA   +  +++AANE+A+ +F E KI +LDIF+++E      +   V    L++I++ ++  R+Y     K
  S:    74 KPISILGSTGSIGTQTLSIVAEFPERFKVVSLAAGSNITLLADQIKTFKPEVV---GLRNESLIDELKEALADVEHKPEIIPGEQGVIEAARHPDSTTVVTGIVGCAGLKPTVAAIEAGKDIALANKETMIAGAPFVLPLAHKHNIKILPADSEHSAIFQSIQGLPKGALRKILLTGSGGAFREWPAEKMKDIKLADALKHPIWSLGRKITIDSATLFNKGLEVIEAHYLFGASYDDIEIVIHPQSIIHSLVETQDSSVIAQLGIPDMRLPLLYTLSWPERI--YCSEVTWPRLDLSKYGSLTFFAPDDKKFPSVNLCY----AAGRAGGTMTGVLSAANEKAVEMFVEEKISYLDIFKVVELTCQEHQKELVVAPSLEEIIHYDQWARQYAASLQK 461
>gi|37524677|ref|NP_928021.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|39930825|sp|Q7N8P3|DXR_PHOLL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|36784102|emb|CAE12971.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photorhabdus luminescens subsp. laumondii TTO1] (398 aa)
Score = 452, Expect = 4.9e-43, Identities = 118/353 (33%), Positives = 199/353 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL---------KNNNKE--IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG++G S+L ++    + +++   +   N +   E    F P     +  V  K       E   KT                + D +++ +VG +GL  TL A++    + LANKESL+ +G    D     ++++ P+DSEH++++ SL         + + K+  I  +I+T SGGPF      +L  +    A  HPNW+MG+KIS+DSATMMNK  E IEA  LFN    +++V  H QS+IHSM+++ D S IA +  PDM   I   ++      + +  L F +L  LTFS+ D +++  +  A +   +  +A   ++NAANEE + +F +N I F DI  I  + +  L  +E   ++++L ++   R
  S:     2 KRLTILGSTGSVGKSTLTVVRNNPDKFKVTALAAGKNIQVMAEQCLEFRPQYAAMADEVSAKELRQLLIEQGCKTEVFFGEQAACDLAALNDVDQVMSGIVGVAGLLPTLAAIRAGKQILLANKESLITSGRFFMDAVAKHNAQLLPIDSEHNAIFQSLPEVIQRNLGRGDLKQYGIANIILTGSGGPFRHTPLEQLAFVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEACCLFNASAAEMEVVVHPQSVIHSMVRYQDGSVIAQLGTPDMCTPIAYAMAYPNRIASGVEPLDFYSLGTLTFSKPDYERYPCLKLAIEAC-HAGQAATTVLNAANEEIVKIFLQNGISFTDIAIINRQVVEKLNLSEPQSIEEVLQIDNLAR 386
>gi|56459947|ref|YP_155228.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Idiomarina loihiensis L2TR] >gi|81170450|sp|Q5QUF4|DXR_IDILO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|56178957|gb|AAV81679.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Idiomarina loihiensis L2TR] (397 aa)
Score = 452, Expect = 5.3e-43, Identities = 114/353 (32%), Positives = 195/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEI-INRFPNALVFSP---------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +++ V GATG+IG ++L ++ +  +++++   + ++      E+ +   P   V                  S +      +  E+      D+++ A+VG +GL  TL A+    D+ LANKE+LV++G L  D  + S +RI PVDSEH++++  L    ++           I+ L++T SGGPF      EL       A  HPNW+MG+KIS+DSATM+NK  E IEA +LFN  +  +KV  H QS+IHSM+++TD S +A M  PDM+  I   L   E   + +  L F  +  LTF + +  ++  +  A +       A   +  A         +E ++ F DI ++ +  + +++  E + L+ +L ++K  R
  S:     2 RRITVLGATGSIGQNTLNVVSRHPDDFQVFALTAHSQISAMAELCVKHNPQYAVMGSYNAAAELKALLGQQTSTQVMYGDQALAEVSSDAEVDVVMAAIVGAAGLSPTLAAIDAGKDVLLANKEALVMSGQLFIDHAQRSGARIIPVDSEHNAIFQCLPQAAQQQVGTMALAEHGIQYLLLTGSGGPFRDIPLEELPQQTPGAACNHPNWSMGRKISVDSATMLNKGLEYIEARWLFNCSRDQLKVVIHPQSVIHSMVQYTDGSVLAQMGEPDMRTPIAHSLGYPERLESGVAGLDFTQIAELTFKQPEAQRYPCLQLAIEACWEGQWATTALNAANEVAVAAFLQE-QVGFTDIAKVCDSVLQSIQADEADSLETLLAIDKQAR 385
>gi|116051647|ref|YP_789514.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa UCBPP-PA14] >gi|122260790|sp|Q02RC2|DXR_PSEAB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115586868|gb|ABJ12883.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa UCBPP-PA14] (396 aa)
Score = 452, Expect = 5.4e-43, Identities = 125/356 (35%), Positives = 209/356 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEIINRFPNALV-------------FSPSVKTKNTV--NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++ +++ V GATG+IG S+L+++++     E + L GFS     E AL + +R   A+V              +  ++T+      +  E+      D+++ A+VG +GL  TL A++    + LANKE+LV++G L     + S + + P+DSEH++++ SL  N  +      ++ +++T SGGPF +    +L ++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +++V  H QS+IHSM+ + D S IA +  PDM+  I   ++  E   + ++ L  F    L F   D  ++  +  A    E    A P ++NAANE A+  F E +I+F DI  IIE  +     T V  L  +L  ++  R
  S:     2 SRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELE-ALCLRHRPVYAVVPEQAAAIALQGSLAAAGIRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAVGRLDFQRPDEQRFPCLRLASQAAETGGSA-PAMLNAANEVAVAAFLERRIRFSDIAVIIEDVLNREAVTAVESLDQVLAADRRAR 384
>gi|16121348|ref|NP_404661.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis CO92] >gi|22127007|ref|NP_670430.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis KIM] >gi|108806521|ref|YP_650437.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Antiqua] >gi|108813112|ref|YP_648879.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Nepal516] >gi|145598946|ref|YP_001163022.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Pestoides F] >gi|149366951|ref|ZP_01888984.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis CA88-4125] >gi|153948946|ref|YP_001400001.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis IP 31758] >gi|161511345|ref|NP_994109.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Microtus str. 91001] >gi|162420292|ref|YP_001607768.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Angola] >gi|165927084|ref|ZP_02222916.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939811|ref|ZP_02228351.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Orientalis str. IP275] >gi|166011906|ref|ZP_02232804.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211377|ref|ZP_02237412.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400136|ref|ZP_02305654.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419497|ref|ZP_02311250.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425344|ref|ZP_02317097.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470427|ref|ZP_02335131.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis FV-1] >gi|170023319|ref|YP_001719824.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis YPIII] >gi|122979778|sp|Q1CAN0|DXR_YERPA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|123372991|sp|Q1CFF1|DXR_YERPN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166198590|sp|A4TL87|DXR_YERPP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166920135|sp|A7FFH3|DXR_YERP3 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21263524|sp|Q8ZH62|DXR_YERPE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21960054|gb|AAM86681.1|AE013914_1 putative ATP-binding component of a transport system [Yersinia pestis KIM] >gi|108776760|gb|ABG19279.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Nepal516] >gi|108778434|gb|ABG12492.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Antiqua] >gi|115346827|emb|CAL19713.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis CO92] >gi|145210642|gb|ABP40049.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Pestoides F] >gi|149290565|gb|EDM40641.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis CA88-4125] >gi|152960441|gb|ABS47902.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis IP 31758] >gi|162353107|gb|ABX87055.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis Angola] >gi|165912214|gb|EDR30851.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Orientalis str. IP275] >gi|165920980|gb|EDR38204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989172|gb|EDR41473.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166207148|gb|EDR51628.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962238|gb|EDR58259.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050844|gb|EDR62252.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055744|gb|EDR65528.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749853|gb|ACA67371.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis YPIII] (398 aa)
Score = 452, Expect = 6.2e-43, Identities = 127/353 (35%), Positives = 211/353 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYEL-------VGFSFNNNYEKALEIINRFPNALVFSPSVKT----------KNTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII-ALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG S+L ++ + N EL        G +     ++ LE   R+  A+    S K+             V S E    EL    + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  + S +++ P+DSEH++++ SL             N   +  +I+T SGGPF +   ++  ++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++I+V  H QS+IHSM+++ D S +A M  PDM+  I   ++     ++ +  L F  +  LTF+  D  ++  +  A D   N  +A    +NAANE +++ F ++KI+F DI E+I + ++  L  +E   ++++L +++  R
  S:     2 KQLTILGSTGSIGNSTLSVV-RANPELFKVTALVAGRNVREMAQQCLEFSPRYA-AMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDAC-NAGQAATTALNAANEISVMAFLDSKIRFTDI-EVINRTVVEGLLLSEPTSVEEVLVIDRKAR 386
>gi|119962940|ref|YP_947310.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrobacter aurescens TC1] >gi|166218234|sp|A1R4Z8|DXR_ARTAT 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|119949799|gb|ABM08710.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Arthrobacter aurescens TC1] (394 aa)
Score = 451, Expect = 6.4e-43, Identities = 118/360 (32%), Positives = 199/360 (55%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFN------------NNYEKALEIINRFPNALV--------------FSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYD 369
           + +K+++ G+TG+IG  ++++++     +E+V  S              +   +A+ I      AL               F+P +      ++    +E    D++LN + G  GL  TL AL     LALANKESL+V G L++    +S  +I PVDSEHS++   L++  ++E+++LI+T SGGPF  +   +L ++   +A+ HP W+MG  ++ +SA+++NK  E+IEA+ LF+    +I V  H QS++HSM++F D S IA  S PDM+L I  GL   +          +    + TF  +D   +  +  A D    Q    P + NAANEEA+  F   +I+F  I + +E  +     +    ++ +L+  K  R    D
  S:     2 QPRKIVILGSTGSIGTQAIDVVDAAPHRFEVVALSAGGGNLALIAQQAVHTRAQAVGIAQGDQGALRQLIAAAAAAAGVRNFAPEIFVGPDASTRIAAIE---CDVVLNGITGSIGLAPTLAALGTGATLALANKESLIVGGALVK--AAASPGQIVPVDSEHSAIAQCLRSGTDQEVEKLILTASGGPFRGRSREQLHDVTPQEALAHPTWDMGLMVTTNSASLVNKGLEVIEAHLLFDVPLDRIDVVVHPQSVVHSMVQFVDGSIIAQASPPDMRLPIALGLGWPDRVPRAAQACDWTQATSWTFEPLDTVAFPAVDLAKD-AAKQGSTFPAVFNAANEEAVEAFHAGRIRFTQIVDTVESVLSEHSGSSELTVESVLDAEKWARARTLD 387
>gi|67641704|ref|ZP_00440473.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia mallei GB8 horse 4] (392 aa)
Score = 451, Expect = 6.5e-43, Identities = 116/342 (33%), Positives = 191/342 (55%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE---IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           + G+TG+IG S+L+++ +  E + +   + + N EK +    RF   +      +T   V                  +  ++ +    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D  R   + + PVDSEH++++  +  +  E   I ++I+T SGGPF  +E   L ++   +A KHPNW MG+KIS+DSATMMNK  E+IEA++LF   ++ I V  H QS+IHS++ + D S +A +  PDM+  I   L+  E     +  L    +  LTF + D  ++  +  A D LE    A    +NAANE A+  F   +I+F  I + +   +  L N     L D++
  S:     1 MLGSTGSIGDSTLDVVARHPERFAVHALTAHRNGEKLVAQCLRFAPDVAVVGDAETAARVEAQLRAAGSRTQVAYGKQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKRILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGIAKIIVTASGGPFRTREPATLASVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGLPSEHIDVLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVAQLDLAQIATLTFEKPDYARFPCLALAIDALEAGGVA-SAALNAANEIAVDAFLSRRIRFTAIAQTVGAVLDGLSNRTPGGLDDVI 366
>gi|70728564|ref|YP_258313.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas fluorescens Pf-5] >gi|81170455|sp|Q4KHH0|DXR_PSEF5 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|68342863|gb|AAY90469.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas fluorescens Pf-5] (396 aa)
Score = 451, Expect = 7.0e-43, Identities = 112/353 (31%), Positives = 194/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNS-----------------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +++ V GATG+IG S+L++I +  + Y++   +      + L +  +        P     + +                     E+      D ++ A+VG +GL  TL A++    + LANKE+LV++G L       S S + P+DSEH++++  +  +         ++ +++T SGGPF +    EL +++   A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D  ++  +  A    E  N A P ++NAANE A+  F E +I++ +I  II++ +       VN+L  +   +   R
  S:     5 QQITVLGATGSIGLSTLDVIARHPDRYQVFALTGFTRLAELLALCVKHEPRFAVVPEAAAASRLQQDLRGAGLATQVLVGEQGLCEVASAPEVDAVMAAIVGAAGLRPTLAAVEAGKKILLANKEALVMSGALFMQAVGKSGSVLLPIDSEHNAIFQCMPADFSRGLSRVGVRRILLTASGGPFRQTPLEELEHVSPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDARPSQVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSA-PAMLNAANEVAVSAFLERRIRYPEIASIIDEVLTREPVVAVNELDAVFAADARAR 384
>gi|91209243|ref|YP_539229.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli UTI89] >gi|117622458|ref|YP_851371.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli APEC O1] >gi|91070817|gb|ABE05698.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Escherichia coli UTI89] >gi|115511582|gb|ABI99656.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Escherichia coli APEC O1] (398 aa)
Score = 451, Expect = 7.1e-43, Identities = 120/354 (33%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVARMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANARE 387
>gi|51247219|pdb|1Q0L|A Chain A, Crystal Structure Of Dxr In Complex With Fosmidomycin >gi|51247220|pdb|1Q0Q|A Chain A, Crystal Structure Of Dxr In Complex With The Substrate 1- Deoxy-D-Xylulose-5-Phosphate >gi|51247221|pdb|1Q0Q|B Chain B, Crystal Structure Of Dxr In Complex With The Substrate 1- Deoxy-D-Xylulose-5-Phosphate (406 aa)
Score = 451, Expect = 7.1e-43, Identities = 120/354 (33%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+
  S:    10 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANARE 395
>gi|16128166|ref|NP_414715.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli str. K-12 substr. MG1655] >gi|74310793|ref|YP_309212.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella sonnei Ss046] >gi|82542772|ref|YP_406719.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella boydii Sb227] >gi|89107053|ref|AP_000833.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli W3110] >gi|157156618|ref|YP_001461342.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli E24377A] >gi|157159638|ref|YP_001456956.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli HS] >gi|170079809|ref|YP_001729129.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Escherichia coli str. K12 substr. DH10B] >gi|170683853|ref|YP_001742301.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli SMS-3-5] >gi|187731348|ref|YP_001878975.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella boydii CDC 3083-94] >gi|188494315|ref|ZP_03001585.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli 53638] >gi|191166380|ref|ZP_03028212.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli B7A] >gi|193067711|ref|ZP_03048678.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli E110019] >gi|194428258|ref|ZP_03060800.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli B171] >gi|194439124|ref|ZP_03071206.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli 101-1] >gi|2506592|sp|P45568|DXR_ECOLI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|20150689|pdb|1K5H|A Chain A, 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase >gi|20150690|pdb|1K5H|B Chain B, 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase >gi|20150691|pdb|1K5H|C Chain C, 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase >gi|29726949|pdb|1ONN|A Chain A, Ispc Apo Structure >gi|29726950|pdb|1ONN|B Chain B, Ispc Apo Structure >gi|29726951|pdb|1ONO|A Chain A, Ispc Mn2+ Complex >gi|29726952|pdb|1ONO|B Chain B, Ispc Mn2+ Complex >gi|29726953|pdb|1ONP|A Chain A, Ispc Complex With Mn2+ And Fosmidomycin >gi|29726954|pdb|1ONP|B Chain B, Ispc Complex With Mn2+ And Fosmidomycin >gi|1552750|gb|AAB08602.1| hypothetical [Escherichia coli] >gi|1786369|gb|AAC73284.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli str. K-12 substr. MG1655] >gi|3434984|dbj|BAA32426.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli W3110] >gi|73854270|gb|AAZ86977.1| putative ATP-binding component of a transport system [Shigella sonnei Ss046] >gi|81244183|gb|ABB64891.1| putative ATP-binding component of a transport system [Shigella boydii Sb227] >gi|85674366|dbj|BAA77848.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli W3110] >gi|157065318|gb|ABV04573.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli HS] >gi|157078648|gb|ABV18356.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli E24377A] >gi|169887644|gb|ACB01351.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Escherichia coli str. K12 substr. DH10B] >gi|170521571|gb|ACB19749.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli SMS-3-5] >gi|187428340|gb|ACD07614.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella boydii CDC 3083-94] >gi|188489514|gb|EDU64617.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli 53638] >gi|190903631|gb|EDV63348.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli B7A] >gi|192959123|gb|EDV89559.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli E110019] >gi|194413633|gb|EDX29913.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli B171] >gi|194421943|gb|EDX37948.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli 101-1] (398 aa)
Score = 451, Expect = 7.1e-43, Identities = 120/354 (33%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANARE 387
>gi|55669805|pdb|1T1R|A Chain A, Crystal Structure Of The Reductoisomerase Complexed With A Bisphosphonate >gi|55669806|pdb|1T1R|B Chain B, Crystal Structure Of The Reductoisomerase Complexed With A Bisphosphonate >gi|55669807|pdb|1T1S|A Chain A, Crystal Structure Of The Reductoisomerase Complexed With A Bisphosphonate >gi|55669808|pdb|1T1S|B Chain B, Crystal Structure Of The Reductoisomerase Complexed With A Bisphosphonate (398 aa)
Score = 451, Expect = 7.1e-43, Identities = 120/354 (33%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANARE 387
>gi|91070079|gb|ABE11004.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [uncultured Prochlorococcus marinus clone ASNC612] (409 aa)
Score = 451, Expect = 7.7e-43, Identities = 135/366 (36%), Positives = 212/366 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALE-IINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK------NNN-------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA-LENTEVN-DLKDILNLNKNTRKYVYDFSKNKFRY 377
           K + V G+TG+IG  +LEI  +  + ++ V  S   N     E + N  P  +        ++  ++   L   + P                  D ++  +VG +GL  T+ A+    ++ALANKE+L+ AG ++    + ++SR+ P DSEHS+++  L+      N +       K +K + +T SGG F      +L N+   DA  HPNW+MGKKI++DSAT+MNK  E+IEA+YLF T  + I++  H QSIIHSMI+  D+S +A +  PDMKL I   +S  E        L+ + +  LTF E D  K+  +  AY   ++    +P ++NAANE A+  F + KI F +I   I KA  + +EN  ++ +L+DIL ++   R +V    K   RY
  S:     2 KYITVLGSTGSIGTQTLEIASELPDKFKAVALSAGRNINLLTEQVKNHKPEVVAIEDENLIEDLKDNINNLDLDSAPLVLSGKEGINAVAAWDKADTVVTGIVGCAGLIPTMSAINAGKNIALANKETLIAAGPIVIPALKKNNSRLLPADSEHSAIFQCLQGLPNYENADFSTGEIPKGLKAIHLTASGGAFRDWAVEDLKNVTVEDATSHPNWDMGKKITVDSATLMNKGLEVIEAHYLFGTSYENIEIVIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERFKTNWKRLNLSEIGKLTFKEPDEFKYPCMGLAYAAGKSSG-TMPAVLNAANEMAVEQFLKEKISFQEIPTFISKACESHMENLNLSPELEDILEVDNWARLFVEQEIKKGKRY 405
>gi|194433396|ref|ZP_03065675.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella dysenteriae 1012] >gi|194418324|gb|EDX34414.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella dysenteriae 1012] (398 aa)
Score = 450, Expect = 8.3e-43, Identities = 125/354 (35%), Positives = 203/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSP---------SVKTKNTV----NSFEELLEKTNP----------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E        L FSP         S K   T+     S  E+L               D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVE------QCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEEVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANARE 387
>gi|194547549|ref|YP_002082577.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa C3719] >gi|126168495|gb|EAZ54006.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa C3719] (396 aa)
Score = 450, Expect = 8.7e-43, Identities = 126/356 (35%), Positives = 208/356 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEIINRFPNALV-------------FSPSVKTKNTV--NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++ +++ V GATG+IG S+L+++++     E + L GFS     E AL + +R   A+V              +  V+T+      +  E+      D+++ A+VG +GL  TL A++    + LANKE+LV++G L     + S + + P+DSEH++++ SL  N  +      ++ +++T SGGPF +    +L ++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +++V  H QS+IHSM+ + D S IA +  PDM+  I   ++  E   + ++ L  F    L F   D  ++  +  A    E    A P ++NAANE A+  F E  I+F DI  IIE  +     T V  L  +L  ++  R
  S:     2 SRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELE-ALCLRHRPVYAVVPEQAAAIALQGSLAAAGVRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAVGRLDFQRPDEQRFPCLRLASQAAETGGSA-PAMLNAANEVAVAAFLERHIRFSDIAVIIEDVLNREAVTAVESLDQVLAADRRAR 384
>gi|86160001|ref|YP_466786.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85776512|gb|ABC83349.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anaeromyxobacter dehalogenans 2CP-C] (407 aa)
Score = 450, Expect = 8.9e-43, Identities = 120/358 (33%), Positives = 198/358 (55%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALV----FSPSVKTKNTVNSFEELLE--------KTNPD--IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           E   K+V + G+TG+IG  +L+++ +  + +E+VG +   N  + LE I RF   +V     + +   +       E+L          ++PD   +L A+ G +GL  T  A++    + LANKES+V+AG L+     +    I PVDSEHS+++ SL  +N+ E++ LI+T SGGP       EL  +    A+KHPNW+MG KI+IDSAT+MNK  E+IEA +LF    ++I +  H +S++HSM+++ D S +A + + DM+  I   +   E     +  L    L  LTF   D  ++     AY  LE    A P +++ A+E A+  F   +  F  I ++    + A     V  ++  L  +++ R+
  S:    15 EEPVKRVAILGSTGSIGVQALDVVGRFPDRFEVVGLAAGRNAPRLLEQIRRFRPRVVSVCDEAAARAVRAEAPPGTEVLSGDAGAVAVASHPDAAFVLAAISGGAGLRSTAAAIEAGKPVGLANKESMVLAGELLMARAAAKGVAILPVDSEHSAIHQSLVGHNRGEVRRLILTASGGPLRCTPAAELAAVTPERALKHPNWSMGDKITIDSATLMNKGLEVIEARWLFGVEQQRIDIVVHPESVVHSMVEYVDGSIVAQLGISDMRGPISYAMGHPERMPLDLPPLDLGRLGKLTFEPPDPARFPAYTLAYRALELGGTA-PAVLSGADEAAVAAFLARRCSFTQIADVCADVLEAHVAEPVRSVEQALAASEHGRR 391
>gi|186476090|ref|YP_001857560.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia phymatum STM815] >gi|184192549|gb|ACC70514.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Burkholderia phymatum STM815] (401 aa)
Score = 450, Expect = 9.0e-43, Identities = 111/343 (32%), Positives = 195/343 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK---EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDL 353
           +K++ + G+TG+IG S+L+++ +  + + +   + + N +K +E   RF   +       T   V                  +  ++ +    D ++ A+VG +GL  +L A +    + LANKE+LV++G +  D    + + + PVDSEH++++  L   +     + ++I+T SGGPF  +E   L+++   +A KHPNW MG+KIS+DSATMMNK  E+IEA++LFN    +I V  H QS+IHS++ + D S +A +  PDM+  I   L+  +   + +  L    +  L+F + D  ++  +  A   L     A    +NAANE A+  F   +I F+ I ++++  + +L N E   L
  S:     2 QKRLTLLGSTGSIGDSTLDVVARHPDRFFVYALTAHRNGDKLVEQCLRFQPEVAVVGDADTAAKVAAKLRAAGCKTAVAYGPQALVDVSKSDGCDTVVAAIVGAAGLEPSLAAARAGKRILLANKEALVMSGSIFMDAVHDNGAILLPVDSEHNAIFQCLPRESALHGGVSKIILTASGGPFRTREPASLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNLPGDRIDVLIHPQSVIHSLVSYADGSVLAQLGNPDMRTPIAHALAFPDRVDSGVGQLDLAQIAQLSFEKPDYTRFPCLALAMKALAEGGVA-SAALNAANEIAVEAFLTRRIGFMAIAQVVDAVLNSLPNREATSL 368
>gi|83592927|ref|YP_426679.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodospirillum rubrum ATCC 11170] >gi|83575841|gb|ABC22392.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodospirillum rubrum ATCC 11170] (400 aa)
Score = 450, Expect = 9.2e-43, Identities = 127/354 (35%), Positives = 195/354 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL--------EII--------NRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII-----ALENTEVNDLKDILNLNKNTRK 365
           ++V + G+TG+IG ++L++I +  E Y++V  + N N E           EI          R   AL  S  ++      +  E   + + D ++ A+VG +GL  TL A++    +ALANKE LV AG L     R + +   PVDSEH++++       KE I+ +I+T SGGPF       +       AV HPNW+MG KIS+DSA+M NK  E IEAY++F    ++I++  H QS+IHSM+ + D S +A +  PDM+  I   L+  +     +  L F  L ++ F   D D++  I    + L     A P  MNAANE A+  F   +I FLDI  ++E  I       L N  V+ L  ++ ++   R+
  S:    10 RRVSILGSTGSIGKNTLDLIGRSPERYQVVALTANGNAEALAAQAKATRAEIAVVADEAAYGRLKEALAGS-GIEAAAGPQAVCEAAAR-DADWVMAAIVGAAGLAPTLAAVERGATIALANKECLVCAGDLFMAEIRRAGATFLPVDSEHNAIFQVFDFEKKERIERIILTASGGPFRDWTREAMAKATPEQAVAHPNWSMGAKISVDSASMFNKGLEFIEAYHIFGIAPERIEILVHPQSVIHSMVGYVDGSVLAQLGSPDMRTPIAYCLAWPDRMVAPVPHLDFPKLGHMDFRAPDPDRFPAIRIVRETLRRGGVA-PTAMNAANEVAVAGFLGRQIGFLDIPAVVEATINDVMAGPLGNQAVDHLDAVMAVDGEARR 387
>gi|51597314|ref|YP_071505.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis IP 32953] >gi|186896419|ref|YP_001873531.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis PB1/+] >gi|59797521|sp|Q667J3|DXR_YERPS 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|51590596|emb|CAH22237.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis IP 32953] >gi|186699445|gb|ACC90074.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pseudotuberculosis PB1/+] (398 aa)
Score = 450, Expect = 9.8e-43, Identities = 126/353 (35%), Positives = 211/353 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYEL-------VGFSFNNNYEKALEIINRFPNALVFSPSVKT----------KNTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII-ALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG S+L ++ + N EL        G +     ++ LE   R+  A+    S K+             V S E    EL    + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  + S +++ P+DSEH++++ SL             N   +  +I+T SGGPF +   ++  ++    A  HPNW+MG+KIS+DSATMMNK  E +EA +LFN   ++I+V  H QS+IHSM+++ D S +A M  PDM+  I   ++     ++ +  L F  +  LTF+  D  ++  +  A D   N  +A    +NAANE +++ F ++KI+F DI E+I + ++  L  +E   ++++L +++  R
  S:     2 KQLTILGSTGSIGNSTLSVV-RANPELFKVTALVAGRNVREMAQQCLEFSPRYA-AMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYVEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDAC-NAGQAATTALNAANEISVMAFLDSKIRFTDI-EVINRTVVEGLLLSEPTSVEEVLVIDRKAR 386
>gi|59802554|sp|Q8F146|DXR_LEPIN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (389 aa)
Score = 449, Expect = 1.2e-42, Identities = 116/329 (35%), Positives = 189/329 (57%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTV-------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           V + GA+G++G S+L+++    E + L  FS ++N EKA EI   F P+ +  S        +             +S  EL+ +   +I++ A+VG  GL  T+ A+     L +ANKE+LV +G LI+ L    ++++ PVDSEH++L+  L++ N   ++++I+T SGG F      +L ++    A+ HP WNMG KI+IDS  M+NK  E+IEA++LFN    KI V  H QSI H +++  D +     S PDM   I   L   E    ++      +   L F E D  ++  +  A++  +    A P I NAANE A+ LF +++I+F++I + I + +
  S:     5 VCLLGASGSVGESTLKVLRAHPEKFRLHSFSVHSNLEKAKEIQKEFSPDFICVSSDFADVGVLGNKLGRTQILYGESSLCELVREPEVEIVITAIVGSVGLRPTIAAITAGKRLGIANKETLVTSGPLIQSLIAKHNTKVVPVDSEHNALFQLLESLNPNSVEKIILTASGGAFRDLPVEQLSSVTKEQALHHPTWNMGPKITIDSNGMINKGLEVIEAHFLFNVPYDKIGVVIHPQSIAHGIVELKDGASFLYASYPDMIFPIAHSLFHPEPVPKVLRSYPAKDWGKLEFREPDFKRYPGLGLAFEAGKVGGTA-PCIFNAANEAAVELFLKDEIRFIEIPDYIRETL 352
