>gi|26553601|ref|NP_757535.1| asparagine synthetase AsnA [Mycoplasma penetrans HF-2] >gi|47115818|sp|Q8EWQ5|ASNA_MYCPE Aspartate--ammonia ligase (Asparagine synthetase A) >gi|26453607|dbj|BAC43939.1| asparagine synthetase A [Mycoplasma penetrans HF-2] (326 aa)
Score = 1637, Expect = 1.5e-180, Identities = 326/326 (100%), Positives = 326/326 (100%)
  Q:     1 MYNLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           MYNLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL
  S:     1 MYNLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
>gi|31544820|ref|NP_853398.1| asparagine synthetase AsnA [Mycoplasma gallisepticum R] >gi|47115709|sp|Q7NAM0|ASNA_MYCGA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|31541666|gb|AAP56966.1| AsnA [Mycoplasma gallisepticum R] (329 aa)
Score = 951, Expect = 5.7e-101, Identities = 186/326 (57%), Positives = 250/326 (76%)
  Q:     1 MYNLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAE-NLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           M  L++LET+ AIK+IKDLFQ  L+  L L RV+APL++  + G+ND+LNG E PV+F S  NG+S ++ QSLAKWKR  + +YEIPL++G+Y DMNAIR DE+L + HS+YVDQWDWEL I + +RN+E LK  V KIY++++  Q +VN+KY  F + +LLPE I F+++++LL +YP+K P ERE+L+  KYKAVF++ +G  LS+ + HD R+PDYDDW LNGDI+V+N  +K ALELSSMGIRV++  L++QL++S  N R EL FHKKL+N E   +IGGGIGQSRLCYFLL K HIGEVQ+S W  +I+ EA+   IKLL
  S:     3 MKKLTLLETELAIKYIKDLFQNALSKELNLLRVSAPLIIAPDSGLNDNLNGWEAPVSFKSKTNGVSSQVVQSLAKWKRYSIARYEIPLYQGLYTDMNAIRMDETLDATHSMYVDQWDWELRISENDRNVEFLKNTVNKIYKVLKEAQLKVNEKYGIFEQKDLLPEHIHFVTTQELLDQYPDKNPSEREQLVCEKYKAVFVMQVGKKLSNNQVHDGRSPDYDDWSLNGDIMVYNPRSKKALELSSMGIRVNKEVLLKQLEESKQNERLELMFHKKLVNGELHQTIGGGIGQSRLCYFLLQKDHIGEVQASHWSDEIVVEAKAKGIKLL 329
>gi|169824569|ref|YP_001692180.1| aspartate-ammonia ligase [Finegoldia magna ATCC 29328] >gi|167831374|dbj|BAG08290.1| aspartate-ammonia ligase [Finegoldia magna ATCC 29328] (336 aa)
Score = 904, Expect = 1.6e-95, Identities = 187/324 (57%), Positives = 225/324 (69%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPV--TFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L +LETQKAIK IKD FQ  LA  L L RV+APL +  N GIND+LNG E PV   F  DG     EI QSLAKWKR+ L  Y IP+ EGIY DMNAIR  E   + HS+YVDQWDWE  I    RNLE LK  V+ IY+     Q  +   Y+ + E +L +EITFI++E+L + YP+ TP+ERE LI  KY +VF+IGIGD L  G+ H  R+PDYDDW LNGDI+V+N    + LELSSMGIRVD+  LV QLDK  NN RK L++H+ L+N E P SIGGGIGQSR+C F L K HIGEVQSS+WPK++L E  K  IKLL
  S:    12 SLDLLETQKAIKIIKDFFQYRLAETLNLTRVSAPLFVRANTGINDNLNGVEKPVGFEFLEDGTMSRLEIVQSLAKWKRIALKNYNIPVGEGIYTDMNAIRPSEICDNTHSLYVDQWDWEKVISNEHRNLEFLKETVRNIYKCFLDTQTMLINSYDDY-EKILKDEITFITTEELEEMYPDNTPEERENLITKKYGSVFLIGIGDALKSGESHSDRSPDYDDWSLNGDILVYNPVLDNCLELSSMGIRVDKDRLVYQLDKKQNNDRKNLEYHRMLLNDELPQSIGGGIGQSRICMFFLQKAHIGEVQSSIWPKEMLVECNKLGIKLL 336
>gi|166030430|ref|ZP_02233259.1| hypothetical protein DORFOR_00091 [Dorea formicigenerans ATCC 27755] >gi|166029788|gb|EDR48545.1| hypothetical protein DORFOR_00091 [Dorea formicigenerans ATCC 27755] (335 aa)
Score = 904, Expect = 1.8e-95, Identities = 173/324 (53%), Positives = 238/324 (73%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGE---IPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++++ ETQ+AIK+I+D FQ      + L R++APL +E++ G+ND+LNG E PV F  D  GI GE   +  SLAKWKRM L KY+    EG+Y +MNAIR+DE L ++HS YVDQWDWE  I+K +R  ETLK  V+ I++II+  + EV  KY    ++L P+++TFI++++L  RYP+KTPKERE LI  +Y  VF++ IGD L+ G+PHD RAPDYDDW+LNGDI+ W++T   ALE+SSMGIRVDE SL  QL K+    R+EL +HK L++ E PY+IGGGIGQSRLC  LL + H+GEVQ+SLWP+++ +   +++I LL
  S:    12 HMTVRETQEAIKYIRDTFQREFGKEMNLERISAPLFVEKSSGLNDNLNGVERPVQF--DVAGIPGETVEVVHSLAKWKRMALKKYDFEPGEGLYTNMNAIRRDEELDNLHSCYVDQWDWEKVIRKVDRTEETLKTTVRHIFKIIKHMEHEVWYKYPQAVKHL-PDDVTFITTQELEDRYPDKTPKERENLITKEYGCVFLMKIGDKLASGEPHDGRAPDYDDWQLNGDILFWHDTLDCALEISSMGIRVDEKSLASQLKKAGCEDRRELPYHKMLLHGELPYTIGGGIGQSRLCMLLLDRAHVGEVQASLWPEEMRQTCREHDIILL 335
>gi|153853056|ref|ZP_01994465.1| hypothetical protein DORLON_00450 [Dorea longicatena DSM 13814] >gi|149753842|gb|EDM63773.1| hypothetical protein DORLON_00450 [Dorea longicatena DSM 13814] (335 aa)
Score = 903, Expect = 2.3e-95, Identities = 181/323 (56%), Positives = 233/323 (72%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGE---IPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ETQ+AIK+I+D FQ      + L R++APL +E++ G+NDDLNG E PV F  D  G+ GE   +  SLAKWKRM L KY     EG+Y +MNAIR+DE L ++HS YVDQWDWE  IKK ER +ETL+  V+ I++II+  + EV  KY   A   LPE+I FI+S++L   YP+KTPKERE LI  ++  VF++ IGD L+ G+PHD RAPDYDDW+LNGDI+ W ET   ALE+SSMGIRVDE +L EQL K+    RK L +HK L+N E PY+IGGGIGQSRLC  LL + H+GEVQ+SLWP+++ E   ++NI LL
  S:    13 LSVRETQEAIKYIRDTFQKEFGKEMNLERISAPLFVEKSSGLNDDLNGVERPVQF--DIAGVPGETIEVVHSLAKWKRMALYKYGFQPGEGLYTNMNAIRRDEELDNLHSCYVDQWDWEKVIKKEERTVETLEATVRNIFKIIKHMEHEVWYKYPQ-AVKKLPEDIYFITSQELEDMYPDKTPKERENLITKEHGCVFLMKIGDKLASGEPHDGRAPDYDDWQLNGDILFWFETLNCALEISSMGIRVDEKALEEQLVKAGCEERKNLPYHKMLLNGELPYTIGGGIGQSRLCMLLLDRAHVGEVQASLWPEEMRETCREHNIILL 335
>gi|160938399|ref|ZP_02085754.1| hypothetical protein CLOBOL_03297 [Clostridium bolteae ATCC BAA-613] >gi|158438772|gb|EDP16529.1| hypothetical protein CLOBOL_03297 [Clostridium bolteae ATCC BAA-613] (345 aa)
Score = 881, Expect = 8.1e-93, Identities = 175/323 (54%), Positives = 231/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI ETQ AIK+I+D FQ  +   + L R++APL +E++ G+ND+LNG+E PV+F   G  G + E+  SLAKWKRM L KY     EG+Y +MNAIR+DE L ++HS YVDQWDWE  I K +R L+TLK  V++I++II+  Q EV  KY    ++L P++I FI+S++L   YP+ TPKERE LI  ++  VF++ IGD L+ GKPHD RAPDYDDWKLNGDI+ W E  + ALE+SSMGIRVDE +L  QL K+    R+ L +HK L+N E PY+IGGGIGQSRLC  LL + HIGEVQ+S+WP+ + +   +N I LL
  S:    23 LSIRETQDAIKYIRDTFQKEMGREMHLERISAPLFVEKSSGLNDNLNGTERPVSFDMLGLPGETLEVVHSLAKWKRMALKKYGFKPGEGLYTNMNAIRRDEELDNLHSCYVDQWDWERVITKEQRTLDTLKDTVREIFKIIKHMQHEVWYKYPEAVKHL-PKDIYFITSQELEDLYPDNTPKERENLITREHGCVFLMQIGDKLAGGKPHDGRAPDYDDWKLNGDILFWFEHLQCALEISSMGIRVDEAALEYQLKKAGCEDRRSLPYHKMLLNGELPYTIGGGIGQSRLCMLLLDRAHIGEVQASIWPQKMRDICGENKIYLL 345
>gi|167756398|ref|ZP_02428525.1| hypothetical protein CLORAM_01931 [Clostridium ramosum DSM 1402] >gi|167703806|gb|EDS18385.1| hypothetical protein CLORAM_01931 [Clostridium ramosum DSM 1402] (335 aa)
Score = 878, Expect = 1.7e-92, Identities = 175/323 (54%), Positives = 233/323 (72%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGE---IPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +TQ+AIK+I+D FQ  +  AL L R++APL ++++ G+ND+LNG E+PV+FT   N I GE   +  SLAKWKRM L KY   +HEG+Y +MNAIRKDE + ++HS YVDQWDWE  I K ER  ETLK  VKKI+++I+  + EV  KY   A N LP++I F +S++L  RYP+ TP ERE  I  +   VF++G+G  L  G  HD RAPDYDDW LNGDI+ W E  + ALE+SSMGIRVDE +LV+QL   N   R +L +H +++NKE PY+IGGGIGQSRLC  LL K H+GEVQ+S+WP+++++E  K+NI LL
  S:    13 LDLRQTQEAIKYIRDTFQKEIGRALHLSRISAPLFVQKSSGLNDNLNGFESPVSFTI--NEIPGEQIEVVHSLAKWKRMALKKYGFKMHEGLYTNMNAIRKDEEVDNLHSYYVDQWDWEKVIAKEERTEETLKRHVKKIFKVIKHMEHEVWYKYP-HAVNRLPDKIHFFTSQELEDRYPDLTPNERETAICKELGCVFVMGVGCKLKSGIKHDGRAPDYDDWNLNGDILFWFEPLQCALEISSMGIRVDEDTLVKQLKAENCLDRLKLPYHSQIVNKELPYTIGGGIGQSRLCMLLLKKVHVGEVQASIWPQEMIDECTKHNINLL 335
>gi|169350389|ref|ZP_02867327.1| hypothetical protein CLOSPI_01157 [Clostridium spiroforme DSM 1552] >gi|169292709|gb|EDS74842.1| hypothetical protein CLOSPI_01157 [Clostridium spiroforme DSM 1552] (335 aa)
Score = 875, Expect = 3.7e-92, Identities = 172/323 (53%), Positives = 232/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +TQ+AIK+I+D FQ  +  AL+L R++APL + ++ G+ND+LNG E PV+F          E+  SLAKWKRM L KY   +HEG+Y +MNAIRKDE + ++HS YVDQWDWE  I K ERN ETLK  V KI+++I+  + EV  KY   A N LP++I F +S++L  RYP+ TP ERE  +  +Y  +F++G+G  L  G  HD RAPDYDDW LNGDI+ W E  K ALE+SSMGIRVDE SLV+QL+  N   R +L +H++++NKE PY+IGGGIGQSRLC  LL K H+GEVQ+S+WP+++++E  K+NI LL
  S:    13 LNLRQTQEAIKYIRDTFQKEIGRALQLSRISAPLFVPKSSGLNDNLNGVETPVSFIIPQMPNEEIEVVHSLAKWKRMALKKYGFKMHEGLYTNMNAIRKDEEVDNLHSYYVDQWDWEKIISKEERNEETLKRHVLKIFKVIKHMEHEVWYKYP-HAVNRLPDKIHFFTSQELEDRYPDLTPTERETAMCKEYGCIFVMGVGKKLKSGIKHDGRAPDYDDWDLNGDILFWFEPLKCALEISSMGIRVDEDSLVKQLETENCLDRLQLPYHQQIMNKELPYTIGGGIGQSRLCMLLLKKAHVGEVQASIWPQEMIDECSKHNINLL 335
>gi|164686907|ref|ZP_02210935.1| hypothetical protein CLOBAR_00503 [Clostridium bartlettii DSM 16795] >gi|164604297|gb|EDQ97762.1| hypothetical protein CLOBAR_00503 [Clostridium bartlettii DSM 16795] (354 aa)
Score = 875, Expect = 3.9e-92, Identities = 174/324 (53%), Positives = 227/324 (70%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +LS++ETQ+AIK +KD F+  L   LKL RV++PL +    G ND+LNG E PV+F         EI  SLAKWKRM L KY  P+  G+Y DMNAIRKDE L ++HS+YVDQWDWEL I K +R ++TLK VV+ ++E+ +  ++ V++ Y      L PEEITFI+S++LL  YP+ TPKERE  I  + KAVF++ IG  LSDGK HD R+PDYDDW LNGDI+ +N     A+ELSSMGIRVDE +L  QL  +    RKELD+HK L+  + PY+IGGGIGQSR+C F L+K HIGEVQ  +WP+ ++EE  +  I+LL
  S:    32 SLSVIETQQAIKDLKDFFEDRLGEMLKLTRVSSPLFVLPETGTNDNLNGVETPVSFEVPYLHKDAEIVHSLAKWKRMALKKYGFPIGRGLYTDMNAIRKDEELDNLHSLYVDQWDWELVIAKEDRTMDTLKEVVRDLFEVFKETEEHVHEIYPEVGCEL-PEEITFITSQELLDMYPHLTPKEREDAIVKEKKAVFLMQIGKTLSDGKKHDGRSPDYDDWDLNGDILFYNSVLDQAIELSSMGIRVDEDALERQLKAAGCEDRKELDYHKALLAGKLPYTIGGGIGQSRICMFFLNKAHIGEVQVGIWPEKMIEECSEAGIELL 354
>gi|154491806|ref|ZP_02031432.1| hypothetical protein PARMER_01427 [Parabacteroides merdae ATCC 43184] >gi|154088047|gb|EDN87092.1| hypothetical protein PARMER_01427 [Parabacteroides merdae ATCC 43184] (345 aa)
Score = 865, Expect = 5.6e-91, Identities = 179/323 (55%), Positives = 227/323 (70%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAE--NLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +T+  IK IKD FQ NL+  L+L RVTAPL + +  GINDDLNG+E  VTF   D +    EI  SLAKWKR+ L  Y+I    GIY DMNAIR DE L ++HS+YVDQWDWE  +   ERN++ LK +V++IY  +   +  V   YE F E    LP++I FI SEDLLQ+YP  TPKERE  I  +Y AVFIIGIG  LS+G+ HD RAPDYDDW          LNGD++VW+E    +LELSSMGIRVD+ +L+ QL+  N   +KEL FHK+L+N E P SIGGGIGQSRLC F L K HIGE+Q+S+WP+++  EA    + L+
  S:    14 LNLSQTEMGIKKIKDFFQQNLSSELRLRRVTAPLFVLKGMGINDDLNGTERAVTFPIKDLDDAKAEIVHSLAKWKRLTLADYQIEKGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVMGAEERNVDFLKEIVRRIYAAMVRTEYLV---YEMFPEIRPTLPQQIHFIHSEDLLQKYPTFTPKEREDAITKEYGAVFIIGIGCKLSNGEKHDGRAPDYDDWSTIAENGQVGLNGDLLVWDEVLNRSLELSSMGIRVDKEALLRQLEICNAEEKKELYFHKRLLNNELPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEEMRREARAAGMYLI 345
>gi|125972593|ref|YP_001036503.1| asparagine synthetase AsnA [Clostridium thermocellum ATCC 27405] >gi|196251352|ref|ZP_03150022.1| Aspartate--ammonia ligase [Clostridium thermocellum DSM 4150] >gi|125712818|gb|ABN51310.1| aspartate-ammonia ligase [Clostridium thermocellum ATCC 27405] >gi|196199315|gb|EDX94142.1| Aspartate--ammonia ligase [Clostridium thermocellum DSM 4150] (340 aa)
Score = 862, Expect = 1.1e-90, Identities = 176/323 (54%), Positives = 225/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG---EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK IKD F+  LA  L L RV+APL +    G+ND+LNG E PV+F  D   I G   EI  SLAKWKRM L KY   + EG+Y DMNAIR+DE L ++HSIYVDQWDWEL I K +RN ETLK +VKKIY +++  +  + ++Y    +  LPE+I FI++++L   YP  +PKERE  IA + KA+F++ IG  L  GK HD RAPDYDDW LNGDII+W    + + E+SSMGIRVDE SL+ QL ++    RKE+ FHK L+  + PY+IGGGIGQSR+C + L K HIGEVQSS+WP  ++E  E  NI LL
  S:    18 LSVRETEAAIKKIKDFFETALAAELNLSRVSAPLFVRPETGMNDNLNGVERPVSF--DVKAIGGNTVEIVHSLAKWKRMALAKYGFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWELVINKEDRNEETLKNIVKKIYNVLKKTEDFIAEQYPQIPK-FLPEDIFFITTQELEDMYPELSPKEREDAIAKEKKAIFLMKIGGVLKSGKKHDGRAPDYDDWTLNGDIILWYPLLERSFEISSMGIRVDENSLLSQLKEAGCEERKEMKFHKDLLQGKLPYTIGGGIGQSRICMYFLKKAHIGEVQSSVWPDSMIEICENANINLL 340
>gi|153939412|ref|YP_001390849.1| asparagine synthetase AsnA [Clostridium botulinum F str. Langeland] >gi|152935308|gb|ABS40806.1| aspartate--ammonia ligase [Clostridium botulinum F str. Langeland] (340 aa)
Score = 858, Expect = 3.9e-90, Identities = 173/323 (53%), Positives = 224/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L + RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY   +  ++ +  +YE F E +LPEEI FI+S++L   YPN   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE +L +QL+ +    RK L+FH+ L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  IKLL
  S:    18 LGIRETEVAIKKVKDFFERTLAEKLNITRVSAPLFVRKNTGMNDNLNGVERPVAFDMKDLQDEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKVIKKEDRNKETLKAIVNKIYSAFKETERYICSQYEGFNE-ILPEEICFITSQELQDTYPNLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEEALEKQLEITGCEDRKNLEFHRLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKAKIKLL 340
>gi|168182432|ref|ZP_02617096.1| aspartate--ammonia ligase [Clostridium botulinum Bf] >gi|182674392|gb|EDT86353.1| aspartate--ammonia ligase [Clostridium botulinum Bf] (340 aa)
Score = 858, Expect = 3.9e-90, Identities = 174/323 (53%), Positives = 223/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L L RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY   +  ++ +  +YE F E +LPEEI FI+S++L   YP+   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE SL +QL  +    RK L+FH+ L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  IKLL
  S:    18 LGIRETEVAIKKVKDFFERTLAEKLNLTRVSAPLFVRKNTGMNDNLNGVERPVAFDMKDLQDEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWERVIKKEDRNKETLKAIVNKIYSAFKETERYICSQYEGFNE-ILPEEICFITSQELQDTYPDLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEESLEKQLKIAGCEDRKNLEFHRLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKAKIKLL 340
>gi|18310960|ref|NP_562894.1| asparagine synthetase AsnA [Clostridium perfringens str. 13] >gi|168212987|ref|ZP_02638612.1| aspartate--ammonia ligase [Clostridium perfringens CPE str. F4969] >gi|168215604|ref|ZP_02641229.1| aspartate--ammonia ligase [Clostridium perfringens NCTC 8239] >gi|21263426|sp|Q8XIY5|ASNA_CLOPE Aspartate--ammonia ligase (Asparagine synthetase A) >gi|18145642|dbj|BAB81684.1| aspartate-ammonia ligase [Clostridium perfringens str. 13] >gi|170715587|gb|EDT27769.1| aspartate--ammonia ligase [Clostridium perfringens CPE str. F4969] >gi|182382293|gb|EDT79772.1| aspartate--ammonia ligase [Clostridium perfringens NCTC 8239] (336 aa)
Score = 857, Expect = 4.4e-90, Identities = 176/323 (54%), Positives = 225/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK +KD F+ +LA  L L RV+APL + +  G+NDDLNG E PV+F        + +I  SLAKWKR+ L +YE    EG+Y DMNAIR+DE L +IHSIYVDQWDWE  I K ERNLETLK  VK IY   +  +  +  KY    E +LPE+ITFI+S++L  RYP+ T KERE  I  ++ AVFIIGIG  L+ G+ HD R+PDYDDW LNGD++ +      A+ELSSMGIRVDE SL++QL  +    RKEL FH+ L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +D++   E+NNI LL
  S:    14 LSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGLNDDLNGIERPVSFDMKAMPEFNIQIVHSLAKWKRLALHRYEFEHGEGLYTDMNAIRRDEDLDNIHSIYVDQWDWEKIIDKEERNLETLKETVKSIYGTFKATEDFIVAKYPHI-EKILPEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEKHDDRSPDYDDWTLNGDLLFYYPLFDEAVELSSMGIRVDEESLLKQLKIAECEERKELPFHQMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL 336
>gi|170755714|ref|YP_001781139.1| aspartate--ammonia ligase [Clostridium botulinum B1 str. Okra] >gi|169120926|gb|ACA44762.1| aspartate--ammonia ligase [Clostridium botulinum B1 str. Okra] (340 aa)
Score = 856, Expect = 7.1e-90, Identities = 173/323 (53%), Positives = 223/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L + RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY   +  ++ +  +YE F E +LPEEI FI+S++L   YPN   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE +L +QL  +    RK L+FH+ L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  IKLL
  S:    18 LGIRETEVAIKKVKDFFERTLAEKLNITRVSAPLFVRKNTGMNDNLNGVERPVAFDMKDLQDEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKVIKKEDRNKETLKAIVNKIYSAFKETERYICSQYEGFNE-ILPEEICFITSQELQDTYPNLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEEALEKQLKITGCEDRKNLEFHRLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKAKIKLL 340
>gi|168208679|ref|ZP_02634304.1| aspartate--ammonia ligase [Clostridium perfringens B str. ATCC 3626] >gi|170713209|gb|EDT25391.1| aspartate--ammonia ligase [Clostridium perfringens B str. ATCC 3626] (336 aa)
Score = 856, Expect = 7.2e-90, Identities = 176/323 (54%), Positives = 225/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK +KD F+ +LA  L L RV+APL + +  G+NDDLNG E PV+F        + +I  SLAKWKR+ L +YE    EG+Y DMNAIR+DE L +IHSIYVDQWDWE  I K ERNLETLK  VK IY   +  +  +  KY    E +LPE+ITFI+S++L  RYP+ T KERE  I  ++ AVFIIGIG  L+ G+ HD R+PDYDDW LNGD++ +      A+ELSSMGIRVDE SL++QL  +    RKEL FH+ L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +D++   E+NNI LL
  S:    14 LSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGLNDDLNGIERPVSFDMKAMPEFNIQIVHSLAKWKRLALHRYEFEHGEGLYTDMNAIRRDEDLDNIHSIYVDQWDWEKIIDKEERNLETLKETVKSIYGTFKSTEDFIVAKYPHI-EKILPEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEKHDDRSPDYDDWTLNGDLLFYYPLFDEAVELSSMGIRVDEESLLKQLKIAECEERKELPFHQMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL 336
>gi|110803224|ref|YP_699255.1| asparagine synthetase AsnA [Clostridium perfringens SM101] >gi|123047246|sp|Q0SRK2|ASNA_CLOPS Aspartate--ammonia ligase (Asparagine synthetase A) >gi|110683725|gb|ABG87095.1| aspartate--ammonia ligase [Clostridium perfringens SM101] (336 aa)
Score = 856, Expect = 7.3e-90, Identities = 175/323 (54%), Positives = 225/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK +KD F+ +LA  L L RV+APL + +  G+NDDLNG E PV+F        + +I  SLAKWKR+ L +YE    EG+Y DMNAIR+DE L +IHSIYVDQWDWE  I K ERNLETLK  V+ IY   +  +  +  KY    E +LPE+ITFI+S++L  RYP+ T KERE  I  ++ AVFIIGIG  L+ G+ HD R+PDYDDW LNGD++ +      A+ELSSMGIRVDE SL++QL  +    RKEL FH+ L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +D++   E+NNI LL
  S:    14 LSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGLNDDLNGIERPVSFDMKAIPEFNIQIVHSLAKWKRLALHRYEFKHGEGLYTDMNAIRRDEDLDNIHSIYVDQWDWEKIIDKEERNLETLKETVRSIYSTFKATEDFIVSKYPHI-EKILPEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEKHDDRSPDYDDWTLNGDLLFYYPLFDEAVELSSMGIRVDEESLLKQLKIAECEERKELPFHQMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL 336
>gi|187779847|ref|ZP_02996320.1| hypothetical protein CLOSPO_03443 [Clostridium sporogenes ATCC 15579] >gi|187773472|gb|EDU37274.1| hypothetical protein CLOSPO_03443 [Clostridium sporogenes ATCC 15579] (349 aa)
Score = 855, Expect = 7.9e-90, Identities = 174/323 (53%), Positives = 224/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L L RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY + +  ++E+  +YE F E +LPEEI FI+S++L   YP+   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE SL +QL  +    RK L+FH+ L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  I LL
  S:    27 LGIRETEVAIKKVKDFFERTLAEKLNLTRVSAPLFVRKNTGMNDNLNGVERPVAFDMKDLKEEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKVIKKEDRNKETLKSIVNKIYSVFKETEREICSQYEGFNE-ILPEEICFITSQELEDTYPDLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEESLEKQLKIAGCEDRKNLEFHRLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKAKINLL 349
>gi|110799543|ref|YP_696657.1| asparagine synthetase AsnA [Clostridium perfringens ATCC 13124] >gi|168204838|ref|ZP_02630843.1| aspartate--ammonia ligase [Clostridium perfringens E str. JGS1987] >gi|123049689|sp|Q0TNY3|ASNA_CLOP1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|110674190|gb|ABG83177.1| aspartate--ammonia ligase [Clostridium perfringens ATCC 13124] >gi|170663531|gb|EDT16214.1| aspartate--ammonia ligase [Clostridium perfringens E str. JGS1987] (336 aa)
Score = 855, Expect = 8.2e-90, Identities = 175/323 (54%), Positives = 225/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK +KD F+ +LA  L L RV+APL + +  G+NDDLNG E PV+F        + +I  SLAKWKR+ L +YE    EG+Y DMNAIR+DE L +IHSIYVDQWDWE  I K ERNLETLK  V+ IY   +  +  +  KY    E +LPE+ITFI+S++L  RYP+ T KERE  I  ++ AVFIIGIG  L+ G+ HD R+PDYDDW LNGD++ +      A+ELSSMGIRVDE SL++QL  +    RKEL FH+ L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +D++   E+NNI LL
  S:    14 LSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGLNDDLNGIERPVSFDMKAMPEFNIQIVHSLAKWKRLALHRYEFEHGEGLYTDMNAIRRDEDLDNIHSIYVDQWDWEKIIDKEERNLETLKETVRSIYGTFKATEDFIVAKYPHI-EKILPEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEKHDDRSPDYDDWTLNGDLLFYYPLFDEAVELSSMGIRVDEESLLKQLKIAECEERKELPFHQMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL 336