>gi|24215991|ref|NP_713472.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptospira interrogans serovar Lai str. 56601] >gi|24197215|gb|AAN50490.1|AE011490_5 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptospira interrogans serovar Lai str. 56601] (391 aa)
Score = 449, Expect = 1.2e-42, Identities = 116/329 (35%), Positives = 189/329 (57%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTV-------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           V + GA+G++G S+L+++    E + L  FS ++N EKA EI   F P+ +  S        +             +S  EL+ +   +I++ A+VG  GL  T+ A+     L +ANKE+LV +G LI+ L    ++++ PVDSEH++L+  L++ N   ++++I+T SGG F      +L ++    A+ HP WNMG KI+IDS  M+NK  E+IEA++LFN    KI V  H QSI H +++  D +     S PDM   I   L   E    ++      +   L F E D  ++  +  A++  +    A P I NAANE A+ LF +++I+F++I + I + +
  S:     7 VCLLGASGSVGESTLKVLRAHPEKFRLHSFSVHSNLEKAKEIQKEFSPDFICVSSDFADVGVLGNKLGRTQILYGESSLCELVREPEVEIVITAIVGSVGLRPTIAAITAGKRLGIANKETLVTSGPLIQSLIAKHNTKVVPVDSEHNALFQLLESLNPNSVEKIILTASGGAFRDLPVEQLSSVTKEQALHHPTWNMGPKITIDSNGMINKGLEVIEAHFLFNVPYDKIGVVIHPQSIAHGIVELKDGASFLYASYPDMIFPIAHSLFHPEPVPKVLRSYPAKDWGKLEFREPDFKRYPGLGLAFEAGKVGGTA-PCIFNAANEAAVELFLKDEIRFIEIPDYIRETL 354
>gi|15598846|ref|NP_252340.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa PAO1] >gi|107103164|ref|ZP_01367082.1| hypothetical protein PaerPA_01004233 [Pseudomonas aeruginosa PACS2] >gi|194553333|ref|YP_002088360.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa 2192] >gi|13124136|sp|Q9KGU6|DXR_PSEAE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|9664863|gb|AAF97241.1|AF282879_1 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Dxp reductoisomerase; Dxr [Pseudomonas aeruginosa] >gi|9949811|gb|AAG07038.1|AE004785_2 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa PAO1] >gi|126195726|gb|EAZ59789.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa 2192] (396 aa)
Score = 449, Expect = 1.2e-42, Identities = 125/356 (35%), Positives = 208/356 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEIINRFPNALV-------------FSPSVKTKNTV--NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++ +++ V GATG+IG S+L+++++     E + L GFS     E AL + +R   A+V              +  ++T+      +  E+      D+++ A+VG +GL  TL A++    + LANKE+LV++G L     + S + + P+DSEH++++ SL  N  +      ++ +++T SGGPF +    +L ++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +++V  H QS+IHSM+ + D S IA +  PDM+  I   ++  E   + ++ L  F    L F   D  ++  +  A    E    A P ++NAANE A+  F E  I+F DI  IIE  +     T V  L  +L  ++  R
  S:     2 SRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELE-ALCLRHRPVYAVVPEQAAAIALQGSLAAAGIRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAVGRLDFQRPDEQRFPCLRLASQAAETGGSA-PAMLNAANEVAVAAFLERHIRFSDIAVIIEDVLNREAVTAVESLDQVLAADRRAR 384
>gi|77963171|ref|ZP_00826983.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia mollaretii ATCC 43969] (408 aa)
Score = 448, Expect = 1.6e-42, Identities = 126/353 (35%), Positives = 209/353 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYEL-------VGFSFNNNYEKALEIINRFPNALVFSPSVK----------TKNTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG S+L ++ + N EL        G +     ++ LE   R+  A+    S K          ++  V S E    EL    + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  ++S +++ P+DSEH++++ SL             +   +  +I+T SGGP  +   ++ +++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++I+V  H QS+IHSM+++ D S +A M  PDM+  I   ++ Y  + N  +  L F  +N LTF+  D  ++  +  A D   N  +A    +NAANE +++ F +++I+F DI  I    +  L   E   + ++L +++  R
  S:     2 KQLTILGSTGSIGNSTLGVV-RTNPELFNVTALVAGRNVQQMAQQCLEFAPRYA-AMSDETSAKALRLLLAEKGSRTEVYSGEKAACELAALDDVDQVMAAIVGVAGLSSTLSAIRAGKQVLLANKESLITCGKLFMDEVKNSKAQLLPIDSEHNAIFQSLPEKIQRQLGYSSLSENGVSSIILTGSGGPLREVPLSQFVDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVILHPQSVIHSMVRYHDGSVLAQMGAPDMRTPIAHAMA-YPMRVNSGVAPLDFCKINELTFAAPDYQRYPCLKLAIDAC-NAGQAATTALNAANEVSVMAFLDSQIRFTDIAAINRAVVEHLSLPEPTSVDEVLVIDRKAR 386
>gi|32491137|ref|NP_871391.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340051|sp|Q8D2G6|DXR_WIGBR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|25166344|dbj|BAC24534.1| yaeM [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (397 aa)
Score = 448, Expect = 1.7e-42, Identities = 144/361 (39%), Positives = 202/361 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVK------------TKNTV----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSL-----------KNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDL--SFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSK 372
           KK+ + G+TG+IG ++L+II         Y LV +  N N   + + I   PN +      K             K +V    N    L      DI+++A VG SG+     A+K+   + LANKE LV  G           S I P+DSEH++++ SL             N   I +LI+T SGGPF   E  +L  ++   A  HPNW MGKKISIDSATMMNK FE I A +LFN  K  I++  H QSIIHSMI++ D + IANMS+PDM+ SI  GL GY  +  + N     + N  LTF  ID +++  ++ A     N   A   ++N+ANE ++  F   KI F DI  I +K +  L+  E + +++IL L+   R     F K
  S:     2 KKITILGSTGSIGKNTLKIISNNLDKFSVYSLVAYGNNINVLIS-QCIKYKPNYVCIMNKKKLLDLKQGLLKNKCKTSVLFGSNDICNLSSSKEVDIVISATVGLSGIFFLFSAIKSGKKILLANKEILVSCGHFFMKQVEKYKSIIIPIDSEHNAIFQSLPLDFQKKLGIASINKYGIYKLILTGSGGPFRNVELRDLKKVSPDQACNHPNWKMGKKISIDSATMMNKGFEYIVAKWLFNVCKDQIELIIHHQSIIHSMIRYIDGTVIANMSLPDMQSSISYGL-GYPKRIKIKNKYLDFYKNNKLTFESIDYNRYPCLNLAIQASYNGQGAT-TVLNSANEISVSAFLSKKIYFTDIAIINKKVLDKLDIFEPSSIEEILLLDSKARNLAKKFIK 395
>gi|91070004|gb|ABE10930.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [uncultured Prochlorococcus marinus clone ASNC3046] (409 aa)
Score = 448, Expect = 1.7e-42, Identities = 136/366 (37%), Positives = 212/366 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-------------------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK------NNN-------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA-LENTEVN-DLKDILNLNKNTRKYVYDFSKNKFRY 377
           K + V G+TG+IG  +LEI  ++  N++ V  S   N     E +       + +P V      N  E+L +  N                          D ++  +VG +GL  T+ A+    ++ALANKE+L+ AG ++    + ++SR+ P DSEHS+++  L+      N +       K +K + +T SGG F      +L ++   DA  HPNW+MGKKI++DSAT+MNK  E+IEA+YLF T  + I++  H QSIIHSMI+  D+S +A +  PDMKL I   +S  E        L+ + +  LTF E D  K+  +  AY   ++    +P ++NAANE A+  F + KI F +I   I KA  + +EN   + +L+DIL ++   R +V    K   +Y
  S:     2 KYITVLGSTGSIGTQTLEIASEQPDNFKAVALSAGKNINLLTEQVK------IHNPEVVAIEDENLIEDLKDNINNLDLENDPLILGGKEGINAVAAWDKADTVVTGIVGCAGLIPTMSAINAGKNIALANKETLIAAGPIVIPALKKNNSRLLPADSEHSAIFQCLQGLPNYENADFSTGEIPKGLKAIHLTASGGAFRDWAVEDLKHVTVEDATSHPNWDMGKKITVDSATLMNKGLEVIEAHYLFGTSYENIEIVIHPQSIIHSMIELEDSSVLAQLGWPDMKLPILYAMSWPERFKTNWKRLNLSEIGKLTFKEPDELKYPCMGLAYAAGKSSG-TMPAVLNAANEMAVEQFLKEKISFQEIPTFISKACESHMENLNSSPELEDILEVDNWARLFVEQEIKKGKKY 405
>gi|89900779|ref|YP_523250.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodoferax ferrireducens T118] >gi|89345516|gb|ABD69719.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodoferax ferrireducens T118] (404 aa)
Score = 448, Expect = 1.8e-42, Identities = 124/354 (35%), Positives = 203/354 (57%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKTNP----------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN----NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLD----KWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++V + G+TG+IG S+L++I +  + +E+   S     +  LE   RF P   V       +       EL   T                  D ++ A+VG +GL   L A +    L LANKE+LVV G           +++ P+DSEHS+++ SL ++    + +I ++I+T SGGPF ++E   L ++    A  HPNW MG+KIS+DSATMMNK  E+IEA +LF  N ++I+V  H QS+IHSM+++ DNS +A +  PDMK+ I  GL   +   +    L F  + +LTF  +D +    ++  +  A+  L   + +  ++  AANE A+  F + +I+F  I  +  + + ++       L+D+L L+  +R
  S:     9 KQRVAILGSTGSIGVSTLDVIARHPDRFEVFALSAATQTQLMLEQCVRFKPVFAVMVSEPHGRALERQCRELHLTTRVLWGASALAMIASHELVDAVMAAIVGAAGLASCLAAAQAGKRLLLANKEALVVGGAYFMQAVAKGGAKLLPIDSEHSAIFQSLPDDAAVWSSQIDKIILTASGGPFRQREPQTLRDVTPDQACAHPNWVMGRKISVDSATMMNKALEVIEARFLFGVNPEQIEVVIHPQSVIHSMVQYKDNSVLAQLGTPDMKVPIAYGLCWPDRMVSGAGALDFRAMADLTFESLDSNGHEQRFPGLQLAWAVLRAPSGSTAVLN-AANEVAVAAFLDGQIRFDQIHGVNLETLESVVPASPQSLEDLLALDAESR 391
>gi|58584439|ref|YP_198012.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75498037|sp|Q5GTA4|DXR_WOLTR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|58418755|gb|AAW70770.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont strain TRS of Brugia malayi] (389 aa)
Score = 447, Expect = 1.9e-42, Identities = 124/363 (34%), Positives = 209/363 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRKYVYDFSKNK 374
           KK+ V G+TG+IG  +++++   KE Y++   S  +N+   L    +  NA   +  +  K      +E L  T                   D+ + A+VG +GL   +  +++    +ALANKES+V  G L+       + +I P+DSEH++++  L+N NK ++++I+T SGG F      +L N+    A+ HP WNMGKKIS+DSATMMNK  EIIEA+ LFN    +I+   H +SIIH ++ + D    A ++  DM + I   LS +  ++ L   L      LTF E D  ++  +  + + L + +     I++NAANE A+  F +++I FL+I ++++  +   ++ T++N L DI+N++  +R    +  KNK
  S:     2 KKISVLGSTGSIGKKTVDLLLKRKEEYQVEALSTCSNF-ALLACQAKLLNARYVA--ISNKRFYKDLKESLLGTGIKVEVGTEGLMNVASLPVDLSVVAVVGIAGLEPVMHVIESGTKVIALANKESIVCGGKLLLKKTEEKNVQIVPIDSEHNAIFQVLQNGNKCVEKIILTASGGSFLNYSLEQLRNVTVGQALSHPTWNMGKKISVDSATMMNKALEIIEAHNLFNISPNRIEAIVHPESIIHGIVIYKDGFNFAVLAEADMAIPISYALS-WPERSALSYKLDLTKQKLTFQEPDHKRFPALKLSMEVLNSSSPHTNSIVLNAANEVAVDKFLKSRIDFLEIIKVVKLTVENFDSYTDINSLSDIINIDLESRAIAKEIIKNK 384
>gi|114799124|ref|YP_760478.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hyphomonas neptunium ATCC 15444] >gi|114739298|gb|ABI77423.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hyphomonas neptunium ATCC 15444] (397 aa)
Score = 447, Expect = 1.9e-42, Identities = 119/331 (35%), Positives = 185/331 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN------YELVGFSFNNNYE----KALEIINRFP-----------NALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +KV +FG+TG+IG S++++I   N      + +   +   + E    +AL++  +              AL+    ++      +  E   +   D +L A+VG +GL  TL A+K   D+A+ANKES+V  G L+    R S +RI+PVDSEHS+++  +  + + ++ L IT SGGPF      ++     A A  HP W+MG K SIDSA++MNK  E IEA  LF+     I V  H QSIIH M  F D S IA +  PDM+  I   L   +     ++ L+   + NL F E+D +++  I  A + +     A  +++N ANE A+  F   +  FLDI  ++E A+
  S:     3 RKVSIFGSTGSIGRSAIDVICNANETGAAEFSVEALAAGRDVEGLASQALKLKPKIAVIADESRKVELAALLAGSGIEVAAGEGALNEAAARPC-DRVLAAIVGAAGLGSTLAAIKAGNDIAIANKESIVCGGQLMLGEARQSGARIFPVDSEHSAIFQCI-GDGRSLENLTITASGGPFRNWSLEQMATATPAQAAAHPVWSMGIKNSIDSASLMNKALEFIEAAVLFDVAADHINVLVHPQSIIHGMAHFDDGSVIAQLGCPDMRTPISYALGWPDRIPTTVDRLNLAQISNLEFFEVDEERFASIRLAREAM-GAGPAARVVLNCANEAAVSAFIAGECGFLDISRLVEAAL 354
>gi|152987023|ref|YP_001346873.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa PA7] >gi|166218272|sp|A6V1D8|DXR_PSEA7 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|150962181|gb|ABR84206.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas aeruginosa PA7] (396 aa)
Score = 447, Expect = 2.2e-42, Identities = 125/356 (35%), Positives = 207/356 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEIINRFPNALV-------------FSPSVKTKNTV--NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           ++ +++ V GATG+IG S+L+++++     E + L GFS     E AL + +R   A+V              +  ++T+      +  E+      D+++ A+VG +GL  TL A++    + LANKE+LV++G L     + S + + P+DSEH++++ SL  N  +      ++ +++T SGGPF +    +L ++    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +++V  H QS+IHSM+ + D S IA +  PDM+  I   ++  E   + +  L  F    L F   D  ++  +  A    E    A P ++NAANE A+  F E  I+F DI  IIE  +     T V  L  +L  ++  R
  S:     2 SRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELE-ALCLRHRPVYAVVPEQAAAIALQGSLAAAGIRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIESGVAPLDMFAVGRLDFQRPDEQRFPCLRLARQAAETGGSA-PAMLNAANEVAVAAFLERHIRFSDIAVIIEDVLNREAVTAVESLDQVLAADRRAR 384
>gi|88812383|ref|ZP_01127633.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrococcus mobilis Nb-231] >gi|88790390|gb|EAR21507.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nitrococcus mobilis Nb-231] (397 aa)
Score = 447, Expect = 2.2e-42, Identities = 111/354 (31%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSP-----------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +++ + GA+G+IG ++L++I +  +++E+   + N   ++  E   RF P   V +                  S +      +  ++   +  D ++  +VG +GL  TL A +    + LANKE+LV+AG L     + + + + PVDSEH+++Y  L     +       ++ +++T SGGPF  +   EL  +  A+A  HPNW MG+KIS+DSAT+MNK  E+IEA  LF+     ++   H QSI+HS++++ D S +A +  PDM+  +   L+      +    L   N+  L F   D  ++  +  AY  ++    + P I+NAANE A+  F + +I+F  I  +IE  + ++    + DL  +L +++ +R+
  S:     2 QRITILGASGSIGVNTLDVIARHPQHFEIFALAANRAVDRLFEQCQRFQPRYAVLADEQAAATLRARLSERSGCSTQVLGGTEALIDVAGASEVDCVVAGIVGSAGLLPTLAAARGGKRILLANKEALVMAGALFLTEAKRNGATLVPVDSEHNAVYQCLPPEFGQRPLLELGVRRILLTASGGPFRCRPLAELQWVTPAEACAHPNWVMGRKISVDSATLMNKGLELIEACLLFDVGPDCVEAVIHPQSIVHSLVEYVDGSVLAQLGNPDMRTPLAHALATPGRLASGTRPLDLLNVGRLEFEAPDHRRFPCLGLAYQAMQ-AGESTPAILNAANEVAVGAFLQERIQFTAIPAVIESTLESVTAEVIEDLDQLLAMDRCSRR 384
>gi|146308068|ref|YP_001188533.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas mendocina ymp] >gi|166218273|sp|A4XWT5|DXR_PSEMY 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|145576269|gb|ABP85801.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas mendocina ymp] (394 aa)
Score = 446, Expect = 2.5e-42, Identities = 117/353 (33%), Positives = 193/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFS-FNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP----------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +++ V GATG+IG S+L++I +  E Y +   S F+   E     +   P  +V   +        S       T                  D ++ A+VG +GL  TL A++    + LANKE+LV++G L     R S + + P+DSEH++++  L  +         ++ +++T SGGPF +    EL  +    A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +I+V  H QS+IHS++ + D S +A +  PDM+  I   L+  +   + ++ L  F    L F   D  ++  +  A +  +    A P ++NAANE A+  F + +I+F DI  +IE  + A     V  L  +   ++  R
  S:     5 QQITVLGATGSIGLSTLDVIARHPERYAVFALSGFSRLAELETLCVQHRPRYVVVPDAAAAHALQGSLRAAALPTEVLVGEEGLCAVAGHGEVDCVMAAIVGAAGLRPTLAAVQAGKKVLLANKEALVMSGALFMQAVRESGATLLPIDSEHNAIFQCLPGDYGRGLQAVGVRRVLLTASGGPFRETPLAELERVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDARPEQIEVVIHRQSVIHSLVDYVDGSVLAQLGNPDMRTPIAHALAWPQRIDSGVSPLDLFAIGRLDFERPDEQRFPCLRLAREAAQVGGSA-PAMLNAANEVAVDAFLQRRIRFSDIARMIEFVLNAESARAVEALDAVFEADRRAR 384
>gi|116626176|ref|YP_828332.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Solibacter usitatus Ellin6076] >gi|122251785|sp|Q01QM3|DXR_SOLUE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|116229338|gb|ABJ88047.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Solibacter usitatus Ellin6076] (397 aa)
Score = 446, Expect = 2.8e-42, Identities = 121/353 (34%), Positives = 199/353 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEIINRF-PN-ALVFSPSVKTKNTVNSFEELLEKTN-PDI------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + V G+TG+IG ++L+++ +    YE+       N E     I  F P  A+V S +V    T +     L K+  PD+                  +++A+VG +GL  T  A+     + LANKE LV  G L+ +  R   + + PVDSEH+  +  L+  N+ ++  LI+T SGGPF     +EL  +    A+ HP W MG +I+ID AT+MNK FE+IEA +LF+   + + V  H QS +H+MI+++D S +A +S  DM++ IQ  L+  +     +  + +       F   DL+K+  +  AY   E+   A   I+NAA+E A+  F + +I FL I EI+++ +  + +     + DIL +++ +R
  S:     2 KTIAVLGSTGSIGTNTLDVVRRNRHLYEVYSLVAGQNIELLTGQILEFRPKLAVVASAAVLDLLTASLQAAGLPKSEWPDLLSGDAARVAAVRAPEVDTVISAIVGVAGLEATYEAVCLGKRVGLANKEVLVSGGSLVMEAVRKFGAELLPVDSEHNGAHQCLRAGNRAQVSRLILTASGGPFRNTPVSELPFVTPGQALNHPTWKMGNRITIDCATLMNKGFEVIEACWLFDFAPRDVGVVIHPQSTVHAMIEYSDGSVLAQISATDMRMPIQYALTYPDRADAPVPKIDWAEARKWEFLPPDLEKFPLLKLAYQCQESGGSAT-CILNAADEIAVEAFLQGRIGFLSIHEIVQETLSRMPSRTPASVGDILEIDRESR 380
>gi|15799855|ref|NP_285867.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 EDL933] >gi|15829429|ref|NP_308202.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. Sakai] >gi|168737979|ref|ZP_02770256.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4115] >gi|168751392|ref|ZP_02776414.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4113] >gi|168755786|ref|ZP_02780793.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4401] >gi|168770353|ref|ZP_02795360.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4486] >gi|168777010|ref|ZP_02802017.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4196] >gi|168782065|ref|ZP_02807072.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4076] >gi|168789282|ref|ZP_02814289.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC869] >gi|195938145|ref|ZP_03083527.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4024] >gi|21263507|sp|Q8X8Y1|DXR_ECO57 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|12512898|gb|AAG54475.1|AE005193_5 putative ATP-binding component of a transport system [Escherichia coli O157:H7 EDL933] >gi|13359631|dbj|BAB33598.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. Sakai] >gi|187767682|gb|EDU31526.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4196] >gi|188014573|gb|EDU52695.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4113] >gi|189000484|gb|EDU69470.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4076] >gi|189357092|gb|EDU75511.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4401] >gi|189360735|gb|EDU79154.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC4486] >gi|189371064|gb|EDU89480.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Escherichia coli O157:H7 str. EC869] (398 aa)
Score = 446, Expect = 3.1e-42, Identities = 119/354 (33%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ + R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDASARE 387
>gi|146310375|ref|YP_001175449.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Enterobacter sp. 638] >gi|145317251|gb|ABP59398.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Enterobacter sp. 638] (399 aa)
Score = 446, Expect = 3.1e-42, Identities = 123/353 (34%), Positives = 203/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---VKTKNTVNSFEELLEK--------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + + G+TG+IG S+L+++    E Y +       N ++ +E        L FSP    +  + +    + LL                       + D ++ A+VG +GL  TL A+     + LANKE+LV  G L  D  +   +R+ PVDSEH++++ SL    +E           +  +++T SGGPF +   +EL+++    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN   K+++V  H QS+IHSM+++ D S IA +  PDM+  I   ++      +    L F  L+ LTFSE D D++  +  A +  + Q +A    +NAANE  +  F + +I+F DI  +    +  ++  E   ++++L ++   R
  S:     2 KHLTLLGSTGSIGCSTLDVVRHNPEEYTVTALVAGKNVQRMVE------QCLEFSPRYAVMDDEESARQVKALLADRGSCTEVMSGRQAACDMAALDDVDQVMAAIVGAAGLLPTLAAIDAGKTVLLANKEALVTCGRLFMDAVKQRGARLLPVDSEHNAIFQSLPQPFQENLGYADLEQNGVVSVLLTGSGGPFRETPLSELVSMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAKQMEVLIHPQSVIHSMVRYQDGSVIAQLGEPDMRTPIAHSMAWPNRVMSGAKPLDFCALSALTFSEPDYDRYPCLKLAMNAFD-QGQAATTALNAANEITVEAFLKQQIRFTDIAALNLSVLEEMDLREPQSVEEVLAVDSQAR 386
>gi|114770501|ref|ZP_01447991.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [alpha proteobacterium HTCC2255] (393 aa)
Score = 445, Expect = 3.2e-42, Identities = 118/354 (33%), Positives = 197/354 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEK-------------ALEIINRFPNALVFSPS----VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + GATG+IG ++L+++++ N  Y +   + N++YE               L  ++    AL  + S    V+    V++  ++      D ++ A+VG +GL  T  A+     + LANKE+LV++G L         + I P+DSEH++++  L ++ K        I ++++T SGGPF + +      I  A A  HPNW+MG+KISIDSATMMNK  E IEA +LF  +   I +  H QS IHSM+++ D S IA M  PDM+  I   L+      + +N L FN L + TFS    +++  ++ A        ++    +NAANE  +  F    I F DI     + + A E + +  ++ ++  ++N R+
  S:     2 QTLTILGATGSIGKNTLDVVKRHNDKYRVYALTANSDYETLLLQARDVNAQHVVLADVSVQNEALALAASMELDVQCHFGVDALVKVSNDNKVDTVMAAIVGAAGLIPTFAAVAAGKRVLLANKEALVMSGELFIAKANECGATILPIDSEHNAIFQCLPHSFKYGDLAASGISKVLLTGSGGPFLETDLALFDAITPAQACAHPNWDMGQKISIDSATMMNKGLEFIEARWLFGLDNDDIDIVLHPQSTIHSMVQYVDGSVIAQMGAPDMRTPIAHALAYPVRIKSGVNPLDFNQLRDFTFSTPCPERYPNLYLALR-AARMGQSACTTLNAANEINVAAFLAGHISFTDIARCNAQVLDAHEISSLTTIEQVIQCDQNARE 383
>gi|23336022|ref|ZP_00121251.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium longum DJO10A] >gi|189438978|ref|YP_001954059.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium longum DJO10A] >gi|189427413|gb|ACD97561.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium longum DJO10A] (396 aa)
Score = 445, Expect = 3.3e-42, Identities = 120/357 (33%), Positives = 203/357 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL-EIINRF--PNALVFS----PSVKTKNTVNSFEELLEKTNPD-----------IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE-----NTEVNDLKDILNLNKNTRKYVYDF 370
           V++ G+TG+IG   L++I +  E + + G +    + + L +   +F    A VF     P+++        + +     PD           ++LN + G  GL  ++ ALK    LALANKES+V  G L+    +   ++I PVDSEHS+++ SL++  + E+ +L++T SGGPF   +  ++ NI    A+ HP WNMG  ++I+S+T+MNK  E+IEA  LFN   ++I V  H QSI+HSM++F D + I   S PDM+L I  GLS  +  TN+     +      TF  +D + +  +  A   L    +    ++NAANE+A+  F E+++ +L I + ++  +  ++     N    D++++  L    R+   D 
  S:     9 VIILGSTGSIGTQGLDVISRHPERFTVTGLAAGGAHIELLAQQAAQFHVSEAAVFDETKVPALQAALAQAGAQGVRVTGGPDSVIAMAGSGANVVLNGITGSIGLEPSIAALKAGSQLALANKESVVAGGHLLFS-AQVRENQINPVDSEHSAIWQSLRSGTHAEVAKLVVTASGGPFRGWKRADMENITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFNVPPERIDVTVHPQSIVHSMVEFVDGATICQASPPDMRLPIALGLSAPDRMTNVAAACDWTQAATWTFEPLDDEAFPAVQLARHCLAASEKHTA-VLNAANEQAVHAFLEHRLPYLGIVDTVKAVLDQMDAELRGNPLFTDVEEMNQLELEARRRADDL 392
>gi|83589889|ref|YP_429898.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Moorella thermoacetica ATCC 39073] >gi|123524649|sp|Q2RJN4|DXR_MOOTA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|83572803|gb|ABC19355.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Moorella thermoacetica ATCC 39073] (385 aa)
Score = 445, Expect = 3.7e-42, Identities = 119/346 (34%), Positives = 187/346 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNAL---------------VFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRA---IPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           K++ V G+TG+IG  +LE++      + +       N E     + RF   L               V  P ++                 ++++ A+VG   L   L AL+   D+ALANKE LV AG L+ D  R  S +I PVDSEHS+++  L+   + + E+IIT SGGP  +    E+ N+    A+ HP W MG KI+IDSAT+MNK  E+IEA +LFN    +IKV  H QS++H++++++D +  A +   DM+L IQ  L+  E     +  L    L +L F+  DL+++  +  A        RA    P +++AA+E A+  F   KI    I +++ + +   +   V DL+ IL
  S:     3 KEITVLGSTGSIGRQTLEVVAAHPGRFRVAALVAARNDELLAAQVRRFRPRLAVLLDEERARVLAEMVSDPGIRILAGEEGLMAAACLEGVELVVAAMVGIRSLKAILAALEAGKDIALANKEVLVAAGQLVMDRARRLSRQIIPVDSEHSAIFQCLRQGGR-VAEVIITASGGPLRQMPRAEMANVTPEQALNHPTWVMGPKITIDSATLMNKGLEVIEAKHLFNLDFDQIKVLIHPQSVVHALVRYSDGALFAQLGPADMRLPIQYALTWPERWDLDVQPLDLAALGHLEFALPDLERFPCLELAL----QAGRAGGTYPAVLSAADEVAVEYFLAGKITLTAISQVVGRVLDEHQPEPVPDLEGIL 366
>gi|78779621|ref|YP_397733.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. MIT 9312] >gi|123553994|sp|Q319Z8|DXR_PROM9 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|78713120|gb|ABB50297.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus str. MIT 9312] (408 aa)
Score = 445, Expect = 4.1e-42, Identities = 134/366 (36%), Positives = 207/366 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-------------------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-------------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA-LENTEVN-DLKDILNLNKNTRKYVYDFSKNKFRY 377
           K + V G+TG+IG  +LEI  ++   ++ V  S   N     E +          P V      N  E+L +  N                          D ++  +VG +GL  T+ A+    ++ALANKE+L+ AG ++    + ++SR+ P DSEHS+++  L+                K +K + +T SGG F       L ++   DA  HPNW+MGKKI++DSAT+MNK  E+IEA+YLF T  + I++  H QSIIHSMI+  D+S +A +  PDMKL I   +S  E        L+ + +  LTF E D  K+  +  AY   ++    +P ++NAANE A+  F + KI F +I   I KA  + +EN  ++ +L+DIL ++   R +V    K   +Y
  S:     2 KYITVLGSTGSIGTQTLEIASEQPDKFKAVALSAGRNITLLTEQVK------THKPEVVAIEDENLIEDLKDNINNLDLDSAPLVLGGKEGINAVAAWDKADTVITGIVGCAGLIPTMSAINAGKNIALANKETLIAAGPIVIPALKKNNSRLLPADSEHSAIFQCLQGLPNYENADFSTGVMPKGLKAIHLTASGGAFRDWPVENLKHVTVEDATSHPNWDMGKKITVDSATLMNKGLEVIEAHYLFGTSYENIEIVIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERFKTNWKRLNLSEIGKLTFKEPDEFKYPCMGLAYAAGKSSG-TMPAVLNAANEMAVEQFLKEKISFQEIPTFISKACESHMENLNLSPELEDILEVDNWARIFVKQEIKKGKKY 405
>gi|71892057|ref|YP_277787.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|123641044|sp|Q493C8|DXR_BLOPB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|71796163|gb|AAZ40914.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Candidatus Blochmannia pennsylvanicus str. BPEN] (397 aa)
Score = 444, Expect = 4.2e-42, Identities = 107/288 (37%), Positives = 177/288 (61%)
  Q:    78 ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN------NNKEIKE-----LIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-----GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           EL    + D++++A+VG +GL  T  AL+    + LANKE+LV  G L         + I P+DSEH++++ +L         N  + E     +++T SGG F+K    +L  I    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN K  +I++  H QSI+H+M+ ++D + +A+++ PDM++ I   ++     G +  +N+  D+ + N  L F ++D   +     A D  +N +++  II+NAANE A+  F    I F DI ++I + + A+   + ND++DIL +++  R+
  S:    88 ELASTNDVDMVMSAIVGIAGLKPTFSALRAGKKILLANKETLVTGGKLFMKEANRYRACILPIDSEHNAIFQNLPEICQKSLGNTSLSECGISRIVLTASGGIFFKTPQKQLTKITPEQACVHPNWSMGRKISVDSATMMNKGLEYIEARHLFNAKPSEIEILLHPQSIVHAMVYYSDGNVLAHLAPPDMRIPIAYAMAYPKRIGLKISSNI--DIYYLN-KLHFDQLDNCSYPCFQLAID-ADNCSQSATIILNAANEIAVEAFLRKMISFTDIPDVIRRVLDAINLNDPNDIEDILYIDQKARE 389
>gi|120555453|ref|YP_959804.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Marinobacter aquaeolei VT8] >gi|120325302|gb|ABM19617.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Marinobacter aquaeolei VT8] (394 aa)
Score = 444, Expect = 5.1e-42, Identities = 119/355 (33%), Positives = 193/355 (54%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFS---------------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K+ + V GATG+IG S+L++I +  + + +   +     ++   +   F P   V +               P  +         E+      D ++ A+VG +GL  TL A++    + LANKE+LV++G L  D      + + P+DSEH++++  +  +         I  +++T SGGPF +    +L  +  A A  HPNW+MG+KIS+DSAT+MNK  E+IEA +LFNT    ++V+ H +SIIHSM+++ D S +A +  PDM+  I  GL+  E     +  L  F      F   DL ++  +  A +       A P ++NAANE A+  F E ++ F DI  IIE+A+ A E    +    I   +   R+
  S:     3 KRSITVLGATGSIGLSTLDVIRRHPDRFSVYALTAGTRADELATLCREFRPAVAVMADSEAAERLKALLADMPETRVLAGETGLCEVAASAESDTVMAAIVGAAGLAPTLAAVRAGKRVLLANKEALVMSGKLFMDAVERHGAELLPIDSEHNAIFQCMPADKVRDPHGAGITRILLTASGGPFRESAAEDLRAVTPAQACAHPNWSMGQKISVDSATLMNKGLELIEACWLFNTTPANVQVHVHPESIIHSMVEYADGSVLAQLGSPDMRTPIANGLAWPERIEAGVAPLDLFAIGRFHFERPDLQRFPCLRLAAEAFAAGGTA-PAVLNAANEVAVAAFLEGRLCFADIPVIIERALTATEVVPADSFDTIFAKDAEARR 383
>gi|29840203|ref|NP_829309.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila caviae GPIC] >gi|33301046|sp|Q823G9|DXR_CHLCV 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|29834551|gb|AAP05187.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila caviae GPIC] (379 aa)