>gi|170758848|ref|YP_001786925.1| aspartate--ammonia ligase [Clostridium botulinum A3 str. Loch Maree] >gi|169405837|gb|ACA54248.1| aspartate--ammonia ligase [Clostridium botulinum A3 str. Loch Maree] (340 aa)
Score = 855, Expect = 8.2e-90, Identities = 173/323 (53%), Positives = 223/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L L RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY   +  ++ +  +YE F E +LPEEI FI+S++L   YP+   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE +L +QL  +    RK L+FH+ L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  IKLL
  S:    18 LGIRETEVAIKEVKDFFERTLAEKLNLTRVSAPLFVRKNTGMNDNLNGVERPVAFDMKDLQDEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWERVIKKEDRNKETLKAIVNKIYSAFKETERYICSQYEGFNE-ILPEEICFITSQELQDTYPDLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEEALEKQLKITGCEDRKNLEFHRLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKAKIKLL 340
>gi|116630339|ref|YP_815606.1| asparagine synthetase AsnA [Lactobacillus gasseri ATCC 33323] >gi|116095921|gb|ABJ61073.1| aspartate-ammonia ligase [Lactobacillus gasseri ATCC 33323] (353 aa)
Score = 855, Expect = 8.5e-90, Identities = 170/324 (52%), Positives = 230/324 (70%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L+I +T+ AI FI++ FQ  +A  L + R++AP+ +E++ G+ND+LNG E PV+F        + E+  SLAKWKR+ L +Y   +HEG+Y +MNAIR+DE L + HSIYVDQWDWE  I K ERN++TLK  VK+I++ I+  +KEV  +Y   +   LP EITFI++++L  R+P+ TP ERE  IA + KAVF++ IGD L   GKPHD RAPDYDDW+LNGD++ W E  +  LE+SSMGIRV E SL  QL K++   R  L FHK L+N E PY+IGGGIGQSRLC  LL K HIGEVQ+S+WP  ++EE E   +++L
  S:    29 SLTIRDTEAAIVFIRETFQDKIAEKLNVQRMSAPMFVEKSTGLNDNLNGVERPVSFDMKAMPNDTIEVVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRRDEDLDNFHSIYVDQWDWEKIISKDERNIDTLKDTVKQIFKAIKETEKEVAARYP-SSTYRLPNEITFITTQELEDRWPDLTPDEREDKIAKEKKAVFLMKIGDKLKRSGKPHDGRAPDYDDWQLNGDLLFWYEPLQRKLEISSMGIRVSEESLKTQLKKAHAEERAALPFHKMLLNGELPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPPKMIEECEAAGMQML 353
>gi|90962008|ref|YP_535924.1| asparagine synthetase AsnA [Lactobacillus salivarius UCC118] >gi|122448900|sp|Q1WTD6|ASNA_LACS1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|90821202|gb|ABD99841.1| Aspartate--ammonia ligase [Lactobacillus salivarius UCC118] (336 aa)
Score = 853, Expect = 1.4e-89, Identities = 175/323 (54%), Positives = 233/323 (72%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPN-KTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI ETQ+AI++I++ FQ      + L+RV+AP+ +E++ GIND+LNG E PV+FT  D  G + E+  SLAKWKRM L KY   LHEG+Y +MNAIRKDE L + HS YVDQWDWE  I K ERN +TLK  V+ I+++++  + EV  K+   A   LP++I FI+S++L  +YP  +  K+RE  I  +   VF++ IGD L  GK HD RAPDYDDWKLNGDI+ W E  + ALELSSMGIRVDE S+VEQL K+ +  R +L +HK ++NKE PY+IGGGIGQSRLC  LL K H+GEVQ+S+WP ++L++ E+N I +L
  S:    13 LSIRETQEAIRYIRETFQDEFGKEMGLNRVSAPMYVEKSSGINDNLNGYEKPVSFTMKDMPGETIEVVHSLAKWKRMALKKYGFGLHEGLYTNMNAIRKDEDLDNFHSSYVDQWDWEKVISKDERNEKTLKETVELIFKVVKHMEHEVWYKFP-NAVYHLPDKIHFITSQELEDKYPELEDAKDRENAICKELGCVFVMQIGDVLKSGKRHDGRAPDYDDWKLNGDILFWYEPLQCALELSSMGIRVDEDSMVEQLKKTGDEDRLKLQYHKMILNKELPYTIGGGIGQSRLCMLLLGKAHVGEVQASIWPDEMLKKCEENGIHIL 336
>gi|182624442|ref|ZP_02952226.1| aspartate--ammonia ligase [Clostridium perfringens D str. JGS1721] >gi|177910445|gb|EDT72822.1| aspartate--ammonia ligase [Clostridium perfringens D str. JGS1721] (336 aa)
Score = 853, Expect = 1.6e-89, Identities = 175/323 (54%), Positives = 224/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK +KD F+ +LA  L L RV+APL + +  G+NDDLNG E PV+F        + +I  SLAKWKR+ L +YE    EG+Y DMNAIR+DE L +IHSIYVDQWDWE  I K ERNLETLK  VK IY   +  +  +  KY    E +LPE+ITFI+S++L  RYP+ T KERE  I  ++ AVFIIGIG  L+ G+ HD R+PDYDDW LNGD++ +      A+ELSSMGIRVDE  L++QL  +    RKEL FH+ L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +D++   E+NNI LL
  S:    14 LSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGLNDDLNGLERPVSFDMKAMPEFNIQIVHSLAKWKRLALHRYEFEHGEGLYTDMNAIRRDEDLDNIHSIYVDQWDWEKIIDKEERNLETLKETVKSIYGTFKATEDFIVAKYPHI-EKILPEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEKHDDRSPDYDDWTLNGDLLFYYPLFDEAVELSSMGIRVDEERLLKQLKIAECEERKELPFHQMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL 336
>gi|153809855|ref|ZP_01962523.1| hypothetical protein RUMOBE_00236 [Ruminococcus obeum ATCC 29174] >gi|149834033|gb|EDM89113.1| hypothetical protein RUMOBE_00236 [Ruminococcus obeum ATCC 29174] (335 aa)
Score = 852, Expect = 1.7e-89, Identities = 168/324 (51%), Positives = 225/324 (69%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L++ +TQ AIK +KD FQ  L+  L L RV+AP+ +  + G+ND+LNG E PV+F   G   + EI  SLAKWKR  L KY     EG+Y DM AIR+DE L +IHS+YVDQWDWE  I K ER +ETL   V+ IY ++R  +K +  +Y++  E +LP+EI F+S+++L+  YP+ TPKERE  I  +  AVF++ +G  LS+G+ HD RAPDYDDW+LNGDI+V+      ALELSSMGIRVDE +L  QL ++  + R+EL F K ++NKE PY+IGGGIGQSR+C F L K HIGEV  SLWP+ I + AE+  + LL
  S:    13 DLNLHDTQVAIKTVKDFFQQTLSQKLNLLRVSAPIFVSPSSGLNDNLNGVERPVSFDIKGQDENAEIVHSLAKWKRYALKKYGFAHGEGLYTDMVAIRRDEDLDNIHSVYVDQWDWEKIISKEERTMETLINTVRSIYSVLRKTEKYMAVQYDYI-EEILPKEIAFVSTQELVDMYPDLTPKEREYKIVKEKGAVFLMQVGKTLSNGERHDGRAPDYDDWELNGDILVYYPVLDIALELSSMGIRVDEEALDRQLTEAGCDDRRELPFQKAILNKELPYTIGGGIGQSRICMFFLRKAHIGEVHVSLWPESITKAAEEAGVNLL 335
>gi|169343733|ref|ZP_02864732.1| aspartate--ammonia ligase [Clostridium perfringens C str. JGS1495] >gi|169298293|gb|EDS80383.1| aspartate--ammonia ligase [Clostridium perfringens C str. JGS1495] (336 aa)
Score = 851, Expect = 2.5e-89, Identities = 175/323 (54%), Positives = 224/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ ET+ AIK +KD F+ +LA  L L RV+APL + +  G+NDDLNG E PV+F        + +I  SLAKWKR+ L +YE    EG+Y DMNAIR+DE L +IHSIYVDQWDWE  I K ERNLETLK  VK IY   +  +  +  KY    E +LPE+ITFI+S++L  RYP+ T KERE  I  ++ AVFIIGIG  L+ G+ HD R+PDYDDW LNGD++ +      A+ELSSMGIRVDE  L++QL  +    RKEL FH+ L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +D++   E+NNI LL
  S:    14 LSLRETEVAIKELKDFFEDSLAKNLNLTRVSAPLFVNKGSGLNDDLNGIERPVSFDMKAMPEFNIQIVHSLAKWKRLALHRYEFEHGEGLYTDMNAIRRDEDLDNIHSIYVDQWDWEKIIDKEERNLETLKETVKSIYGTFKSTEDFIVAKYPHI-EKILPEDITFITSQELEDRYPDLTSKERETAICKEFGAVFIIGIGGKLASGEKHDDRSPDYDDWTLNGDLLFYYPLFDEAVELSSMGIRVDEERLLKQLKIAECEERKELPFHQMLLEGKLPYTIGGGIGQSRICMFFLRKAHIGEVQASMWDEDMIRTCEENNIHLL 336
>gi|158319284|ref|YP_001511791.1| asparagine synthetase AsnA [Alkaliphilus oremlandii OhILAs] >gi|158139483|gb|ABW17795.1| Aspartate--ammonia ligase [Alkaliphilus oremlandii OhILAs] (337 aa)
Score = 849, Expect = 3.8e-89, Identities = 174/324 (53%), Positives = 227/324 (70%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +LSI ET+ AIK +KD F+  LA  L L RV+APL +    G+ND+LNG E PV+F   D  G   EI  SLAKWKRM LG+Y   + EG+Y DM+AIR+DE L +IHSIYVDQWDWE  I K ER    LK +V++IYE+ +     V K Y    +N+LPE+ITFI+S++L  RYP  + K+RE  IA +Y AVFI+ IG  L  G+ HD RAPDYDDW+LNGDI+ WN      LELSSMGIRVDE +L +QL  +    RK+LDFH+ ++ K+ PY++GGGIGQSR+C F L K HIGEVQ+S+W K++++  EK+++ LL
  S:    14 SLSIKETEVAIKQLKDFFERELAKTLNLTRVSAPLFVCPETGMNDNLNGVERPVSFDIKDIKGQYVEIVHSLAKWKRMALGRYGFEVGEGLYTDMDAIRRDEDLDNIHSIYVDQWDWEKIITKEERTEAKLKEIVERIYEVFKRTGDYVEKLYPEL-KNILPEKITFITSQELEDRYPGLSSKDREHAIAKEYGAVFIMKIGGKLLSGERHDGRAPDYDDWELNGDILFWNPLLNIGLELSSMGIRVDEDTLEKQLSIAGCEDRKKLDFHRLVLEKKLPYTVGGGIGQSRICMFFLQKAHIGEVQASIWSKEMIDFCEKHHMPLL 337
>gi|168180161|ref|ZP_02614825.1| aspartate--ammonia ligase [Clostridium botulinum NCTC 2916] >gi|182669176|gb|EDT81152.1| aspartate--ammonia ligase [Clostridium botulinum NCTC 2916] (340 aa)
Score = 848, Expect = 6.0e-89, Identities = 173/323 (53%), Positives = 223/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L L RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY   +  ++ +  +YE F E +LPE+I FI+S++L   YP+   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE SL +QL  +    RK L+FH+ L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  IKLL
  S:    18 LGIRETEVAIKKVKDFFERTLAEKLNLTRVSAPLFVRKNTGMNDNLNGIERPVDFDMKDLQDEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKVIKKEDRNKETLKAIVNKIYSAFKETERYICSQYEGFNE-ILPEKICFITSQELQDTYPDLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEESLEKQLKITGCEDRKNLEFHRLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKAKIKLL 340
>gi|150010288|ref|YP_001305031.1| asparagine synthetase AsnA [Parabacteroides distasonis ATCC 8503] >gi|166219929|sp|A6LI95|ASNA_PARD8 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|149938712|gb|ABR45409.1| aspartate-ammonia ligase [Parabacteroides distasonis ATCC 8503] (345 aa)
Score = 847, Expect = 6.6e-89, Identities = 174/323 (53%), Positives = 228/323 (70%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAE--NLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +T+  IK IKD FQ NL+  L+L RVTAPL + +  GINDDLNG+E  VTF   D N    EI  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  + ++ER ++ LK +V++IY  +   +  V   YE F +    LP++I FI SEDLLQ+YP  TPKERE  I  +Y AVFIIGIG +LS+G+ HD RAPDYDDW          LNGD++VW++    ++ELSSMGIRV++ +L+ QLD      +KEL FHK+L++ E P SIGGGIGQSRLC F L K HIGE+Q+S+WP+++ +EA    + L+
  S:    14 LNLSQTEMGIKKIKDFFQQNLSSELRLRRVTAPLFVLKGMGINDDLNGTERAVTFPIKDLNDSKAEIVHSLAKWKRLTLADYHIEEGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVMSESERKIDFLKEIVRRIYAAMVRTEYLV---YEMFPQIRPTLPQQIHFIHSEDLLQKYPTFTPKEREDAITKEYGAVFIIGIGCSLSNGEKHDGRAPDYDDWSTIAENGQTGLNGDLLVWDDVLNRSMELSSMGIRVNKEALLRQLDICKAGEKKELYFHKRLLSGELPQSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEEMRKEARAAGMMLI 345
>gi|148379475|ref|YP_001254016.1| aspartate--ammonia ligase [Clostridium botulinum A str. ATCC 3502] >gi|153933488|ref|YP_001383852.1| asparagine synthetase AsnA [Clostridium botulinum A str. ATCC 19397] >gi|153937625|ref|YP_001387402.1| asparagine synthetase AsnA [Clostridium botulinum A str. Hall] >gi|148288959|emb|CAL83046.1| putative aspartate--ammonia ligase [Clostridium botulinum A str. ATCC 3502] >gi|152929532|gb|ABS35032.1| aspartate--ammonia ligase [Clostridium botulinum A str. ATCC 19397] >gi|152933539|gb|ABS39038.1| aspartate--ammonia ligase [Clostridium botulinum A str. Hall] (340 aa)