Score = 443, Expect = 5.5e-42, Identities = 123/353 (34%), Positives = 196/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFPNALV--------FSPSVKTKNTVNSF---EELLEKTNP---DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + + G+TG+IG  +L+II      +++V   S+ NN +   E I  F  ++V        F  S +  N +  F   E LL        D I+ A  G   L   + A+K    LALANKE LV AG +I+++ +   +RI P+DSEH++LY  L+  N  E+K+L++T SGGP   K   +L  +   D +KHP WNMG KI++DS+T++NK  EIIEAY+LF  +  +I    H QS+IH M++F D + ++ M+ P M   IQ  L+  +        + F+    L F  +D +++  I  A   L  +  + P  +NAANE  +  F   +I + DI + + + +     +  + L D+  ++K  R
  S:     2 KHLAILGSTGSIGQQTLKIIRSLPHLFKVVALASYGNNKDVFFEQIREFSPSIVSVYDEQSYFEISKEFPN-IEVFLGEEGLLAAATAGEVDTIVAASSGVVALPAIIEAMKLGKTLALANKEVLVSAGEIIKEIAKQYQTRILPIDSEHNALYQCLEGKNTSEVKKLVLTASGGPLLYKSKEDLSRVTIRDVLKHPIWNMGAKITVDSSTLVNKGLEIIEAYWLFGLENAEIDAVVHPQSLIHGMVEFQDGTVLSVMNPPSMLFPIQHALTAPKRYPAPHKGIDFSVKQTLEFFPVDEERFPSIGLARQVLREKGSSGP-FLNAANEVLVQRFLTEEIAWCDILDKLTRLMENYRVSSCSSLDDVFAVDKEAR 373
>gi|39935981|ref|NP_948257.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris CGA009] >gi|59797571|sp|Q6N5Q6|DXR_RHOPA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|39649835|emb|CAE28357.1| 1-deoxy-d-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris CGA009] (407 aa)
Score = 443, Expect = 5.9e-42, Identities = 121/331 (36%), Positives = 182/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + V V GATG+IG S++++I  E E Y++   + N N     ++   F    V   +V     +      L  T+                  D ++ A+ G +GL   L A+     +ALANKE LV AG        ++ ++I P DSEH++L+ +L + N+ E+  +IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA YLF  +  +I V  H QSI+H +++F D S +A +  PDM++ I   L   +  T     L    +  LTF   D  ++  +  AYD L   N A   + NAANE A+  F   KI+F  I  ++E  +
  S:    17 RTVSVLGATGSIGDSTMDLIRAEPERYQVEALTGNANVAGLAKLAKEFSARFV---AVADPARLGELRAALAGTDVACGAGESAVIEAAARPADWVMAAISGAAGLKPALAAVDRGTTVALANKECLVCAGDFFMSRATAAGAQILPADSEHNALFQALASGNRHELTRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYLFALSPDEIDVLVHPQSIVHGLVEFADRSVVAQLGAPDMRIPIAHCLGFPDRITGRAAKLDLAKIGQLTFEAPDFTRFPGLRLAYDALRTGNGAT-TVYNAANEVAVAAFIAQKIRFGAIARLVEDTL 366
>gi|78776327|ref|YP_392642.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sulfurimonas denitrificans DSM 1251] >gi|78496867|gb|ABB43407.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sulfurimonas denitrificans DSM 1251] (353 aa)
Score = 443, Expect = 6.1e-42, Identities = 130/354 (36%), Positives = 200/354 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKAL---EIINRFPNALVFS-----PSVKTKNTVNSFEELL---EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           +++ G+TG+IG ++LEI +K +  +      NN   AL   +I    P  +V +       V   N +   E +L   E ++ ++++NALVGF GL  TL AL  N  +ALANKESLV  G  IE      +S+I P+DSEH  L+  ++N  + ++++IIT SGG F      +L N   AD  KHPNW+MG+KI+IDSATM+NK FE++EA +LF   K       +S+IH++I F D S  A+ +   M+L I   L+    +  L +       +L F EI  +++       + L+N  R   +++NAANE AI  F   KI F+DI + I KA    + +  N + D+  L++  R ++
  S:     1 MILLGSTGSIGVNTLEIAKKFSIHVEALVAGNNI--ALLNKQIKEHNPKVVVIADKADISKVNHSNVLYGQEAVLKVIEDSSSELVVNALVGFLGLRPTLKALTCNKRVALANKESLVACGAFIE------TSKIQPIDSEHFGLWYLMQN--RPVEKMIITASGGAFRDWNIAKLQNATLADTQKHPNWSMGQKITIDSATMVNKMFELLEARWLFGEGKYDALIETKSLIHALIDFKDGSTTAHFANASMQLPIAFALNTKMDENILPHVDLLKVGSLEFREITCERYPVWEIKDELLKNPARG--VVVNAANEAAIKKFIARKIGFMDIAKTIIKAYEKFDISPKN-VDDVFALDEEVRNFI 352
>gi|42520804|ref|NP_966719.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|59797594|sp|Q73GG3|DXR_WOLPM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|42410544|gb|AAS14653.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont of Drosophila melanogaster] (387 aa)
Score = 443, Expect = 6.6e-42, Identities = 127/363 (34%), Positives = 213/363 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILN--------------ALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYE-SKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRKYVYDFSKNK 374
           KKV V G+TG++G  +++++   KE Y++   S ++N+   L    +  NA     ++  +      +E L  T+  I +               A+VG +GL   +  +++    +ALANKES+V  G L+    +  + +I P+DSEH++++  L+N++K ++++I+T SGGPF      +L N+    A+ HP WNMGKKIS+DSATMMNK  EIIEA+ LFN    KI+   H +SI+H ++ + D    A ++  DM + I   LSG E S  N   DL+     LTF E D  ++  +  +   L +   +   I++NAANE A+  F +++I FL I E++E  + +  + T++N L DI+N++  +R   +   ++K
  S:     2 KKVSVLGSTGSVGKKTVDLLSKRKEEYQVEALSAHSNF-ALLAHQAKLLNAKYV--AISDERLYKDLKESLLGTDVKIAIGATNIATIPVDLSVVAIVGIAGLGPVMEVIESGTKVIALANKESIVCGGKLLLKKAKEKNVQIIPIDSEHNAIFQILQNDDKCVEKIILTASGGPFLNYSLEQLRNVMVDKALSHPTWNMGKKISVDSATMMNKALEIIEAHNLFNISPDKIEAIVHPESIVHGIVTYKDGFNFAVLAETDMAIPISYALSGPERSALNRKLDLTKQG-KLTFQEPDHKRFPALKLSMAVLNSSAPQTNSIVLNAANEIAVNEFLKSRIGFLKIVEVVESTMESFGSYTDINSLSDIINIDYESRIIAHKIVESK 382
>gi|118471802|ref|YP_886915.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium smegmatis str. MC2 155] >gi|118173089|gb|ABK73985.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium smegmatis str. MC2 155] (398 aa)
Score = 443, Expect = 6.8e-42, Identities = 126/358 (35%), Positives = 192/358 (53%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV---------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL------SGYESKTNLINDLSFNNL---NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN--TEVNDLKDILNLNKNTRK 365
           E  +++VL+ G+TG+IG  +LE+I    + +E+VG +      + L            + +                ++   L+E T  D++LNALVG  GL  TL AL     LALANKESLV  G L+  LK ++  +I PVDSEHS++   L+   + E+ ++++T SGGPF      +L ++    A KHP W+MG   +++SAT++NK  E+IE + LF      I V  H QSI+HSM  FTD S +A  S PDMKL I   L      +G  +  +     ++  L   N  F  +DL +         F   Q   +  + N+ANEEA   F + +I F DI E +   + A +    E   + D+L+  +  R+
  S:     9 EPGRQRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNPELLAAQRAQTGVAAVAVADPAAAEAVGDVRYSGPDAVTRLVEDTEADVVLNALVGALGLQPTLAALATGARLALANKESLVAGGPLV--LKAAAPGQIVPVDSEHSAMAQCLRGGTRAELDKIVLTASGGPFLGWSAEDLKSVTPEQAGKHPTWSMGPMNTLNSATLVNKGLELIETHLLFGVDYDDIDVVVHPQSIVHSMATFTDGSTLAQASPPDMKLPIALALGWPDRIAGAAAACDFSTASTWEFLPLDNAVFPAVDLAR---------FAGKQGGCLTAVYNSANEEAAEAFLDGRIGFPDIVETVGDVLHAADRWAAEPATVDDVLDAQRWARE 380
>gi|116327679|ref|YP_797399.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330594|ref|YP_800312.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281651|sp|Q04U66|DXR_LEPBJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|122284525|sp|Q053M9|DXR_LEPBL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|116120423|gb|ABJ78466.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124283|gb|ABJ75554.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (389 aa)
Score = 443, Expect = 6.8e-42, Identities = 118/361 (32%), Positives = 198/361 (54%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTV-------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNK 374
           V + GA+G++G S+L ++    + + L  FS ++N EKA EI   F P  L  S S   +  +             ++  EL+ +    I++ A+VG  GL  T+ A+ +   L +ANKE+LV  G L+  L     +++ PVDSEH++L+  L++ N++ ++++++T SGG F      +L  +    A+ HP WNMG KI++DS  M+NK  E+IEA++LF    ++I V  H QSI H +++  D +     S PDM   I   L   E     +   S  +   L F E DL ++  +  A++  +    A P I NAANE A+ LF +++I+F +I + I   +  +       L++   +++  RK V +    K
  S:     5 VSLLGASGSVGESTLRVLRAYPQEFRLHSFSVHSNLEKAREIQKEFSPEFLCVSDSTADRTVLGNKIGKTQVLYGESALCELVREPEVQIVITAIVGSVGLRPTIAAITSGKRLGIANKETLVTFGPLVNSLIAKHKTKVVPVDSEHNALFQLLESLNRDSVEKIVLTASGGSFRDLSVEQLAYVTKEQALHHPTWNMGPKITVDSNGMINKGLEVIEAHFLFGVPYERIGVVIHPQSIAHGIVELKDGASFVYASYPDMIFPIAHSLFHPEPVPKSLRSYSAKDWGKLEFWEPDLKRYPGLGLAFEAGKAGGTA-PCIFNAANEAAVELFLKDEIRFTEIPDYIWYTLDEMPIDFPTSLEEYEEVDRIARKTVLNLKARK 384
>gi|86138420|ref|ZP_01056994.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseobacter sp. MED193] >gi|85824945|gb|EAQ45146.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseobacter sp. MED193] (390 aa)
Score = 443, Expect = 6.9e-42, Identities = 114/335 (34%), Positives = 195/335 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEK---------ALEIINRFPNALVFSPSVKTKNTVNSFEE------LLEK-TNP-DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE 346
           +K+ +FGATG+IG S++++I++    YE+V  +   N  +         A   +  + + L   P+++     +  E       L+E  T P D I++A+VG +GL   L AL++   LALANKESLV AG L+ +  +   +R+ PVDSEHS+++  L   +   ++ ++IT SGG F      +L     A A  HPNW+MG++I+IDSA+M NK  E+IE   Y+    ++I+V  H +S++H+++ F D + +A++  PDM+ +I   L   E +   +  L    +  L F + DL ++  +  A D ++ +   +  + NAA E A+  F    I+F D+ EI  + +  +E
  S:     2 RKISIFGATGSIGQSTIDLIKRAPSAYEVVALTGGRNIAQLSADAITLGAELAVTAYEDQL---PALQEALAGSGVEAAAGQAALIEAATRPADWIMSAIVGVAGLAPGLKALEHGTTLALANKESLVCAGELLLETAKQYGARLLPVDSEHSAVFQGLVGEDISAVERIVITASGGAFRDWPLEDLKQATLAQASSHPNWDMGQRITIDSASMFNKALEVIETREYFGVEPEQIEVLVHPESLVHALVGFRDGALMAHLGAPDMRHAIGYALHWPERRDLPVARLDLAAIGQLNFRQPDLARYPALAQARDVMQRRG-LMGAVFNAAKERALDHFIAGSIRFTDMAEITARVLEQIE 355
>gi|108562642|ref|YP_626958.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Helicobacter pylori HPAG1] >gi|122386760|sp|Q1CUT8|DXR_HELPH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|107836415|gb|ABF84284.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Helicobacter pylori HPAG1] (368 aa)
Score = 442, Expect = 7.4e-42, Identities = 126/352 (35%), Positives = 204/352 (57%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFP--NALVFSPS---------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK-KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA--IIALENTEVNDLKDILNLNKNTRK 365
           ++V G+TG+IG ++L+I +K   E+   S   N     E I  F      +  PS          +    ++  + ++E+   +++LNA+VG +GL  +  +L+ N  LALANKESLV AG L++       S+I PVDSEH  L+  L+N   + K LII+ SGG F       +   N  +A+KHPNW+MG KI+IDSA+M+NK FEI+E Y+LF T  KI       SI+H++++F DNS I +++  DM+L I   +    +  N  I  L    LN + F  I ++++    W Y  L  +N  + +++NA+NE A+  F   +I F  + + I +A  + A ++ +++ L ++L L+K  R+
  S:     1 MVVLGSTGSIGKNALKIAKKFGVEIEALSCGKNIALINEQIKVFKPKKVAILDPSDLNNLEPLGAEVFVGLDGIDAMIEECVSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGNLLD------ISQITPVDSEHFGLWALLQNKTLKPKSLIISASGGAFRDTPLELIAIQNAQNALKHPNWSMGSKITIDSASMVNKLFEILETYWLFGTSLKIDALIERSSIVHALVEFEDNSIIVHLASADMQLPISYAIDPKLASLNASIKPLDLYALNAIKFEPISMERYT--LWRYKDLLLENPKLGVVLNASNEVAMEKFLNQEIAFGGLIQTISQALELYAKKSFKLSSLDEVLELDKEVRE 360
>gi|15644844|ref|NP_207014.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Helicobacter pylori 26695] >gi|2495695|sp|P56139|DXR_HELPY 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|2313306|gb|AAD07284.1| conserved hypothetical protein [Helicobacter pylori 26695] (368 aa)
Score = 442, Expect = 7.9e-42, Identities = 123/352 (34%), Positives = 203/352 (57%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFP--NALVFSPS---------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK-KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-GYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENT--EVNDLKDILNLNKNTRK 365
           ++V G+TG+IG ++L+I +K   E+   S   N     E I  F      +  PS          +    +   + ++E+   +++LNA+VG +GL  +  +L+ N  LALANKESLV AG L++       S+I P+DSEH  L+  L+N   + K LII+ SGG F       +   N  +A+KHPNW+MG KI+IDSA+M+NK FEI+E Y+LF    KI       SI+H++++F DNS IA+++  DM+L I   +     S +  I  L    L+ + F  I ++++    W Y  L  +N  + +++NA+NE A+  F   +I F  + + I +A+ + +    +++ L+++L L+K  R+
  S:     1 MVVLGSTGSIGKNALKIAKKFGIEIEALSCGKNIALINEQIQVFKPKKVAILDPSDLNDLEPLGAEVFVGLEGIDAMIEECTSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLLD------ISQITPIDSEHFGLWALLQNKTLKPKSLIISASGGAFRDTPLEFIPIQNAQNALKHPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIAHLASADMQLPISYAIDPKLASLSASIKPLDLYALSAIKFEPISMERYT--LWCYKDLLLENPKLGVVLNASNEVAMEKFLNKEIAFGGLIQTISQALESYDKMPFKLSSLEEVLELDKEVRE 360
>gi|77457334|ref|YP_346839.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas fluorescens PfO-1] >gi|123605787|sp|Q3KHA6|DXR_PSEPF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|77381337|gb|ABA72850.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas fluorescens PfO-1] (396 aa)
Score = 442, Expect = 8.9e-42, Identities = 117/341 (34%), Positives = 200/341 (58%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFS-FNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFE----------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA-----IIALENTE 349
           ++ +++ V GATG+IG S+L++I +  + Y+    S F    E     +   P   V   +   +N  +                   ++      D ++ A+VG +GL  TL A++    + LANKE+LV++G L     R S S + P+DSEH++++  +  +      N  ++ +++T SGGPF +    EL +++   A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ K  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D +++  +  A    E  N A P ++NAANE A+  F + ++++L+I  IIE+      ++AL+N +
  S:     2 SRPQQITVLGATGSIGLSTLDVIARHPDRYQAFALSGFTRLSELFALCVRHLPEYAVVPEAGAARNLQDDLRAAGLSTQVLVGEEGLCQVAAAPEVDAVMAAIVGAAGLRPTLAAVEAGKKILLANKEALVMSGALFMQAVRKSGSVLLPIDSEHNAIFQCMPQDFARGLSNVGVRRILLTASGGPFRQTPMAELAHVSPDQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAKPSQVEVVIHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAVARLDFEAPDEERFPCLRLARQAAEAGNSA-PAMLNAANEVAVAAFLDGRVRYLEIASIIEEVLNLEPVVALDNLD 374
>gi|23464723|ref|NP_695326.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium longum NCC2705] >gi|32171391|sp|Q8G7Y7|DXR_BIFLO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|23325290|gb|AAN23962.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bifidobacterium longum NCC2705] (396 aa)
Score = 441, Expect = 1.1e-41, Identities = 119/357 (33%), Positives = 202/357 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL-EIINRF--PNALVFS----PSVKTKNTVNSFEELLEKTNPD-----------IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE-----NTEVNDLKDILNLNKNTRKYVYDF 370
           V++ G+TG+IG   L++I +  E + + G +    + + L +   +F      VF     P+++        + +     PD           ++LN + G  GL  ++ ALK    LALANKES+V  G L+    +   ++I PVDSEHS+++ SL++  + E+ +L++T SGGPF   +  ++ NI    A+ HP WNMG  ++I+S+T+MNK  E+IEA  LFN   ++I V  H QSI+HSM++F D + I   S PDM+L I  GLS  +  TN+     +      TF  +D + +  +  A   L    +    ++NAANE+A+  F E+++ +L I + ++  +  ++     N    D++++  L    R+   D 
  S:     9 VIILGSTGSIGTQGLDVISRHPERFTVTGLAAGGAHIELLAQQAAQFHVSEVAVFDETKVPALQAALAQAGAQGVRVTGGPDSVIAMAGSGANVVLNGITGSIGLEPSIAALKAGSQLALANKESVVAGGHLLFS-AQVRENQINPVDSEHSAIWQSLRSGTHAEVAKLVVTASGGPFRGWKRADMENITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFNVPPERIDVTVHPQSIVHSMVEFVDGATICQASPPDMRLPIALGLSAPDRMTNVAAACDWTQAATWTFEPLDDEAFPAVQLARHCLAASEKHTA-VLNAANEQAVHAFLEHRLPYLGIVDTVKAVLDQMDAELRGNPLFTDVEEMNQLELEARRRADDL 392
>gi|15611272|ref|NP_222923.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Helicobacter pylori J99] >gi|8134420|sp|Q9ZML6|DXR_HELPJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|4154714|gb|AAD05777.1| putative [Helicobacter pylori J99] (368 aa)
Score = 441, Expect = 1.1e-41, Identities = 127/352 (36%), Positives = 207/352 (58%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL--------------LEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK-KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS-GYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKA--IIALENTEVNDLKDILNLNKNTRK 365
           ++V G+TG+IG ++L+I +K   ++   S   N     E I  F    V   ++   N +N+ E L              +E+   ++++NA+VG +GL  +  +L+ N  LALANKESLV AG L++       S+I PVDSEH  L+  L+N   + K LII+ SGG F     + +   N  +A+KHPNW+MG KI+IDSA+M+NK FEI+E Y+LF    KI       SI+H++++F DNS IA+++  DM+L I   ++    S +  I  L    L+ + F  I ++++    W Y  L  +N  + +++NA+NE A+  F   +I F    +II +A  + A ++ +++ L ++L L+K  R+
  S:     1 MVVLGSTGSIGKNALKIAKKFGVKIEALSCGKNIALINEQIKVFKPKKV---AILDPNDLNNLEPLGAEVFVGLDGIDAMIEECVSNLVINAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHLLD------ISQITPVDSEHFGLWALLQNKTLKPKSLIISASGGAFRDTPLDLIAIQNAQNALKHPNWSMGDKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSVIAHLASADMQLPISYAINPKLASLSASIKPLDLYALSAIKFEPISVERYT--LWRYKDLLLENPKLGVVLNASNEVAMKKFLNQEIAFGGFIQIISQALELYAKKSFKLSSLDEVLALDKEVRE 360
>gi|88607594|ref|YP_505043.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anaplasma phagocytophilum HZ] >gi|123495401|sp|Q2GKQ8|DXR_ANAPZ 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|88598657|gb|ABD44127.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anaplasma phagocytophilum HZ] (385 aa)
Score = 439, Expect = 1.7e-41, Identities = 120/346 (34%), Positives = 196/346 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYE---KALEIINRFPNALVFSPSVKTKNTVNSF-----------EELLEKT--NPDIILNALVGFSGLHITLLALKNNV-DLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAI-PIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           KKV VFG+TG IG +++ I+    E+++++     +N     +  +++N      V +   + +    S            E +LE    + D  + A+ G   L   +  +++ V  +ALA+KES+V  G L+ D    S +RI PVDSEH++++  L   +   K + IT SGGPF     ++L ++   DA+ HP W MGKKIS+DSATMMNK  E++EA YLF    +KI V  H +SI+H++  + D +  A MS+PDM + I   L     K   + ++       LTF   D +++  +  A+D L++  R +  I+ NAANE A+  F  ++I FL+I  I+   +  +   +V+ L DI+
  S:     2 KKVSVFGSTGFIGKTTVGILSGNTEDFKVIALVAGSNVSLLAQQAKLLN--AEMAVIADDAQYEELKRSLHGSGIRVAAGKEAVLEAAALSVDTAVMAITGIVALSAVMRLIESGVGTIALASKESVVCGGVLLRDAACKSGTRIVPVDSEHNAVFRLLSQGDNPYK-ITITASGGPFLHWSHDQLKSVTIEDALVHPVWKMGKKISVDSATMMNKALEVLEASYLFELGYRKIDVVIHPESIVHALAFYQDGTSTALMSLPDMSIPILHALYWPHRKEVSVREVDLIAYGKLTFIRPDFERFPALKAAFDILQSSERDVASIVFNAANEVAVESFLNSEITFLEIVNIVLHVMNKVPYGKVSSLADIM 367
>gi|24111608|ref|NP_706118.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella flexneri 2a str. 301] >gi|30061730|ref|NP_835901.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella flexneri 2a str. 2457T] >gi|39930878|sp|Q83MD3|DXR_SHIFL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|24050376|gb|AAN41825.1| putative ATP-binding component of a transport system [Shigella flexneri 2a str. 301] >gi|30039972|gb|AAP15706.1| putative ATP-binding component of a transport system [Shigella flexneri 2a str. 2457T] (398 aa)
Score = 439, Expect = 1.8e-41, Identities = 123/351 (35%), Positives = 201/351 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSP---------SVKTKNTV----NSFEELLEKTNP----------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKN 362
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E        L FSP         S K   T+     S  E+L               D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D +++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVE------QCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEEVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYERYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDAN 384
>gi|89898373|ref|YP_515483.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila felis Fe/C-56] >gi|123483253|sp|Q254F0|DXR_CHLFF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|89331745|dbj|BAE81338.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila felis Fe/C-56] (379 aa)
Score = 439, Expect = 1.8e-41, Identities = 121/353 (34%), Positives = 201/353 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFPNALV-------FSPSVKTKNTVNSF---EELLEKTNP---DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + +FG+TG+IG  +L+I+      + +V   S+ NN +  +E I  F  ++V       +    K    + +F   E L+        D+++ A  G   L   + A+K+   LALANKE LV AG +I++  +   + I+PVDSEH++LY  L+  N  E+K+L++T SGGP   K   EL ++   D +KHP W+MG KI++DS+T++NK  EIIEAY+LF  +  +I    H QS+IH M++F D + ++ M+ P+M   IQ  L+  +        ++F+    L F  ID +++  I  A   L+N+  + P   NAANE  +  F   +I + DI + + + +          L+D+L +++  R
  S:     2 KHLSIFGSTGSIGQQTLKIVRSLPHLFNVVALASYGNNKDLFIEQIREFSPSIVSVYDEQLYFEIRKEFPEIQAFLREEGLMAAATAEEIDMVVAASSGVVALPAIIEAMKSGKVLALANKEVLVSAGEIIKEFAKQYQTEIFPVDSEHNALYQCLEGRNALEVKKLLLTASGGPLLHKTKEELAHVTVQDVLKHPIWHMGAKITVDSSTLVNKGLEIIEAYWLFGLENAEIDAVIHPQSLIHGMVEFLDGTVLSVMNPPNMLFPIQHVLTTPKRYPAPHKGINFSIKQTLEFFPIDEERFPSIGLARQVLKNKGSSGP-FFNAANEVLVQRFLAEEIAWCDILDKLTRLMENYRVFACTSLEDVLAVDEEAR 373
>gi|90413535|ref|ZP_01221526.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photobacterium profundum 3TCK] >gi|90325467|gb|EAS41950.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photobacterium profundum 3TCK] (397 aa)
Score = 439, Expect = 1.9e-41, Identities = 121/353 (34%), Positives = 206/353 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP-----------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +K+ + GATG+IG S+L +  +  + +E+V  +   N +K LE+   +        S++    +++  +  E +                   D ++ A+VG +GL  T+  +K    + LANKE+LV++G +  D      + + PVDSEH++++  L    +            I ++++T SGGPF   + +EL ++    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A M +PDM+  I   +S Y ++ +  +  L F+N+   TF   D  ++  +  A D    + +A    +NAANE A+  F  N+I F DI  I E+ + + + T   DL+ ++ L+   R
  S:     2 RKLTILGATGSIGSSTLAVAAQNPQLFEVVALAAGTNSQKMLELCRIWKPKYAAMASLQAAKELSALLKKHEISTQVLAGDAGLCQVAALDEIDTVMAAIVGAAGLLPTMAGVKAGKRILLANKEALVMSGQMFIDACEQYGAELLPVDSEHNAIFQCLPAEIQRAMGRCDLEEHGISKILLTGSGGPFRYTDISELASVTPQMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFNASREQLQVIIHPQSVIHSMVQYKDGSVLAQMGLPDMQTPIACAMS-YPNRVDAGVAPLDFSNIGEFTFLPPDYSRYPCLKLAIDACY-EGQAATTALNAANEIAVAAFLNNEIGFTDIAVINEQILNSADMTTPVDLESVIELDMRAR 386
>gi|33241685|ref|NP_876626.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila pneumoniae TW-183] >gi|33236194|gb|AAP98283.1| hypothetical protein CpB0352 [Chlamydophila pneumoniae TW-183] (379 aa)
Score = 439, Expect = 2.0e-41, Identities = 121/353 (34%), Positives = 192/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFP-------NALVFSPSVKTKNTVNSF---EELLEKTNPDIILNALVGFSG---LHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQ--HGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + V G+TG+IG  +LEI+ +    ++++   S+ NN     + +  F        N  V++ + +    +  F   E L +    D +   +   SG   L   L ++K    LALANKE LV AG L+    + +  ++ P+DSEH++LY  L+    E IK+LI+T SGGP   K   EL  +   D + HP WNMG K+++DS+T++NK  EIIEAY+LF  + I++    H QS+IH M++F D S I+ M+ PDM   IQ  L+  E   +  + + F+    L F  +D +++  I  A   LE Q  +     NAANE  +  F   +I + DI   +   +   +    + L+DIL ++   R
  S:     2 KHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQQLEEFAPLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSGIEALPAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEHNALYQCLEGRTIEGIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWNMGSKVTVDSSTLVNKGLEIIEAYWLFGLENIEILAVIHPQSLIHGMVEFLDGSVISIMNPPDMLFPIQYALTAPERFASPRDGMDFSKKQTLEFFPVDEERFPSIRLAQQVLEKQGSS-GSFFNAANEVLVRRFLCEEISWCDILRKLTTLMECHKVYACHSLEDILEVDGEAR 373
>gi|110804225|ref|YP_687745.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Shigella flexneri 5 str. 8401] >gi|110613773|gb|ABF02440.1| putative ATP-binding component of a transport system [Shigella flexneri 5 str. 8401] (398 aa)
Score = 438, Expect = 2.2e-41, Identities = 118/351 (33%), Positives = 197/351 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKTNP----------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKN 362
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                  D ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN    +++V  H QS+IHSM+++ D S +A +  PDM+  I   ++      + +  L F  L+ LTF+  D +++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L+++ N
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVSSGQQAACDMAALEEVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYERYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDAN 384
>gi|77972714|ref|ZP_00828273.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia frederiksenii ATCC 33641] (398 aa)
Score = 438, Expect = 2.2e-41, Identities = 123/353 (34%), Positives = 202/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVK-------------------TKNTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG S+L ++    E +++       N E+  +        L FSP                      ++  V S E    EL    + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  + S +++ P+DSEH++++ SL  N +            +  +I+T SGGP  +   ++  ++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++I+V  H QS+IHSM+++ D S +A M  PDM+  I   ++ Y  + N  +  L F  +  LTF + D  ++  +  A D   N  +A    +NAANE +++ F ++ I+F DI  I    +  L   E   + ++L +++  R
  S:     2 KQLTILGSTGSIGNSTLGVVRTNPELFKVTALVAGRNVEQMAQ------QCLEFSPRYAAMSDEESAAALRRLLAEHGSQTEVYSGEKAACELAALDDVDQVMAAIVGVAGLPSTLAAIRKGKQVLLANKESLITCGKLFMDEVKHSHAQLLPIDSEHNAIFQSLPENVQRQLGYSSLSEHGVSRIILTGSGGPLRETPLSQFADVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVILHPQSVIHSMVRYHDGSVLAQMGAPDMRTPIAHAMA-YPMRVNSGVAPLDFCKIRELTFGDPDYQRYPCLKLAID-ASNAGQAATTALNAANEISVMAFLDSIIRFTDIAAINRTVVEHLSLQEPTSVDEVLVIDRQAR 386
>gi|33861698|ref|NP_893259.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|39930840|sp|Q7V0W0|DXR_PROMP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|33640066|emb|CAE19601.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (404 aa)
Score = 438, Expect = 2.6e-41, Identities = 136/362 (37%), Positives = 211/362 (58%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPS---VKTKNTVNSFEELLEKTNP-------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKE------------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYES-KTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA-LENTEVN-DLKDILNLNKNTRKYVYDFSKNKFRY 377
           + G+TG+IG  +LEI+ +  + +++V  S   N +   E +++  P  +           KN +N+    L  +NP                   D ++  +VG +GL  T+ A+K   ++ALANKE+L+ AG ++    + S SR+ P DSEHS+++  ++   N E            +K + +T SGG F   E  +L N+   DA  HPNW+MG+KI++DSAT+MNK  E+IEA+YLF T  + I++  H QSIIHSMI+  D+S +A +  PDMKL I   +S  E  KTN           LTF + D  K+  +  AY   +     +P ++NAANE A+  F + KI F +I   I K   + L    +N  L+DIL ++   R +V +  K   +Y
  S:     1 MLGSTGSIGTQTLEIVSELPDKFKVVALSAGRNIDLLTEQVSQHKPEVIAIEDENLLTDLKNNINN----LGISNPPIVLGGREAINSVAAWDSADTVITGIVGCAGLIPTMSAIKAGKNIALANKETLIAAGSVVIPALKESKSRLLPADSEHSAIFQCIQGLPNYENADFSTGQIPNGLKAIHLTASGGAFRDWEVEDLKNVTVEDATSHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGTSYENIEIAIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERFKTNWKRFNLTEIGQLTFKKPDEVKYPCMGLAYSAGKCSG-TMPAVLNAANEMAVDQFLKEKISFQEIPIFINKTCESHLNKINLNPKLEDILEVDNWARIFVQEEIKKGKKY 400
>gi|15618260|ref|NP_224545.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila pneumoniae CWL029] >gi|8134419|sp|Q9Z8J8|DXR_CHLPN 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|4376619|gb|AAD18489.1| CT071 hypothetical protein [Chlamydophila pneumoniae CWL029] (379 aa)
Score = 438, Expect = 2.6e-41, Identities = 120/353 (33%), Positives = 192/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFP-------NALVFSPSVKTKNTVNSF---EELLEKTNPDIILNALVGFSG---LHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQ--HGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + V G+TG+IG  +LEI+ +    ++++   S+ NN     + +  F        N  V++ + +    +  F   E L +    D +   +   SG   L   L ++K    LALANKE LV AG L+    + +  ++ P+DSEH++LY  L+    E IK+LI+T SGGP   K   EL  +   D + HP WNMG K+++DS+T++NK  EIIEAY+LF  + +++    H QS+IH M++F D S I+ M+ PDM   IQ  L+  E   +  + + F+    L F  +D +++  I  A   LE Q  +     NAANE  +  F   +I + DI   +   +   +    + L+DIL ++   R