Score = 845, Expect = 1.4e-88, Identities = 173/323 (53%), Positives = 223/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK +KD F+  LA  L L RV+APL + +N G+ND+LNG E PV F   D      EI  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE L ++HSIYVDQWDWE  IKK +RN ETLK +V KIY   +  ++ +  +YE F E +LPE+I FI+S++L   YP+   KERE  I  +  AVF++ IG  L+ G+ HD RAPDYDDW LNGDI+ WN   + A ELSSMGIRVDE SL +QL  +    RK+L+FHK L+  + PY++GGGIGQSR+C + L K HIGEVQ+S+WP  ++E+ EK  I LL
  S:    18 LGIRETEVAIKKVKDFFERTLAEKLNLTRVSAPLFVRKNTGMNDNLNGVERPVDFDMKDLQDEMIEIVHSLAKWKRMALHRYDFKVGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKVIKKEDRNKETLKAIVNKIYSAFKETERYICSQYEGFNE-ILPEKICFITSQELQDTYPDLDSKEREDAITKEKGAVFLMEIGGVLASGEKHDGRAPDYDDWTLNGDILFWNPVLERAFELSSMGIRVDEESLEKQLKIAGCEDRKKLEFHKLLLEGKLPYTVGGGIGQSRICMYFLRKAHIGEVQASIWPDLMIEDCEKVKINLL 340
>gi|184156078|ref|YP_001844418.1| aspartate-ammonia ligase [Lactobacillus fermentum IFO 3956] >gi|183227422|dbj|BAG27938.1| aspartate-ammonia ligase [Lactobacillus fermentum IFO 3956] (336 aa)
Score = 843, Expect = 2.2e-88, Identities = 169/323 (52%), Positives = 228/323 (70%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI ET++AI++I++ FQ  +   L L R++AP+ +E++ G+ND+LNG E PV+FT  D  G + EI  SLAKWKR  L KY   LHEG+Y +MNAIRKDE L + HSIYVDQWDWE  I K ER   TLK  V++++++I+  + EV  K+   A   LP+EI F++++ L  R+P  +P ERE  IA +   VF++ IGD L   G+PHD RAPDYDDW LNGDII W E  ++ LE+SSMGIRVDE ++ EQL+K++   R EL FH+ L+  + PY+IGGGIGQSRLC  LL K H+GEVQ+S+WP+++ E   K  I+LL
  S:    13 LSIRETEEAIRYIRETFQDEIGKELNLQRMSAPMFVEQSTGLNDNLNGVEAPVSFTMKDLPGETIEIVHSLAKWKRFALKKYGFGLHEGLYTNMNAIRKDEDLDNFHSIYVDQWDWEKVIAKEERTEATLKATVRQVFKVIKHMEHEVWYKFPQ-AVYHLPDEIHFVTTQGLEDRWPELSPMEREDKIAKELGCVFVMKIGDKLQRSGEPHDGRAPDYDDWSLNGDIIFWYEPLQTKLEVSSMGIRVDERAMKEQLEKAHATDRAELPFHRDLLAGKMPYTIGGGIGQSRLCMLLLGKAHVGEVQASIWPEEMKEACAKAKIQLL 336
>gi|160934361|ref|ZP_02081748.1| hypothetical protein CLOLEP_03232 [Clostridium leptum DSM 753] >gi|156867034|gb|EDO60406.1| hypothetical protein CLOLEP_03232 [Clostridium leptum DSM 753] (343 aa)
Score = 842, Expect = 2.6e-88, Identities = 171/323 (52%), Positives = 221/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +SI ET+ AIK IKD F+  L+ AL L RV+APL +  + G+ND+LNG E PVTF   + +    EI  SLAKWKRM L +Y     EG+Y DMNAIR+DE   ++HSIYVDQWDWE  I K ER ++TLK VV +IYE+++  +  V   Y    + +LP+ ITF+++ +L  RY   T KERER I  ++ AVF++GIG  L +GKPHD RAPDYDDW LNGDIIV      +ALELSSMGIRVD  +L  QL+ +    R EL F K L+N E P +IGGGIGQSR+C F L + HIGEVQ+S+WP++ +   E++NI LL
  S:    21 MSIRETEVAIKLIKDFFERELSEALALTRVSAPLFVSPDSGLNDNLNGIERPVTFGIKELDDAPVEIVHSLAKWKRMALKRYGFCKGEGLYTDMNAIRRDEDTDNLHSIYVDQWDWEKIIGKEERTIDTLKTVVNQIYEVLKRTEMYVASFYPQI-KPVLPKHITFVTTAELEDRYCGLTTKERERQIVKEHGAVFLMGIGGALRNGKPHDGRAPDYDDWTLNGDIIVDYPMLDTALELSSMGIRVDAKALRAQLEIAGCMERAELPFQKALLNNELPDTIGGGIGQSRICMFFLRRAHIGEVQASIWPEETIRLCEEHNIHLL 343
>gi|150392340|ref|YP_001322389.1| asparagine synthetase AsnA [Alkaliphilus metalliredigens QYMF] >gi|149952202|gb|ABR50730.1| Aspartate--ammonia ligase [Alkaliphilus metalliredigens QYMF] (341 aa)
Score = 842, Expect = 2.9e-88, Identities = 169/323 (52%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I ET+ AIK IKD F+  LA  L L RV+APL +    GIND+LNG E PV+F   G +    E+  SLAKWKRM L +Y   L EGIY DM+AIR+DE L ++HSIYVDQWDWE  I K ER +ETLK  V+ IY + +  +  + + Y    + +LPEEITFI++++L  RYP  +PKERE  I  + KAVFII IG ++  G+ HD RAPDYDDW LNGDI+ W      A+ELSSMG+RVDE ++  QL  +    R+ L FH+ ++ K  PY+IGGGIGQSR+C F L K HIGEVQ+++WP  ++E  EK  I LL
  S:    19 LDIRETEIAIKRIKDFFEGRLAEMLNLTRVSAPLFVRPETGINDNLNGVERPVSFEVKGIDNKEVEVVHSLAKWKRMALHRYGFKLGEGIYTDMDAIRRDEDLDNLHSIYVDQWDWERVISKEERRIETLKSTVESIYGVFKDTENYLFQFYPHLGK-MLPEEITFITAQELEDRYPTLSPKERENAITKEKKAVFIIAIGGDMKSGEKHDGRAPDYDDWNLNGDILFWYPMLDQAVELSSMGVRVDEEAMARQLSLAKCEDRQSLVFHQGILTKVLPYTIGGGIGQSRICMFFLKKAHIGEVQAAIWPDKMIETCEKAKIALL 341
>gi|118725342|ref|ZP_01573984.1| Aspartate--ammonia ligase [Clostridium cellulolyticum H10] >gi|118665333|gb|EAV71953.1| Aspartate--ammonia ligase [Clostridium cellulolyticum H10] (336 aa)
Score = 842, Expect = 3.0e-88, Identities = 172/324 (53%), Positives = 220/324 (67%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG---EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L I  T+ AIK  KD F+  LA  L L RV+APL +    G+ND+LNG E PV F  D  GI G   E+  SLAKWKRM L +Y     EG+Y DMNAIR+DE + ++HS+YVDQWDWE  I K+ER  ETLK +V KI+ + +  +  ++  Y    +  LPE+I F+++++L   YP  TPKERE  +A + KA+FI+ IGD L  G  HD RAPDYDDW LNGDI+ +      A E+SSMGIRVDE SLV QL K+    RK L FHK+LINKE PY+IGGGIGQSR+C F L K HIGEVQ+S+W  D++ E  ++NI+LL
  S:    13 SLDIRMTEVAIKKTKDYFESELAKELNLTRVSAPLFVRPETGLNDNLNGVERPVAF--DVKGIGGDTVEVVHSLAKWKRMALKRYGFAPGEGLYTDMNAIRRDEDMDNLHSVYVDQWDWEQIILKSERTEETLKTIVSKIFSVFKRTENYLSGLYPNL-QKYLPEDIFFVTTQELEDMYPELTPKERETALAKEKKAIFIMKIGDTLKSGIKHDGRAPDYDDWALNGDIVFYYPVLDLAYEVSSMGIRVDEDSLVAQLKKAGCEDRKNLKFHKELINKELPYTIGGGIGQSRICMFFLGKAHIGEVQASIWSDDMISECSQHNIQLL 336
>gi|42519814|ref|NP_965744.1| asparagine synthetase AsnA [Lactobacillus johnsonii NCC 533] >gi|47115603|sp|P61190|ASNA_LACJO Aspartate--ammonia ligase (Asparagine synthetase A) >gi|41584104|gb|AAS09710.1| aspartate-ammonia ligase [Lactobacillus johnsonii NCC 533] (336 aa)
Score = 841, Expect = 3.3e-88, Identities = 168/324 (51%), Positives = 232/324 (71%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L+I +T+ AI FI++ FQ  +A  L L R++AP+ +E++ G+ND+LNG E PV F        + E+  SLAKWKR+ L +Y   +HEG+Y +MNAIR+DE L + HSIYVDQWDWE  I K ERN+ETLK  VK+I++ I+  +KE++ +Y   +   LP +ITFI++++L  R+P+  P+ERE  IA + KAVF++ IGD L   GKPHD RAPDYDDW+LNGD++ W E  K  +E+SSMGIRV E SL EQL K++   R +L FHK L+  + PY+IGGGIGQSRLC  LL K HIGEVQ+S+WP +++E  +  +IK+L
  S:    12 SLTIRDTEAAIVFIRENFQDKIADKLNLQRMSAPMFVEKSTGLNDNLNGIERPVAFDMKAMPDDTIEVVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRRDEDLDNFHSIYVDQWDWEKIIAKEERNIETLKTTVKQIFKAIKETEKELSARYPG-STYRLPSDITFITTQELEDRWPDLAPEEREDKIAKEKKAVFLMKIGDKLKRSGKPHDGRAPDYDDWELNGDLLFWYEPLKRKIEISSMGIRVSEESLKEQLKKAHTEERSDLPFHKMLLEGKLPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPPEMIESCKAADIKIL 336
>gi|28210498|ref|NP_781442.1| asparagine synthetase AsnA [Clostridium tetani E88] >gi|47115783|sp|Q897F7|ASNA_CLOTE Aspartate--ammonia ligase (Asparagine synthetase A) >gi|28202935|gb|AAO35379.1| aspartate--ammonia ligase [Clostridium tetani E88] (341 aa)
Score = 841, Expect = 4.0e-88, Identities = 172/323 (53%), Positives = 226/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + ET  AIK +KD F+  LA  L L RV+APL +  +KG+ND+LNG E PV FT  D N  + EI  SLAKWKRM L +Y     EG+Y DMNAIR+DE L + HSIYVDQWDWE  IKK +RN E LK +V+KI++  +  ++ +NK Y +  E +LPEE+ F+++++L   +P+ T KERE  I  + KAVF++ IG  L  G+ HD RAPDYDDW+LNGDI+ WN     A ELSSMGIRVDE SL++QL  +N   RKEL FHK L+ K+ PY+IGGGIGQSR+C   L K HIGEVQSS+WP+++++  E+  + +L
  S:    19 LDLKETAIAIKEVKDCFERALAKQLNLIRVSAPLFVRCDKGLNDNLNGVERPVKFTVKDDNEAAVEIVHSLAKWKRMALYRYNFNADEGLYTDMNAIRRDEELDNTHSIYVDQWDWERIIKKEDRNEEYLKDIVRKIFKAFKETEEHINKLYPFLGE-VLPEEVFFMTTQELEDMFPDLTAKEREDAITKEKKAVFLMKIGKTLESGEKHDGRAPDYDDWELNGDILFWNPVLNKAFELSSMGIRVDEESLLKQLKLANCEERKELQFHKMLLEKKLPYTIGGGIGQSRMCMLFLKKAHIGEVQSSIWPEEMIKFCEEKGMTIL 341
>gi|150006626|ref|YP_001301370.1| asparagine synthetase AsnA [Bacteroides vulgatus ATCC 8482] >gi|149935050|gb|ABR41748.1| aspartate-ammonia ligase [Bacteroides vulgatus ATCC 8482] (346 aa)
Score = 839, Expect = 6.8e-88, Identities = 170/323 (52%), Positives = 223/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK----------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ NL+  L+L RVTAPL + +  GINDDL+G+E  V+F   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I K +R ++ LK +V +IY  +R  +  V + Y    +  LP +I FI SE+L Q YP+K+PKERE  I+ KY AVFIIGIG  LSDGK HDLRAPDYDD+           LNGD++VW++    ++ELSSMGIRVD+ +L+ QL  S    RKEL FHK+L+N+  P  IGGGIGQSRLC   L K HIGE+Q+S+WP+D+ +E  +  ++L+
  S:    14 LDLKQTELGIKQIKEFFQQNLSSELRLRRVTAPLFVLKGMGINDDLSGTERAVSFPIKDLGDAQAEVVHSLAKWKRLTLADYNIEPGYGIYTDMNAIRADEELGNLHSLYVDQWDWERVITKEQRTVDFLKQIVTRIYAAMRRTEYMVCEMYPQI-KPFLPHDIHFIHSEELCQMYPDKSPKEREHAISQKYGAVFIIGIGCKLSDGKEHDLRAPDYDDYTTINPENGLPGLNGDLLVWDKVLDRSVELSSMGIRVDKEALLRQLTLSGQEKRKELYFHKRLLNETLPLCIGGGIGQSRLCMLYLQKAHIGEIQASIWPEDMRKECAQLGMQLI 346
>gi|160947204|ref|ZP_02094371.1| hypothetical protein PEPMIC_01137 [Peptostreptococcus micros ATCC 33270] >gi|158446338|gb|EDP23333.1| hypothetical protein PEPMIC_01137 [Peptostreptococcus micros ATCC 33270] (337 aa)
Score = 838, Expect = 7.1e-88, Identities = 175/324 (54%), Positives = 231/324 (71%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGE--IPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L+I+ETQKAIK IKD F+ NLA+ L L RV+APL +++N GIND+L+G E PV F+      S E  I QSLAKWKR+ L  Y IP  EGIY DMNAIR  E+L +IHS+YVDQWDWE  I   +RN + L  +VKKIY + +   + +++++  + + +LP+++ FIS+++L   +PN TPKERE  I    KAVFI  IG+ L+ GK HD R+PDYDDW+LNGD+I WN    S+LELSSMGIRV++  L++QL  S N  RK L +HK L+N E P +IGGGIGQSR+C F L K HIGEVQSS WP+++L   ++N I LL
  S:    13 DLNIIETQKAIKEIKDFFETNLANELNLTRVSAPLFVKKNTGINDNLSGIEYPVIFSLSEEENSEELEIVQSLAKWKRIALKNYAIPDGEGIYTDMNAIRPCETLDNIHSVYVDQWDWERVISNEDRNEKFLTDIVKKIYNVFKRTDEFLSRRFLNY-QTILPKKVFFISTQELEDMFPNDTPKEREHKITRAKKAVFITKIGNVLNSGKKHDGRSPDYDDWELNGDLIFWNPILNSSLELSSMGIRVNKEILLKQLKISGNEDRKNLKYHKMLLNDELPLTIGGGIGQSRICMFFLQKAHIGEVQSSFWPEEMLNICKENKINLL 337
>gi|116334228|ref|YP_795755.1| asparagine synthetase AsnA [Lactobacillus brevis ATCC 367] >gi|122269090|sp|Q03PZ8|ASNA_LACBA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|116099575|gb|ABJ64724.1| aspartate-ammonia ligase [Lactobacillus brevis ATCC 367] (335 aa)
Score = 834, Expect = 2.1e-87, Identities = 162/323 (50%), Positives = 228/323 (70%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ +TQ+AI++I++ FQ      L L R++AP+ +E++ G+ND+LNG E PV+FT    G S  EI  SLAKWKR+ L +Y   LHEG+Y +MNAIRKDE L + HS YVDQWDWE  I K ER L+TLK  V++I+++I+  + EV  K+   A + LP++I FI++++L  R+P+ TP+ERE  I  +   VF++ IG  L  GK HD RAPDYDDW+LNGDI+ W E  K A+E+SSMGIRVD  S+  QL  ++   R  L +H+ ++++E P++IGGGIGQSRLC  LL K H+GEVQ++LWP+ ++++ E  NI LL
  S:    13 LSVKDTQRAIRYIRETFQDEFGAQLNLSRLSAPMFVEKSTGLNDNLNGIEQPVSFTMQDMGDSQIEIVHSLAKWKRVALKRYGFNLHEGLYTNMNAIRKDEDLDNFHSAYVDQWDWEKVITKEERTLDTLKQTVRQIFKVIKHMEHEVWYKFPE-AVHHLPDKIHFITTQELEDRFPDLTPRERENAITKELGCVFLMQIGGALKSGKRHDGRAPDYDDWQLNGDILFWYEPLKQAIEISSMGIRVDAESMQRQLKIADAEDRLSLPYHQMVLHEEVPFTIGGGIGQSRLCMLLLGKAHVGEVQAALWPQAMIDQCEAANIHLL 335
>gi|184154422|ref|YP_001842763.1| aspartate-ammonia ligase [Lactobacillus reuteri F275] >gi|183225766|dbj|BAG26283.1| aspartate-ammonia ligase [Lactobacillus reuteri F275] (339 aa)
Score = 834, Expect = 2.5e-87, Identities = 168/323 (52%), Positives = 231/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI ET+ AI++I++ FQ      L L R++AP+ +E++ G+ND+LNG E PV+F   D    + EI  SLAKWKR+ L +Y   +HEG+Y +MNAIRK+E L + HSIYVDQWDWE  I K ER  ETLK  V+ I+++I+  + EV  K+   A   LP+EI F+++++L  R+P+ TP ERE  IA +  AVF++ IGD L   GKPHD RAPDYDDW LNGDII W E  +  +E+SSMGIRV   S+  QL++++   R++L FHK L+N E PY+IGGGIGQSRLC  LL K HIGEVQ+S+WP+D++++ E+N+I++L
  S:    16 LSIRETEAAIRYIRETFQDEFGKELNLQRMSAPMFVEKSTGLNDNLNGVEQPVSFEMKDMPNETVEIVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRKEEDLDNFHSIYVDQWDWEKIISKDERTEETLKDTVRDIFKVIKHMEHEVWYKFPQ-AVYHLPDEIHFVTTQELEDRWPDLTPLEREDKIAKELGAVFVMKIGDKLQRSGKPHDGRAPDYDDWSLNGDIIFWYEPLQRRIEVSSMGIRVSPESMKYQLEQADATDREKLPFHKMLLNGELPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPEDMIKKCEENHIQIL 339
>gi|189459660|ref|ZP_03008445.1| hypothetical protein BACCOP_00287 [Bacteroides coprocola DSM 17136] >gi|189433619|gb|EDV02604.1| hypothetical protein BACCOP_00287 [Bacteroides coprocola DSM 17136] (346 aa)
Score = 834, Expect = 2.5e-87, Identities = 166/323 (51%), Positives = 219/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK----------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ NL+  L+L RVTAPL +    G+NDDLNG E PVTF   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I   +R ++ LK +V +IY  +R  +  + + Y   + + LP ++ FI S+DLL  YP+KTPKERE LI  +Y AVFIIGIG  LSDG PHD RAPDYDD+           LNGD+++WN     A+ELSSMGIRVD+ +L++QL+ +    R +L FHK+L+    P SIGGGIGQSRLC   L K HIGE+Q+S+WP+++  E  +  ++L+
  S:    14 LDMKQTELGIKQIKEFFQQNLSSELRLRRVTAPLFVLTGMGMNDDLNGVERPVTFPIKDLGEQRAEVVHSLAKWKRVTLADYNIEPGYGIYTDMNAIRADEELGNLHSLYVDQWDWERVITPEQRTVDFLKSIVTRIYSAMRRTEYMICEVYPQIS-SFLPHDVHFIHSQDLLDMYPDKTPKEREDLITERYGAVFIIGIGGKLSDGNPHDKRAPDYDDYTTIDPKTGLPGLNGDLLIWNSVLGRAIELSSMGIRVDKAALLKQLELAGKEERTKLYFHKRLLEGSLPLSIGGGIGQSRLCMLYLRKAHIGEIQASIWPEEMRRECAELGMQLI 346
>gi|168185637|ref|ZP_02620272.1| aspartate--ammonia ligase [Clostridium botulinum C str. Eklund] >gi|169296330|gb|EDS78463.1| aspartate--ammonia ligase [Clostridium botulinum C str. Eklund] (339 aa)
Score = 833, Expect = 2.7e-87, Identities = 169/324 (52%), Positives = 226/324 (69%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++ + +T+ AIK +KD F+  LA+ L L RV+APL ++ + G+ND+LNG E PV F + D      +I  SLAKWKRM L +Y     EG+Y DMNAIR+DE L +IHS+YVDQWDWE  I+K +R    LK +V+ IYE+ +  +  VN KY    +  LPE+ITFI+S++L   YPN TPKERE  I  +  AVF++ IGD L+ G+ HD RAPDYDDW LNGDI+ W      ALELSSMGIRVDE +L  QL +++   R EL+FHK L+ K+ PY++GGGIGQSR+C F L K HIGEVQ+S+W +D+++E E++ I LL
  S:    16 SMDLKKTEIAIKQLKDFFERELAYKLNLTRVSAPLFVKASSGLNDNLNGVERPVAFDALDIKNEEIQIVHSLAKWKRMALHRYGFKPGEGLYTDMNAIRRDEELDNIHSMYVDQWDWEKVIEKKDRTEAKLKKIVEGIYEVFKSTENFVNDKYPEI-DKTLPEKITFITSQELEDMYPNLTPKERENTITKEKGAVFLMKIGDTLASGEKHDGRAPDYDDWSLNGDILFWYPILNCALELSSMGIRVDEDALRYQLKRASCEERAELEFHKMLLEKKLPYTVGGGIGQSRICMFFLRKAHIGEVQTSIWSEDVIKECEESRITLL 339
>gi|194467333|ref|ZP_03073320.1| aspartate/ammonia ligase [Lactobacillus reuteri 100-23] >gi|194454369|gb|EDX43266.1| aspartate/ammonia ligase [Lactobacillus reuteri 100-23] (336 aa)
Score = 833, Expect = 2.8e-87, Identities = 167/323 (51%), Positives = 231/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI ET+ AI++I++ FQ      L L R++AP+ +E++ G+ND+LNG E PV+F   D    + E+  SLAKWKR+ L +Y   +HEG+Y +MNAIRK+E L + HSIYVDQWDWE  I K ER  ETLK  V+ I+++I+  + EV  K+   A   LP+EI F+++++L  R+P+ TP ERE  IA +  AVF++ IGD L   GKPHD RAPDYDDW LNGDII W E  +  +E+SSMGIRV   S+  QL++++   R++L FHK L+N E PY+IGGGIGQSRLC  LL K HIGEVQ+S+WP+D++++ E+N+I++L
  S:    13 LSIRETEAAIRYIRETFQDEFGKELNLQRMSAPMFVEKSTGLNDNLNGVEQPVSFEMKDMPSETVEVVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRKEEDLDNFHSIYVDQWDWEKVISKDERTEETLKDTVRDIFKVIKHMEHEVWYKFPQ-AVYHLPDEIHFVTTQELEDRWPDLTPLEREDKIAKELGAVFVMKIGDKLQRSGKPHDGRAPDYDDWSLNGDIIFWYEPLQRRIEISSMGIRVSPESMKYQLEQADATDREKLPFHKMLLNGELPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPEDMIKKCEENHIQIL 336
>gi|111610261|gb|ABH11630.1| aspartate-ammonia ligase [Lactobacillus helveticus CNRZ32] (337 aa)
Score = 833, Expect = 2.9e-87, Identities = 166/323 (51%), Positives = 230/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG--NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +T+ AI FI++ FQ  LA  L + R++AP+ +E+  G+ND+LNG E PV F         + EI  SLAKWKR+ L KY   +HEG+Y +MNAIR+DE L + HSIYVDQWDWE  I+K ERN +TL++ V KI+  I+  +K V+ ++   +   L + ++FI++++L  R+P+ +P ERE  IA + K VFI+ IGD L   GKPHD RAPDYDDW+LNGD++ W E  +S +E+SSMGIRV E SL EQL K++   R +L FH+ ++  E PYSIGGGIGQSRLC  LL K HIGEVQ+S+WP+D++E+ E +NI+LL
  S:    13 LTVRDTEAAIVFIRETFQDKLASILGIQRMSAPMFVEQKTGLNDNLNGVERPVAFDVKAMPKEDTIEIVHSLAKWKRLALKKYGFGMHEGLYTNMNAIRRDEDLDNFHSIYVDQWDWEKIIRKEERNTDTLEITVNKIFRAIKETEKLVSARHPG-STYRLGDHVSFITTQELEDRWPDLSPDERENQIAKEEKVVFIMKIGDKLKRSGKPHDGRAPDYDDWQLNGDLVFWYEPLQSKIEISSMGIRVSEESLKEQLKKAHCEERTKLPFHQMILKGELPYSIGGGIGQSRLCMLLLGKAHIGEVQASIWPEDMVEKCEADNIELL 337
>gi|148545089|ref|YP_001272459.1| asparagine synthetase AsnA [Lactobacillus reuteri F275] >gi|166988301|sp|A5VMP8|ASNA_LACRF Aspartate--ammonia ligase (Asparagine synthetase A) >gi|148532123|gb|ABQ84122.1| Aspartate--ammonia ligase [Lactobacillus reuteri F275] (336 aa)
Score = 833, Expect = 3.2e-87, Identities = 168/323 (52%), Positives = 231/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI ET+ AI++I++ FQ      L L R++AP+ +E++ G+ND+LNG E PV+F   D    + EI  SLAKWKR+ L +Y   +HEG+Y +MNAIRK+E L + HSIYVDQWDWE  I K ER  ETLK  V+ I+++I+  + EV  K+   A   LP+EI F+++++L  R+P+ TP ERE  IA +  AVF++ IGD L   GKPHD RAPDYDDW LNGDII W E  +  +E+SSMGIRV   S+  QL++++   R++L FHK L+N E PY+IGGGIGQSRLC  LL K HIGEVQ+S+WP+D++++ E+N+I++L
  S:    13 LSIRETEAAIRYIRETFQDEFGKELNLQRMSAPMFVEKSTGLNDNLNGVEQPVSFEMKDMPNETVEIVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRKEEDLDNFHSIYVDQWDWEKIISKDERTEETLKDTVRDIFKVIKHMEHEVWYKFPQ-AVYHLPDEIHFVTTQELEDRWPDLTPLEREDKIAKELGAVFVMKIGDKLQRSGKPHDGRAPDYDDWSLNGDIIFWYEPLQRRIEVSSMGIRVSPESMKYQLEQADATDREKLPFHKMLLNGELPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPEDMIKKCEENHIQIL 336
>gi|116493207|ref|YP_804942.1| asparagine synthetase AsnA [Pediococcus pentosaceus ATCC 25745] >gi|122265329|sp|Q03E72|ASNA_PEDPA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|116103357|gb|ABJ68500.1| aspartate-ammonia ligase [Pediococcus pentosaceus ATCC 25745] (335 aa)
Score = 832, Expect = 3.4e-87, Identities = 161/323 (49%), Positives = 227/323 (70%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LS+ +TQ+AI++I++ FQ      L L R++AP+ +    G+ND+LNG E PV+F+  D    S EI  SLAKWKR+ L +++  +H G+Y +MNAIRKDE L +IHSIYVDQWDWE  I ++ERNL TLK  V+ I+++I+  + EV  KY   A   LP++I F+++++L  R+P  TPKERE  I  +   VF++ IG  L  G+ HD RAPDYDDW+LNGDI+ W E  + ALE+SSMGIRV E S+++QL  +N   R  L +H+ L+N + PY+IGGGIGQSRLC  LL K H+GEVQ+S+WP+ ++++ E+N I +L
  S:    13 LSVRQTQEAIRYIRETFQDEFGKELNLSRLSAPMFVPSATGLNDNLNGVETPVSFSMQDMPETSIEIVHSLAKWKRVALKRFDFEMHSGLYTNMNAIRKDEDLDNIHSIYVDQWDWEKVIDQSERNLTTLKETVQTIFKVIKHMEHEVWYKYPE-AVYHLPDQIHFVTTQELEDRFPKLTPKEREDAICKELGCVFLMQIGGTLKSGERHDGRAPDYDDWQLNGDILFWYEPLQKALEISSMGIRVSEESMLKQLKIANAEDRIHLPYHQMLLNHQLPYTIGGGIGQSRLCMLLLGKAHVGEVQASVWPQSMIDQCEENQIHIL 335
>gi|161508168|ref|YP_001578139.1| asparagine synthetase AsnA [Lactobacillus helveticus DPC 4571] >gi|172048189|sp|A8YTK7|ASNA_LACH4 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|160349157|gb|ABX27831.1| Aspartate-ammonia ligase [Lactobacillus helveticus DPC 4571] (337 aa)
Score = 832, Expect = 3.5e-87, Identities = 166/323 (51%), Positives = 230/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG--NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +T+ AI FI++ FQ  LA  L + R++AP+ +E+  G+ND+LNG E PV F         + EI  SLAKWKR+ L KY   +HEG+Y +MNAIR+DE L + HSIYVDQWDWE  I+K ERN +TL++ V KI+  I+  +K V+ ++   +   L + ++FI++++L  R+P+ +P ERE  IA + K VFI+ IGD L   GKPHD RAPDYDDW+LNGD++ W E  +S +E+SSMGIRV E SL EQL K++   R +L FH+ ++  E PYSIGGGIGQSRLC  LL K HIGEVQ+S+WP+D++E+ E +NI+LL
  S:    13 LTVRDTEAAIVFIRETFQDKLASILGVQRMSAPMFVEQKTGLNDNLNGVERPVAFDMKAMPKEDTIEIVHSLAKWKRLALKKYGFGIHEGLYTNMNAIRRDEDLDNFHSIYVDQWDWEKIIRKEERNTDTLEITVNKIFRAIKETEKLVSARHPG-STYRLGDHVSFITTQELEDRWPDLSPDERENQIAKEEKVVFIMKIGDKLKRSGKPHDGRAPDYDDWQLNGDLVFWYEPLQSKIEISSMGIRVSEESLKEQLKKAHCEERAKLPFHQMILKGELPYSIGGGIGQSRLCMLLLGKAHIGEVQASIWPEDMVEKCEADNIELL 337
>gi|118443512|ref|YP_877371.1| asparagine synthetase AsnA [Clostridium novyi NT] >gi|118133968|gb|ABK61012.1| aspartate--ammonia ligase [Clostridium novyi NT] (339 aa)
Score = 832, Expect = 4.3e-87, Identities = 171/324 (52%), Positives = 225/324 (69%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++ + +T+ AIK +KD F+  LA+ L L RV+APL ++ + G+ND+LNG E PV F + D      +I  SLAKWKRM L +Y     EG+Y DMNAIR+DE L +IHS+YVDQWDWE  IKK +R    LK +V+ IYE+ +  +  V+ KY    +  LPE+ITFI+S++L   YPN TPKERE  I  +  AVF++ IGD L+ G+ HD RAPDYDDW LNGDI+ W      ALELSSMGIRVDE +L  QL K+N   R EL+FHK L+ K+ PY++GGGIGQSR+C F L K HIGEVQ+S+W +D+++E E+  I LL
  S:    16 SMDLKKTEIAIKQLKDFFERELAYKLNLIRVSAPLFVKESSGLNDNLNGIERPVAFDALDIKKEEIQIVHSLAKWKRMALHRYGFKPGEGLYTDMNAIRRDEELDNIHSMYVDQWDWEKVIKKEDRTEAKLKEIVEGIYEVFKSTENFVSDKYPEI-DKTLPEKITFITSQELENMYPNLTPKERENTITKEKGAVFLMKIGDTLASGEKHDGRAPDYDDWSLNGDILFWYPVLNCALELSSMGIRVDEDALKYQLKKANCEERAELEFHKMLLEKKLPYTVGGGIGQSRICMFFLRKAHIGEVQASIWSEDVIKECEELGITLL 339
>gi|167770391|ref|ZP_02442444.1| hypothetical protein ANACOL_01734 [Anaerotruncus colihominis DSM 17241] >gi|167667398|gb|EDS11528.1| hypothetical protein ANACOL_01734 [Anaerotruncus colihominis DSM 17241] (343 aa)
Score = 831, Expect = 5.3e-87, Identities = 161/323 (49%), Positives = 205/323 (63%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I+ET+ AIK  KD F+  LA AL L RV+APL +    G+NDDLNG E PV F     G   +I  SLAKWKRM LG+Y      G+Y DMNAIR+DE L ++HS+YVDQWDWE  I + +R +ET++  V+ I   +   Q  +   +    E  LPE+I+F++S+ L   YP  TPKERE   A KY AVF+  IG  L  GKPHD RAPDYDDW LNGDI++W      ALE+SSMGIRVD  +L  QL+ +    R  L FH+ L+    P ++GGGIGQSR+C  LL K HIGEVQ+S+WP D+ +    + I LL