  S:     2 KHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQQLEEFAPLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSGIEALPAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEHNALYQCLEGRTIEGIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWNMGSKVTVDSSTLVNKGLEIIEAYWLFGLENVEILAVIHPQSLIHGMVEFLDGSVISIMNPPDMLFPIQYALTAPERFASPRDGMDFSKKQTLEFFPVDEERFPSIRLAQQVLEKQGSS-GSFFNAANEVLVRRFLCEEISWCDILRKLTTLMECHKVYACHSLEDILEVDGEAR 373
>gi|15835878|ref|NP_300402.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila pneumoniae J138] >gi|8978717|dbj|BAA98553.1| CT071 hypothetical protein [Chlamydophila pneumoniae J138] (379 aa)
Score = 437, Expect = 2.8e-41, Identities = 120/353 (33%), Positives = 192/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFP-------NALVFSPSVKTKNTVNSF---EELLEKTNPDIILNALVGFSG---LHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQ--HGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + V G+TG+IG  +LEI+ +    ++++   S+ NN     + +  F        N  V++ + +    +  F   E L +    D +   +   SG   L   L ++K    LALANKE LV AG L+    + +  ++ P+DSEH++LY  L+    E IK+LI+T SGGP   K   EL  +   D + HP WNMG K+++DS+T++NK  EIIEAY+LF  + +++    H QS+IH M++F D S I+ M+ PDM   IQ  L+  E   +  + + F+    L F  +D +++  I  A   LE Q  +     NAANE  +  F   +I + DI   +   +   +    + L+DIL ++   R
  S:     2 KHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQHLEEFAPLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSGIEALPAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEHNALYQCLEGRTIEGIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWNMGSKVTVDSSTLVNKGLEIIEAYWLFGLENVEILAVIHPQSLIHGMVEFLDGSVISIMNPPDMLFPIQYALTAPERFASPRDGMDFSKKQTLEFFPVDEERFPSIRLAQQVLEKQGSS-GSFFNAANEVLVRRFLCEEISWCDILRKLTTLMECHKVYACHSLEDILEVDGEAR 373
>gi|99081251|ref|YP_613405.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Silicibacter sp. TM1040] >gi|123378917|sp|Q1GGS3|DXR_SILST 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|99037531|gb|ABF64143.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Silicibacter sp. TM1040] (395 aa)
Score = 437, Expect = 2.8e-41, Identities = 115/335 (34%), Positives = 189/335 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEK----ALEI------------INRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE 346
           KK+ +FGATG+IG S++++I +  + Y++V  S  +N  +    A+E+            +    +AL  S  V+  +   +  E   +   D I++A+VG +GL   L AL+    LALANKESLV AG L+        +RI PVDSEHS+++ +L     +E++ +IIT SGG F       L   + A+A  HPNW+MG++I+IDSA+M NK  E+IE    F    ++I+V  H QS++H+++ F D + ++++  PDM+ +I   L   +     +  L    +  L F   DL ++  +  A + +     +     N A E A+  F   +I FLD+  + E+ +  LE
  S:     7 KKISIFGATGSIGQSTIDLIRRAPDAYDVVALSGGHNVAQLARDAIELQADIAITAHDARLEELRSALAGS-GVEAASGAAALVEAASRP-ADWIMSAIVGAAGLAPGLKALEQGTTLALANKESLVCAGALLMQTAADHGARILPVDSEHSAVFQALVGERIEEVERIIITASGGAFRDWPLERLKTASLAEASSHPNWDMGQRITIDSASMFNKALEVIETREFFGVAPEQIEVLVHPQSLVHALVGFRDGALMSHLGAPDMRHAIGYALHWPDRNALPVARLDLAAIGQLEFRAPDLQRYPALRLAQEVMRRGGLS-GAAFNGAKERALDHFIAGRIGFLDMASLTEEGLATLE 360
>gi|16763610|ref|NP_459225.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella typhimurium LT2] >gi|56412493|ref|YP_149568.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167546836|ref|ZP_02342398.1| hypothetical protein Sentent_26319 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167990105|ref|ZP_02571205.1| hypothetical protein Sententer_01000001_0100001590 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168221777|ref|ZP_02647009.1| hypothetical protein Senterenterica_15381 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168230527|ref|ZP_02655585.1| hypothetical protein Sententerica_06096 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168244986|ref|ZP_02669918.1| hypothetical protein Senterienterica_25324 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263913|ref|ZP_02685886.1| hypothetical protein Salmentericaenterica_22768 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168823248|ref|ZP_02835248.1| hypothetical protein Salentericaenterica_27947 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|21263526|sp|Q8ZRP3|DXR_SALTY 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|81170458|sp|Q5PD59|DXR_SALPA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|16418725|gb|AAL19184.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella typhimurium LT2] >gi|56126750|gb|AAV76256.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (398 aa)
Score = 437, Expect = 3.4e-41, Identities = 121/354 (34%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL---LEKTNPDI--------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    +++ ++      N  +  E        L FSP     +  +S E+L   L++                         ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S++R+ PVDSEH++++ SL  + +            +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A +  PDM+  I   ++     T+    L F  L+ LTFS  D  ++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   ++D+L ++   R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAE------QCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIARE 387
>gi|74316809|ref|YP_314549.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thiobacillus denitrificans ATCC 25259] >gi|74056304|gb|AAZ96744.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thiobacillus denitrificans ATCC 25259] (394 aa)
Score = 437, Expect = 3.4e-41, Identities = 121/361 (33%), Positives = 192/361 (53%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIIN----RFPNALVFSP---------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           +++ + V GATG IG ++L+++ +  E +E+   +     E+  E       RF  A++  P               +V+      +  E+      D ++ A+VG +GL  TL A +    + LANKE+LVV+G L  D   +S + + P+DSEH++++ +L            +  L +T SGGPF       +       AV HPNW MG+KIS+DSA++MNK  E+IEA +LFN +  +IKV  H QSI+HSM+++ D S +A M  PDM+  I   L   E     +  L      LTF   D  ++  +  A+D           ++NAANE A+  F E  I F  I   I  A+ A+     + L ++L+ +   R+   D+
  S:     2 RRRVLTVLGATGTIGVNTLDVVSRHPERFEIFALTGATQVERMFEQCRAHRPRF--AVMSEPAAAAALRARLAADGLAVEVLEGAAALTEVAIAAEVDTVMAAIVGAAGLPATLAAARAGKRILLANKETLVVSGQLFMDAVAASGAELLPIDSEHNAIFQALPRGFDGDFQRAGVNTLWLTASGGPFRTLSAEAIAAATPEQAVAHPNWVMGRKISVDSASLMNKGLEVIEARWLFNARPEQIKVLVHPQSIVHSMVEYVDGSVVAQMGTPDMRTPIAYALGFPERIAAGVPMLELMGRQLTFEAPDTVRFPCLQLAFD-ALAAGGNAAAVLNAANEVAVARFLEGAISFGGIAASIAHALDAVAGGRADTLDELLDADHRARRVADDY 388
>gi|45437435|gb|AAS62986.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia pestis biovar Microtus str. 91001] (381 aa)
Score = 437, Expect = 3.4e-41, Identities = 106/287 (36%), Positives = 175/287 (60%)
  Q:    78 ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII-ALENTEVNDLKDILNLNKNTR 364
           EL    + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  + S +++ P+DSEH++++ SL             N   +  +I+T SGGPF +   ++  ++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++I+V  H QS+IHSM+++ D S +A M  PDM+  I   ++     ++ +  L F  +  LTF+  D  ++  +  A D   N  +A    +NAANE +++ F ++KI+F DI E+I + ++  L  +E   ++++L +++  R
  S:    70 ELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDAC-NAGQAATTALNAANEISVMAFLDSKIRFTDI-EVINRTVVEGLLLSEPTSVEEVLVIDRKAR 369
>gi|83647911|ref|YP_436346.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hahella chejuensis KCTC 2396] >gi|123531342|sp|Q2SBQ3|DXR_HAHCH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|83635954|gb|ABC31921.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hahella chejuensis KCTC 2396] (403 aa)
Score = 436, Expect = 4.4e-41, Identities = 119/355 (33%), Positives = 208/355 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEI-INRFPNALVFSP----------------SVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKEL-----------IITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           ++V V GATG+IG S+L+++ +  + YEL   + ++N  +   I I   P   + +                 S + +  V +  E    ++ D+++ A+VG +GL  TL A+ +   + LANKE+LV+ G L  D  R   + + P+DSEH+++Y  L    + + ++           ++T SGGPF      +L  +    A +HPNW+MG+KIS+DSA++MNK  E+IEA +LF+     ++V+ H +SIIHSM+++ D S +A M  PDM+  I  GL+  E     +  L  F+   L F   D +++  +  A +       A P ++NAANE A+  F +  I+F+DI  +IEK+++     + + ++ ++  ++  R+Y
  S:     2 RRVTVLGATGSIGRSTLDVMARHPDRYELYAATAHSNLNELFSICIKHRPRYAILATDAGLAGFKKRLRDAGVSTEVRVGVEAMCEASSASDVDVVVAAIVGAAGLVPTLAAVNSGKRILLANKEALVMTGRLFMDAVRRHGAELLPIDSEHNAIYQCLPEAGQHLSDMTSLAAYGVTRVLLTASGGPFRHFSQQQLQQVTPEQACRHPNWSMGRKISVDSASLMNKGLELIEACWLFDLTPGSVQVHLHPESIIHSMVEYVDGSILAQMGNPDMRTPIAYGLAWPERIDAGVQPLDLFSIGKLHFEMPDKERFPCLRLAEEAFSLGGTA-PAVVNAANEVAVEAFLQGDIRFVDIPVVIEKSLLKGSIVDADSVETVIEADRVARQY 388
>gi|187478234|ref|YP_786258.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bordetella avium 197N] >gi|123515017|sp|Q2L155|DXR_BORA1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115422820|emb|CAJ49348.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bordetella avium 197N] (399 aa)
Score = 436, Expect = 4.5e-41, Identities = 119/355 (33%), Positives = 201/355 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL----------------EIINRFPNALVFSPS---VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN---------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI---IALENTEVNDLKDILNLNKNTRKY 366
           +++ V G+TG+IG S+L++I +  E + +   S  +  +K                      RF  A  +SPS    + +    +  +       D ++ A+VG +GL   L A ++   + LANKE+LV AG +     R S + + P+DSEH++++  L             K +++LI+T SGGPF +    +L ++    A  HPNW+MG+KIS+DSATM+NK  E+IEA++LF     +I+V  H QS++HS++++ D S +A M  PDM+  I  GL   E     ++ L       L F   DL+++  +  +Y+ L    +A  + +NAANE A+  F E ++ +  I  +I+ A+       +  ++ L D+L L+   R Y
  S:     5 QRIAVLGSTGSIGDSTLDVIARYPERFGVYALSAFSRMDKLAAQALATGAAVVVVPDNNAATRFRQA--WSPSRALPEIRVGAQALADTAADAGCDTVMAAIVGIAGLPAALAAAQSGKRVLLANKEALVAAGSIFMSAVRQSGAELLPIDSEHNAIFQCLPQGERAGAPSTPAKTVRKLILTASGGPFRRHSPEDLQDVTPDQACAHPNWSMGRKISVDSATMLNKGLEVIEAHWLFAMPADRIEVLIHPQSVVHSLVEYDDGSVLAQMGQPDMRTPISYGLGFPERLDAGVSPLDLAKWGRLDFETPDLERFPCLRLSYEALR-AGQAACVALNAANEIAVAAFLEGRLPYPWIARVIDAALEWQAGRPSVTLDHLTDVLALDAQVRAY 392
>gi|56416872|ref|YP_153946.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anaplasma marginale str. St. Maries] >gi|81170431|sp|Q5PAI9|DXR_ANAMM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|56388104|gb|AAV86691.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Anaplasma marginale str. St. Maries] (396 aa)
Score = 436, Expect = 4.5e-41, Identities = 120/345 (34%), Positives = 196/345 (56%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT-----------------NPDIILNALVGFSGLHITLLALKNNV-DLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKD 355
           +K+V VFG+TG IG  +++I+    +++E+V      +    L    R  +A +    V       +  ELL  T                 + D  + A+ G + LH  +  +K+ V  +ALANKES+V  G L+ +  + +   I PVDSEH++++  L ++   +  + +T SGGPF +    ++  +  +DA+ HP W MG+KIS+DSATM+NK  E+IEA+YLF  +   I V  H +S++H++  + + + I+ MSVPDM +     L   +S T   + L   +   LTF E DL+++  + + ++ L +   RA  I +NAANE A+  F   +I FLDI  II  A+  L   EVN + +
  S:     6 RKRVSVFGSTGCIGQKAVQILRDNPDDFEVVALVAKQD-AHLLASQARLLSANM--AVVAEDAAYETLRELLRGTCVEVGAGTAGVMDAASRDVDSAVMAITGIAALHPVIRLIKSGVKSIALANKESVVCGGELLINAAKQTGVNIVPVDSEHNAVFQILAHDGC-VARVTLTASGGPFLRWTREQMQAVTPSDALAHPVWKMGRKISVDSATMVNKALEVIEAHYLFSLDPDSIDVTVHPESVVHAVAAYPNGTSISLMSVPDMGIPTLHALYWPQSATVCGSTLDLASYGKLTFMEPDLERFPALGFGFEALRSSKPRAACIALNAANEVAVEAFLNFEIAFLDIPNIIMSAMDKLACCEVNSISE 370
>gi|68074259|ref|XP_679044.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, [Plasmodium berghei strain ANKA] >gi|56499689|emb|CAH98329.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative [Plasmodium berghei] (415 aa)
Score = 435, Expect = 5.0e-41, Identities = 131/335 (39%), Positives = 198/335 (59%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEIIEKEN-----YELVGFSFNNN----YEKALEII---------NRFPNALVFSPSVKTKNTV-----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDL-KRSSSSRIYPVDSEHSSLYDSLKNNN--------------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + K   V +FG+TG+IG ++L II + N     + +     N N    YE+A E +         N++        ++K  N +        +++      D I+  +  F GL+ T+ A+KNN  +ALANKES+V AG+ ++ L     +S I PVDSEH++++  L NN                +I ++ +  SGGPF     +EL N+    A+KHP WNMGKKISIDSATMMNK  E+IEA++LF+     I++  H + IIHS ++F D S I+ M  PDM++ I   L+     +  +  L+F  ++ LTF +  L  +  I  AY      N   P ++NA+NE A  LF  NKIK+ DI  II + +
  S:    22 KKKPINVAIFGSTGSIGTNTLSIIRECNKIEKQFNVEALYVNKNIEGIYEQAKEFLPKYVCIHDPNKYEELKKLLENIKNYNPIILIGNEGMKQICSSNEIDKIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDSEHNAIFQCLNNNILLKSKCLQENYSKINKINKIFLCSSGGPFQNLSIDELKNVTSEKALKHPKWNMGKKISIDSATMMNKGLEVIEAHFLFDIDYNDIEIIVHKECIIHSCVEFLDKSVISQMYYPDMRVQIIYALTWPNRISTNLKSLNFEEISPLTFYKPSLKHFPCIKLAYHAGRKSN-FFPTVLNASNEVANNLFLNNKIKYFDIPAIISQVL 396
>gi|81170457|sp|Q57T35|DXR_SALCH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (398 aa)
Score = 435, Expect = 5.1e-41, Identities = 120/354 (33%), Positives = 204/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL---LEKTNPDI--------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    +++ ++      N  +  E        L FSP     +  +S E+L   L++                         ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S++R+ PVDSEH++++ SL  + +            +  +++T SGGPF +    +L  +    A +HPNW+MG+K+S+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A +  PDM+  I   ++     T+    L F  L+ LTFS  D  ++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   ++D+L ++   R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPDSFRVIALVAGKNVARMAE------QCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKVSVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIARE 387
>gi|84686914|ref|ZP_01014798.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacterales bacterium HTCC2654] >gi|84665111|gb|EAQ11591.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacterales bacterium HTCC2654] (399 aa)
Score = 435, Expect = 5.2e-41, Identities = 114/334 (34%), Positives = 191/334 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKT-KNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL 345
           ++V +FGATG+IG S++++IE+  E +E+V  +   N    ++++ R   AL    +V   +  +    E L  T                   D +++A+VG +GL   L AL+    LALANKESLV AG LI    R   + + PVDSEHS+++ +L   +   ++ +IIT SGG F     ++L +    +A  HPNW+MG++I+IDSA+M NK  E+IE    F  +  +I+V  H QS+IH+++ F D + +A++  PDM+ +I   L+  E K   +  L    +  L F   +  ++  +  A + +E    A   + NAA E A+  F  +++ F+D+  ++E  +  L
  S:     3 RRVSIFGATGSIGCSTIDLIERDPEAFEVVALTGGRN----VDLLARQAKALGAEVAVTAHEECLADLREALSGTGIEVAAGEAALTDAARRPADWVMSAIVGAAGLPPGLAALEQGATLALANKESLVTAGPLILGTARDHGATVLPVDSEHSAVFQALVGEDMAAVERVIITASGGAFRDWPIDKLASATLEEASSHPNWDMGQRITIDSASMFNKALELIETREFFGVRPDQIEVIVHPQSLIHALVGFNDGALMAHVGPPDMRHAIGYALNWPERKPLPVERLDLARIGQLEFRAPEDARYPALRLAREVMEAGGMA-GAVFNAAKETALDGFIAHRLGFMDMAGVVEGVLTEL 355
>gi|62185056|ref|YP_219841.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila abortus S26/3] >gi|81170440|sp|Q5L651|DXR_CHLAB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|62148123|emb|CAH63880.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila abortus S26/3] (379 aa)
Score = 435, Expect = 5.5e-41, Identities = 121/353 (34%), Positives = 193/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFPNALV-------FSPSVKTKNTVNSF---EELLEKTNP---DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + +FG+TG++G  +L II      + +V   S+ N  +   E I  F  ++V       +    K    V +F   E LL        D I+ A  G   L   + A+++   LALANKE LV AG LI  L +   ++I P+DSEH++LY  L+  +  E+++L +T SGGP   K   EL  +   D +KHP WNMG KI++DS+T++NK  EIIEAY+LF  +  +I    H QS+IH M++F D + ++ M+ P M   IQ  L+  +        + F+    L F  ID +++  I  A   L+++  + P   NAANE  +  F + +I + DI + + + +     +    L D+ +++K  R
  S:     2 KHLAIFGSTGSVGQQALAIIRSLPHLFNVVALASYGNKRDLFFEQIREFSPSIVSVYDEQLYFEIRKEFPKVQAFLCEEGLLAAATANEIDTIVAASSGIVALPAIIAAMRSGKTLALANKEVLVSAGELINGLAQQYQTKILPIDSEHNALYQCLEGRDTSEVRKLFLTASGGPLLYKSKEELTRVTIQDVLKHPIWNMGAKITVDSSTLVNKGLEIIEAYWLFGLEHAEIDAVIHPQSLIHGMVEFEDGTVLSVMNPPSMLFPIQHVLTTPKRCPAPHKGMDFSIKQILEFFPIDEERFPSIALARQVLQDKGSSGP-FFNAANEILVQRFLKKEIAWCDILDKLTRLMKNHRVSSCTSLDDVFSVDKEAR 373
>gi|83858382|ref|ZP_00951904.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oceanicaulis alexandrii HTCC2633] >gi|83853205|gb|EAP91057.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Oceanicaulis alexandrii HTCC2633] (393 aa)
Score = 435, Expect = 5.5e-41, Identities = 121/365 (33%), Positives = 202/365 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE---NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT-----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-----TEVNDLKDILNLNKNTRKYVYDFSKNKFR 376
           +KV + GATG++G ++L++IE+     +E+V  + N   ++  ++  R         +V      ++ E  L+ T                 + D ++ A+VG +GL  TL A+K    +A ANKE+LV AG L     R + +R+ PVDSEH++++ +     ++ ++ +I+T SGGPF      ++   + A AV HP W+MG KIS+DSATMMNK  EIIEA +LF      + V  H +SIIH ++++ D   +A + +PDM+  I   L+  +     +  L    L+ LTF   D  ++  +  A    +   +  P I NAANE A+  F   +I FLDI   +  ++   E       E +D + +L++++  R+   D  K + R
  S:     4 RKVTILGATGSVGRATLDLIERAPEGAFEIVALTANTQADELAQLAIRTGARFC---AVAAPEAGSALEAALKGTAIRSGAGPDAICEAARLSADWVMAAIVGAAGLPPTLEAVKRGAAVAFANKEALVCAGDLFMHAARDAGARLLPVDSEHNAIFQAFDERQRDRVRRIILTASGGPFRSWTLEQMGQASPAQAVAHPTWSMGAKISVDSATMMNKGLEIIEACHLFGLPHSDVDVLVHPESIIHGLVEYADGGMLAQLGMPDMRTPIAHALAWPDRIETPVERLDLALLSQLTFEAPDPVRFPALGLARAAFD-AGKGAPAIFNAANEVAVAAFLNGQIGFLDIAACVSDSLDRGEKDGVAAVEPSDFETVLDVDRQGRRLATDAVKQRSR 393
>gi|82595928|ref|XP_726051.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Plasmodium yoelii yoelii str. 17XNL] >gi|23481296|gb|EAA17616.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Plasmodium yoelii yoelii] (493 aa)
Score = 434, Expect = 6.6e-41, Identities = 136/367 (37%), Positives = 216/367 (58%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEIIEKEN-----YELVGFSFNNN----YEKALEIINRFPNALVFSPS-----------VKTKNTV-----NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDL-KRSSSSRIYPVDSEHSSLYDSLKNNN--------------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND-----LKDILNLNKNTRKYVYDFSKNK 374
           +NK   V +FG+TG+IG ++L II + N     + +     N N    YE+A E + ++    +  PS           +K  N +        +++      D I+  +  F GL+ T+ A+KNN  +ALANKES+V AG+ ++ L     +S I PVDSEH++++  L NN                +I ++ +  SGGPF     +EL N++   A+KHP WNMGKKISIDSATMMNK  E+IEA++LF+     I++  H + I+HS ++F D S I+ M  PDM++ I   L+        +  L+F  ++ LTF +  L  +  I+ AY      N   P ++NA+NE    LF  NKIK+ DI  II + + +    ++++     +K IL ++  +++   D    K
  S:    79 QNKPINVGIFGSTGSIGTNTLSIIRECNKIEKKFNVEALYVNKNVEGIYEQAKEFLPKY--VCIHDPSKYEELKKLLENIKNYNPIILIGNEGMKQICSSNEIDKIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDSEHNAIFQCLNNNILLKSKCLQENYSKINQINKIFLCSSGGPFQNLSIDELKNVSSEKALKHPKWNMGKKISIDSATMMNKGLEVIEAHFLFDIDYNDIEIIVHKECIMHSCVEFLDKSVISQMYYPDMRVQIIYALTWPNRINTNLKSLNFEEISPLTFYKPSLKHFPCINLAYHAGRKSN-FFPTVLNASNEVVNNLFLNNKIKYFDIPAIISQVLESFNPQQISENPEDLMKQILEIHNWSKQKAVDIYNTK 490
>gi|58698667|ref|ZP_00373559.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534820|gb|EAL58927.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont of Drosophila ananassae] (387 aa)
Score = 434, Expect = 7.0e-41, Identities = 126/363 (34%), Positives = 212/363 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILN--------------ALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKT-NLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRKYVYDFSKNK 374
           KKV V G+TG++G  +++++   KE Y++   S ++N+   L    +  NA     ++  +      +E L  T+  I +               A+VG +GL   +  +++    +ALANKES+V  G L+    +  + +I P+DSEH++++  L+N++K ++++I+T SGGPF      +L NI    A+ HP WNMGKKIS+DSATMMNK  EIIEA+ LFN    KI+   H +SI+H ++ + D    A ++  DM + I   LS  E    N   DL+     LTF E D   +  +  + + L +   +   I++NAANE A+  F +++I FL+I E++E  + +  + T++N L DI+N++  +R   +   ++K
  S:     2 KKVSVLGSTGSVGKKTVDLLSKRKEEYQVEALSAHSNF-ALLAHQAKLLNAKYV--AISDERLYKDLKESLLGTDVKIAIGATNVAAIPVDLSVVAIVGIAGLGPVMEVIESGTKVIALANKESIVCGGKLLLKKAKEKNVQIIPIDSEHNAIFQILQNDDKCVEKIILTASGGPFLNYSLEQLRNIMVDQALSHPTWNMGKKISVDSATMMNKALEIIEAHNLFNISPDKIEAVVHPESIVHGIVTYKDGFNFAVLAETDMAIPISYALSWPERLVLNYKLDLTKQG-KLTFQEPDHKHFPVLKLSMEVLNSSTPQTNSIVLNAANEIAVNEFLKSRIGFLEIVEVVESTMESFGSYTDINSLSDIINIDCESRIIAHKIVESK 382
>gi|54026091|ref|YP_120333.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nocardia farcinica IFM 10152] >gi|59797497|sp|Q5YS72|DXR_NOCFA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|54017599|dbj|BAD58969.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nocardia farcinica IFM 10152] (394 aa)
Score = 434, Expect = 7.1e-41, Identities = 121/352 (34%), Positives = 188/352 (53%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN--------------------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALE--NTEVNDLKDILNLNKNTR 364
           +VL+ G+TG+IG  +LE+I    + +E+VG +             R  N  + +  +    T N                    +  EL+ +T  D++LNALVG  GL  TL  L     LALANKESLV  G L+   + ++  +I PVDSEHS+L   L+     E+  L++T SGGPF       L ++N   A  HP W+MG   +++SA+++NK  E+IE + LF     +I V  H QSI+HSM+ F D S +A  S PDMKL I   L   +          F+  +  TF  +D + +  +  A         ++  + NAANE A+  F + +I+F +I   + +A+ A +    E   ++D+L  ++  R
  S:    21 RVLLLGSTGSIGTQALEVIAANPDKFEVVGLA------------ARGGNPALLAEQMAATGTRNVAVADPAAGAALDIKLAGPHAVTELVRRTEADVVLNALVGSLGLEPTLATLTAGTRLALANKESLVAGGSLVT--RAAAPGQIVPVDSEHSALAQCLRGGRADEVDRLVLTASGGPFRGWTAQMLESVNPEAAKAHPTWSMGLMNTLNSASLVNKGLELIETHLLFGIPYDRIDVTVHPQSIVHSMVTFVDGSTLAQASPPDMKLPIALALGWPDRVPGAAAACDFSTASTWTFEPVDTEVFPAVELARQ-AGQAGGSVTAVYNAANEVAVQAFLDGRIRFPEIVRTVARAVEAADRWRAEPETVEDVLAADRWAR 385
>gi|16759210|ref|NP_454827.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29140760|ref|NP_804102.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|21263522|sp|Q8Z9A6|DXR_SALTI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|25323819|pir||AF0529 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.-) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501501|emb|CAD08678.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase; hypothetical protein in frr 3'region [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136384|gb|AAO67951.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (398 aa)
Score = 434, Expect = 7.1e-41, Identities = 121/354 (34%), Positives = 203/354 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL---LEKTNPDI--------------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    +++ ++      N  +  E        L FSP     +  +S E+L   L++                         ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S++R+ PVDSEH++++ SL  + +            +  +++T SGGPF +    +L  +    A +HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A +  PDM+  I   ++     T+    L F  L+ LTFS  D  ++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   + D+L ++   R+
  S:     2 KQLTILGSTGSIGCSTLDVVHHNPDSFRVIALVAGKNVARMAE------QCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLHEPASVDDVLQVDAIARE 387
>gi|16752697|ref|NP_444964.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila pneumoniae AR39] >gi|7189340|gb|AAF38259.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydophila pneumoniae AR39] (379 aa)
Score = 434, Expect = 7.3e-41, Identities = 120/353 (33%), Positives = 191/353 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGF-SFNNNYEKALEIINRFP-------NALVFSPSVKTKNTVNSF---EELLEKTNPDIILNALVGFSG---LHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQ--HGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFN-NLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + V G+TG+IG  +LEI+ +    ++++   S+ NN     + +  F        N  V++ + +    +  F   E L +    D +   +   SG   L   L ++K    LALANKE LV AG L+    + +  ++ P+DSEH++LY  L+    E IK+LI+T SGGP   K   EL  +   D + HP WNMG K+++DS+T++NK  EIIEAY+LF  +  ++    H QS+IH M++F D S I+ M+ PDM   IQ  L+  E   +  + + F+    L F  +D +++  I  A   LE Q  +     NAANE  +  F   +I + DI   +   +   +    + L+DIL ++   R
  S:     2 KHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQQLEEFAPLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSGIEALPAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEHNALYQCLEGRTIEGIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWNMGSKVTVDSSTLVNKGLEIIEAYWLFGLENXEILAVIHPQSLIHGMVEFLDGSVISIMNPPDMLFPIQYALTAPERFASPRDGMDFSKKQTLEFFPVDEERFPSIRLAQQVLEKQGSS-GSFFNAANEVLVRRFLCEEISWCDILRKLTTLMECHKVYACHSLEDILEVDGEAR 373
>gi|115524566|ref|YP_781477.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris BisA53] >gi|122296184|sp|Q07NI7|DXR_RHOP5 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|115518513|gb|ABJ06497.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris BisA53] (407 aa)
Score = 433, Expect = 8.8e-41, Identities = 120/344 (34%), Positives = 195/344 (56%)
  Q:     1 LLEGEKMENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNY----EKALEIINRFP-----------NALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA 344
           L  G+   +  ++V V GATG+IG S+++++    E Y++   + N+N     + A+E   RF             A +    ++      +  E   + + D ++ A+ G +GL   L A+     +ALANKE LV AG         + + I P DSEH++L+ +L + ++ E+ ++IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA++LF  +  +I+V  H QSIIH M++F+D S +A +  PDM++ I   L   +        L    +  LTF   D  ++  +  AYD L   + A   + NAANE A+  F + +I+F  I  ++E+ + A
  S:     6 LRNGKAAASGVRQVTVLGATGSIGDSTMDLLRATPERYQVEALTANSNVAGLAKLAIEFNARFAAVADASLLGDLRAALAGTGIECGAGEGAVIEAAARPS-DWVMAAVAGAAGLKPALAAVDRGATVALANKECLVCAGEFFMQRAADAQACILPADSEHNALFQALASGDRAELTKVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEAHWLFALSPDEIEVVVHPQSIIHGMVEFSDRSVVAQLGAPDMRIPIAHCLGWPDRIVGRAAALDLTKIGQLTFEAPDFARFPGLRLAYDALRAGHCAT-TVYNAANEIAVAAFVKEQIRFGAIARLVEETLNA 368
>gi|77957693|ref|ZP_00821742.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia bercovieri ATCC 43970] (408 aa)
Score = 432, Expect = 1.1e-40, Identities = 124/346 (35%), Positives = 205/346 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYEL-------VGFSFNNNYEKALEIINRFPNALVFSPSVK----------TKNTVNSFE----ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDIL 357
           K++ + G+TG+IG S+L ++ + N EL        G +     ++ LE   R+  A+    S K          ++  V + E    EL    + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  +SS +++ P+DSEH++++ SL             +   +  +I+T SGGP  +   ++  ++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++I+V  H QS+IHSM+++ D S +A M  PDM+  I   ++ Y  + N  +  L F  +  LTF+  D  ++  +  A D   N  +A    +NAANE +++ F +++I+F DI  I    + +L   E + + ++L
  S:     2 KQLTILGSTGSIGNSTLGVV-RANPELFKVTALVAGRNVEQMAQQCLEFAPRYA-AMSDELSAKALRLLLAEKGSRTEVYAGEKAACELAALDDVDQVMAAIVGVAGLSSTLAAIRAGKQVLLANKESLITCGKLFMDEVKSSKAQLLPIDSEHNAIFQSLPEKIQRQLGYSSLSENGVSSIILTGSGGPLRETPLSQFADVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVILHPQSVIHSMVRYHDGSVLAQMGTPDMRTPIAHAMA-YPMRVNSGVTALDFCKIRELTFATPDYQRYPCLKLAIDAC-NAGQAATTALNAANEVSVMAFLDSQIRFTDIAAINRVVVESLSLPEPSCVDEVL 379
>gi|27365213|ref|NP_760741.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio vulnificus CMCP6] >gi|31340052|sp|Q8DBF5|DXR_VIBVU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|27361360|gb|AAO10268.1|AE016803_55 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio vulnificus CMCP6] (402 aa)