  S:    22 LDIMETEIAIKLAKDTFERELARALTLTRVSAPLFVRPETGLNDDLNGVERPVQFDILDLGADVQIVHSLAKWKRMALGRYGFAPQTGLYTDMNAIRRDEELDNLHSVYVDQWDWEKVITREQRTMETVEDAVRSIMGALCKTQNVLADAFTAL-ERFLPEQISFVTSQQLEDEYPELTPKERENAAAQKYGAVFVSQIGGKLRSGKPHDGRAPDYDDWSLNGDILIWYPVLGRALEISSMGIRVDAAALKRQLETAGCMQRAGLPFHRMLLEDRLPLTMGGGIGQSRICMALLQKAHIGEVQASVWPDDMHDACAASGIHLL 343
>gi|148323992|gb|EDK89242.1| aspartate--ammonia ligase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (327 aa)
Score = 830, Expect = 6.3e-87, Identities = 173/324 (53%), Positives = 223/324 (68%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L ILET+ AIK +KD F+ +L+  L L RV+APL +    G+ND+LNG+E PV+F +  +G   EI  SLAKWKRM L +Y I  H+GIY DMNAIR+DE    IHS YVDQWDWE  I K +RN E LK VV+KIY + +  ++ +  +Y    + L PEEITFI++++L  +YPN TPK RE   A +Y A+F++ IG  LS G+ HD RAPDYDDW LNGDII         LELSSMGIRVDE SL EQL  +N   R+ L +H+ ++NK  PY+IGGGIGQSR+C F L K HIGEVQ+S+W +++ E   + NIKLL
  S:     6 SLDILETEIAIKKVKDFFESHLSKELDLLRVSAPLFVIPESGLNDNLNGTERPVSFDTK-SGERVEIVHSLAKWKRMALYRYNIENHKGIYTDMNAIRRDEDTDFIHSYYVDQWDWEKIISKEDRNEEYLKEVVRKIYSVFKATEEYITNEYPKLTKKL-PEEITFITAQELENKYPNLTPKNREHAAAKEYGAIFLMKIGGKLSSGEKHDGRAPDYDDWDLNGDIIFNYPLLGIGLELSSMGIRVDEKSLDEQLKIANCEDRRSLPYHQMILNKVLPYTIGGGIGQSRICMFFLDKLHIGEVQASIWSEEVHEICRQMNIKLL 327
>gi|160881573|ref|YP_001560541.1| asparagine synthetase AsnA [Clostridium phytofermentans ISDg] >gi|160430239|gb|ABX43802.1| Aspartate--ammonia ligase [Clostridium phytofermentans ISDg] (337 aa)
Score = 830, Expect = 7.1e-87, Identities = 167/323 (51%), Positives = 222/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I +TQ AIK +KD F+  LA  L L RV+APL +    G+ND+L+G E PV+F   + +    EI  SLAKWKRM L KY     EG+Y DMNAIR+DE   +IHSI+VDQWDWE  +   ERN+ETLK VV+ +Y+ ++  +  ++ KY++  + +LP+EI F+++++L   YPN TPK+RE  IA    AVFI+ IG  L+ G+ HD RAPDYDDW LNGDIIV+      ALELSSMGIRVDE SL  QL+ ++   R +L F K ++N+E PY++GGGIGQSR+C F L K HIGEVQSS+W ++ +E+   N I LL
  S:    15 LDIKDTQGAIKHVKDHFERQLAKQLNLTRVSAPLFVRPETGLNDNLSGVERPVSFGVKEQDDAEVEIVHSLAKWKRMALKKYGFAYGEGLYTDMNAIRRDEDTDNIHSIFVDQWDWEKILLHDERNVETLKSVVRSVYQALKDTEHYISDKYDYIGK-ILPKEIAFVTTQELENMYPNDTPKDREYKIAKLKGAVFIMQIGGALASGEKHDGRAPDYDDWSLNGDIIVYYPVLDIALELSSMGIRVDETSLANQLEIADCKDRAKLPFQKAVLNRELPYTVGGGIGQSRICMFFLRKAHIGEVQSSIWKEEDIEKLGNNGITLL 337
>gi|30019890|ref|NP_831521.1| asparagine synthetase AsnA [Bacillus cereus ATCC 14579] >gi|168134622|ref|ZP_02577851.1| asparagine synthetase AsnA [Bacillus cereus B4264] >gi|47115753|sp|Q81F55|ASNA_BACCR Aspartate--ammonia ligase (Asparagine synthetase A) >gi|29895435|gb|AAP08722.1| Aspartate--ammonia ligase [Bacillus cereus ATCC 14579] (327 aa)
Score = 828, Expect = 1.0e-86, Identities = 166/323 (51%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R +E L+  V+ IY I +  +  + +KY  F    LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVEYLQKTVQTIYGIFKDLEDHLFEKYP-FLGKYLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|34763200|ref|ZP_00144165.1| Aspartate--ammonia ligase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887138|gb|EAA24244.1| Aspartate--ammonia ligase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (327 aa)
Score = 828, Expect = 1.0e-86, Identities = 174/324 (53%), Positives = 221/324 (68%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L ILET+ AIK +KD F+  LA  L L RV+APL +    G+ND+LNG+E PV+F +  +G   EI  SLAKWKRM L +Y I  H+GIY DMNAIR+DE    IHS YVDQWDWE  I K +RN E LK  V+KIY + +  ++ +  +Y    + L PEEITFI+S++L  +YPN TPK RE   A +Y A+F++ IG  LS G+ HD RAPDYDDW LNGDII         LELSSMGIRVDE SL EQL  +N   R+ L +H+ ++NK  PY+IGGGIGQSR+C F L K HIGEVQ+S+W +++ E   + NIKLL
  S:     6 SLDILETEIAIKKVKDFFESRLAKELDLLRVSAPLFVIPESGLNDNLNGTERPVSFDTK-SGERVEIVHSLAKWKRMALYRYNIENHKGIYTDMNAIRRDEDTDFIHSYYVDQWDWEKIISKEDRNEEYLKETVRKIYCVFKETEEYITTEYPKLTKKL-PEEITFITSQELENKYPNLTPKNREHAAAKEYGAIFLMKIGGKLSSGEKHDGRAPDYDDWDLNGDIIFNYPLLGIGLELSSMGIRVDEKSLDEQLKIANCEDRRSLPYHQMILNKVLPYTIGGGIGQSRICMFFLDKLHIGEVQASIWSQEVHEICRQMNIKLL 327
>gi|188587650|ref|YP_001921715.1| aspartate--ammonia ligase [Clostridium botulinum E3 str. Alaska E43] >gi|188497931|gb|ACD51067.1| aspartate--ammonia ligase [Clostridium botulinum E3 str. Alaska E43] (337 aa)
Score = 828, Expect = 1.2e-86, Identities = 171/322 (53%), Positives = 220/322 (68%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           S++ET+  IK IKD F+  LA +L L RV+APL +E   G+ND+LNGSE PV+F     G   +I  SLAKWKR  L +Y     EG+Y DMNAIR+DE L ++HSIYVDQWDWE  I K +RNL+TLK +VKKIY + +  + +   K     E  LPE+I FI++++L   YP KT KERE LIA +  AVFI+ IGD L  G+ HD R+PDYDDW +NGDII +    + A E+SSMGIRVDE +L+ QL ++N   RK L+FHK L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +  L   EK  I+LL
  S:    17 SLIETEVHIKKIKDFFERALAESLNLTRVSAPLFVEPQTGMNDNLNGSERPVSFDVLATGKDVQIVHSLAKWKRYSLYRYGFEAGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKIIDKEDRNLDTLKDIVKKIYTVFKKAE-DFACKESMDEEKFLPEDIFFITTQELEDMYPGKTGKEREDLIAKEKGAVFIMQIGDVLKSGEKHDGRSPDYDDWTMNGDIIFYYPILERAFEVSSMGIRVDEKALLRQLKEANCEDRKNLEFHKMLLEGKLPYTIGGGIGQSRICMFFLKKAHIGEVQASIWDEKNLNACEKYGIRLL 337
>gi|152975224|ref|YP_001374741.1| asparagine synthetase AsnA [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189046373|sp|A7GNN8|ASNA_BACCN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|152023976|gb|ABS21746.1| Aspartate--ammonia ligase [Bacillus cereus subsp. cytotoxis NVH 391-98] (327 aa)
Score = 827, Expect = 1.3e-86, Identities = 166/323 (51%), Positives = 216/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R +E L+  V+ IY I +  +  + +KY  F    LPE+I FI+S++L  +YP  TPKERE  IA +Y AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + +++ DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP ++ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLGLFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVEYLQETVRTIYGIFKDLEDHLFEKYP-FLGKYLPEDIAFITSQELEDKYPELTPKEREHAIAKEYGAVFIIGIGDVLRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSQSLDEQLTKAGEDFKRDYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDEMREACKKENIHLF 327
>gi|58338140|ref|YP_194725.1| asparagine synthetase AsnA [Lactobacillus acidophilus NCFM] >gi|75507531|sp|Q5FHY0|ASNA_LACAC Aspartate--ammonia ligase (Asparagine synthetase A) >gi|58255457|gb|AAV43694.1| aspartate-ammonia ligase [Lactobacillus acidophilus NCFM] (336 aa)
Score = 827, Expect = 1.5e-86, Identities = 167/323 (51%), Positives = 231/323 (71%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG---EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +T+ AI +I++ FQ  LA  L + R++AP+ +E+  G+ND+LNG E PV F  D   I     E+  SLAKWKR+ L +Y   +HEG+Y +MNAIR+DE L + HSIYVDQWDWE  I K ERN +TL+V V KI++ I+  +K V  +Y   +   L + ++FI++++L  R+P  +P+ERE  IA + KAVFI+ IGD L   GKPHD RAPDYDDW+LNGD+I W E  +S +E+SSMGIRV E SL EQL K++   R++L FHK L+  + PY+IGGGIGQSRLC  LL K HIGEVQ+S+WP++++E+ E ++I LL
  S:    13 LTVRDTEAAIVYIRETFQDKLASILGVQRMSAPMFVEKASGLNDNLNGVERPVGF--DMKAIPDSEIEVVHSLAKWKRLALKRYGFGMHEGLYTNMNAIRRDEDLDNFHSIYVDQWDWEKIIAKEERNTDTLEVTVMKIFKAIKATEKLVTARYPG-STYRLGDHVSFITTQELEDRWPELSPEERENKIAKEEKAVFIMKIGDKLKRSGKPHDGRAPDYDDWQLNGDLIFWYEPLQSKIEVSSMGIRVSEESLREQLKKAHCEDREKLPFHKMLLEGKLPYTIGGGIGQSRLCMLLLGKAHIGEVQASIWPEEMIEKCESDHIHLL 336
>gi|196041258|ref|ZP_03108553.1| aspartate--ammonia ligase [Bacillus cereus NVH0597-99] >gi|196027966|gb|EDX66578.1| aspartate--ammonia ligase [Bacillus cereus NVH0597-99] (327 aa)
Score = 825, Expect = 2.3e-86, Identities = 164/323 (50%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V  IY I +  +  + +KY +  +  LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLEDHLFEKYPFLGK-YLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSTSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|153813832|ref|ZP_01966500.1| hypothetical protein RUMTOR_00038 [Ruminococcus torques ATCC 27756] >gi|145848228|gb|EDK25146.1| hypothetical protein RUMTOR_00038 [Ruminococcus torques ATCC 27756] (336 aa)
Score = 824, Expect = 3.2e-86, Identities = 169/323 (52%), Positives = 220/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L+I ET+ AIK +KD F+  LA +L L RV+APL +    G+ND+LNG E PV+F   + +    EI  SLAKWKR  L KY     EG+Y DM AIR+DE   +IHS+YVDQWDWE  I K ERN+ETL+  V+K+Y  ++  +  ++++Y +  E LLP++I FI+S++L   +P+ TPKERE  IA    AVFI  IG  L+ G+ HD RAPDYDDW+LNGDIIV+      ALELSSMGIRVDE SL  QL  +    R +L F K L++ E PY++GGGIGQSR+C + L K HIGEV SS+WP+ I+E A +N I LL
  S:    14 LTIRETEVAIKEVKDHFERALAKSLHLTRVSAPLFVLPQSGMNDNLNGIERPVSFGIKEQDDACAEIVHSLAKWKRYALKKYGFHSGEGLYTDMTAIRRDEDTDNIHSLYVDQWDWEKIISKEERNMETLEYTVRKVYSALKDTEDYISRRYNYI-EPLLPDDIFFITSQELEDMFPDCTPKERELRIAKAKGAVFISQIGKVLASGEKHDGRAPDYDDWELNGDIIVYYPVLDIALELSSMGIRVDEESLKSQLKTAGCEDRAKLPFQKSLLDGELPYTVGGGIGQSRICMYYLRKAHIGEVHSSMWPESIVETASENGIHLL 336
>gi|168695405|ref|ZP_02727682.1| asparagine synthetase AsnA [Clostridium difficile QCD-37x79] >gi|168715941|ref|ZP_02748218.1| asparagine synthetase AsnA [Clostridium difficile QCD-63q42] >gi|168722797|ref|ZP_02755074.1| asparagine synthetase AsnA [Clostridium difficile QCD-76w55] >gi|168731310|ref|ZP_02763587.1| asparagine synthetase AsnA [Clostridium difficile QCD-97b34] >gi|196126846|ref|ZP_03118595.1| asparagine synthetase AsnA [Clostridium difficile ATCC 43255] >gi|196161646|ref|ZP_03122207.1| asparagine synthetase AsnA [Clostridium difficile CIP 107932] (333 aa)
Score = 823, Expect = 4.1e-86, Identities = 171/324 (52%), Positives = 223/324 (68%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L++++TQ AIK +KD F++ L++ L L RV++PL +    G ND+LNG E  V+F       + EI QSLAKWKR+ L KY   +  G+Y DMNAIRK+E L +IHS+YVDQWDWEL I K+ RN +TLK VVK++Y + +  +  V   YE   E +LPEEITFI+S++L   YP  +PKERE  I  + KAVFI  IG  L  G+ HD R+PDYDDW+LNGDI+ +N    SALELSSMGIRVDE SL  QL  +    RKE D+HK L+N E PY+IGGGIGQSR+C + L K HIGEVQ  +WP+D+++      I+LL
  S:    12 SLNVIDTQIAIKKLKDFFEMRLSNELNLIRVSSPLFVLPETGANDNLNG-EKAVSFDIPFMNKNAEIVQSLAKWKRLALKKYGFEVGSGLYTDMNAIRKNEELDNIHSLYVDQWDWELVIDKSSRNEKTLKDVVKRLYGVFKDTEIFVCSMYEGIKE-ILPEEITFITSQELEDMYPELSPKEREDKIVKEKKAVFITQIGKTLISGEKHDGRSPDYDDWELNGDILFYNPVLDSALELSSMGIRVDEESLDRQLKLAGCEERKEFDYHKMLLNGELPYTIGGGIGQSRICMYFLQKAHIGEVQVGVWPQDMIQNCSSAGIELL 333
>gi|47565538|ref|ZP_00236579.1| aspartate--ammonia ligase [Bacillus cereus G9241] >gi|47557528|gb|EAL15855.1| aspartate--ammonia ligase [Bacillus cereus G9241] (327 aa)
Score = 822, Expect = 5.0e-86, Identities = 165/323 (51%), Positives = 216/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V  IY I +  +  + +KY  F    LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLENHLFEKYP-FLGKYLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|42780949|ref|NP_978196.1| asparagine synthetase AsnA [Bacillus cereus ATCC 10987] >gi|47605385|sp|P61397|ASNA_BACC1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|42736870|gb|AAS40804.1| aspartate--ammonia ligase [Bacillus cereus ATCC 10987] (327 aa)
Score = 822, Expect = 5.2e-86, Identities = 164/323 (50%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V  IY I +  +  + +KY +  +  LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKRSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLEDHLFEKYPFLGK-YLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|126700309|ref|YP_001089206.1| asparagine synthetase AsnA [Clostridium difficile 630] >gi|145953160|ref|ZP_01802168.1| hypothetical protein CdifQ_04003139 [Clostridium difficile QCD-32g58] >gi|115251746|emb|CAJ69581.1| aspartate--ammonia ligase [Clostridium difficile 630] (336 aa)
Score = 822, Expect = 5.4e-86, Identities = 171/324 (52%), Positives = 223/324 (68%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L++++TQ AIK +KD F++ L++ L L RV++PL +    G ND+LNG E  V+F       + EI QSLAKWKR+ L KY   +  G+Y DMNAIRK+E L +IHS+YVDQWDWEL I K+ RN +TLK VVK++Y + +  +  V   YE   E +LPEEITFI+S++L   YP  +PKERE  I  + KAVFI  IG  L  G+ HD R+PDYDDW+LNGDI+ +N    SALELSSMGIRVDE SL  QL  +    RKE D+HK L+N E PY+IGGGIGQSR+C + L K HIGEVQ  +WP+D+++      I+LL
  S:    15 SLNVIDTQIAIKKLKDFFEMRLSNELNLIRVSSPLFVLPETGANDNLNG-EKAVSFDIPFMNKNAEIVQSLAKWKRLALKKYGFEVGSGLYTDMNAIRKNEELDNIHSLYVDQWDWELVIDKSSRNEKTLKDVVKRLYGVFKDTEIFVCSMYEGIKE-ILPEEITFITSQELEDMYPELSPKEREDKIVKEKKAVFITQIGKTLISGEKHDGRSPDYDDWELNGDILFYNPVLDSALELSSMGIRVDEESLDRQLKLAGCEERKEFDYHKMLLNGELPYTIGGGIGQSRICMYFLQKAHIGEVQVGVWPQDMIQNCSSAGIELL 336
>gi|65319129|ref|ZP_00392088.1| COG2502: Asparagine synthetase A [Bacillus anthracis str. A2012] (322 aa)
Score = 822, Expect = 5.5e-86, Identities = 165/323 (51%), Positives = 216/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V  IY I +  +  + +KY  F    LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     1 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLEDHLFEKYP-FLGKYLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 322
>gi|168141913|ref|ZP_02585142.1| asparagine synthetase AsnA [Bacillus cereus G9842] (327 aa)
Score = 822, Expect = 5.7e-86, Identities = 164/323 (50%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V+ IY I +  +  + +KY +  +  LPEEI FI+S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+    +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVQTIYGIFKDLEDHLFEKYPFLGK-YLPEEIVFITSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLRAACKKENIHLF 327
>gi|30261854|ref|NP_844231.1| asparagine synthetase AsnA [Bacillus anthracis str. Ames] >gi|47527094|ref|YP_018443.1| asparagine synthetase AsnA [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184687|ref|YP_027939.1| asparagine synthetase AsnA [Bacillus anthracis str. Sterne] >gi|49481104|ref|YP_035988.1| asparagine synthetase AsnA [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52143614|ref|YP_083214.1| asparagine synthetase AsnA [Bacillus cereus E33L] >gi|118477276|ref|YP_894427.1| asparagine synthetase AsnA [Bacillus thuringiensis str. Al Hakam] >gi|165869279|ref|ZP_02213938.1| aspartate--ammonia ligase [Bacillus anthracis str. A0488] >gi|166992428|ref|ZP_02258888.1| asparagine synthetase AsnA [Bacillus cereus AH820] >gi|167633287|ref|ZP_02391612.1| aspartate--ammonia ligase [Bacillus anthracis str. A0442] >gi|167638722|ref|ZP_02396997.1| aspartate--ammonia ligase [Bacillus anthracis str. A0193] >gi|170686225|ref|ZP_02877447.1| aspartate--ammonia ligase [Bacillus anthracis str. A0465] >gi|170707341|ref|ZP_02897796.1| aspartate--ammonia ligase [Bacillus anthracis str. A0389] >gi|177650474|ref|ZP_02933441.1| aspartate--ammonia ligase [Bacillus anthracis str. A0174] >gi|190566364|ref|ZP_03019282.1| aspartate--ammonia ligase [Bacillus anthracis Tsiankovskii-I] >gi|196033482|ref|ZP_03100894.1| aspartate--ammonia ligase [Bacillus cereus W] >gi|196045040|ref|ZP_03112273.1| aspartate--ammonia ligase [Bacillus cereus 03BB108] >gi|81688508|sp|Q63D03|ASNA_BACCZ Aspartate--ammonia ligase (Asparagine synthetase A) >gi|81696871|sp|Q6HKD8|ASNA_BACHK Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166219923|sp|A0RCH7|ASNA_BACAH Aspartate--ammonia ligase (Asparagine synthetase A) >gi|47115755|sp|Q81S64|ASNA_BACAN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|30256082|gb|AAP25717.1| aspartate--ammonia ligase [Bacillus anthracis str. Ames] >gi|47502242|gb|AAT30918.1| aspartate--ammonia ligase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178614|gb|AAT53990.1| aspartate--ammonia ligase [Bacillus anthracis str. Sterne] >gi|49332660|gb|AAT63306.1| aspartate-ammonia ligase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51977083|gb|AAU18633.1| aspartate-ammonia ligase [Bacillus cereus E33L] >gi|118416501|gb|ABK84920.1| aspartate-ammonia ligase [Bacillus thuringiensis str. Al Hakam] >gi|164714719|gb|EDR20237.1| aspartate--ammonia ligase [Bacillus anthracis str. A0488] >gi|167513186|gb|EDR88557.1| aspartate--ammonia ligase [Bacillus anthracis str. A0193] >gi|167531325|gb|EDR94003.1| aspartate--ammonia ligase [Bacillus anthracis str. A0442] >gi|170127840|gb|EDS96712.1| aspartate--ammonia ligase [Bacillus anthracis str. A0389] >gi|170669922|gb|EDT20663.1| aspartate--ammonia ligase [Bacillus anthracis str. A0465] >gi|172083618|gb|EDT68678.1| aspartate--ammonia ligase [Bacillus anthracis str. A0174] >gi|190562499|gb|EDV16466.1| aspartate--ammonia ligase [Bacillus anthracis Tsiankovskii-I] >gi|195993916|gb|EDX57872.1| aspartate--ammonia ligase [Bacillus cereus W] >gi|196024042|gb|EDX62716.1| aspartate--ammonia ligase [Bacillus cereus 03BB108] (327 aa)
Score = 822, Expect = 5.7e-86, Identities = 165/323 (51%), Positives = 216/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V  IY I +  +  + +KY  F    LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLEDHLFEKYP-FLGKYLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|166983741|ref|ZP_02255128.1| asparagine synthetase AsnA [Bacillus cereus AH187] >gi|168160075|ref|ZP_02595308.1| asparagine synthetase AsnA [Bacillus cereus H3081.97] (327 aa)
Score = 822, Expect = 5.9e-86, Identities = 165/323 (51%), Positives = 216/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V  IY I +  +  + +KY  F    LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVLTIYGIFKDLEDHLFEKYP-FLGKYLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDYKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|163939657|ref|YP_001644541.1| asparagine synthetase AsnA [Bacillus weihenstephanensis KBAB4] >gi|163861854|gb|ABY42913.1| Aspartate--ammonia ligase [Bacillus weihenstephanensis KBAB4] (327 aa)
Score = 822, Expect = 6.1e-86, Identities = 164/323 (50%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V+ IY I +  +  + +KY  F    LPEEI FI+S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +++ ELSSMGIRVD  +L EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+ E  +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTIDYLQKTVQTIYGIFKELEGHLFEKYP-FLGKYLPEEIIFITSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRASDYDDWKLNGDILFWHPVLQASFELSSMGIRVDSKALDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLREACKKENIHLF 327
>gi|154503368|ref|ZP_02040428.1| hypothetical protein RUMGNA_01192 [Ruminococcus gnavus ATCC 29149] >gi|153796035|gb|EDN78455.1| hypothetical protein RUMGNA_01192 [Ruminococcus gnavus ATCC 29149] (336 aa)
Score = 822, Expect = 6.3e-86, Identities = 169/323 (52%), Positives = 221/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L+I ET+ AIK IKD F+ +LA +L L RV+APL ++   G+ND+LNG E PV+F   +      EI  SLAKWKR  L  Y     EG+Y DM+AIR+DE   +IHSIYVDQWDWE  I K ERN+ETL+  V+K+Y  ++  +  ++++Y +  E LLP++I FI+S++L   YP    KERE  +A +  A+F+  IG  L+ G+ HD RAPDYDDW+LNGDIIV+      ALELSSMGIRVDE +L +QL  S    R +L F K L+N+E PY+IGGGIGQSR+C + L K HIGEVQSSLWP DI   A ++ I+LL
  S:    14 LTIRETEVAIKEIKDYFERSLAKSLHLTRVSAPLFVKPESGLNDNLNGVERPVSFGIKEQEDTPAEIVHSLAKWKRYALKHYGFHSGEGLYTDMSAIRRDEDTDNIHSIYVDQWDWEKVISKEERNMETLQYTVRKVYSALKETEDYISRRYNYI-EPLLPDDIFFITSQELEDLYPGCDAKEREHRLAKEKGAIFVAQIGKVLASGEKHDGRAPDYDDWELNGDIIVYYPVLDIALELSSMGIRVDEEALAKQLKLSGCEDRAKLPFQKSLLNRELPYTIGGGIGQSRICMYYLRKAHIGEVQSSLWPDDIYNCALEHGIQLL 336
>gi|167934678|ref|ZP_02521753.1| asparagine synthetase AsnA [Bacillus cereus AH1134] (327 aa)
Score = 821, Expect = 6.7e-86, Identities = 163/323 (50%), Positives = 217/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVDQWDWE  ++K  R ++ L+  V+ IY I +  +  + +KY +  +  LPEEI F++S++L  +YP  TPK+RE  IA ++ AVFIIGIGD L  G+ HD RA DYDDWKLNGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+    +K NI L 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDQWDWEKIVQKEWRTVDYLQKTVQTIYGIFKDLEDHLFEKYPFLGK-YLPEEIVFVTSQELEDKYPELTPKDREHAIAKEHGAVFIIGIGDALRSGEKHDGRAADYDDWKLNGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLRAACKKENIHLF 327
>gi|196166186|ref|ZP_03126717.1| asparagine synthetase AsnA [Clostridium difficile QCD-23m63] (333 aa)
Score = 820, Expect = 8.7e-86, Identities = 171/324 (52%), Positives = 223/324 (68%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L++++TQ AIK +KD F++ L++ L L RV++PL +    G ND+LNG E  V+F       + EI QSLAKWKR+ L KY   +  G+Y DMNAIRK+E L +IHS+YVDQWDWEL I K+ RN +TLK VVK++Y + +  +  V   YE   E +LPEEITFI+S++L   YP  +PKERE  I  + KAVFI  IG  L  G+ HD R+PDYDDW+LNGDI+ +N    SALELSSMGIRVDE SL  QL  +    RKE D+HK L+N E PY+IGGGIGQSR+C + L K HIGEVQ  +WP+D+++      I+LL