Score = 431, Expect = 1.3e-40, Identities = 106/281 (37%), Positives = 170/281 (60%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------PNAL-------VFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-----------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKW 292
           +K+ + GATG+IG S+L++IE+  + + +V  + ++N EK  ++  R+            AL       V +P+ +      +   +      D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D    S +++ PVDSEH++++  L              ++ +  +++T SGGPF   +  EL  +    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN  +  +KV  H QS+IHSM+++ D S +A M  PDM   I   LS  E     +  L F  +  LTF + D +++
  S:     2 QKLTILGATGSIGASTLKVIEQNPDKFSVVALAADSNVEKMQQLCQRWQPEYAVMANKEAALRLKMALAVLAPNTQVLGGQEALCYVATLEQVDSVMAAIVGAAGLVPTMAAVKAGKRILLANKEALVMSGQLFIDEVEKSGAQLLPVDSEHNAIFQCLPQTVQGNLGRCDLASQGVSHILLTGSGGPFRYTDVAELEAVTPEQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNASRDQLKVIIHPQSVIHSMVQYLDGSVLAQMGEPDMATPIALTLSYPERVKAGVKPLDFTQVGELTFLQPDFERY 315
>gi|50842988|ref|YP_056215.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Propionibacterium acnes KPA171202] >gi|59797530|sp|Q6A7K8|DXR_PROAC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|50840590|gb|AAT83257.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Propionibacterium acnes KPA171202] (407 aa)
Score = 431, Expect = 1.4e-40, Identities = 120/327 (36%), Positives = 181/327 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNN--------------------YEKALEIINR------------FPNALVFS-PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNK--CFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEII 338
           KKV++ G+TG+IG  +LE+I   ++ +E+ G S   +                     E A E + R             PN  + + P   T+         L     D++ NA+ G +GL  TL  L     LALANKESLV+ G L+   + ++S +I PVDSEHS+    L+   + E++ L++T SGGPF  ++   L +++ A+A+KHP WNMG+ I+I+S+T++NK          Y  +   I V  H QSI+HSM++F D + IA  S PDM+L I  GLS  +   +      ++     TF  +D D +  +  A         A P + NAANE  +  F    I FLDI + I
  S:     2 KKVIILGSTGSIGTQTLEVISSRRDQFEVAGISAGGSDVGSLAQQIIDFSIPVVAVAREDAAEELQRALAVQAGSRGRIVPNPRILTGPDASTE---------LAAMPADVVCNAITGAAGLRPTLATLAAGTTLALANKESLVIGGRLVT--QAAASGQIVPVDSEHSAFAQCLRGGGRNEVRRLVLTASGGPFRGRDRASLADVSAAEAMKHPTWNMGRVITINSSTLVNKGLELLEAALLYDVDLDDITVVVHPQSIVHSMVEFWDGATIAQASPPDMRLPIALGLSWPDRLPDAAAGCDWSTATQWTFEPLDNDTFGAVELARRAGHAAGTA-PAVFNAANESCVDAFCAGSIGFLDITDTI 355
>gi|37680735|ref|NP_935344.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio vulnificus YJ016] >gi|39930818|sp|Q7MIG6|DXR_VIBVY 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|37199484|dbj|BAC95315.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio vulnificus YJ016] (402 aa)
Score = 431, Expect = 1.4e-40, Identities = 104/281 (37%), Positives = 168/281 (59%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNAL-----------------VFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-----------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKW 292
           +K+ + GATG+IG S+L++IE+  + + +V  + ++N EK  ++  R+                     V +P+ +      +   +      D ++ A+VG +GL  T+ A+K    + LANKE+LV++G L  D    S +++ PVDSEH++++  L              ++ +  +++T SGGPF   +  EL  +    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN  +  +KV  H QS+IHSM+++ D S +A M  PDM   I   LS  E     +  L F  +  LTF + D +++
  S:     2 QKLTILGATGSIGASTLKVIEQNPDKFSVVALAADSNVEKMQQLCQRWQPEFAVMANKEAALRLKMALAVLAPNTQVLGGQEALCYVATLEQVDSVMAAIVGAAGLVPTMAAVKAGKRILLANKEALVMSGQLFIDEVEKSGAQLLPVDSEHNAIFQCLPQAVQGNLGRCDLASQGVSHILLTGSGGPFRYTDVAELEAVTPEQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFNANRDQLKVIIHPQSVIHSMVQYLDGSVLAQMGEPDMATPIALTLSYPERVKAGVKPLDFTQVGELTFLQPDFERY 315
>gi|54310078|ref|YP_131098.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Photobacterium profundum SS9] >gi|59797563|sp|Q6LN30|DXR_PHOPR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|46914517|emb|CAG21296.1| putative 1-deoxy-D-xylulose 5-phosphatereductoisomerase [Photobacterium profundum SS9] (397 aa)
Score = 430, Expect = 1.9e-40, Identities = 122/353 (34%), Positives = 202/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL---LEK--------------------TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +K+ + GATG+IG S+L +  +  + +E+V  +   N +K LE+        ++ P      ++ + +EL   LEK                       D ++ A+VG +GL  T+  +K    + LANKE+LV++G +  D      + + PVDSEH++++  L  + +            I ++++T SGGPF   +  EL ++    A+ HPNW+MG KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A M +PDM+  I   +S  +     +  L F+ +   TF   D  ++  +  A D   +  +A    +NAANE A+  F  N I F DI  I E+ + +     + DL+ ++ L+   R
  S:     2 RKLTILGATGSIGSSTLAVAAQNPQLFEVVALAAGTNSQKMLELCR------IWKPKYAAMASLQAAKELSVLLEKHEISTQVLAGDAGLCQVAALDEIDTVMAAIVGAAGLLPTMAGVKAGKRILLANKEALVMSGQMFIDACEQYGAELLPVDSEHNAIFQCLPADIQRAMGRCDLEEYGISKILLTGSGGPFRYTDIAELASVTPQMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFNASREQLQVIIHPQSVIHSMVQYKDGSVLAQMGLPDMQTPIACAMSYPDRVDAGVAPLDFSKIGEFTFLPPDYSRYPCLKLAIDACYD-GQAATTALNAANEIAVAAFLNNDIGFTDIAIINEQILNSANMATLVDLESVIELDMQAR 386
>gi|55980825|ref|YP_144122.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermus thermophilus HB8] >gi|81170461|sp|Q5SJZ6|DXR_THET8 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|55772238|dbj|BAD70679.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Thermus thermophilus HB8] (367 aa)
Score = 430, Expect = 1.9e-40, Identities = 120/342 (35%), Positives = 186/342 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL-------LEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDL 353
           K+V+V G+TG+IG  +LE+     YE+VG +   N E     I  +   LV +     K     F  L       +     ++ + A+ G +GL  T  A++    +ALANKE++V AG L+     +  + I PVDSEHS+L+ +L    +E + ELI+T SGGPF  +E  +L  +    A++HP W MG K+++DSAT+ NK  E++EA  LF    ++IKV  H Q+ +H +++F D S  A +   DM+L IQ  L+  E     + DL    + L F E DL ++  +  AY+       A  + ++AA+E A+  F + KI F  I EI+ +    LE T +  L
  S:     2 KRVVVLGSTGSIGQQALEVCRLRGYEVVGLAAGKNLEALSRQIALWKPRLVAAEESLHKELKARFPGLRLATAEEVAALEAEVAVAAIPGLAGLAPTRAAVRTGKRVALANKEAMVAAGPLLWREAEAHGAEILPVDSEHSALFQALLGERREDVAELILTASGGPFL-REPEDLAQVTPEMALRHPRWRMGPKVTVDSATLFNKGLEVLEAKELFRFPLERIKVLIHPQAYVHGLVRFVDGSLKAQLGPTDMRLFIQYALTYPERAETPLKDLPIPGV-LEFLEPDLKRFPALAVAYEAGRRGGLA-QVAVSAADEVAVEAFLQGKIPFPRIPEILAR---VLEATPIEPL 347
>gi|67156406|ref|ZP_00417999.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Azotobacter vinelandii AvOP] >gi|67086165|gb|EAM05635.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Azotobacter vinelandii AvOP] (395 aa)
Score = 430, Expect = 2.0e-40, Identities = 117/353 (33%), Positives = 200/353 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---------------VKTKNTVNS--FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +++ V GATG+IG S+L++I +  E Y     +     ++   +  RF       P                + T+    S    E+      D ++ A+VG +GL  TL A++    + LANKE+LV++G L     R S +++ P+DSEH++++  L            ++ +++T SGGPF +    EL+ +  A A  HPNW+MG+KIS+DSA+MMNK  E+IEA +LF+ +  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+  E   + +  L  F+   L F   D  ++  +  A +  E    A P ++NAANE A+  F + +++F +I  IIE  +       ++DL+ +L+++   R
  S:     4 QRITVLGATGSIGLSTLDVIARHPERYRAFALTGFTRLDELRALCLRFAPCYAVVPEAAAACRLEDELRAAGLDTRVLFGSEGLCEVAAHPEADAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMQAVRRSGAQLLPIDSEHNAIFQCLPAAYGNGLATVGVRRILLTASGGPFRETPAAELIEVTPAQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDARPAQVEVVVHPQSVIHSLVDYIDGSVLAQLGNPDMRTPIAHALAWPERIDSGVVPLDLFSIARLDFQAPDPARFPCLRLAREAAEVGGSA-PAMLNAANEVAVAAFLDGRVRFPEIASIIEDVLQGEPVVAIDDLETVLHVDIQAR 383
>gi|114327602|ref|YP_744759.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Granulibacter bethesdensis CGDNIH1] >gi|114315776|gb|ABI61836.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Granulibacter bethesdensis CGDNIH1] (405 aa)
Score = 429, Expect = 2.4e-40, Identities = 113/364 (31%), Positives = 191/364 (52%)
  Q:    10 KKKKVLVFGATGNIGFSSLEII-EKENYELVGFSFNNNYEKALEIINRFPNALV------FSPSVKTKNTVNSFEE--------LLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKN 373
           + + + + G+TG+IG  ++E++ ++  Y++       N     +        L       F P +K +   +                   D  + A+ G +GL  TL A+K+   +ALANKE+LV AG ++      + + + PVDSEH++++ +L + N   + ++++T SGGPF      E+       A+KHP W+MG KISIDSATMMNK  E+IEA  LF+    +I V  H QS++H ++ + D S +A +  PDM++ I   L+  E        L    ++ L F E D+ ++  +  A + L     A P I +AANE A+  F   +I FLDI E ++K +  L    V  L+ +  ++   R+     +++
  S:    21 RPRTITILGSTGSIGTQTIELLGDRSRYQVKALVGGKNAALLADQALALGAELAVIADPDFYPVLKERLADSGIASACGPDAVVAAAALEADWTMAAITGAAGLPPTLEAIKHGRSVALANKEALVCAGDVMLRAVEQAGATLLPVDSEHNAIFQALADGNITRLDKIVLTASGGPFRTASLEEMKAATPERALKHPVWSMGAKISIDSATMMNKGLEVIEAARLFSLTEDRISVLVHPQSVVHGLVYYQDGSVLAQLGSPDMRIPIAHTLAWPERVETQARRLDLAAVSRLDFEEPDVVRFPALRLAREVLRAGGGA-PAIYSAANEIAVDAFLNKRIGFLDIAETVDKTLQHLGAPAVETLETVFAVDAEARRVAASLTQS 402
>gi|119505672|ref|ZP_01627742.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine gamma proteobacterium HTCC2080] >gi|119458484|gb|EAW39589.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine gamma proteobacterium HTCC2080] (401 aa)
Score = 428, Expect = 3.0e-40, Identities = 117/353 (33%), Positives = 204/353 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---VKTKNTVNSFEELLEKTNP-------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K+V+V GATG+IG S+L+++ +  + + L   +   + +K LE++      L + P    +   +       LL   +P                   D+++ A+VGF+GL  TL A ++   L LANKE+LV AG +  +  R+  + + P+DSEH++++  +  N++       ++++++T SGGPF  +  ++L+ +    A  HPNW+MG+KIS+DSAT++NK  E+ EA +LF+     I V  H QSIIHS++++ D S +A +  PDM+  I  GLS  E     ++ L   ++  L F   DLD +  +  A + +         ++NAANE A+  F + ++ F  I  +I  A+  + + E  +L  +  L+   R
  S:     7 KQVVVLGATGSIGLSTLDVLNRHADRFTLHTITAYRSVKKMLELV------LAYEPVQAVMACPDAAEQLASLLPAQSPTRVLGGEQALVDVASASEVDVVMAAIVGFAGLRPTLAAAEHGKRLLLANKEALVSAGSVFMEATRAGGATLLPIDSEHNAMFQCIPANSQGRPQSAGVEKILLTASGGPFRGRSRSQLVAVTPEQACAHPNWSMGRKISVDSATLLNKGLELAEACWLFDCTPDDIDVVVHPQSIIHSLVRYHDGSVLAQLGNPDMRTPIAYGLSWPERIDAGVSPLDLVSVAKLDFEAPDLDAFPCLRLAQEAITQPGGM--CVLNAANEVAVAAFLDGQLGFTGIDNVIAHALEEVSSREPENLAAVEALDSRAR 384
>gi|87199396|ref|YP_496653.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Novosphingobium aromaticivorans DSM 12444] >gi|87135077|gb|ABD25819.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Novosphingobium aromaticivorans DSM 12444] (385 aa)
Score = 428, Expect = 3.4e-40, Identities = 110/331 (33%), Positives = 182/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPN--ALVFSPSVKTKNTVNSFEELLEKT------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + V GATG+IG S+L++I  E++ + +V  + N N  +   +   F    A+V   S             +E                ++ + A+VG +GL  T+ A++    +ALANKE+LV AG ++        + + PVDSEH++++  L+ N+   ++ + +T SGGPF      +L     A+AV+HPNW+MG KIS+DSATMMNK  E IEA++LF    +++++  H QSI+HSM+++ D S +A +   DM++ I   L+         + L    +  LTF   D  ++     A + +     A P ++NAANE A+  F   +I F  I +  E  +
  S:     3 RTISVLGATGSIGASTLDLIRRERDKWRVVALTANGNARELAALAREFGAEVAVVADESALAALRDALAGSGIEAAAGPGALIDAAALGAEVTVAAIVGCAGLAPTMAAIERGGIIALANKEALVSAGDVMMAAVERHGATLLPVDSEHNAIFQCLQGNDIAHVRAITLTASGGPFRDWTTEQLQRATPAEAVRHPNWSMGAKISVDSATMMNKGLEFIEAFHLFPVGVERLRIIVHPQSIVHSMVEYRDGSTLAQLGPSDMRVPIASALAWPARMDTPCDPLDLATIGQLTFRAPDEQRFPATRLAREAV-IAGGAAPAVLNAANEMAVAAFLGGQIGFTRIVQCCEDVL 352
>gi|62424987|ref|ZP_00380126.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Brevibacterium linens BL2] (417 aa)
Score = 428, Expect = 3.7e-40, Identities = 124/356 (34%), Positives = 219/356 (61%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYE----KALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-------TNP-------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL-SGYESKTNLINDLSFNNLNLTFSEIDLDKW-KPIHWAYDFLEN--------------QNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K++++V G+TG++G  +L+++ +  E +E++G +     +    +ALE     P   + SP    +   +   + LE+       ++P                   D++LNA+ G +GL  TL AL+   D+ALANKESL++ G ++ D    +++ + PVDSEHS++  +L++  + E+ +L+IT SGGPF     + L ++  A A+KHP W+MG  I+I+SAT++NK  E+IEA+ LF+     I+V  H QS IHSM++F+D S IA +S PDM+L I   L +  + +T  ++  +  N            W +P+HW+++ + +              + ++ P + NAANE  +  F   +I F  I + IE+A+ A E    + ++ +L  +   R++
  S:     3 KRRIIVVGSTGSVGTQALDVLAENAEGFEVIGLAAGTQLDALVAQALEF--SVPVIGLTSPP---EGGPDEIRQRLEQAAGQRGVSDPVREIHVGPDAAEVVAGAAADMVLNAVTGAAGLGATLAALERGTDVALANKESLIIGGSIVLDAAARNNAALIPVDSEHSAIAQALRSGTHGEVSKLVITASGGPFRGMTRDALRSVTPAQALKHPTWSMGSMITINSATLVNKGLEVIEAHLLFDIDFDHIEVVVHPQSQIHSMVEFSDASTIAQISPPDMRLPIAYALGTQTDGQTQRLSSGAVAN-----------NWGQPMHWSFEPVNHLAFPALGLAVEAGRKRKSFPAVFNAANEVLVEAFVGGQIPFTGIDKGIERALRAHEPAAEHTVETVLAADAWAREF 393
>gi|124267162|ref|YP_001021166.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylibium petroleiphilum PM1] >gi|124259937|gb|ABM94931.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Methylibium petroleiphilum PM1] (392 aa)
Score = 428, Expect = 3.8e-40, Identities = 107/287 (37%), Positives = 166/287 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVN-----SFEELLE----------KTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN----KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWK--PIHWA 298
           ++V + GATG+IG S+L++I +  + YEL   S ++  ++      +F       P      T+      S  E+L               D ++ A+VG +GL   L A +    L LANKE+LVV G L     +   + + P+DSEHS+++  L  +     + I  +++T SGGPF  ++   L N+   +A  HPNW MG+KIS+DSATMMNK  E+IEA +LF+ +  +++V  H QSIIHSM+   D+S +A +  PDM++ I  GL+  E   +    L F  L  L+F   D  ++   P+ WA
  S:     4 QRVCLLGATGSIGVSTLDVIARHPDRYELFALSAHSRIDELAAQCLQFRPRYAVLPDAAAAQTLRERLAGSGVEVLSGAAALAEVAAHAEVDTVMAAIVGAAGLAPCLAAARAGKRLLLANKEALVVGGALFMAAVKEGGATLLPIDSEHSAIFQCLPEDRSTWARRIDHIVLTASGGPFRSRDPASLSNVTPDEACAHPNWVMGRKISVDSATMMNKALEVIEARWLFDLQPEQVRVVLHPQSIIHSMVVCRDHSVLAQLGTPDMRVPIAYGLAWPERIESGAEQLDFMRLGTLSFEPADERRYPGLPLAWA 316
>gi|94496936|ref|ZP_01303510.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sphingomonas sp. SKA58] >gi|94423612|gb|EAT08639.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sphingomonas sp. SKA58] (385 aa)
Score = 427, Expect = 3.9e-40, Identities = 123/355 (34%), Positives = 198/355 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYE----------KALEIINR------FPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKY 366
           K V +FGATG++G S+++++ +E   Y +V  + +++ +            + +I +        +AL  S            +    +   D  + A+VG +GL  T+ ALK+   +ALANKESLV AG L+    R S + + PVDSEH++++  L   + +++  +I+T SGGPF  +   +++ I  A AV HPNW+MG KIS+DSATMMNK  E+IEA +LF     +I++  H QS+IHSM+++ D S +A +  PDM++ I   L+     +     L    +  L F   D D++  +         +  A P I+NAANE A+  F   +I FLDI  I+E  +        N + D+L  +   R +
  S:     2 KSVSIFGATGSVGLSTIDLVRREPDAYRVVALTAHSDIDGLATQAKATGAQIAVIAQDGLYGALKDALAGSGIEAAAGQAALVDA--AQAGADWTMAAIVGCAGLEPTMSALKSGGTVALANKESLVSAGGLMMAAARESGATLLPVDSEHNAIFQCLAGGSIEDVSRIILTASGGPFRTRSRADMVGITPAQAVAHPNWSMGAKISVDSATMMNKGLELIEADHLFPVGLDRIEILVHPQSVIHSMVEYHDCSTLAQLGSPDMRIPIAHALAWPARISTPCQKLDLATIGRLDFEAPDPDRFPALR-LARAAAAEGGATPAILNAANEVAVAAFLAGRIGFLDIAMIVEDVLDRYSAGRPNTIGDVLAADAQARLF 375
>gi|119477108|ref|ZP_01617344.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine gamma proteobacterium HTCC2143] >gi|119449471|gb|EAW30709.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine gamma proteobacterium HTCC2143] (403 aa)
Score = 427, Expect = 4.3e-40, Identities = 118/347 (34%), Positives = 191/347 (55%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKN-------------TVNSFEELLEKTNPD----IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN----------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDL 353
           M    + + V G+TG+IG S+L+++ +  + Y     + N + +  +  I R  P   V       +               V S E+ L +   D     ++ A+VG +GL  T+ A+     + LANKESLV+AG L  +   +S + + P+DSEH++++ S+             ++ ++ +++T SGGPF +    +L  +    A  HPNW+MG+KIS+DSATMMNK  E+IEA +LFNT   +I +  H QSIIHSM+++TD S +A +  PDM+  I   L+  +   + +  L       L F   D  ++  +  A +       A+  ++NAANE A+  F    I+F DI   IE  + A    E + L
  S:     1 MSQSPQNITVLGSTGSIGVSTLDVLARHPDKYRAYALTANTSVDLIVPQIQRHSPRFAVMRDERSAQQLEDRLFALGHKETAVLSGEKGLLRVASDEAVSAVMAAIVGAAGLSPTMAAVTAGKKVLLANKESLVMAGHLFMEAVETSGATLLPIDSEHNAIFQSMPARYQSGKSTGLASEGVRRILLTGSGGPFRELPLAQLPLVTPDQACAHPNWDMGRKISVDSATMMNKGLELIEACWLFNTTADRIDIVIHPQSIIHSMVEYTDGSVLAQLGNPDMRTPIAHALAFPDRIDSGVGSLDIIATARLDFEAPDYQRFPCLRLATEAAAVGGTAMA-VLNAANEVAVDAFLAGSIRFTDIPLTIEHVLAAKTIVEPDTL 379
>gi|77977744|ref|ZP_00833185.1| COG0743: 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Yersinia intermedia ATCC 29909] (398 aa)
Score = 427, Expect = 4.4e-40, Identities = 118/353 (33%), Positives = 205/353 (58%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSP---SVKTKNTVNSFEELL------------EKT--------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K++ + G+TG+IG S+L ++    E + +       N E+  +        L FSP   ++  +++  +  +LL            EK         + D ++ A+VG +GL  TL A++    + LANKESL+  G L  D  + + +++ P+DSEH++++ SL             +   +  +I+T SGGP  +   ++  ++    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A M  PDM+  I   ++ Y  + N  +  L F  +  LTF+  D  ++  +  A D   N  +A    +NAANE +++ F +++I+F DI  +    +  L   E   + ++L +++  R
  S:     2 KQLTILGSTGSIGNSTLGVVRANPELFNVTALVAGRNVEQMAK------QCLEFSPRYAAMSDESSAKALRQLLAEYGSKTEVFHGEKAAGELAALDDVDQVMAAIVGVAGLSSTLAAIRAGKQVLLANKESLITCGKLFMDEVKHNHAQLLPIDSEHNAIFQSLPEKIQRKLGYSSLSENGVSRIILTGSGGPLREMPLSQFADVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQVEVILHPQSVIHSMVRYHDGSVLAQMGTPDMRTPIAHAMA-YPMRVNSGVAPLDFCQIRELTFAAPDYQRYPCLKLAID-ASNAGQAATTALNAANEISVMAFLDSRIRFTDIAVVNRMVVEHLSLAEPASVDEVLVIDRKAR 386
>gi|82780240|gb|ABB90400.1| dxrB [Streptomyces rubellomurinus] (417 aa)
Score = 427, Expect = 4.4e-40, Identities = 95/257 (36%), Positives = 153/257 (59%)
  Q:    86 DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           D +LN + G  GL  TL ALK+   L LANKESL+V G L++  K ++  +I PVDSEHS+L+  L+    +++++L++T SGGPF+ +   E+  +    A+ HP WNMG  I+I+ A ++NK  E+IEA+ LF+    +I+V  H Q ++HSM++FTD S +A +S PD++L +  GL   +   +      +   +   F  +D D +  +  AY+  E     +P + NAANEE +  F   ++ FL I + + K +
  S:   125 DSVLNGITGSVGLEPTLAALKSGSRLILANKESLIVGGPLVK--KVAAPGQILPVDSEHSALFQCLQGGKEQDVRKLVVTASGGPFHGRGRAEMAAVTPEQALAHPVWNMGPVITINCANLVNKGLEVIEAHLLFDIPFSRIEVVVHPQVMVHSMVEFTDGSTLAQVSPPDIRLPLSLGLGWPDRVPDAAPSCDWTKASTWEFFPVDGDAFPGVQLAYEVGE-AGGTVPAVFNAANEELVAAFVAGRLPFLGIVDTLGKIV 382
>gi|46198812|ref|YP_004479.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermus thermophilus HB27] >gi|59797584|sp|Q72KE2|DXR_THET2 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|46196435|gb|AAS80852.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Thermus thermophilus HB27] (367 aa)
Score = 426, Expect = 5.2e-40, Identities = 116/333 (34%), Positives = 183/333 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL-------LEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA 344
           K+V+V G+TG+IG  +LE+     YE+VG +   N E     I  +   LV +     K     F  L       +     ++ + A+ G +GL  T  A++    +ALANKE++V AG L+     +  + I PVDSEHS+L+ +L    +E + ELI+T SGGPF  +E  +L  +    A++HP W MG K+++DSAT+ NK  E++EA  LF    ++I+V  H Q+ +H +++F D S  A +   DM+L IQ  L+  E     + DL    + L F E DL ++  +  AY+       A  + ++AA+E A+  F + KI F  I EI+ + + A
  S:     2 KRVVVLGSTGSIGQQALEVCRLRGYEVVGLAAGKNLEALSRQIALWKPRLVAAEESLHKELKARFPGLRLATAEEVAALEAEVAVAAIPGLAGLAPTRAAVRTGKRVALANKEAMVAAGPLLWREAEAHGAEILPVDSEHSALFQALLGERREDVAELILTASGGPFL-REPEDLAQVTPEMALRHPRWRMGPKVTVDSATLFNKGLEVLEAKELFRFPLERIQVLIHPQAYVHGLVRFVDGSLKAQLGPTDMRLFIQYALTYPERAETPLKDLPIPGV-LEFLEPDLKRFPALAVAYEAGRRGGLA-QVAVSAADEVAVEAFLQGKIPFPRIPEILARVLEA 341
>gi|27379966|ref|NP_771495.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bradyrhizobium japonicum USDA 110] >gi|32171380|sp|Q89KP9|DXR_BRAJA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|27353119|dbj|BAC50120.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bradyrhizobium japonicum USDA 110] (407 aa)
Score = 426, Expect = 5.3e-40, Identities = 118/331 (35%), Positives = 180/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + V V GATG+IG S+++++    E Y +   + N N E   ++   F    V   ++   +     +  L  T+                  D ++ A+ G +GL   L A+     +ALANKE LV AG         + + I P DSEH++L+ +L + N+ E+  +IIT SGGPF   +  ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA YLF  +  +I V  H QSIIH M++F+D S +A +  PDM+  I   L   +        L    +  LTF   D +++  +  AYD L    +    + NAANE A+  F   KI+F  I  ++E  +
  S:    17 RSVTVLGATGSIGDSTMDLLRASPERYRVEALTANGNVEALAKLAKEFSARFV---AIADTSKFAELKAALAGTSTECGAGESAVIEAGARPADWVMAAVSGAAGLKPALAAVDRGAHVALANKECLVCAGDFFMQRAAKAGACILPADSEHNALFQALGSGNRDELVRVIITASGGPFRTWKPADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYLFALSPDEIDVLVHPQSIIHGMVEFSDRSVVAQLGSPDMRTPIAHCLGWPDRIKGPAAKLDLAKIGQLTFEAPDFERFPGLRLAYDSLRT-GKGATTVYNAANEVAVAAFIAGKIRFGAIARLVEATL 366
>gi|110679820|ref|YP_682827.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseobacter denitrificans OCh 114] >gi|109455936|gb|ABG32141.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseobacter denitrificans OCh 114] (390 aa)
Score = 426, Expect = 6.3e-40, Identities = 110/331 (33%), Positives = 186/331 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFP--------NALVFSPSVKTKNTVNSFEELLEKTN------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + V +FGATG+IG +++++I +  + Y++V  +   N ++      R          +AL+         +        +  N       D +++A+VG +GL   L AL+    LALANKESLV AG L+ D  R++ +R+ PVDSEHS+++ +L   +   ++ +IIT SGG F      +L     A+A  HPNW+MG++I+IDSA+M NK  E+IE   Y+     +I+   H +S+IH+M+ F D + +A++   DM+ +I   L   + KT  +  L   ++  LTF      +W  +  A + +E    A   I NA+ E A+  F + +++F D+  I+E  +
  S:     2 RSVSIFGATGSIGQNTIDLIARDPQAYDVVALTGAGNIKQLAHDARRLKADIAVTAHDALLPELRAALDGSGVVAAAGAQALNDAACRPADWVMSAIVGAAGLAPGLRALEQGATLALANKESLVCAGALMLDTARANKARLLPVDSEHSAVFQALTGEDIASVERIIITASGGAFRDWPIEKLAGATLAEASSHPNWDMGQRITIDSASMFNKAMELIETKEYFGVEPSRIEALVHPESLIHAMVGFRDGALMAHVGPHDMRHAIGYALHWPDRKTLPVERLDLASIAQLTFRAPCEQRWPALRLAREVMETGGMA-GAIFNASKEIALDGFIDGQLRFTDMAGIVEDVL 351
>gi|114321008|ref|YP_742691.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alkalilimnicola ehrlichei MLHE-1] >gi|114227402|gb|ABI57201.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alkalilimnicola ehrlichei MLHE-1] (401 aa)
Score = 425, Expect = 7.1e-40, Identities = 113/327 (34%), Positives = 181/327 (55%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF---------PNALVFS--------PSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + GATG+IG S+L+++ +  + + +   + + +      +  RF         P+A V          P V+         E       D ++ A+VG +GL  TL A ++   + LANKE LV+AG L     R+  + + PVDSEH++++  L         ++  I+ LI+T SGGPF  +    L  +   +A  HPNW+MG+KIS+DSATMMNK  E+IEA  LF+ +  ++ V  H QSI+HS++++ D S +A +  PDM++ I   L   E   +    L    L  L F   D  ++  +  AYD LE    A   ++NAANE A+  F   +I +  I  ++ + +
  S:    12 ILGATGSIGTSTLDVVARHPDRFRVRALAAHRDVAGMAGLCRRFRPELAVMADPDAAVALRRQLGDDLPGVRVAGGEAGLIEAATWPGVDCVVAAIVGAAGLMPTLAAARDGRRILLANKEVLVMAGELFMAEARAHGAVVLPVDSEHNAIFQCLPEAYPARDLDSLGIRRLILTASGGPFRARAPETLAQVTPDEACAHPNWSMGRKISVDSATMMNKGLELIEACRLFSAEPGRVDVVIHPQSIVHSLVEYRDGSLLAQLGQPDMRIPIAHALGWPERLVSGAESLDLAALARLDFEAPDPRRFPCLQLAYDALEAGGHACA-VLNAANEVAVEAFLHGEIGYTRIAVVVAEVL 366
>gi|83955549|ref|ZP_00964180.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sulfitobacter sp. NAS-14.1] >gi|83840193|gb|EAP79368.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sulfitobacter sp. NAS-14.1] (390 aa)
Score = 425, Expect = 8.5e-40, Identities = 112/334 (33%), Positives = 190/334 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL 345
           KKV +FGATG+IG +++++I +  + Y++V  +  +N  +  E   R    L  +     ++ ++   + L  T                   D +++A++G +GL   + ALK    LALANKESLV AG L+ D   +  + + PVDSEHS+++ +L   +   ++ +IIT SGG F      +L +     A  HPNW+MG++I+IDSA+M NK  E+IE   Y+  +  +I+V  H QS+IH+++ F D + +A++  PDM+ +I   L  +  +T+L +  L    + +  F   D  +W  +  A + +     A   + NAA E A+  F   K++F  + EI+E  + AL
  S:     2 KKVSIFGATGSIGQNTIDLISRAPDAYDVVALTGASNIAQLAEDAQRLNAQLAVTAH---EHLLDDLRDALSGTGVEAAAGPQAINEAAARPADWVMSAIIGAAGLAPGVEALKQGATLALANKESLVCAGQLMLDTAAAHGATMLPVDSEHSAVFQALIGEDISAVERIIITASGGAFRDWPLEKLADATLEQASSHPNWDMGQRITIDSASMFNKAMEVIETREYFRVDPDQIEVLVHPQSMIHALVGFNDGALMAHIGPPDMRHAIGFALH-HPDRTHLPVERLDLAKIGSFDFRAPDDIRWPALRLAREVMARGGMA-GAVFNAAKEVALDGFIGGKLRFPQMAEIVEDTMEAL 354
>gi|85059917|ref|YP_455619.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sodalis glossinidius str. 'morsitans'] >gi|123518939|sp|Q2NRL1|DXR_SODGM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|84780437|dbj|BAE75214.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sodalis glossinidius str. 'morsitans'] (398 aa)
Score = 424, Expect = 9.7e-40, Identities = 122/354 (34%), Positives = 200/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNY----EKAL-----------EIINRFPNALVFSPSVKTK--NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + G+TG+IG S+L +++   + Y +      NN     E+ L           +   R   A + +  V T   + V +  EL      D ++ A+VG +GL  TL AL+    + +ANKESLV  G L  +  R   +R+ PVDSEH++++ SL    +            +  +++T SGGPF +     L  +    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++++V  H QSIIHSM+++TD S +A +  PDM+  I   ++  E   + +  L F  L  L+F++ D  ++  +  A D    Q +A    +NAANE A+  F    I+F DI  +  + +  +   E + ++++L ++   R+
  S:     2 RHLTILGSTGSIGNSTLAVVKHNPDQYTVRALVAGNNVALMTEQCLAFRPAYACMADDTAARTLKANLAAAGVATAVLSGVQAACELATLDEVDTVMAAIVGAAGLAATLAALRAGKRVLMANKESLVTCGRLFMNEARRHHARLLPVDSEHNAIFQSLPEPLQRGLGYASLAKHGVSRIVLTGSGGPFRQTPLAALATMTPEQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNAAAEQMEVLLHPQSIIHSMVRYTDGSVLAQLGSPDMRTPIAHAMAYPERVPSGVAPLDFLRLGTLSFAQPDTARYPCLQLAVD-ASQQGQAATTTLNAANEIAVAAFLHGDIRFTDIAAVNRRVLEQISLPEPDSVEEVLAIDSQARE 387
>gi|32266023|ref|NP_860055.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Helicobacter hepaticus ATCC 51449] >gi|81170449|sp|Q7VIT0|DXR_HELHP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|32262072|gb|AAP77121.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Helicobacter hepaticus ATCC 51449] (369 aa)
Score = 423, Expect = 1.2e-39, Identities = 115/325 (35%), Positives = 177/325 (54%)
  Q:    14 VLVFGATGNIGFSSLEIIEKENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNS----------FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYE-SKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEII 338
           +++ G+TG+IG ++LE+    +  +       N     + I  + P  +  +        +N             E++E ++  ++LNALVGF+GL  +  AL+ N  LALANKESLV AGWL+++      + I P+DSEH  L+     NN+ I +L IT SGG F     +++      +A+KHPNW MG KI+IDSA+M NK FEI+EA +LF+ + I  +    S +H++I+F D S   ++S PDMKL I   L   + ++   I  L   +L L    ID  ++   +     L    +   I++NA+NE AI  F   KI F  I  +I
  S:     1 MILLGSTGSIGTNALEVASHFDIPIESLCAGKNITLLNQQIAHYAPKNVCIADKNDAHKLINGNYKLFFGSEGILEMIESSHSHLLLNALVGFAGLKPSFKALQCNKKLALANKESLVNAGWLLQN------ADITPIDSEHFGLW--YLQNNRPITKLYITASGGAFRDYPLDKIALATPQEALKHPNWQMGYKITIDSASMANKLFEILEARWLFDIESIDAFIEPSSSMHALIEFADGSITTHISTPDMKLPIAYALDKDKAAQMPFIQPLDIQSLCLALKNIDTLRYPLWNLKDTLLHTPQKG--IVLNASNEIAIEAFLAQKIPFGHISALI 327
>gi|84498649|ref|ZP_00997406.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Janibacter sp. HTCC2649] >gi|84381046|gb|EAP96932.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Janibacter sp. HTCC2649] (396 aa)
Score = 423, Expect = 1.3e-39, Identities = 119/333 (35%), Positives = 188/333 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYE----KALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT--NPDII-----------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIA 344
           + V + G+TG+IG  +L++I +  E + +V  S  +N +    +A++    F      +P    +  + ++   L KT   P+I+                 LN + G  GL  TL ALK    LALANKESL++ G L+    R    +I PVDSEHS++  SL+     E++ L++T SGGPF  +   EL ++    A+ HPN++MG+ I+ +SAT++NK  E+IEA+ LF+    +I V  H Q  IHSM++F D S IA +  P M + I  GLS  E   ++     +    +  F+ +D   +  +  A    E      P + NAANE A+  F E +I F+DI + +E+ + A
  S:     4 RTVALLGSTGSIGTQALDVIGRNPERFTVVAISAGSNIDLIARQAVDFDVPFVAVASGAPE-DVRTAIRAYAVELGKTAYAPEIVVGDQAAEAAAAVGADVVLNGITGSIGLRPTLAALKAGSTLALANKESLIIGGDLVRRAAR--PDQIVPVDSEHSAIAQSLRGGRADEVRRLVVTASGGPFRGRTRAELKDVTPEQALAHPNFSMGRVITTNSATLVNKGLEVIEAHLLFDIPYDRIDVVVHPQQQIHSMVEFRDGSTIAQLGPPRMLVPIALGLSWPERLDDIDEPCDWTKAQSWEFAPLDDAAFPAVRLARRVGE-AGGTFPAVYNAANEVAVDAFHEGRIGFVDIVDSVERVVDA 361
>gi|159036941|ref|YP_001536194.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salinispora arenicola CNS-205] >gi|157915776|gb|ABV97203.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salinispora arenicola CNS-205] (403 aa)
Score = 422, Expect = 1.6e-39, Identities = 108/272 (39%), Positives = 159/272 (58%)
  Q:    86 DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSR---IYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAII-ALENTEVNDLKDIL 357
           D++LN +VG  GL  TL AL+    LALANKESLV  G L+    R++ +R   I PVDSEH++L   L++  + E++ LI+T SGGPF     +EL ++    A+ HP W+MG  I+I+SATM+NK  E+IEA+ LF      I V  H QS+IHSM++F D S IA  S PDM+L I   L   +   +    + +   +   F+ +D   +  +  A    E   R+ P I NAANEE +  F   ++ FL I + +E+ +  A +  E   ++D+L
  S:   108 DVVLNGVVGSLGLAPTLAALRAGRTLALANKESLVAGGPLV----RAAMTRPEQIVPVDSEHTALAQCLRSGCRPEVRRLIVTASGGPFRGWRRDELTHVTPEQALAHPTWDMGPVITINSATMVNKALEVIEAHELFGVPYADIAVTVHPQSVIHSMVEFVDGSTIAQASPPDMRLPIAVALGWPDRVPDAAPAVDWTTSHTWQFAPLDDAAFPAVALAKAAGE-AGRSRPAIYNAANEECVAAFVAGRLPFLGIVDTLEQVLADAPDFGEPGTVEDVL 382
>gi|157283970|ref|YP_001468238.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Kineococcus radiotolerans SRS30216] >gi|151363112|gb|ABS06114.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Kineococcus radiotolerans SRS30216] (415 aa)
Score = 422, Expect = 1.8e-39, Identities = 99/283 (34%), Positives = 163/283 (57%)
  Q:    88 ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           +LNA+ G  GL  T+  L+    LALANKESL+V G  + +   ++  +I PVDSEHS++  +L++  + E+ +L+IT +GGPF  +   +L +++ A A+ HP W+MG+ I+I+S+T++NK  E+IEA++LF  +  +I V  H QS IHSM++F D S IA +S PDM+L+I  GL   E          +          +D + +  +  AY        A P + NAANE  +  F + ++ +L I + + + +  L +  V +L D+L  +   R+   +F
  S:   129 VLNAVDGALGLASTMGVLRAGSVLALANKESLIVGGRFVTE--AAAPGQIVPVDSEHSAIAQALRSGTRAEVAQLVITATGGPFRGRTRAQLADVSVAQAMAHPTWSMGQVITINSSTLINKGLEVIEAHHLFALDFDQIAVVGHPQSRIHSMVEFVDGSTIAQVSPPDMRLAISLGLGWPERVPAAAQTFDWTQPETWDLFPLDHETFPAVQLAYQVGRAGGSA-PAVYNAANEVCVRAFIDRRLPWLGIVDTVARVVADLGDPAVANLDDVLAADAWARRRSNEF 412
>gi|114777894|ref|ZP_01452808.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mariprofundus ferrooxydans PV-1] >gi|114551681|gb|EAU54233.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mariprofundus ferrooxydans PV-1] (362 aa)
Score = 422, Expect = 1.8e-39, Identities = 96/286 (33%), Positives = 174/286 (60%)
  Q:    79 LLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL----NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           L    + D+++ A+VG +GL  TL A++    + LANKE LV AG +      +S + + PVDSEH++++  L+ + +  +K++++T SGGPF  ++   L  +  A A+ HPNW+MG KISIDSATMMNK  E+IEA +LF+   +K+    H +SI+H+M+++ D S +A +++PDM++ I   +   +++  L   +S+ +L     L F  +D  ++  +      L  ++ ++ I +NAANE A   F + +I F+ I   +E+ +  +++  V  L ++  ++++ R
  S:    65 LASDVDTDMVMAAMVGSAGLPATLAAVRAGKRVGLANKECLVTAGRIFMSAAEASGAVVVPVDSEHAAVHQCLQGHERGSVKQVVLTASGGPFRDRDPASLHAVTPAQAIAHPNWDMGAKISIDSATMMNKALELIEARWLFDLPPEKLSAIIHPESIVHAMVEYQDGSALAQLAMPDMRMPIAYAM---QAEPRLDTGISWLDLAKTGTLHFHAVDHLRFPAMALVQQVLRGED-SLAITLNAANEVANAAFRDGRIGFMQIVTTVEQVLARVDDRAVVTLDEVWQIDEHAR 353
>gi|148255864|ref|YP_001240449.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bradyrhizobium sp. BTAi1] >gi|166218239|sp|A5EK49|DXR_BRASB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|146408037|gb|ABQ36543.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Bradyrhizobium sp. BTAi1] (407 aa)
Score = 422, Expect = 1.8e-39, Identities = 117/331 (35%), Positives = 180/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIE--KENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + V GATG+IG S+++++    E Y +   + N+N +   ++   F    V   +V     +N   + L  T                   D ++ A+ G +GL   L A+     +ALANKE LV AG         + + I P DSEH++L+ +L + N+E +  +IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA YLF  +  +I V  H QSI+H M++F+D S +A +  PDM++ I   L   +        L    +  LTF   D  ++  +  AYD L    R    + NAANE A+  F   +I+F  I  ++E  +
  S:    17 RSITVLGATGSIGESTMDLLRGAPERYRVEALTGNSNVQGLAKLAREFKPGFV---AVADPARLNELRDALAGTGIACGAGESAIIEAAARPADWVMAAVSGAAGLKPALAAVDRGATVALANKECLVCAGDFFMQRAAQAGACILPADSEHNALFQALSSGNREELVRVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASYLFALSPDEIDVLVHPQSIVHGMVEFSDRSVVAQLGAPDMRIPIAHCLGWPDRIAGPSARLDLAKIGTLTFEAPDFVRFPGLRLAYDSLRT-GRGATTVYNAANEVAVAAFAAGQIRFGAIARLVEATL 366
>gi|15834962|ref|NP_296721.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydia muridarum Nigg] >gi|13124150|sp|Q9PKW8|DXR_CHLMU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|7190384|gb|AAF39204.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydia muridarum Nigg] (379 aa)
Score = 421, Expect = 2.2e-39, Identities = 114/353 (32%), Positives = 195/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKENYELV---GFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELL----------------EKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQ--HGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSF-NNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVN---DLKDILNLNKNTR 364
           K++ + G+TG+IG   L++I +     V     ++  N E  +  I  F   +V   +V+ + T     +L                    + D+ + A  G   L   + +++    +ALANKESLV AG L+  L + +  +I P+DSEH++L+  L+  +   IK+LI+T SGGP   K   EL  +   + +KHP W+MG KI++DS+T++NK  EIIEA++LF  + +++    H QS+IH M++F D + ++ M+ P M   IQ  L+  +   ++I+ L+F  N  L F  ID +++  I  A D L  +  ++    N ANE  +  F   +I +   ++I+ K    ++   V     L+DIL ++   R
  S:     2 KRLALIGSTGSIGKQVLQVIREIPDAFVIETLAAYGRNRESLISQIREFSPRVV---AVRDETTYKELRKLFPHIEILSGEEGLIAVATAASVDMTIVASSGIDALPAVMASIQERKTIALANKESLVAAGELVTTLAKKNHVQILPIDSEHNALFQCLEGRDPSTIKKLILTASGGPLRNKSKEELQKVTLQEVLKHPIWDMGPKITVDSSTLVNKGLEIIEAFWLFGLQAVEIEAVIHPQSLIHGMVEFCDGTILSVMNPPSMLFPIQHVLTFPDRYPSIISGLNFLTNQTLEFLPIDDERFPSIRLAKDVLR-EGGSMGCFFNGANEALVQRFLSGEIAW---YQIVSKLQTLMDKYVVRSCLSLEDILQVDSEAR 373
>gi|90415799|ref|ZP_01223732.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine gamma proteobacterium HTCC2207] >gi|90332173|gb|EAS47370.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [marine gamma proteobacterium HTCC2207] (394 aa)
Score = 421, Expect = 2.4e-39, Identities = 113/360 (31%), Positives = 196/360 (54%)
  Q:    14 VLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFP------------NALVFSPSVKTKNT-----VNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN---------NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKN 373
           + V GATG+IG S+L+++ +  + Y +   + +   +K  E   +F             N L     V+   T     V++  ++      D ++ A+VG +GL  TL A+     + LANKE+LV+AG L       S S + P+DSEH++++  L  +         N  +++L+++ SGGPF      ++  +    A  HPNW+MG+KIS+DSA++MNK  E+IEA +LF    + I V  H QSIIHS+++++D S +A +  PDM+  I   L+  +   + + +L  F+   L F + D+  +  +  A +           I+NAANE A+  F + +I F  I  ++ + + +    E   L+ +   +   R Y   + K+
  S:     2 ITVLGATGSIGVSTLDVVARHPDKYAVFALTAHTQIDKLAEQCEQFSPKFAVVGNAALANQLQTKLRVRGSRTEVIYGVDALCQVSSDAAVDTVMAAIVGAAGLVPTLAAVHAGKKILLANKEALVMAGGLFMQAVADSGSVLLPIDSEHNAIFQCLPADYGRSPGIGMNSGVEKLLLSASGGPFRGMSLEQMHAVTPDQACAHPNWSMGRKISVDSASLMNKGLELIEACWLFAVPEQSIDVVVHPQSIIHSLVQYSDGSVLAQLGNPDMRTPIAHALAWPQRIESGVANLDLFDVARLDFEKPDMQAFPCLGIARE-AAQAGANAATILNAANEIAVQAFLDQRIGFTQIASVVAQTLNSQVINEPESLEAVQESDNQARLYSSAYIKS 391
>gi|83942313|ref|ZP_00954774.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sulfitobacter sp. EE-36] >gi|83846406|gb|EAP84282.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sulfitobacter sp. EE-36] (390 aa)
Score = 420, Expect = 2.5e-39, Identities = 112/334 (33%), Positives = 190/334 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL 345
           KKV +FGATG+IG +++++I +  + Y++V  +  +N  +  E   R    L  +     ++ ++   + L  T                   D +++A++G +GL   + ALK    LALANKESLV AG L+ D   +  + + PVDSEHS+++ +L   +   ++ +IIT SGG F      +L +     A  HPNW+MG++I+IDSA+M NK  E+IE   Y+  +  +I+V  H QS+IH+++ F D + +A++  PDM+ +I   L  +  +T+L +  L    + +  F   D  +W  +  A + +     A   + NAA E A+  F   K++F  + EI+E  + AL
  S:     2 KKVSIFGATGSIGQNTIDLIARAPDAYDVVALTGASNIAQLAEDAQRLNAQLAVTAH---EHLLDDLRDALSGTGVEAAAGTQAINEAAARPADWVMSAIIGAAGLAPGVEALKQGATLALANKESLVCAGQLMLDTAMAHGATMLPVDSEHSAVFQALIGEDILAVERIIITASGGAFRDWPLEKLADATLEQASSHPNWDMGQRITIDSASMFNKAMEVIETREYFRVDPGQIEVLVHPQSMIHALVGFNDGALMAHIGPPDMRHAIGFALH-HPDRTHLPVERLDLAKIGSFDFRAPDDIRWPALRLAREVMARGGMA-GAVFNAAKEVALDGFIGGKLRFPQMAEIVEDTMEAL 354
>gi|111023547|ref|YP_706519.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodococcus sp. RHA1] >gi|123045446|sp|Q0S275|DXR_RHOSR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|110823077|gb|ABG98361.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Rhodococcus sp. RHA1] (398 aa)
Score = 420, Expect = 2.7e-39, Identities = 117/335 (34%), Positives = 181/335 (54%)
  Q:     8 ENKKKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINR------FPNALVFSPSVKTK-------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           EN+  +VL+ G+TG+IG  +LE++    + + +VG +        +E+++R        +  V  PS           +  ++  EL+  T  D++LNALVG  GL  TL AL++   LALANKESLV  G L+     ++  +I PVDSEHS+L   L+  +  E+  L++T SGGPF     + L ++    A  HP W+MG   +++SAT++NK  E+IE + LF  +  +I V  H QSI+HSM+ FTD S +A  S PDMKL I   L              F+  +   F  +D   +  +  A +  +     +  + NAANE A   F +  I+F  I   +   +
  S:    16 ENRPTRVLLLGSTGSIGTQALEVVAANPDKFTVVGLAAGG---ANVELLDRQIRETGVSSVAVADPSAAASLARPGVLSGPDAVTELVRTTEADVVLNALVGSLGLEPTLAALESGARLALANKESLVAGGPLVT--AAAAPGQIVPVDSEHSALAQCLRGGSADEVDRLVLTASGGPFRGWTADRLESVTPEQAGAHPTWSMGPMNTLNSATLVNKGLELIETHLLFGVDYDRIDVTVHPQSIVHSMVTFTDGSTLAQASPPDMKLPIALALGWPHRIAGAAAACDFSTASTWDFEPLDSQVFPAVDLAREAGKGGG-CLTAVYNAANEVAAQAFLDGIIRFPRIVRTVASVL 363
>gi|83311591|ref|YP_421855.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Magnetospirillum magneticum AMB-1] >gi|82946432|dbj|BAE51296.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Magnetospirillum magneticum AMB-1] (387 aa)
Score = 420, Expect = 2.9e-39, Identities = 115/357 (32%), Positives = 195/357 (54%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLK-NNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYV 367
           ++ V + G+TG+IG ++++++E+  + Y +     N+  +   E   +    L     V  ++   + +  L  T                   D ++ A+VG +GL  TL A++    + LANKE LV AG L+        + + PVDSEHS+++   + + + +I ++I+T SGGPF  K    + ++    AV HPNW+MG KIS+DSA+M NK  E+IEA++LF+    KI +  H QS+IHS++ + D S +A +  PDM+  I   L         +  L    +  LTF   D  ++  +  A + L     A   +MNAANE A+  F   +I FLDI  ++E+ +  + + E+  + D+L  +   R++V
  S:     4 RRGVTILGSTGSIGCNTVDLVERNPDLYRVEALVANSRVDILAEQARKLQAKLAV---VADESAYGALKSALAGTGIEVAAGAQAVVAAAERPADWVMAAIVGAAGLAPTLAAVRRGAVVGLANKECLVCAGQLMMAEVEKHGATLLPVDSEHSAIFQVFEADQHDKIDKIILTASGGPFRTKTREFMADVTPEQAVAHPNWSMGAKISVDSASMFNKGLELIEAHHLFDMPEDKIDIVVHPQSVIHSLVAYVDGSVLAQLGSPDMRTPIAYALGWPNRMEAPVPKLDLAAIATLTFEAPDPVRFPSLRLAREALRAGGSA-AAVMNAANEVAVAAFLGRRIGFLDIASLVERTVAGVSHCELTCIDDVLAQDAEARRFV 379
>gi|110834010|ref|YP_692869.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alcanivorax borkumensis SK2] >gi|110647121|emb|CAL16597.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Alcanivorax borkumensis SK2] (404 aa)
Score = 419, Expect = 3.4e-39, Identities = 113/364 (31%), Positives = 200/364 (54%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIIN----RFPNALVFSPSVKTKNTV-------------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN--NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDFSKNK 374
           ++++ + GATG+IG  +L+++ +  E YE+   +    ++    +      R+      + +   +N +              +  EL    + D ++  +VG +G+  TL A++    + LANKE+LVV G L  D  +   + + P+DSEH++++  L     N  ++ L++T SGGPF +    +L  +    A+KHPNW+MG KIS+DSAT+MNK  E IEA +LF+     + V  H QS+IHSM+ + D S +A M  PDM+  I  GLS  E   +    L F+ L  L F   DL+++  +  A D           ++NAANEEA+  F + ++ F+ I +++ + +   +     D+  ++ +++  R+    + K +
  S:    16 RQRLTLLGATGSIGQQTLDVLVRHPERYEVFAVTAGTQWQAMARLCETVQPRYAAMADATSATSLRNHLAGLGSQVEVLSGPEALAELAAHPDVDTVVAGIVGAAGVRPTLAAVEAGKRVLLANKEALVVTGSLFMDAVKRYGATLLPLDSEHNAIFQCLPTEGVNAGVERLLLTASGGPFREFSAEQLKAVTPEQAIKHPNWDMGPKISVDSATLMNKGLEFIEACWLFDVPPAMVDVVVHPQSVIHSMVAYRDGSVLAQMGTPDMRTPIACGLSWPERVESGAQRLDFSTLIGLNFELPDLERFPCLGLARD-AMAAGGTATAVLNAANEEAVAAFLDGRLDFMGIADVVARTLDKQDAPACCDVDAVMEIDRQARQLACHWIKER 402
>gi|16126160|ref|NP_420724.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Caulobacter crescentus CB15] >gi|21263544|sp|Q9A709|DXR_CAUCR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|13423370|gb|AAK23892.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Caulobacter crescentus CB15] (399 aa)
Score = 419, Expect = 3.5e-39, Identities = 116/323 (35%), Positives = 184/323 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKEN--YELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDI 334
           +KV+V G+TG+IG S+L + E+     +++  +   N E+ +E   R+  +L     ++ ++ ++     L  T                   D +++A+VG +GL  T+ A +    +ALANKESLV AG  +  + +++   + PVDSEHS+++  L++     +  LI+T SGGPF   +   +       A+ HPNW+MG KIS+DSATMMNK  E+IEA YLF T   ++ V  H QS+IHS++++ D S +A +  PDM+  I    +  +        L       LTF   D++++  I  A + L     A P  MNAANE A+  F + +I FLDI
  S:     8 RKVVVLGSTGSIGLSTLSLFEESGAPVQILALTAGRNVERLIEQARRWKPSLAV---IEDESRLDDLRAGLAGTGVEAAAGADAVRDAAAMGADWVMSAIVGAAGLAPTVAAARTGAVIALANKESLVCAGPALLAIAKAAGGSVIPVDSEHSAIFQVLQSECAHRVSRLILTASGGPFRTWDKAAMARATPEQAIAHPNWSMGAKISVDSATMMNKGLEMIEASYLFATPEDRVDVVIHPQSVIHSLVEYVDGSTLAQLGPPDMRAPIACAFAWPDRLPWPAPRLDLAAYGQLTFESPDVERFPAIGIAREALRLGGGA-PAAMNAANEVAVAAFLDRRIGFLDI 349
>gi|58040247|ref|YP_192211.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Gluconobacter oxydans 621H] >gi|81170447|sp|Q5FPZ1|DXR_GLUOX 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|58002661|gb|AAW61555.1| 1-Deoxy-D-xylulose 5-phosphate reductoisomerase [Gluconobacter oxydans 621H] (408 aa)
Score = 419, Expect = 3.6e-39, Identities = 119/354 (33%), Positives = 191/354 (53%)
  Q:    11 KKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKN-------------TVNSFEELLEK--TNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL-ENTEVNDLKDILNLNKNTR 364
           ++++ V G+TG+IG S+++++ +  +  E+       N     E   R  NA V     ++++             T    + ++E      D  + A+ G +GL  TL A +N   +ALANKE+LV AG ++      + + + PVDSEH+++  SL   + E ++++I+T SGGPF K    E+       A+KHP W MG KI+IDSA+M NK  E+IEA  LF     +I V  H QS++H +++F D S ++ M   DM++ I   L+  +        L       L F   D  ++ P+  A   L     A P + +AANE A+  F   +I FL I E I+ A+ A+ EN E+  L D+L+ +   R
  S:    10 RRRITVLGSTGSIGTSTVDLLARIPDEIEVRALVGGCNAALLAEQARRL-NAEVAVIHDESRHEELKTCLAGTGIRTAAGRQAVIEAGAMEADWTMAAITGAAGLEPTLAAARNGHAVALANKEALVCAGDVMLRAVAEAGATLLPVDSEHNAIAQSLGGCDMESVEKIILTASGGPFRKSSIEEMRAATPEKALKHPTWTMGAKITIDSASMANKGLEVIEAARLFGLTEDRIDVLVHPQSVVHGLVQFRDGSLVSQMGSADMRIPIAHTLAWPKRMVTPCERLDLAAYGRLEFEAPDEVRFAPLRLARQVLR-AGGAAPAVFSAANEVAVDAFLNRRIGFLGIGETIDAALQAMDENPELRTLDDVLHWDARGR 383
>gi|152965395|ref|YP_001361179.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Kineococcus radiotolerans SRS30216] >gi|151359912|gb|ABS02915.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Kineococcus radiotolerans SRS30216] (409 aa)
Score = 419, Expect = 4.0e-39, Identities = 98/270 (36%), Positives = 148/270 (54%)
  Q:    87 IILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDI 356
           ++LN + G  GL  TL AL     LALANKESLV  G L+     +   ++ PVDSEHS+L   L+  +  E+  L++T SGGPF  +   EL  +  A A+ HP W+MG  ++ +SAT++NK  E+IEA  LF     +I V  H QS++HSM++FTD S +A  S PDM+L I  GL   +        + +    + TF  +D   +  +  A +    +   +P + NAANEE +  F   ++ FL I + +  A +  E+    D +D+
  S:   117 VVLNGMTGSVGLRPTLAALGTGRTLALANKESLVAGGPLVT--AAAGPGQVVPVDSEHSALAQCLRGGSPAEVARLVLTASGGPFRGRRREELGGVTPAQALAHPTWSMGPVVTTNSATLVNKGLEVIEASLLFGVGYDRIDVVVHPQSVVHSMVEFTDGSTLAQCSPPDMRLPIALGLGWPDRVPGATAGIDWTRAASWTFEPLDAQAFPAVDLARE-AGRRGSTVPAVFNAANEECVTAFHAGRLPFLGIVDTV--AAVVAEHDPAGDPRDV 385
>gi|103487438|ref|YP_616999.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sphingopyxis alaskensis RB2256] >gi|98977515|gb|ABF53666.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sphingopyxis alaskensis RB2256] (387 aa)
Score = 419, Expect = 4.1e-39, Identities = 118/359 (32%), Positives = 201/359 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEEL--------------------LEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           +++ +FGATG++G S+L+++  ++E + +   + N + ++   +      A+ F P V      + +  L                      +   D+++ A+VG +GL  T+ AL    D+ALANKE+LV AG L+    R+S + I PVDSEH++++  L      +++ +I+T SGGPF      ++  +  A AV HPNW+MG KIS+DSATMMNK  E+IEA++LF     +I++  H QS+IHS++++ D S +A +  PDM++ I   L+  +        L    ++ L F   D +++ P             A P  +NAANE A+  F   +I F  I + + + + A E    + L+DI +++  +R     F
  S:     3 RRLSLFGATGSVGQSTLDLVRRDREAWRVGVLTANCDVQELARL------AIEFRPDVAVVADESCYGYLKAALAGQGIECAAGAAALVEAAERRADLVMAAIVGTAGLAPTMTALAAGHDVALANKEALVSAGELMTAAARASGATILPVDSEHNAIFQCLAGGRIDQVRRIILTASGGPFRTMSAADMAAVTPAQAVAHPNWSMGAKISVDSATMMNKGLELIEAHHLFPVGLDRIEILVHPQSVIHSLVEYIDCSTLAQLGSPDMRIPIASALAWPQRMATPCAPLDLAAISRLDFEAPDEERF-PATALCRAAIAAGGARPAQLNAANEVAVAAFLAGRISFPAIVDTVRRVVDAAEPAAPSSLQDIFSVDTASRAAALRF 380
>gi|58696716|ref|ZP_00372262.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont of Drosophila simulans] >gi|58537098|gb|EAL60216.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolbachia endosymbiont of Drosophila simulans] (358 aa)
Score = 418, Expect = 4.6e-39, Identities = 107/289 (37%), Positives = 175/289 (60%)
  Q:    86 DIILNALVGFSGLHITLLALKNNVD-LALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKT-NLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQN-RAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-TEVNDLKDILNLNKNTRKYVYDFSKNK 374
           D+ + A+VG +GL   +  +++    +ALANKES+V  G L+    +  + +I P+DSEH++++  L+N++K ++++I+T SGGPF      +L NI    A+ HP WNMGKKIS+DSATMMNK  EIIEA+ LFN    KI+   H +SI+H ++ + D    A ++  DM + I   LS  E    N   DL+     LTF E D   +  +  + + L +   +   I++NAANE A+  F +++I FL+I E++E  + +  + T++N L DI+N++  +R   +   ++K
  S:    60 DLSVVAIVGIAGLGPVMEVIESGTKVIALANKESIVCGGKLLLKKAKEKNVQIIPIDSEHNAIFQILQNDDKCVEKIILTASGGPFLNYSLEQLRNIMVDQALSHPTWNMGKKISVDSATMMNKALEIIEAHNLFNISPDKIEAVVHPESIVHGIVTYKDGFNFAVLAETDMAIPISYALSWPERLVLNYKLDLTKQG-KLTFQEPDHKHFPVLKLSMEVLNSSTPQTNSIVLNAANEIAVNEFLKSRIGFLEIVEVVESTMESFGSYTDINSLSDIINIDCESRIIAHKIVESK 353
>gi|39930838|sp|Q7URM5|DXR_RHOBA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (455 aa)
Score = 418, Expect = 4.7e-39, Identities = 124/348 (35%), Positives = 204/348 (58%)
  Q:    13 KVLVFGATGNIGFSSLEIIEKEN-------YELVGFSFNNNYEKALEI---INRFPNALVFS---------PSVKTKNTVNSFEELLEKTNPDIILNALV----------------GFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------------------------------------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLN 360
           +V V GATG+IG ++L++IE  N       +E+   S ++  +  +E+    +  P  +V S          +++T +T  S   L E+   D+  +ALV                G +GL  TL A+     +ALANKE+LVVAG ++     ++ +++ PVDSEHS+++  L  +                                       ++ LI+T SGGPF      ++       A+ HP W MG KI+IDSA+MMNK  E+IEA +LF+    KI+V  H QS+IHS+++F D S IA +S PDM++ IQ  L+          +L  +   +++    D D++  +   ++       A  ++ NAANE A+ LF   +I+F DI EI  + ++  ++     L+ +L L+
  S:    23 RVAVLGATGSIGVAALDVIENLNRCDPDFAWEVSSMSGHSQIDPLIELAGGCHTPPKCVVVSDAEMEAQAAKALRTASTQTS-SRLTERCRLDVGPDALVRAATENDVDVVVAAIVGRAGLESTLAAVHAGKRVALANKETLVVAGPVVTRAAANNGAQLLPVDSEHSAIFQCLAESRARQSQYATAKQSIQPESVRATDPPSSTTDSPAKTHWPGVRRLILTASGGPFRDWTTAQMREATIEQALAHPTWKMGAKITIDSASMMNKALEVIEAKWLFDVPADKIEVVVHPQSLIHSLVEFEDGSLIAQVSPPDMRIPIQYALTYPRRLPCPAPELDRSQAWDMSLCPADPDRFPALALGFEVARVGGTAGAVV-NAANETAVDLFLHGQIRFTDIPEICRRTLLDHDHESSPTLERLLKLD 442
>gi|32473779|ref|NP_866773.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopirellula baltica SH 1] >gi|32444315|emb|CAD74313.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopirellula baltica SH 1] (489 aa)
Score = 418, Expect = 4.7e-39, Identities = 124/348 (35%), Positives = 204/348 (58%)
  Q:    13 KVLVFGATGNIGFSSLEIIEKEN-------YELVGFSFNNNYEKALEI---INRFPNALVFS---------PSVKTKNTVNSFEELLEKTNPDIILNALV----------------GFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------------------------------------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLN 360
           +V V GATG+IG ++L++IE  N       +E+   S ++  +  +E+    +  P  +V S          +++T +T  S   L E+   D+  +ALV                G +GL  TL A+     +ALANKE+LVVAG ++     ++ +++ PVDSEHS+++  L  +                                       ++ LI+T SGGPF      ++       A+ HP W MG KI+IDSA+MMNK  E+IEA +LF+    KI+V  H QS+IHS+++F D S IA +S PDM++ IQ  L+          +L  +   +++    D D++  +   ++       A  ++ NAANE A+ LF   +I+F DI EI  + ++  ++     L+ +L L+
  S:    57 RVAVLGATGSIGVAALDVIENLNRCDPDFAWEVSSMSGHSQIDPLIELAGGCHTPPKCVVVSDAEMEAQAAKALRTASTQTS-SRLTERCRLDVGPDALVRAATENDVDVVVAAIVGRAGLESTLAAVHAGKRVALANKETLVVAGPVVTRAAANNGAQLLPVDSEHSAIFQCLAESRARQSQYATAKQSIQPESVRATDPPSSTTDSPAKTHWPGVRRLILTASGGPFRDWTTAQMREATIEQALAHPTWKMGAKITIDSASMMNKALEVIEAKWLFDVPADKIEVVVHPQSLIHSLVEFEDGSLIAQVSPPDMRIPIQYALTYPRRLPCPAPELDRSQAWDMSLCPADPDRFPALALGFEVARVGGTAGAVV-NAANETAVDLFLHGQIRFTDIPEICRRTLLDHDHESSPTLERLLKLD 476
>gi|148261540|ref|YP_001235667.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acidiphilium cryptum JF-5] >gi|146403221|gb|ABQ31748.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Acidiphilium cryptum JF-5] (391 aa)
Score = 418, Expect = 5.0e-39, Identities = 102/275 (37%), Positives = 161/275 (58%)
  Q:    86 DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLS--GYESKTNLINDLSFNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLN 360
           D  + A+ G +GL  TL A +N   +ALANKE+LV AG +      +  + + PVDSEH++++ SL + N+  ++++I+T SGGPF +   +E+ +     A+KHP W+MG KISIDSAT+ NK  E+IEA  +F     +I+V  H QSI+H M+ + D S +A M  PDM++ I   L+     + ++   DL+     L F   D  ++  +  A + LE  + A   ++NAANE A+  F   +I FLDI  ++E+ +  L    + DL  +L L+
  S:    94 DWTMAAITGTAGLEPTLAATRNGGAIALANKEALVSAGDVFLAAIAAGGATLLPVDSEHNAIFQSLADGNRAALEKIILTASGGPFREASLDEMKDATPETALKHPVWSMGAKISIDSATLFNKGLEVIEAARIFGLAPHEIEVLVHPQSIVHGMVCYRDGSVLAQMGAPDMRIPIAHTLAWPARLATSSPRLDLA-AAARLDFLAPDPVRFPALRLAREALEAGHGA-STVLNAANEIAVEAFLRRRIGFLDITAVVERVMQRLGAPPIGDLAAVLALD 371
>gi|68070245|ref|XP_677034.1| hypothetical protein PB000130.00.0 [Plasmodium berghei strain ANKA] >gi|56496990|emb|CAH93706.1| hypothetical protein PB000130.00.0 [Plasmodium berghei] (332 aa)
Score = 417, Expect = 5.6e-39, Identities = 115/289 (39%), Positives = 174/289 (60%)
  Q:    86 DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDL-KRSSSSRIYPVDSEHSSLYDSLKNNN--------------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND-----LKDILNLNKNTRKYVYDFSKNK 374
           D I+  +  F GL+ T+ A+KNN  +ALANKES+V AG+ ++ L     +S I PVDSEH++++  L NN                +I ++ +  SGGPF     +EL N+    A+KHP WNMGKKISIDSATMMNK  E+IEA++LF+     I++  H + IIHS ++F D S I+ M  PDM++ I   L+     +  +  L+F  ++ LTF +  L  +  I  AY      N   P ++NA+NE A  LF  NKIK+ DI  II + + +    ++++     +K IL ++  +++   D    K
  S:    19 DKIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDSEHNAIFQCLNNNILLKSKCLQENYSKINKINKIFLCSSGGPFQNLSIDELKNVTSEKALKHPKWNMGKKISIDSATMMNKGLEVIEAHFLFDIDYNDIEIIVHKECIIHSCVEFLDKSVISQMYYPDMRVQIIYALTWPNRISTNLKSLNFEEISPLTFYKPSLKHFPCIKLAYHAGRKSN-FFPTVLNASNEVANNLFLNNKIKYFDIPAIISQVLESFNPQQISETPEDLMKQILEIHNWSKQKAMDIYNRK 329
>gi|148553390|ref|YP_001260972.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sphingomonas wittichii RW1] >gi|148498580|gb|ABQ66834.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Sphingomonas wittichii RW1] (387 aa)
Score = 417, Expect = 6.4e-39, Identities = 118/354 (33%), Positives = 187/354 (52%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           + + + GATG+IG S+L+++E+E   + +   +   + +       R    L     +      +  +  L  T                   D  + A+VG +GL  TL AL     +ALANKESLV AG L+ D  R+  + + PVDSEH++++    +     I+++ +T SGGPF       +     A AV+HPNW+MG KIS+DSAT+MNK  E+IEA++LF    +      H QS++H+++ + D S +A +  PDM+  I   L+  +        L    +  L F   DL+++  +  A D L     A P I+NAANE A+  F + +I FLDI  I+ KA+   +      L DI  ++   R+
  S:     4 RSIAILGATGSIGTSTLDLVEREPDRFRVTTLTAQRDVDGLAAAARRTGAELAV---IGDPARYDDLKAALAGTGIRAAAGVEAIVEAAAAGADWTMAAIVGIAGLRPTLAALAAGGTVALANKESLVSAGALMTDAARAHGATLLPVDSEHNAVFQCFDHAAPGSIRKVTLTASGGPFRDWSIEAMRAATPAQAVRHPNWSMGAKISVDSATLMNKGLELIEAFHLFPLPPEAFDAIIHPQSVVHALVDYIDGSVLAQLGTPDMRTPIAHSLAWPQRMATPCRRLDLATVGRLDFLAPDLERFPALAIALDVLA-AGGARPAILNAANEVAVAAFLDGRIGFLDIALIVRKALERYDPPAPASLDDIFAIDAGARR 376
>gi|85373588|ref|YP_457650.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Erythrobacter litoralis HTCC2594] >gi|84786671|gb|ABC62853.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Erythrobacter litoralis HTCC2594] (384 aa)
Score = 417, Expect = 6.7e-39, Identities = 115/354 (32%), Positives = 190/354 (53%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSF-NNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEV-NDLKDILNLNKNTRK 365
           + + + GATG++G S+L++I  E+E + +   + N + ++   +   F   +     V  +  +    E L  +                   DI + A+VG +GL   + A++    +ALANKE+LV AG ++        + + PVDSEH++++  L+ N  +E++ + +T SGGP      +EL  +  A AV HPNW+MG KIS+DSATMMNK  E IEA++LF     +I++  H QS+IHSM+++ D S +A +   DMK+ I   L+           L       LTF   D +++     A +  E    A P ++NAANE A+  F + +I F  I   +E  +   +       L D+L ++   R+
  S:     2 RSITILGATGSVGASTLDLIRREREVWRVEALTANCSAKELAALAREFDAKVAV---VGDEGCLADLREALSGSGIEAAGGRSALCEAAARPVDITVAAIVGCAGLGPVMAAIEQGGTIALANKEALVSAGDVMTAAVAKHGATLLPVDSEHNAIFQCLQGNTIEEVRWITLTASGGPLRTLSADELHAVTPAQAVAHPNWDMGAKISVDSATMMNKGLEFIEAHHLFPVGLDRIRIVVHPQSVIHSMVEYRDGSTLAQLGPSDMKVPIASCLAWPRRMETGCEPLDLVAQGELTFFAPDEERFPATRLAREAAEAGGSA-PAVLNAANEIAVAAFLDGQIPFTRIALSVEDTLAQSDLPPAPTSLDDVLAVDSAARE 375
>gi|108799009|ref|YP_639206.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. MCS] >gi|119868124|ref|YP_938076.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. KMS] >gi|126434612|ref|YP_001070303.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. JLS] >gi|108769428|gb|ABG08150.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. MCS] >gi|119694213|gb|ABL91286.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. KMS] >gi|126234412|gb|ABN97812.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium sp. JLS] (392 aa)
Score = 417, Expect = 6.9e-39, Identities = 104/250 (41%), Positives = 152/250 (60%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNAL------VFSPSVKTK------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +VL+ G+TG+IG  +L++I    + +E+VG +         E++ R   A       V  P+   K      +  ++   L+E T  D++LNALVG  GL  TL AL     LALANKESLV  G L+  L+ ++  +I PVDSEHS++   L+  +  E+  L++T SGGPF      +L ++    A KHP W+MG   +++SAT++NK  E+IE + LF  +  +I+V  H QSI+HSM  FTD S +A  S PDMKL I   L
  S:     6 RVLILGSTGSIGTQALDVIAANPDRFEVVGLAAGGANP---ELLARQRAATGVHAIAVTDPAAAEKIGDVTYSGPDAVTRLVENTQADVVLNALVGALGLEPTLAALATGARLALANKESLVAGGPLV--LRAAAPGQIVPVDSEHSAMAQCLRGGSADEVATLVLTASGGPFLGWSAEDLQSVTPEQAGKHPTWSMGPMNTLNSATLVNKGLELIETHLLFGIDYDRIEVVVHPQSIVHSMATFTDGSTLAQASPPDMKLPIALAL 267
>gi|145224663|ref|YP_001135341.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium gilvum PYR-GCK] >gi|145217149|gb|ABP46553.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium gilvum PYR-GCK] (387 aa)
Score = 415, Expect = 9.9e-39, Identities = 102/254 (40%), Positives = 150/254 (59%)
  Q:     9 NKKKKVLVFGATGNIGFSSLEII--EKENYELVGFSFN---------NNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           N++ +VL+ G+TG+IG  +LE+I    + +E+VG +              E  +  I     A   +    T +  ++   L+E T  D++LN LVG  GL  TL AL     LALANKESLV  G L++  K ++  +I PVDSEHS+L   L+  +  E+  L++T SGGPF     + L ++    A  HP W+MG   +++SA+++NK  E+IE + LF  +  +I V  H QSI+HSM+ FTD S +A  S PDMKL I   L
  S:     2 NERLRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNRDLLARQRAETGVTNIAVADEAAAAALGEVTYSGPDAVTRLVEATEADVVLNGLVGALGLKPTLAALATGARLALANKESLVAGGPLVQ--KAAAPGQIVPVDSEHSALAQCLRGGSADEVATLVLTASGGPFRGWSVDRLEDVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIDYDRIDVVVHPQSIVHSMVTFTDGSTLAQASPPDMKLPIALAL 267
>gi|124810261|ref|XP_001348815.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Plasmodium falciparum 3D7] >gi|23497715|gb|AAN37254.1|AE014826_53 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Plasmodium falciparum 3D7] >gi|4139260|gb|AAD03739.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Plasmodium falciparum] (488 aa)
Score = 415, Expect = 1.2e-38, Identities = 129/343 (37%), Positives = 198/343 (57%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEKEN---------YELVGFSFNNNYEKALEIINRF----------------PNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKR-SSSSRIYPVDSEHSSLYDSLKNNN--------------KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND 352
           K   V +FG+TG+IG ++L II + N            V  S N  YE+A E +  +                 N   + P +   +     +E+    + D I+  +  F GL+ T+ A+ NN  +ALANKES+V AG+ ++ L     +++I PVDSEHS+++  L NN                 I ++ +  SGGPF     +EL N+   +A+KHP W MGKKI+IDSATMMNK  E+IE ++LF+     I+V  H + IIHS ++F D S I+ M  PDM++ I   L+  +     +  L    ++ LTF +  L+ +  I  AY      N   P ++NA+NE A  LF  NKIK+ DI  II + + +  + +V++
  S:    76 KPINVAIFGSTGSIGTNALNIIRECNKIENVFNVKALYVNKSVNELYEQAREFLPEYLCIHDKSVYEELKELVKNIKDYKPIILCGD--EGMKEICSSNSIDKIVIGIDSFQGLYSTMYAIMNNKIVALANKESIVSAGFFLKKLLNIHKNAKIIPVDSEHSAIFQCLDNNKVLKTKCLQDNFSKINNINKIFLCSSGGPFQNLTMDELKNVTSENALKHPKWKMGKKITIDSATMMNKGLEVIETHFLFDVDYNDIEVIVHKECIIHSCVEFIDKSVISQMYYPDMQIPILYSLTWPDRIKTNLKPLDLAQVSTLTFHKPSLEHFPCIKLAYQAGIKGN-FYPTVLNASNEIANNLFLNNKIKYFDISSIISQVLESFNSQKVSE 458
>gi|119898194|ref|YP_933407.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Azoarcus sp. BH72] >gi|119670607|emb|CAL94520.1| probable 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Azoarcus sp. BH72] (399 aa)
Score = 413, Expect = 1.6e-38, Identities = 116/354 (32%), Positives = 199/354 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEII--NRFPNALVFSPSVKTK---------------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEI------KELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           +++ + GATG+IG S+L+++ +  + + +   S +   E+ +EI   +R   A++      T+                   + E++    +   ++ A+VG +GL  TL A +    + LANKE+LV++G L  D   +S++ + P+DSEH++++ +L  + + I      + +++T SGGPF       L  +    A  HPNW MG+KIS+DSATMMNK  E+IEA++LF      I+V  H QS+IHSM+ + D S +A +  PDM+  I   L+  E   + +  L  F    L F   D  ++  +  AY  LE    A   +  AANEEA+  F E ++ F  I  +IE  +       V+ ++ +L+ +++ R+
  S:     7 QQITILGATGSIGASTLDVVARHPDRFAVFAVSAHRQVERMVEICLRHRPRYAVMVDADAATRLQRLLVQQGCRTEVLAGAAALEDVAAHGDVHAVMAAIVGAAGLKPTLAAARAGKKVLLANKEALVLSGRLFMDTVAASNAVLLPIDSEHNAVFQALPVDYRRIPGAAGVRRILLTASGGPFRSTPLEALDAVTPDQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGAPASIIEVVVHPQSVIHSMVDYLDGSVLAQLGNPDMRTPIAHALAWPERIDSGVAPLDLFAIGQLAFERPDFHRFPCLALAYRALEEGGSAAATLN-AANEEAVAAFLEGQLGFRGIPAVIEATMERAGQHAVDSVEAVLDADRHARR 387
>gi|15604790|ref|NP_219574.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydia trachomatis D/UW-3/CX] >gi|76788784|ref|YP_327870.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydia trachomatis A/HAR-13] >gi|123607191|sp|Q3KMV0|DXR_CHLTA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|8134413|sp|O84074|DXR_CHLTR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|3328465|gb|AAC67662.1| hypothetical protein CT_071 [Chlamydia trachomatis D/UW-3/CX] >gi|76167314|gb|AAX50322.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chlamydia trachomatis A/HAR-13] (379 aa)
Score = 413, Expect = 1.7e-38, Identities = 109/353 (30%), Positives = 190/353 (53%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFS-FNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK--------------TNPDIILN--ALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQ--HGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSF-NNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + + G+TG+IG   L+++    + + +   + +  N E  +  I  F   +V   +V+ + T     +L                 T P + +   A  G   L   + A++    +ALANKESLV AG L+  L R +  +I P+DSEH++L+  L+  ++  IK+L++T SGGP   K   EL  ++  + ++HP WNMG KI++DS+T++NK  EIIEA++LF  + +++    H QS++H M++F D + ++ M+ P M   IQ  L+  E    +     F +N  L F  ID D++  +H A   L  +  ++    N ANE  +  F   +I +  I   ++  +          L++IL+++   R
  S:     2 KHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAYGRNQEALISQIREFNPRVV---AVREETTYKELRKLFPHIEILLGEEGLVSVATEPSVTMTIVASSGIDALPAVIAAIRQKKTIALANKESLVAAGELVTTLARENGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNKSKEELQKVSLQEVLRHPVWNMGPKITVDSSTLVNKGLEIIEAFWLFGLEAVEIEAVIHPQSLVHGMVEFCDGTILSVMNPPSMLFPIQHVLTFPERSPAIGPGFDFLSNRTLEFFPIDEDRFPSVHLAKRVLLEKG-SMGCFFNGANEALVHRFLAGEISWHQIVPKLQALVDQHRVQSCLSLEEILSVDAEAR 373
>gi|21224043|ref|NP_629822.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Streptomyces coelicolor A3(2)] >gi|27808652|sp|Q9KYS1|DXR_STRCO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|7801266|emb|CAB91130.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Streptomyces coelicolor A3(2)] (418 aa)
Score = 413, Expect = 1.9e-38, Identities = 113/331 (34%), Positives = 188/331 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNY-----EKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN------PDI-----------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           K V+V G+TG+IG  +++++ +  + + +   S N        E+A  +  R       + +V  ++ V +  E L          P+I                 +LN + G  GL  TL AL+    LALANKESL+V G L++ L +    +I PVDSEH++L+ +L    + ++++L++T SGGPF  +  +EL  +   DA+ HP W MG  I+I+SAT++NK  E+IEA+ L++    +I+V  H QS +HSM+++TD S +A+ + PDM   I  GL   E   +      ++  +   F  +D + +  +  A    +    A P + NAANEE +  F    + FL I E + + +
  S:    24 KDVVVLGSTGSIGTQAIDLVLRNPDRFRVTALSANGGRVALLAEQAYRLKAR-------TVAVAREDVVPALREALTAQYGTGEPLPEILAGPEAATQLAASDCHTVLNGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKALAKPG--QIIPVDSEHAALFQALAAGTRADVRKLVVTASGGPFRGRTRDELAAVTVEDALAHPTWAMGPVITINSATLVNKGLEVIEAHLLYDIPFDRIEVVVHPQSYVHSMVEYTDGSTLAHATPPDMGGPIAVGLGWPERVPDAAPAFDWSKASTWEFFPLDNEAFPSVDLARHVGQLAGTA-PAVFNAANEECVEAFRSGALPFLGIMETVTRVV 378
>gi|146278185|ref|YP_001168344.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacter sphaeroides ATCC 17025] >gi|145556426|gb|ABP71039.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacter sphaeroides ATCC 17025] (394 aa)
Score = 413, Expect = 2.0e-38, Identities = 112/354 (31%), Positives = 197/354 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK----ENYELVGFSFNNNYEKALEIINRFPNALVFS------PSVKT------KNTVNSFEELLEKTN--PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEV-----NDLKDILNLNKNTRK 365
           + + +FGATG+IG S+ +++ +    E +  V  +   N  +  E+       L  +      P+++              + + E  +   D  ++A+VG +GL   + ALK+   LALANKESLV AG L+      + + I PVDSEHS+++ +L   +   ++ +IIT SGGPF      ++     A A+ HPNW+MG++ISIDSA+M NK  E+IE   ++ F  ++I+   H QSI+H+++ F D   +A++   DM+ +I   L+        +  L    + NLTF + D +++  +  A + +  +  +     NAA E A+  F    I FLD+  ++E+A+ A+    +     + L+++L ++   RK
  S:     2 RSLSIFGATGSIGESTFDLVMRKGGPEAFRTVALTGGRNVARLAEMARALKAELAVTAHEECLPALREALAGSGTEVAGGTQAIAEAADRPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTAEENGATILPVDSEHSAVFQALAGEDTTCVERVIITASGGPFRDWTLEQIRGCTVAQAMAHPNWSMGQRISIDSASMFNKALELIETREFFGFEPERIEAVVHPQSIVHALVGFCDGGIMAHLGPADMRHAIGFALNWPGRGEVPVARLDLAQIANLTFQKPDEERFPALRLAREVMAARGLS-GAAFNAAKEIALDHFIAGNIGFLDMAAVVEEALSAVSADPLFGKVPSTLEEVLAMDHLARK 381
>gi|62178790|ref|YP_215207.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62126423|gb|AAX64126.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (379 aa)
Score = 413, Expect = 2.1e-38, Identities = 102/278 (36%), Positives = 166/278 (59%)
  Q:    88 ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           ++ A+VG +GL  TL A++    + LANKESLV  G L  D  + S++R+ PVDSEH++++ SL  + +            +  +++T SGGPF +    +L  +    A +HPNW+MG+K+S+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++ D S +A +  PDM+  I   ++     T+    L F  L+ LTFS  D  ++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +  ++  E   ++D+L ++   R+
  S:    78 VMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPNWSMGRKVSVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIARE 368
>gi|118617653|ref|YP_905985.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium ulcerans Agy99] >gi|118569763|gb|ABL04514.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase Dxr [Mycobacterium ulcerans Agy99] (402 aa)
Score = 411, Expect = 2.9e-38, Identities = 103/250 (41%), Positives = 150/250 (60%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKAL----------EIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +VLV G+TG+IG  +LE+I    + +E+VG +   +    L          EI      A   +  +  +   ++   L+E+T  D++LNALVG  GL  TL AL +   LALANKESLV  G L+  L+ +   +I PVDSEHS+L   L+     E+ +L++T SGGPF      +L  +    A  HP W+MG   +++SA+++NK  E+IE + LF  + ++I+V  H QSI+HSM+ F D S IA  S PDMKL I   L
  S:    14 RVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGGSNLDTLRRQRAETGVTEIAIADERAAQLAGDIAYQEP-DAVTRLVEETEADVVLNALVGALGLRPTLAALASGARLALANKESLVAGGPLV--LQAAQPGQIVPVDSEHSALAQCLRAGTPDEVAKLVLTASGGPFRGWSAADLQEVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGISYERIEVVVHPQSIVHSMVTFVDGSTIAQASPPDMKLPISLAL 275
>gi|31794047|ref|NP_856540.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium bovis AF2122/97] >gi|57117032|ref|NP_217386.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis H37Rv] >gi|121638752|ref|YP_978976.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662713|ref|YP_001284236.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis H37Ra] >gi|148824061|ref|YP_001288815.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis F11] >gi|161350061|ref|NP_337449.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis CDC1551] >gi|167969499|ref|ZP_02551776.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis H37Ra] >gi|166218268|sp|A1KML5|DXR_MYCBP 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|166218269|sp|A5U6M4|DXR_MYCTA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|54037012|sp|P64013|DXR_MYCBO 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|54040750|sp|P64012|DXR_MYCTU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|110590917|pdb|2C82|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis >gi|110590918|pdb|2C82|B Chain B, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis >gi|31619642|emb|CAD96582.1| PROBABLE 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE DXR (DXP REDUCTOISOMERASE) (1-DEOXYXYLULOSE-5-PHOSPHATE REDUCTOISOMERASE) [Mycobacterium bovis AF2122/97] >gi|41352761|emb|CAA98375.2| PROBABLE 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE DXR (DXP REDUCTOISOMERASE) (1-DEOXYXYLULOSE-5-PHOSPHATE REDUCTOISOMERASE) [Mycobacterium tuberculosis H37Rv] >gi|121494400|emb|CAL72881.1| Probable 1-deoxy-d-xylulose 5-phosphate reductoisomerase dxr [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148506865|gb|ABQ74674.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis H37Ra] >gi|148722588|gb|ABR07213.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase dxr [Mycobacterium tuberculosis F11] (413 aa)
Score = 411, Expect = 3.2e-38, Identities = 102/250 (40%), Positives = 150/250 (60%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +V+V G+TG+IG  +L++I    + +E+VG +    +   L  + +     V + +V  ++             ++   L+E+T  D++LNALVG  GL  TL ALK    LALANKESLV  G L+  L+ +   +I PVDSEHS+L   L+     E+ +L++T SGGPF      +L ++    A  HP W+MG   +++SA+++NK  E+IE + LF     +I V  H QSIIHSM+ F D S IA  S PDMKL I   L
  S:    14 RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTL--LRQRAQTGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGGSLV--LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLAL 275
>gi|194545017|ref|YP_002080046.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase dxr [Mycobacterium tuberculosis C] >gi|124602024|gb|EAY61034.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase dxr [Mycobacterium tuberculosis C] (436 aa)
Score = 411, Expect = 3.2e-38, Identities = 102/250 (40%), Positives = 150/250 (60%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +V+V G+TG+IG  +L++I    + +E+VG +    +   L  + +     V + +V  ++             ++   L+E+T  D++LNALVG  GL  TL ALK    LALANKESLV  G L+  L+ +   +I PVDSEHS+L   L+     E+ +L++T SGGPF      +L ++    A  HP W+MG   +++SA+++NK  E+IE + LF     +I V  H QSIIHSM+ F D S IA  S PDMKL I   L
  S:    37 RVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTL--LRQRAQTGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGGSLV--LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLAL 298
>gi|157372021|ref|YP_001480010.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Serratia proteamaculans 568] >gi|166920133|sp|A8GIE2|DXR_SERP5 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|157323785|gb|ABV42882.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Serratia proteamaculans 568] (398 aa)
Score = 409, Expect = 4.8e-38, Identities = 101/288 (35%), Positives = 172/288 (59%)
  Q:    78 ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           EL    + D +  A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ P+DSEH++++ SL  + +            +  +++T SGGPF      +   +    A  HPNW+MG+KIS+DSATMMNK  E IEA +LFN   ++++V  H QS+IHSM+++TD S +A +  PDM+  I   ++  +   + +  L F  + +LTF+E + +++  ++ A +  +   +A    +NAANE A+  F + +I+F DI  + +K +  L   E + +  +L +++  R+
  S:    87 ELAALDDVDQVTAAIVGAAGLLPTLAAIRAGKQVLLANKESLVTCGRLFMDAVQQSKTQLLPLDSEHNAIFQSLPESIQRQLGYSSLESHGVSRIVLTGSGGPFRTTPLEQFTAMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQMEVILHPQSVIHSMVRYTDGSVLAQLGTPDMRTPIAHAMAYPQRVNSGVEALDFCRIGSLTFAEPERERYPCLYLAIEAFD-AGQAATTALNAANEVAVAAFLQEQIRFTDIAAVNQKVVERLSLQEPSCIDAVLEIDRQARE 387
>gi|77463260|ref|YP_352764.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacter sphaeroides 2.4.1] >gi|77387678|gb|ABA78863.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacter sphaeroides 2.4.1] (394 aa)
Score = 408, Expect = 6.6e-38, Identities = 107/331 (32%), Positives = 182/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK----ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI-----------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + +FGATG+IG S+ +++ +    E +  V  +   N  +  E+       L  +     ++ + +  E L  T  ++                  ++A+VG +GL   + ALK+   LALANKESLV AG L+    R + + I PVDSEHS+++ +L   +   ++ +IIT SGGPF       +     A+A  HPNW+MG++ISIDSA+M NK  E+IE   ++ F   +I+   H QSI+H+M+ F D   +A++   DM+ +I   L+        +  +    + +LTF   D +++  +  A D +  +  +     NAA E A+  F   +I FLD+  ++E+ +
  S:     2 RSLSIFGATGSIGESTFDLVMRKGGPEAFRTVALTGGRNIRRLAEMARALKAELAVTAH---EDCLPALREALAGTGTEVAGGAQAIAEAADRPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTARENGATILPVDSEHSAVFQALAGEDTACVERVIITASGGPFRDWSLERIRACTVAEAQAHPNWSMGQRISIDSASMFNKALELIETREFFGFEPDRIEAVVHPQSIVHAMVGFCDGGLMAHLGPADMRHAIGFALNWPGRGEVPVARIDLAQIASLTFQRPDEERFPALRLARDVMAARGLS-GAAFNAAKEIALDHFIAGRIGFLDMAAVVEETL 353
>gi|120403251|ref|YP_953080.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium vanbaalenii PYR-1] >gi|119956069|gb|ABM13074.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium vanbaalenii PYR-1] (390 aa)
Score = 408, Expect = 7.3e-38, Identities = 101/256 (39%), Positives = 152/256 (59%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFN---------NNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESK 268
           +V++ G+TG+IG  +L++I    + +++VG +              E  +  I     A   +    T +  ++   L+E T  D++LNALVG  GL  TL AL     LALANKESLV  G L++  K ++  +I PVDSEHS+L   L+     E+  L++T SGGPF+    + L ++    A  HP W+MG   +++SA+++NK  E+IE + LF  +  +I V  H QSI+HSM+ FTD S +A  S PDMKL I   L G+ S+
  S:     9 RVVILGSTGSIGTQALDVIAANPDRFQVVGLAAGGGNTDLLARQRAETGVTNIAVADEAAATAVGGVTYSGPDAATRLVENTEADVVLNALVGALGLKPTLAALATGARLALANKESLVAGGPLVQ--KAAAPGQIVPVDSEHSALAQCLRGGTGDEVARLVLTASGGPFHGWTADRLEDVTPEQAAAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGVDYDRIDVVVHPQSIVHSMVTFTDGSTLAQASPPDMKLPIALAL-GWPSR 275
>gi|38234079|ref|NP_939846.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium diphtheriae NCTC 13129] >gi|59797573|sp|Q6NGL1|DXR_CORDI 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|38200341|emb|CAE50027.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium diphtheriae] (387 aa)
Score = 407, Expect = 1.0e-37, Identities = 117/332 (35%), Positives = 185/332 (55%)
  Q:    11 KKKVLVFGATGNIGFSSLEII--EKENYELVGFSFNNN----------------------YEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNN-NKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +KK+L+ G+TG+IG  +LE+I   ++ +E+VG +                           EK+   ++R   A V S         ++  +L+E    D +LN LVG  GL  TL  ++    LALANKESLV  G  +    +++  +I PVDSEHS++   L++  + E+ +L++T SGGPF      E+ ++    A  HP W+MG+  +++SAT++NK  E+IEA  LF+    +I+V  H QSI+HSM+ F D + IA  S P M LSI   L+           L F+  +   F  +D + +  +  A +    Q    P + NAANE+A   F   +IKF  I +I+ + +
  S:     2 RKKILILGSTGSIGTQALEVIASRQDQFEVVGIAAGGRDPQLIIQQAQMLGLAADHVAVANEKSATQVSRALGAAVLSGR-------DAATDLVESVPADTVLNGLVGSMGLRATLATIQLGEVLALANKESLVAGGTFVT--SQAAPGQIVPVDSEHSAMAQCLRSGASAEVSKLVLTASGGPFRGWSREEMWDVTPEQAAAHPTWSMGQMNTLNSATLINKGLELIEATLLFDIPADRIEVTVHPQSIVHSMVTFCDGATIAQASPPSMLLSISHALAWPHRVPEAQPALDFSQASTWDFMPVDNEAFPAVELAREVALKQG-TYPAVYNAANEQAAAAFLRGRIKFPQIVDIVGEVV 351
>gi|92112702|ref|YP_572630.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chromohalobacter salexigens DSM 3043] >gi|91795792|gb|ABE57931.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Chromohalobacter salexigens DSM 3043] (390 aa)
Score = 406, Expect = 1.3e-37, Identities = 118/350 (33%), Positives = 192/350 (54%)
  Q:    16 VFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKAL-EIINRFPNALVFSPS----------------VKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           V GATG+IG S+L++I +  E Y L   + + + E    + +   P+  V                     + +    +  E+    + D+++ A++G +GL  TL A++    + LANKE+LV++G L  D      + + P+DSEH+++Y  L   ++       + +L++T SGGPF      +L  +    A  HPNW+MG+KIS+DSAT+MNK  E+IEA +LF+ +  +I+V  H QS+IHSM  ++D S IA M  PDM+  I  GL+  E     +  L  F    L F   D  ++  +  A + +     A P  +NAANE A+  F E ++KF  I  ++     A E    + L+ +L  +   R+
  S:     3 VLGATGSIGRSTLDVIGRHPERYRLHALTAHRSRETLRDQCLAHRPDIAVLGTEDDAAWLRAALSDAGLDTEVRAGEAALAEVAGSRDSDVVMAAIMGAAGLMPTLAAVRAGKRVLLANKEALVMSGALFMDAVDRHGAVLLPIDSEHNAIYQCLPTEHRGGLTRHGVTQLLLTASGGPFRGWSQAQLDEVTPEQACAHPNWSMGRKISVDSATLMNKGLELIEACWLFDARPEQIQVVVHPQSVIHSMAAYSDGSVIAQMGNPDMRTPIAHGLAWPERIDAGVAPLDLFAVARLDFEAPDESRFPCLRLAREAMAAGGTA-PATLNAANEVAVAAFLEGRLKFAQIPALVAVVCEACEVQSAHTLEAVLAADATARR 379
>gi|119717428|ref|YP_924393.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nocardioides sp. JS614] >gi|119538089|gb|ABL82706.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Nocardioides sp. JS614] (372 aa)
Score = 405, Expect = 1.4e-37, Identities = 113/359 (31%), Positives = 188/359 (52%)
  Q:     7 MENKKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEK-TNP-DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           M    + V + G+TG+IG  +L+++    + + +V  +   +  +  E          F+P+     +    E  +E  T P D++LN + G  GL  TL AL     LALANKESL++ G L+  L+R+   +I PVDSEHS++   L+     E++ L++T SGGPF  +   EL ++  A A+ HP W+MG  I+I+SAT++NK  E+IEA+ LF     +I+V  H  S++HSM++F D S +   S P M + I  GLS  +   +    + ++      F  +D   +  +  A +  +    A P + NAANE A+  F    + F +I   ++  +   +      ++DIL  +   R+
  S:     1 MSRPVRDVAILGSTGSIGTQALDLVRANPDRFRVVALTAGGSSPELFE-----RQVAEFAPAYPDLFSGLGEEASVEAATRPCDVVLNGITGAVGLRPTLAALDAGHTLALANKESLIMGGPLV--LERAKPGQIVPVDSEHSAIAQCLRGGRADEVRRLVLTASGGPFRGRTREELADVTPAQAMAHPTWDMGPVITINSATLVNKGLEVIEAHLLFGIPFDRIEVVVHPTSVVHSMVEFVDGSTLVQASPPTMLIPIALGLSWPDRVPDAAPPVDWSRPETWEFFPLDDAAFPAVALAREAGQRGGTA-PAVYNAANEVAVDAFRTGALAFTEIVPTVQAVLSRHDVPSEVTIEDILAADAWARE 359
>gi|13882713|gb|AAK47263.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium tuberculosis CDC1551] (399 aa)
Score = 405, Expect = 1.5e-37, Identities = 101/249 (40%), Positives = 149/249 (59%)
  Q:    14 VLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTV-----------NSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           ++V G+TG+IG  +L++I    + +E+VG +    +   L  + +     V + +V  ++             ++   L+E+T  D++LNALVG  GL  TL ALK    LALANKESLV  G L+  L+ +   +I PVDSEHS+L   L+     E+ +L++T SGGPF      +L ++    A  HP W+MG   +++SA+++NK  E+IE + LF     +I V  H QSIIHSM+ F D S IA  S PDMKL I   L
  S:     1 MVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTL--LRQRAQTGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGGSLV--LRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLAL 261
>gi|28868746|ref|NP_791365.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas syringae pv. tomato str. DC3000] >gi|32171373|sp|Q886N7|DXR_PSESM 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|28851985|gb|AAO55060.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas syringae pv. tomato str. DC3000] (396 aa)
Score = 405, Expect = 1.5e-37, Identities = 112/331 (33%), Positives = 190/331 (57%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEI-INRFPNALVFSPSVKTKNTVNSFE----------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + + GATG+IG S+L+++ +     + + L GFS     ++ L + I   P   V    V  +   +                   E+      D ++ A+VG +GL  TL A++    + LANKE+LV++G L     R S + + P+DSEH++++  L  +         ++ +++T SGGPF +    +L ++    A  HP W+MG+KIS+DSATMMNK  E+IEA +LF+ +  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+      + +  L  F    L F E D +++  +  A    E    A P ++NAANE A+  F + +I++L+I  IIE+ +
  S:     5 QHITILGATGSIGLSTLDVVARHPTLYQVFALTGFS---RLDELLALCIKHTPQYAVVPEQVAARKLQDDLAAAGLDTRVLVGEGGLCEVAAHPMVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMQAVRQSGAVLLPIDSEHNAIFQCLPGDFARGLGAVGVRRIMLTASGGPFRETPLEQLQDVTPEQACAHPVWSMGRKISVDSATMMNKGLELIEACWLFDARPDQVEVVIHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPARVDSGVAPLDLFRIGQLDFQEPDEERFPCLRLARQAAEAGGSA-PAMLNAANEVAVAAFLDGRIRYLEIAGIIEEVL 362
>gi|118466156|ref|YP_882902.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium avium 104] >gi|166218267|sp|A0QJ14|DXR_MYCA1 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|118167443|gb|ABK68340.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium avium 104] (407 aa)
Score = 405, Expect = 1.7e-37, Identities = 103/250 (41%), Positives = 149/250 (59%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFN----------------NNYEKALEIINRFPNALVF-SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +VLV G+TG+IG  +L++I    + +E+VG +                   N   A E   R    + F  P   T+        L+E+T  D++LNALVG  GL  TL AL++   LALANKESL+  G L+  L  ++  +I PVDSEHS+L   L+     E+ +L++T SGGPF      EL ++    A  HP W+MG   +++SA+++NK  E+IE + LF     +I+V  H QSI+HSM+ F D S +A  S PDM+L I   L
  S:    15 RVLVLGSTGSIGTQALQVIAANPDRFEVVGLAAGGANLDTLLRQRAETGVTNVAVADEHAARRAGDIPFCGPEAATR--------LVEETEADVVLNALVGALGLRPTLAALESGARLALANKESLIAGGPLV--LAAAAPGQIVPVDSEHSALAQCLRGGTGDEVAKLVLTASGGPFRGWTAEELEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYDRIEVVVHPQSIVHSMVTFVDGSTLAQASPPDMRLPISLAL 276
>gi|59797598|sp|Q73VS1|DXR_MYCPA 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (407 aa)
Score = 405, Expect = 1.7e-37, Identities = 103/250 (41%), Positives = 149/250 (59%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFN----------------NNYEKALEIINRFPNALVF-SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +VLV G+TG+IG  +L++I    + +E+VG +                   N   A E   R    + F  P   T+        L+E+T  D++LNALVG  GL  TL AL++   LALANKESL+  G L+  L  ++  +I PVDSEHS+L   L+     E+ +L++T SGGPF      EL ++    A  HP W+MG   +++SA+++NK  E+IE + LF     +I+V  H QSI+HSM+ F D S +A  S PDM+L I   L
  S:    15 RVLVLGSTGSIGTQALQVIAANPDRFEVVGLAAGGANLDTLLRQRAETGVTNVAVADEHAARRAGDIPFCGPEAATR--------LVEETEADVVLNALVGALGLRPTLAALESGARLALANKESLIAGGPLV--LAAAAPGQIVPVDSEHSALAQCLRGGTGDEVAKLVLTASGGPFRGWTAEELEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYDRIEVVVHPQSIVHSMVTFVDGSTLAQASPPDMRLPISLAL 276
>gi|41409038|ref|NP_961874.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41397397|gb|AAS05257.1| hypothetical protein MAP_2940c [Mycobacterium avium subsp. paratuberculosis K-10] (419 aa)
Score = 405, Expect = 1.7e-37, Identities = 103/250 (41%), Positives = 149/250 (59%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFN----------------NNYEKALEIINRFPNALVF-SPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +VLV G+TG+IG  +L++I    + +E+VG +                   N   A E   R    + F  P   T+        L+E+T  D++LNALVG  GL  TL AL++   LALANKESL+  G L+  L  ++  +I PVDSEHS+L   L+     E+ +L++T SGGPF      EL ++    A  HP W+MG   +++SA+++NK  E+IE + LF     +I+V  H QSI+HSM+ F D S +A  S PDM+L I   L
  S:    27 RVLVLGSTGSIGTQALQVIAANPDRFEVVGLAAGGANLDTLLRQRAETGVTNVAVADEHAARRAGDIPFCGPEAATR--------LVEETEADVVLNALVGALGLRPTLAALESGARLALANKESLIAGGPLV--LAAAAPGQIVPVDSEHSALAQCLRGGTGDEVAKLVLTASGGPFRGWTAEELEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYDRIEVVVHPQSIVHSMVTFVDGSTLAQASPPDMRLPISLAL 288
>gi|24987413|pdb|1JVS|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase; A Target Enzyme For Antimalarial Drugs >gi|24987414|pdb|1JVS|B Chain B, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase; A Target Enzyme For Antimalarial Drugs (400 aa)
Score = 404, Expect = 2.2e-37, Identities = 115/354 (32%), Positives = 190/354 (53%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D +  A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L       A +HPNW+ G+KIS+DSAT  NK  E IEA +LFN    + +V  H QS+IHS +++ D S +A +  PD +  I    +      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +   +  E   + D+L+++ N R+
  S:     2 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRXVEQCLEFSPRYAVXDDEASAKLLKTXLQQQGSRTEVLSGQQAACDXAALEDVDQVXAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFXDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATXTPDQACRHPNWSXGRKISVDSATXXNKGLEYIEARWLFNASASQXEVLIHPQSVIHSXVRYQDGSVLAQLGEPDXRTPIAHTXAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAXEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKXDXREPQCVDDVLSVDANARE 387
>gi|51247218|pdb|1Q0H|A Chain A, Crystal Structure Of Selenomethionine-Labelled Dxr In Complex With Fosmidomycin (406 aa)
Score = 404, Expect = 2.3e-37, Identities = 115/354 (32%), Positives = 190/354 (53%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF-PNALVFSPSVKTKNTVNSFEELLEKT----------------NPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRK 365
           K++ + G+TG+IG S+L+++    E++ +V      N  + +E    F P   V       K      ++   +T                + D +  A+VG +GL  TL A++    + LANKESLV  G L  D  + S +++ PVDSEH++++ SL                 +  +++T SGGPF +    +L       A +HPNW+ G+KIS+DSAT  NK  E IEA +LFN    + +V  H QS+IHS +++ D S +A +  PD +  I    +      + +  L F  L+ LTF+  D D++  +  A +  E Q +A    +NAANE  +  F   +I+F DI  +    +   +  E   + D+L+++ N R+
  S:    10 KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRXVEQCLEFSPRYAVXDDEASAKLLKTXLQQQGSRTEVLSGQQAACDXAALEDVDQVXAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFXDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATXTPDQACRHPNWSXGRKISVDSATXXNKGLEYIEARWLFNASASQXEVLIHPQSVIHSXVRYQDGSVLAQLGEPDXRTPIAHTXAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAXEAFE-QGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKXDXREPQCVDDVLSVDANARE 395
>gi|15827831|ref|NP_302094.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium leprae TN] >gi|18202764|sp|Q9CBU3|DXR_MYCLE 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|13093383|emb|CAC30534.1| possible 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium leprae] (406 aa)
Score = 403, Expect = 2.6e-37, Identities = 104/250 (41%), Positives = 144/250 (57%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNNYEKAL----------EIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGL 262
           +VLV G+TG+IG  +LE+I    + +E+VG +        L           I      A   +  +    T ++   L+E+T  D++LNALVG  GL  TL AL     LALANKESLV  G L+  L  +   +I PVDSEHS+L   L+     E+ +L++T SGGPF      +L  +    A  HP W+MG   +++SA+++NK  E+IEA  LF     +I+V  H QSI+HSM+ F D S IA  S PDMKL I   L
  S:    14 RVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGGAQLDTLLRQRAATGVTNIAIADDRAAQLAGDIPYHGT-DAVTRLVEETEADVVLNALVGALGLRPTLAALHTGARLALANKESLVAGGSLV--LAAAQPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGPFRGWNAGDLERVTPEQAGVHPTWSMGTMNTLNSASLVNKGLELIEANLLFGIPYDRIEVVVHPQSIVHSMVTFIDGSTIAQASPPDMKLPISLAL 275
>gi|126462134|ref|YP_001043248.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacter sphaeroides ATCC 17029] >gi|126103798|gb|ABN76476.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodobacter sphaeroides ATCC 17029] (394 aa)
Score = 403, Expect = 2.6e-37, Identities = 106/331 (32%), Positives = 182/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK----ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNPDI-----------------ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEA--YYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + + +FGATG+IG S+ +++ +    E +  V  +   N  +  E+       L  +     ++ + +  E L  T  ++                  ++A+VG +GL   + ALK+   LALANKESLV AG L+      + + I PVDSEHS+++ +L   +   ++ +IIT SGGPF       +     A+A  HPNW+MG++ISIDSA+M NK  E+IE   ++ F   +I+   H QSI+H+M+ F D   +A++   DM+ +I   L+        +  +    + +LTF + D +++  +  A D +  +  +     NAA E A+  F   +I FLD+  ++E+ +
  S:     2 RSLSIFGATGSIGESTFDLVMRKGGPEAFRTVALTGGRNIRRLAEMARALKAELAVTAH---EDCLPALREALAGTGTEVAGGAQAIAEAADRPADWTMSAIVGAAGLVPGMRALKHGRTLALANKESLVTAGQLLMRTAEENGATILPVDSEHSAVFQALAGEDTACVERVIITASGGPFRDWSLERIRACTVAEAQAHPNWSMGQRISIDSASMFNKALELIETREFFGFEPDRIEAVVHPQSIVHAMVGFCDGGLMAHLGPADMRHAIGFALNWPGRGEVPVARIDLAQIASLTFQKPDEERFPALRLARDVMAARGLS-GAAFNAAKEIALDHFIAGRIGFLDMAAVVEETL 353
>gi|89054946|ref|YP_510397.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Jannaschia sp. CCS1] >gi|122498450|sp|Q28PJ0|DXR_JANSC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|88864495|gb|ABD55372.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Jannaschia sp. CCS1] (393 aa)
Score = 403, Expect = 2.6e-37, Identities = 122/355 (34%), Positives = 202/355 (56%)
  Q:    10 KKKKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIAL--ENTEVN---DLKDILNLNKNTR 364
           +K++V +FGATG+IG +++++I +  E Y++V  +   N      I     +A   S S+     V + EELL                             D I++A+VG +GL     AL++   LALANKESLV AG L+     +  + I PVDSEHS+++ +L   +   ++ +IIT SGG       ++L     ADA  HPNW+MG++I+IDSA+M NK  E+IE    F     +I+   H QS+IH+++ FTD + +A++  PDM+ +I   L+ Y  + +L ++ L    +  L F      ++  +  A + ++   ++   I NAA E A+  F   KI F+D+  I+   + A+  +N+  N    L+D+L  ++  R
  S:     6 EKRRVSIFGATGSIGQNTIDLIARAPEAYDVVALTGARN------IAQLAADARRLSASI----AVTAEEELLPDLRAALEGSGVEAAAGEAALLEAADRPADWIMSAIVGAAGLAPGFRALRHGTTLALANKESLVTAGPLLLAEAATHGATILPVDSEHSAVFQALVGEDIAAVERIIITASGGGLRDWPEDDLARATPADAGAHPNWDMGQRITIDSASMFNKAMELIETKEFFGVSPARIEAVVHPQSLIHALVGFTDGALMAHLGPPDMRHAIGYALN-YPDRAHLPVDRLDLAQIARLEFHAPSDTRYPALKIAREVMQTGGQS-GCIFNAAKEIALDGFLAGKIGFMDMSGIVSDTLDAMSSKNSLSNAPETLEDVLQTDQMAR 384
>gi|66044597|ref|YP_234438.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas syringae pv. syringae B728a] >gi|75502999|sp|Q4ZWS2|DXR_PSEU2 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|63255304|gb|AAY36400.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas syringae pv. syringae B728a] (396 aa)
Score = 403, Expect = 2.8e-37, Identities = 115/353 (32%), Positives = 197/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEI-INRFPNALVFSPSVKTKNTVNSFE----------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           +++ + GATG+IG S+L+++ +     + + L GFS     ++ L + I   P   V    V  +   +                   E+      D ++ A+VG +GL  TL A++    + LANKE+LV++G L     R + + + P+DSEH++++  L  +         ++ +++T SGGPF +    +L N+    A  HP W+MG+KIS+DSATMMNK  E+IEA +LF+ +  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+      + +  L  F    L F   D +++  +  A    E    A P ++NAANE A+  F + +I++L+I  IIE+ +     T V  L+ +   +   R
  S:     5 QQISILGATGSIGLSTLDVVARHPALYQVFALTGFS---RLDELLALCIRHTPQYAVVPDQVVARKLQDDLAAAGLDTRVLVGEGGLCEVAADPRVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGALFMQAVRQNGAVLLPIDSEHNAIFQCLPGDFARGLGAVGVRRIMLTASGGPFRETPLEQLHNVTPEQACAHPVWSMGRKISVDSATMMNKGLELIEACWLFDARPDQVEVVIHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPARVDSGVAPLDLFRIGQLDFQAPDEERFPCLRLARQAAEAGGSA-PAMLNAANEVAVAAFLDGRIRYLEIAGIIEEVLDHEPVTAVEGLEAVFAADAKAR 384
>gi|117618840|ref|YP_855720.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166218232|sp|A0KHG9|DXR_AERHH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|117560247|gb|ABK37195.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (397 aa)
Score = 403, Expect = 3.0e-37, Identities = 116/357 (32%), Positives = 202/357 (56%)
  Q:    14 VLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYE----KALEIINRFP------NALVFSPSVKTKNTVN-------SFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE-----------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVYDF 370
           +++ GA+G+IG S+L+++      ++++  +   + E      LE   RF        A   +  +KT  +         +  E+    +   ++ A+VG +GL  T+ A++    + LANKE+LV++G    +  R   + + P+DSEH++++  L    +            I ++++T SGGPF   +  EL ++  A A+ HPNW+MG KIS+DSATM+NK  E IEA +LFN   ++I+V  H QS+IHSM+++ D S +A +  PDM   I   L+      + +  L F ++   +F   D +++  +  A    + Q +A    +NAANEEA+  F   +I F+DI  + E  ++AL  T    L D++ L+   R   ++ 
  S:     4 LVILGASGSIGQSTLKVLRHNPGRWQVLALTAARSVEAMLRDCLEFSPRFAVMVDEAAASELAAQLKTHGSATRVMAGPAALCEVAAHPDAHSVMAAIVGAAGLAPTMAAVRAGKRILLANKEALVMSGAFFMEAVREHGAELLPIDSEHNAIFQCLPEAIQRQPGFCDLAGAGISKILLTGSGGPFRYTDIGELAHVTPAQAIAHPNWSMGAKISVDSATMINKGLEYIEARWLFNAAPEQIQVVIHPQSVIHSMVQYKDGSVLAQLGNPDMCTPIAHALAYPARVESGVEPLDFFSVGEFSFIRPDYERYPCLQLAMHACQ-QGQAATTALNAANEEAVAAFLAERIGFMDIARVNEATMLALGGTAAGSLDDLIALDGAARARAHNL 392
>gi|83951887|ref|ZP_00960619.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseovarius nubinhibens ISM] >gi|83836893|gb|EAP76190.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseovarius nubinhibens ISM] (390 aa)
Score = 402, Expect = 3.5e-37, Identities = 113/358 (31%), Positives = 198/358 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTNP------------------------DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLN-LTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVND-----LKDILNLNKNTRKYVYD 369
           K++ + GATG+IG S++++I +  E Y +   +   N     +   R          +  +  V + ++LL+                            D +++A+VG +GL   L A+     LALANKESLV AG ++ D  R + + I PVDSEHS ++ +L+  +   ++ +IIT SGGPF  +   +L ++   +A++HP+W+MG++I+IDSA+M NK  E+IE    F    ++I+   H QSIIH+++   D   IA+M  PDM+ +I   L   E +   +  L    L  L+F++    +++ +  A   ++ Q      + NAA E A+  F   +  FL + +++  A+  +   E  D     L+ + + ++ TR+ V D
  S:     2 KRISILGATGSIGQSTVDLIARAPEAYAVEAMTGGRNIALLAQDARR----------LGARIAVTAHDDLLDDLRAALAGSGVEAAAGRAALLEAAARPVDWVMSAIVGSAGLEPGLAAVDTGATLALANKESLVTAGPILLDHGRRAGATILPVDSEHSGIFQALRGEDMASVERVIITASGGPFRDRSREDLASVTVEEALQHPSWSMGQRITIDSASMFNKAMEMIETKEFFGIEAERIEAVIHPQSIIHALVGHCDGGMIAHMGAPDMRHAIGYALHWPERRDLPVERLDLVALGALSFAKACPKRFRALGLARQVMD-QGGLSGAVFNAAKERALDHFLAGRASFLQMDDLVAGALDRMMGREGFDRVEMTLETVSHADQVTRQAVDD 383
>gi|114764268|ref|ZP_01443496.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseovarius sp. HTCC2601] >gi|114543216|gb|EAU46233.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Roseovarius sp. HTCC2601] (390 aa)
Score = 401, Expect = 4.1e-37, Identities = 105/331 (31%), Positives = 181/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFS------PSVKTKNTVNSFEE------LLEKTN--PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +++ +FGATG+IG +++++I++  E Y +V  S   N  +  E        +  +      P ++ +   +  E       L+E  +   D +++A+VG +GL   L AL+    LALANKES+V AG L+    R+    + PVDSEHS+++ +L   +   ++ +IIT SGG F      +L       A  HPNW+MG++I+IDSA+M NK  E+IE    F+     I+V  H +S+IH+++ F D + +A++  PDM+ +I   L         +  L    +   TF E    +W  +  A + ++    +   + NAA E A+  F   +I F  + E++E+ +
  S:     2 RRISIFGATGSIGQNTIDLIKRDPEAYHVVALSGGRNIAQLAEDARALKAEIAVTADPSLLPELRERLAGSGVEAAAGETALVEAAHRPADWVMSAIVGAAGLPPGLAALEQGASLALANKESMVCAGPLVMQTARAHGGAVLPVDSEHSAVFQALIGEDLSAVERVIITASGGAFRDWPLEKLATATPEQAATHPNWDMGQRITIDSASMFNKALELIETKEFFDIDPGLIEVLVHPESMIHALVGFNDGALMAHVGPPDMRHAIGFALHHPRRLALPVERLDLVKMGQFTFREACEIRWPALRLAREVMQAGGLS-GAVFNAAKERALDAFIAKRIGFQQMAEVVEETL 351
>gi|29829105|ref|NP_823739.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Streptomyces avermitilis MA-4680] >gi|39930867|sp|Q82K41|DXR_STRAW 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|29606211|dbj|BAC70274.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Streptomyces avermitilis MA-4680] (394 aa)
Score = 401, Expect = 5.0e-37, Identities = 96/263 (36%), Positives = 151/263 (57%)
  Q:    80 LEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           L  ++   +LN + G  GL  TL AL+    LALANKESL+V G L++ L +    +I PVDSEH++L+ +L    + ++++L++T SGGPF  +   EL N++   A+ HP W MG  I+I+SAT++NK  E+IEA+ L++   ++I+V  H QS +HSM++FTD S +A  + PDM+  I  GL   E   +      +    +  F  +D D +  +  A    +    A P + NAANEE +  F    + F  I E + + +
  S:    89 LAASDCHTVLNGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVKALAKPG--QIIPVDSEHAALFQALAAGTRADVRKLVVTASGGPFRGRTKAELANVSPEHALAHPTWAMGPVITINSATLVNKGLEVIEAHLLYDIPFERIEVVVHPQSYVHSMVEFTDGSTLAQATPPDMRGPIAIGLGWPERVPDAAPAFDWTKASSWEFFPLDNDAFPSVGLARHVGQLAGTA-PAVFNAANEECVDAFLNGTLPFNGIMETVTRVV 352
>gi|94676749|ref|YP_588961.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|166218238|sp|Q1LSV3|DXR_BAUCH 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|94219899|gb|ABF14058.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (398 aa)
Score = 400, Expect = 5.3e-37, Identities = 121/353 (34%), Positives = 198/353 (56%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---VKTKNTVNSFE--------------------ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-----------NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNL-INDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           K + + G+TG+IG S+L +I++  + + +      NN+    +        L F PS   +  K      +                    EL      D ++ A+ G  GL  TL AL+    + LANKESLV  G L  +     ++++ PVDSEH++++  L             +   + ++I+T SGGPF +   + L  I    A  HPNW+MG+KIS+DSATMMNK  E IEA  LFN  T +I+V  H QSI HSM+++ D S +A ++ PDM++ I   LS Y ++  + +  L+F  L  L+F + D  ++  +  A +      +A    +NAANE A+  F + KI+F DI  + +  +  +   E + ++++L +++  R
  S:     2 KYLTILGSTGSIGTSTLTVIKQNPDKFTVRALVAKNNFTLMTK------QCLDFRPSWVGMVDKRAARELKANLAQLGIAINIISGNQAACELAALKEIDTVMAAIAGVDGLLSTLSALRAGKRVLLANKESLVSCGRLFMNEVHQHNAQLLPVDSEHNAIFQILPEPIQRQLGCLSLSKYGVSQIILTGSGGPFRQTPLDALATITSDQACIHPNWSMGRKISVDSATMMNKGLEYIEARCLFNASTDQIEVLLHPQSIFHSMVRYVDGSVLAQLAYPDMRIPITYALS-YPTRVPIKVTPLNFLQLGTLSFDQPDNKRYPCLQLAIE-ASKLGQAATTTLNAANEVAVAAFLQRKIRFTDIASVNQMVLDKINLEEPSSIEEVLCIDRQAR 386
>gi|71737341|ref|YP_275972.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|81170454|sp|Q48F65|DXR_PSE14 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|71557894|gb|AAZ37105.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas syringae pv. phaseolicola 1448A] (396 aa)
Score = 399, Expect = 7.4e-37, Identities = 116/353 (32%), Positives = 196/353 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK-----ENYELVGFSFNNNYEKALEIINRFPNALVFSPS---------------VKTKNTVNS--FEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKE------IKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTK--KIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLS-FNNLNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTR 364
           + + + GATG+IG S+L+++ +     + + L GFS     ++ L +  R        P                + T+  V      E+      D ++ A+VG +GL  TL A++    + LANKE+LV++G L     R S + + P+DSEH++++  L  +         ++ +++T SGGPF +    +L N+    A  HP W+MG+KIS+DSATMMNK  E+IEA +LF+ +  +++V  H QS+IHS++ + D S +A +  PDM+  I   L+      + +  L  F    L F + D +++  +  A    E    A P ++NAANE A+  F + +I++L+I  IIE+ +     T V  L  +   +   R
  S:     5 QHITILGATGSIGLSTLDVVARHPSRYQVFALTGFS---RLDELLALCVRHTPQYAVVPDQFVARKLQDDLAAAVLDTRVLVGEGGLCEVAAHPRVDAVMAAIVGAAGLRPTLAAVEAGKKVLLANKEALVMSGDLFMQAVRQSGAVLLPIDSEHNAIFQCLPGDFARGLGAVGVRRIMLTASGGPFRETPLEQLQNVTPEQACAHPVWSMGRKISVDSATMMNKGLELIEACWLFDARPDQVEVVIHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPARVDSGVAPLDLFRIGQLDFQKPDEERFPCLRLARHAAEAGGSA-PAMLNAANEVAVAAFLDGRIRYLEIAGIIEEVLNHEPVTAVEGLDAVFAADAKAR 384
>gi|161485970|ref|NP_738515.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium efficiens YS-314] >gi|39930899|sp|Q8FP80|DXR_COREF 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (394 aa)
Score = 398, Expect = 9.0e-37, Identities = 123/352 (34%), Positives = 189/352 (53%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNN-----YEKALEIINRFPNALVFSPS--------------VKTKNTVNSFEELLEKTNP-DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTE--VNDLKDILNLNKNTR 364
           K+L+ G+TG+IG  +LE+I    + + LVG +   +      E+A    N  P+ +  +                +   +   +  E ++ T+P D +LNALVG  GL  TL  L++   LALANKESLV  G  +  + ++   +I PVDSEHS++   L++  + E+  +++T SGGPF      ++  +    A  HP W+MG+  +++SAT++NK  E+IEA  LF+T    I V  H QSIIHSMI F D   IA  S P MKL I   ++           L F   +  TF  +D   +  +  A D +  Q    P + NAANEEA   F   +I+F  I +++ + +          +D+ DIL      R
  S:     7 KILILGSTGSIGTQALEVIADNPDLFTLVGIAAGGSNPGLVIEQA-RAFNLRPHQVAVAGKQAAGEVGEALGGTVIDGPDAAQTLVESVQATDPADAVLNALVGSMGLGATLATLRSGAHLALANKESLVAGGEFV--MAQARPGQIIPVDSEHSAMAQCLRSGTEGEVARIVLTASGGPFRGWTREQMWEVTPEQAAAHPTWSMGQMNTLNSATLINKGLELIEATLLFDTDADLIDVTVHPQSIIHSMITFRDGCTIAQASPPSMKLPIALAMNWPHRVPGAQPALDFTQAHTWTFEPVDDAAFPAVQLARD-VAKQKGTFPAVYNAANEEAAAAFLAGRIRFPQIVDVVSEILQGASQFAGVSSDVDDILATESEAR 382
>gi|90423942|ref|YP_532312.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris BisB18] >gi|122476315|sp|Q215E3|DXR_RHOPB 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|90105956|gb|ABD87993.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rhodopseudomonas palustris BisB18] (407 aa)
Score = 398, Expect = 9.1e-37, Identities = 119/331 (35%), Positives = 182/331 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           + V V GATG+IG S+++++    E Y++   + N N     ++   F    V   +V     ++     L  T                   D ++ A+ G +GL  TL A+     +ALANKE LV AG    D    + + I P DSEH++L+ +L + N+ E+ ++IIT SGGPF      ++     A A+KHPNW+MG+KI+IDSA+MMNK  E+IEA +LF  +  +I V  H QSIIH M++F+D S +A +  PDM+  I   L   +        L    +  LTF   D  ++  +  AY+ L   N A   + NAANE A+  F   +I+F  I  ++E+ +
  S:    17 RSVSVLGATGSIGDSTMDLLRASPERYQVEALTANTNVAGLAKLAREFNARFV---AVADPARLSELRAALAGTGIACGAGDSAIVEAAERPADWVMAAVAGAAGLKPTLAAVDRGAHVALANKECLVCAGEFFMDRAAKAGATILPADSEHNALFQALASGNRDELTKVIITASGGPFRTWAAADIEQATLAQALKHPNWSMGQKITIDSASMMNKGLEVIEASWLFALSPDEIDVVVHPQSIIHGMVEFSDRSVVAQLGSPDMRTPIAHCLGWPDRIVGRAAPLDLAKIGTLTFEAPDYARFPGLKLAYEALRAGNGAT-TVYNAANEVAVAAFIAQRIRFGAIARLVEETM 366
>gi|23493746|dbj|BAC18715.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium efficiens YS-314] (504 aa)
Score = 398, Expect = 1.0e-36, Identities = 123/352 (34%), Positives = 189/352 (53%)
  Q:    13 KVLVFGATGNIGFSSLEII--EKENYELVGFSFNNN-----YEKALEIINRFPNALVFSPS--------------VKTKNTVNSFEELLEKTNP-DIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTE--VNDLKDILNLNKNTR 364
           K+L+ G+TG+IG  +LE+I    + + LVG +   +      E+A    N  P+ +  +                +   +   +  E ++ T+P D +LNALVG  GL  TL  L++   LALANKESLV  G  +  + ++   +I PVDSEHS++   L++  + E+  +++T SGGPF      ++  +    A  HP W+MG+  +++SAT++NK  E+IEA  LF+T    I V  H QSIIHSMI F D   IA  S P MKL I   ++           L F   +  TF  +D   +  +  A D +  Q    P + NAANEEA   F   +I+F  I +++ + +          +D+ DIL      R
  S:   117 KILILGSTGSIGTQALEVIADNPDLFTLVGIAAGGSNPGLVIEQA-RAFNLRPHQVAVAGKQAAGEVGEALGGTVIDGPDAAQTLVESVQATDPADAVLNALVGSMGLGATLATLRSGAHLALANKESLVAGGEFV--MAQARPGQIIPVDSEHSAMAQCLRSGTEGEVARIVLTASGGPFRGWTREQMWEVTPEQAAAHPTWSMGQMNTLNSATLINKGLELIEATLLFDTDADLIDVTVHPQSIIHSMITFRDGCTIAQASPPSMKLPIALAMNWPHRVPGAQPALDFTQAHTWTFEPVDDAAFPAVQLARD-VAKQKGTFPAVYNAANEEAAAAFLAGRIRFPQIVDVVSEILQGASQFAGVSSDVDDILATESEAR 492
>gi|85708129|ref|ZP_01039195.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Erythrobacter sp. NAP1] >gi|85689663|gb|EAQ29666.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Erythrobacter sp. NAP1] (387 aa)
Score = 398, Expect = 1.0e-36, Identities = 108/349 (30%), Positives = 190/349 (54%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRF----------------PNALVFSPSVKTKNTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLF--NTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLN 360
           + + + GATG+IG S+L+++ +  +++++   S N + ++   +   F                 +AL  S  V+     ++  E   +   D+ + A+VG +GL  T+ A++    +ALANKE+LV AG ++      + + + P DSEH++++  L     +++  + +T SGGP        +       AV HPNW+MG KIS+DSATMMNK  E IEA++LF     ++++  H QS+IHSM+++ D S +A +   DM++ I   L+  E     +  L   ++  LTF   D +++     A + +E    A P ++NAANE A+  F   +I F  I  + E  +          L+D+L ++
  S:     3 RSITLLGATGSIGASTLDLVRRNPDDWQVEALSANCSAKELGALAREFGAKVAVVGDESCLGDLKDALAGS-GVEAAGGCDALCEAAARP-VDMTVAAIVGCAGLAPTMAAVRRGGTVALANKEALVSAGDVMMSAVAENGATLLPTDSEHNAIFQCLAGGKIEDVARITLTASGGPLRTWSREAIEAATPEQAVAHPNWSMGAKISVDSATMMNKGLEYIEAFHLFPVGLDRLRIVVHPQSVIHSMVEYRDRSTLAQLGPSDMRVPIASCLAWPERMETPLEPLDLTSIGELTFHAPDEERFPATRIAREAIEAGGGA-PAVLNAANEIAVEAFLAGQIGFSRITAVAEATLAGYSAAAPASLEDVLAID 370
>gi|32171397|sp|Q9AJD7|DXR_KITGR 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|13434973|dbj|BAB39759.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Kitasatospora griseola] (386 aa)
Score = 397, Expect = 1.3e-36, Identities = 90/255 (35%), Positives = 147/255 (57%)
  Q:    88 ILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNT--KKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNN-LNLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           +LN + G  GL  TL AL+    L LANKESL+V G L++ +  +   +I PVDSEH++L+ +L    + E+++L++T SGGPF  +   +L  +  ADA+ HP W MG  ++I+SAT++NK  E+IEA+ L++    +I+V  H QS++HSM++F D S +A  S PDM++ I  GL   +   +      +       F  +D + +  +  A + +       P + NAANEE +  F +  + F  I + + K +
  S:    97 VLNGITGSIGLAPTLAALRAGRVLVLANKESLIVGGPLVKAV--AQPGQIVPVDSEHAALFQALAGGARAEVRKLVVTASGGPFRNRTREQLAAVTPADALAHPTWAMGPVVTINSATLVNKGLEVIEAHLLYDVPFDRIEVVVHPQSVVHSMVEFVDGSTMAQASPPDMRMPIALGLGWPDRVPDAAPGCDWTKAATWEFFPLDNEAFPAVELARE-VGTLGGTAPAVFNAANEECVDAFLKGALPFTGIVDTVAKVV 352
>gi|46488698|gb|AAS99589.1| chloroplast 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Elaeis guineensis] (257 aa)
Score = 396, Expect = 1.9e-36, Identities = 90/235 (38%), Positives = 146/235 (62%)
  Q:    21 GNIGFSSLEIIEK--ENYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTKNTVNSFEELLEKT--NPDII------------------LNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKN-NNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMK 255
           G+IG  +L+I+ +  + + +V  +  +N     + + +F   LV   SV+ ++ V   +E L      P+II                  +  +VG +GL  T+ A++  +D+ALANKE+L+  G  +  L      +I P DSEHS+++  ++      ++ +I+T SGG F      +L  +  ADA+KHPNWNMGKKI++DSAT+ NK  E+IEA+YLF  +   I++  H QSIIHSM++  D+S +A +  PDM+
  S:     1 GSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKQFKPQLV---SVRNESLVGELKEALADAEHKPEIIPGEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGIDIALANKETLIAGGPFVLPLAHKHKVKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDLPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGAEYDIIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMR 257
>gi|84516075|ref|ZP_01003435.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Loktanella vestfoldensis SKA53] >gi|84509771|gb|EAQ06228.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Loktanella vestfoldensis SKA53] (389 aa)
Score = 393, Expect = 3.7e-36, Identities = 108/355 (30%), Positives = 197/355 (55%)
  Q:    12 KKVLVFGATGNIGFSSLEIIEKE--NYELVGFSFNNNYEKALEIINRFPNALVFSPSVKTK---NTVNSFEELLEKTN-----------------PDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNN-KEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFN--TKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALEN-----TEVNDLKDILNLNKNTRKY 366
           +++ +FGATG++G S++++I ++   Y++V  +   N +K         +A+     +      +   + ++ L  T                   D  L+A++G +GL   ++AL +   LALANKESLV AG ++    R++ + I PVDSEHS+++ +L   +   ++ +IIT SGG F     ++L +   A A  HPNW+MG++I+IDSA+M NK  E+IE    F   +  I+V  H +S+IH+++ F D + +A++  PDM+ +I   L   + +   +  L    + +L+F   D D++  +  A   ++    A   + NAA E A+  F   +I FL +  ++   +  + +      +   L D+L  ++  R Y
  S:     2 RRITLFGATGSVGQSAVDLIARDLDAYQVVALTGGRNIQKLAS------DAIALRAELAVTCHDDCYAALKDALAGTGIAVAAGDAAIKQAAMRPVDWALSAIIGSAGLVPGMIALDHGTTLALANKESLVTAGPVLMARARAAGATILPVDSEHSAVFQALVGEDMAAVERIIITASGGAFRDWPKDKLASATLAQASSHPNWDMGQRITIDSASMFNKAMELIETKEFFGVPSSMIEVLVHRESLIHALVGFNDGALMAHVGPPDMRHAIGYALHWPDRRHLPVERLDLAKIGSLSFQAPDEDRYPALALARQVMDTGGLA-GAVFNAAKERALDAFIAGQIGFLQMSAVVSGTLDKMSSGGGLQIQEMTLDDVLEADRLARIY 380
>gi|34557210|ref|NP_907025.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Wolinella succinogenes DSM 1740] >gi|81170462|sp|Q7M9M7|DXR_WOLSU 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|34482926|emb|CAE09925.1| 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE [Wolinella succinogenes] (358 aa)
Score = 393, Expect = 3.9e-36, Identities = 105/291 (36%), Positives = 161/291 (55%)
  Q:    78 ELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNKEIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKKIKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNL-NLTFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAIIALENTEVNDLKDILNLNKNTRKYVY 368
           E L       +LNALVGF GL  TL +L+    LALANKESLV  G  ++      +S+I PVDSEH SL+     ++K    L IT SGG F      E+       A++HPNW+MG+KI++DSATM+NK FEI+EA +LFNTK +       S++H++I + D S+ A+++  DM+L +   + G   +  L   L    L  L+F  I+  ++ P+ W        +  + I +NAANE A+  F E KI F +I   IE+++        + ++++  L+   R++ +
  S:    77 ESLHLAQSSFVLNALVGFLGLRPTLESLRLGKTLALANKESLVAGGSFVD------ASKIIPVDSEHFSLW--FLKSDKPFSRLFITASGGAFRDTPLEEIPLQKAQAALRHPNWSMGRKITVDSATMVNKLFEILEARWLFNTKSVDALIERNSLVHALIGYPDGSFSAHIAQADMRLPLAYAMLGKLDQP-LGPPLELERLAALSFEPINPSRY-PL-WNLKEKLLTHPWLGITLNAANEVAVEKFLEGKILFGEIPRYIERSLERFSMIPAS-IEELFALDSEVRQFAH 356
>gi|19553219|ref|NP_601221.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium glutamicum ATCC 13032] >gi|62390855|ref|YP_226257.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium glutamicum ATCC 13032] >gi|24211657|sp|Q8NP10|DXR_CORGL 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) >gi|21324786|dbj|BAB99409.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Corynebacterium glutamicum ATCC 13032] >gi|41326194|emb|CAF20356.1| PROBABLE 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE [Corynebacterium glutamicum ATCC 13032] (392 aa)
Score = 392, Expect = 5.3e-36, Identities = 116/331 (35%), Positives = 176/331 (53%)
  Q:    12 KKVLVFGATGNIGFSSLEII--EKENYELVGFS---------FNNNYEKALEIINRFPNALVFSPSVKTK------NTVNSFEELLEKTNPDIILNALVGFSGLHITLLALKNNVDLALANKESLVVAGWLIEDLKRSSSSRIYPVDSEHSSLYDSLKNNNK-EIKELIITCSGGPFYKKEFNELLNINFADAVKHPNWNMGKKISIDSATMMNKCFEIIEAYYLFNTKK--IKVYQHGQSIIHSMIKFTDNSYIANMSVPDMKLSIQQGLSGYESKTNLINDLSFNNLNL-TFSEIDLDKWKPIHWAYDFLENQNRAIPIIMNAANEEAIVLFEENKIKFLDIFEIIEKAI 342
           KK+L+ G+TG+IG  +L++I    + +E+VG +          +   +  L            +  +         +  ++ + L+E T  D +LNALVG  GL  TL  L++   LALANKESLV  G  +    ++   +I PVDSEHS++   L++  + E+  +++T SGGPF      ++  +    A  HP W MG+  +++SAT++NK  E+IEA  LF T    I V  H QSIIHSMI FTD + IA  S P MKL I   L            L F   +   F  +D   +  +  A   +  Q    P + NAANEEA   F   +IKF  I +++++ +
  S:     6 KKILILGSTGSIGTQALDVIADNSDKFEVVGIAAGGSQPDLVISQAQQLGLAADKVAVADAQAAAVISKALGGEIISGTDAAKILVETTKADTVLNALVGSLGLAATLATLESGAHLALANKESLVAGGEFVT--SKAKLGQIIP