  S:    12 SLNVIDTQIAIKKLKDFFEMRLSNELNLIRVSSPLFVLPETGANDNLNG-EKAVSFDIPFMNKNAEIVQSLAKWKRLALKKYGFEVGSGLYTDMNAIRKNEELDNIHSLYVDQWDWELVIDKSSRNEKTLKDVVKRLYGVFKDTEIFVCSMYEDIKE-ILPEEITFITSQELEDMYPELSPKEREDKIVKEKKAVFITQIGKTLISGEKHDGRSPDYDDWELNGDILFYNPVLDSALELSSMGIRVDEESLDRQLKLAGCEERKEFDYHKMLLNGELPYTIGGGIGQSRICMYFLQKAHIGEVQVGVWPQDMIQNCSSAGIELL 333
>gi|19704111|ref|NP_603673.1| asparagine synthetase AsnA [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|21263422|sp|P58824|ASNA_FUSNN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|19714317|gb|AAL94972.1| Aspartate-ammonia ligase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (327 aa)
Score = 820, Expect = 9.7e-86, Identities = 172/324 (53%), Positives = 222/324 (68%)
  Q:     3 NLSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +L ILET+ AIK +KD F+ +L+  L L RV+APL +    G+ND+LNG+E PV+F +  +G   EI  SLAKWKRM L +Y I   +GIY DMNAIR+DE    IHS YVDQWDWE  I K +RN E LK VV+KIY + +  ++ +  +Y    + L PEEITFI++++L  +YPN TPK RE   A +Y A+F++ IG  LS G+ HD RAPDYDDW LNGDII         LELSSMGIRVDE SL EQL  +N   R+ L +H+ ++NK  PY+IGGGIGQSR+C F L K HIGEVQ+S+W +++ E   + NIKLL
  S:     6 SLDILETEIAIKKVKDFFESHLSKELDLLRVSAPLFVIPESGLNDNLNGTERPVSFDTK-SGERVEIVHSLAKWKRMALYRYNIENDKGIYTDMNAIRRDEDTDFIHSYYVDQWDWEKIISKEDRNEEYLKDVVRKIYSVFKKTEEYITTEYPKLTKKL-PEEITFITAQELENKYPNLTPKNREHAAAKEYGAIFLMKIGGKLSSGEKHDGRAPDYDDWDLNGDIIFNYPLLGIGLELSSMGIRVDEKSLDEQLKIANCEDRRSLPYHQMILNKVLPYTIGGGIGQSRICMFFLDKLHIGEVQASIWSQEVHEICRQMNIKLL 327
>gi|187934619|ref|YP_001886757.1| aspartate--ammonia ligase [Clostridium botulinum B str. Eklund 17B] >gi|187722772|gb|ACD23993.1| aspartate--ammonia ligase [Clostridium botulinum B str. Eklund 17B] (337 aa)
Score = 817, Expect = 2.0e-85, Identities = 170/322 (52%), Positives = 217/322 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           S++ET+  IK IKD F+  LA +L L RV+APL +E   G+ND+LNGSE PV+F     G   +I  SLAKWKR  L +Y     EG+Y DMNAIR+DE L ++HSIYVDQWDWE  I K +RNL+TLK +VKKIY + +  + +   K     E  LP+EI FI++++L   YP KT KERE LIA +  AVFI+ IGD L  G+ HD R+PDYDDW +NGDII +      A E+SSMGIRVDE +L+ QL  +N   RK L+FHK L+  + PY+IGGGIGQSR+C F L K HIGEVQ+S+W +  L   E   I+LL
  S:    17 SLIETEVHIKKIKDFFEKALAESLNLTRVSAPLFVEPQTGMNDNLNGSERPVSFDVLATGRDVQIVHSLAKWKRYSLYRYGFKAGEGLYTDMNAIRRDEDLDNLHSIYVDQWDWEKIIDKEDRNLDTLKNIVKKIYTVFKKAE-DFACKESMDEEKFLPKEIFFITTQELEDMYPEKTAKEREDLIAKEKGAVFIMQIGDILKSGEKHDGRSPDYDDWTMNGDIIFYYPILDRAFEVSSMGIRVDEKALLRQLKDANCEDRKNLEFHKMLLEGKLPYTIGGGIGQSRICMFFLKKAHIGEVQASIWDEKNLVACENYGIRLL 337
>gi|182417126|ref|ZP_02625521.2| aspartate--ammonia ligase [Clostridium butyricum 5521] >gi|182378968|gb|EDT76474.1| aspartate--ammonia ligase [Clostridium butyricum 5521] (337 aa)
Score = 814, Expect = 5.1e-85, Identities = 171/322 (53%), Positives = 221/322 (68%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIR-----LCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           S++ET+  IK IKD F+  LA  L L RV+APL +E N G+ND+LNG E PV+F         +I  SLAKWKR  L +Y   + EG+YADMNAIR+DE L +IHSIYVDQWDWE  I K +RN++TLK +VK IY   +      C + +N+      +  LPE+I FI++++L  +YP+KTPKERE +IA +  AVFI+ IG  L  GK HD R+PDYDDW LNGDII +    + A E+SSMGIRVDE +L +QL  +  + R+EL FHK L+N E PY++GGGIGQSR+C +LL K HIGEVQSS W    L+  + N I LL
  S:    17 SLIETEVHIKKIKDFFEKALAENLNLTRVSAPLFVEPNTGVNDNLNGIERPVSFDLLEAKKEVQIVHSLAKWKRYSLHRYGFKVGEGLYADMNAIRRDEELDNIHSIYVDQWDWEKIIDKKDRNIDTLKSIVKNIYSAFKAAEEFTCNELINE------DKFLPEDIFFITTQELEDKYPDKTPKEREDIIAKEKGAVFIMQIGGTLKSGKKHDGRSPDYDDWNLNGDIIFYYPLLERAFEVSSMGIRVDEETLDKQLTIAGCDDRRELLFHKMLLNGELPYTVGGGIGQSRICMYLLRKAHIGEVQSSTWDDKNLKICDDNGIVLL 337
>gi|167764835|ref|ZP_02436956.1| hypothetical protein BACSTE_03227 [Bacteroides stercoris ATCC 43183] >gi|167697504|gb|EDS14083.1| hypothetical protein BACSTE_03227 [Bacteroides stercoris ATCC 43183] (345 aa)
Score = 812, Expect = 9.0e-85, Identities = 166/323 (51%), Positives = 220/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E  V+F   D      E+  SLAKWKR+ L +Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I + +RN++ LK +V +IY  +   +  V + Y    +  LP+++ FI +E+L Q YPN  PK RE  IA K+ AVFIIGIG  LSDGK HD RAPDYDD+          LNGD+++W++  + ++ELSSMGIRVD+ +L  QL +     R EL FHK+L+    P SIGGGIGQSRLC F L K HIGE+Q+S+WP+D+  E + +NI L+
  S:    14 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGVERAVSFPIKDLGDAQAEVVHSLAKWKRLTLAEYGIEPGYGIYTDMNAIRADEELGNLHSLYVDQWDWERVITEQDRNIDFLKEIVTRIYAAMVRTEYMVYEMYPQI-KPCLPQKLHFIHAEELRQMYPNIEPKCREHAIAKKFGAVFIIGIGCKLSDGKKHDGRAPDYDDYTTPGLNGLPGLNGDLLLWDDVLQRSVELSSMGIRVDKEALQRQLKQEGEEKRLELYFHKRLMGDALPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRSECKAHNIHLI 345
>gi|153808761|ref|ZP_01961429.1| hypothetical protein BACCAC_03060 [Bacteroides caccae ATCC 43185] >gi|149128587|gb|EDM19805.1| hypothetical protein BACCAC_03060 [Bacteroides caccae ATCC 43185] (345 aa)
Score = 811, Expect = 1.1e-84, Identities = 169/323 (52%), Positives = 220/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E PV+F   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I   +RN+  LK +V +IY  +   +  V + Y    +  LP+++ FI SE+L Q YPN  PK RE  I  KY AVFIIGIG  LSDGK HD RAPDYDD+          LNGD+++W++  + ++ELSSMGIRVD+ +L  QL + +   R EL FHK+L+N   P SIGGGIGQSRLC F L K HIGE+Q+S+WP+D+ +E E+ +I L+
  S:    14 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYHIEPGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVITDEDRNVNFLKEIVNRIYAAMIRTEYMVYEMYPQI-KPCLPQKLHFIHSEELRQLYPNLEPKCREHAICQKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTTNGLNGLPGLNGDLLLWDDVLQRSIELSSMGIRVDKEALQRQLKEEHEEKRLELYFHKRLMNDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKECEELDIHLI 345
>gi|53715099|ref|YP_101091.1| asparagine synthetase AsnA [Bacteroides fragilis YCH46] >gi|60683057|ref|YP_213201.1| asparagine synthetase AsnA [Bacteroides fragilis NCTC 9343] >gi|81313888|sp|Q5L9E0|ASNA_BACFN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|81690589|sp|Q64PM4|ASNA_BACFR Aspartate--ammonia ligase (Asparagine synthetase A) >gi|52217964|dbj|BAD50557.1| aspartate-ammonia ligase [Bacteroides fragilis YCH46] >gi|60494491|emb|CAH09288.1| putative aspartate--ammonia ligase [Bacteroides fragilis NCTC 9343] (345 aa)
Score = 810, Expect = 1.3e-84, Identities = 167/323 (51%), Positives = 218/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E PV+F   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I   +RN + LK +V +IY  +   +  V + Y    +  LP+++ FI SE+L Q YP+  PK RE  I  KY AVFIIGIG  LSDGK HD RAPDYDD+          LNGD+++W++  + ++ELSSMGIRVD+ +L+ Q+ + N   R EL FHK+L+N   P SIGGGIGQSRLC F L K HIGE+Q+S+WP+++  E    NI L+
  S:    14 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYHIEPGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVITAEDRNADFLKEIVNRIYAAMIRTEYMVYEMYPQI-KPCLPQKLHFIHSEELRQLYPDMEPKCREHAICKKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTSKGLNDLPGLNGDLLLWDDVLQRSIELSSMGIRVDKEALLRQVKQENQEQRLELYFHKRLLNDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEEMRRECTALNIHLI 345
>gi|29347539|ref|NP_811042.1| asparagine synthetase AsnA [Bacteroides thetaiotaomicron VPI-5482] >gi|47115788|sp|Q8A5V7|ASNA_BACTN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|29339439|gb|AAO77236.1| aspartate--ammonia ligase [Bacteroides thetaiotaomicron VPI-5482] (345 aa)
Score = 810, Expect = 1.3e-84, Identities = 168/323 (52%), Positives = 220/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E PV+F   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I   +RN+E LK +V +IY  +   +  V + Y    +  LP+++ FI SE+L Q YPN  PK RE  I  KY AVFIIGIG  LSDGK HD RAPDYDD+          LNGD+++W++  + ++ELSSMG+RVD  +L  QL + N   R +L FHK+L++   P SIGGGIGQSRLC F L K HIGE+Q+S+WP+D+ +E E+ +I L+
  S:    14 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYNIEPGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVITNEDRNVEFLKEIVNRIYAAMIRTEYMVYEMYPQI-KPCLPQKLHFIHSEELRQLYPNLEPKCREHAICQKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTSTGLNNLPGLNGDLLLWDDVLQRSIELSSMGVRVDREALQRQLKEENEEERLKLYFHKRLMDDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKECEELDIHLI 345
>gi|116514185|ref|YP_813091.1| asparagine synthetase AsnA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275083|sp|Q04A69|ASNA_LACDB Aspartate--ammonia ligase (Asparagine synthetase A) >gi|116093500|gb|ABJ58653.1| aspartate-ammonia ligase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (338 aa)
Score = 801, Expect = 1.5e-83, Identities = 164/323 (50%), Positives = 222/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++I ET+KAI++I++ FQ     A+ L R++AP+ ++++ G+ND+L+G E PV+FT  DGN    +I  SLAKWKR  L  Y     EG++ +MNAIRKDE  L ++HS+YVDQWDWE  I K+ER   TL+  V++I+E I+  +  V   Y   A +L PEEI+F++SE+L  R+P+ TP ERE  I  +  AVF+  IG  L    KPHDLRAPDYDDW LNGD++ W E  + A E+SSMGIRVDE  L EQL  +    R +L FH+ L+  + PYSIGGGIGQSRLC  LL K HIGEVQ+S+WP +I+E+ +   I+LL
  S:    14 MTIRETEKAIRYIRETFQTEFGTAMNLERISAPMFVKKSSGLNDNLSGWEKPVSFTLHDGNEGELQIVHSLAKWKRWALKHYGFSHGEGLFTNMNAIRKDEEVLDNLHSVYVDQWDWEKVIDKSERTEATLRQTVQRIFETIKGMEYHVRALYPQAAYHL-PEEISFVTSEELEARWPSLTPSEREDKICQEKGAVFLEHIGGALPLSKKPHDLRAPDYDDWTLNGDLLFWYEPLQRAFEVSSMGIRVDEDRLQEQLKLAGAEDRLDLPFHQALLKGDLPYSIGGGIGQSRLCMLLLGKAHIGEVQASIWPDEIVEKCQAAKIQLL 338
>gi|189463946|ref|ZP_03012731.1| hypothetical protein BACINT_00281 [Bacteroides intestinalis DSM 17393] >gi|189438519|gb|EDV07504.1| hypothetical protein BACINT_00281 [Bacteroides intestinalis DSM 17393] (345 aa)
Score = 796, Expect = 5.8e-83, Identities = 166/323 (51%), Positives = 220/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAE--NLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E  V+F   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I    RN++ LK +V +IY  +   +  V   YE + E    LP+++ FI +E+L Q YP+  PK RE  I  KY AVFIIGIG  LSDG+ HD RAPDYDD+          LNGD+++W++  + ++ELSSMGIRVD+ +L  QL +     R EL FHK+L++   P SIGGGIGQSRLC F L K HIGE+Q+S+WP+D+ +E +++NI L+
  S:    14 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGVERAVSFPIKDLGDAQAEVVHSLAKWKRLTLADYNIEPGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVITAENRNVDFLKEIVTRIYAAMIRTEYMV---YEMYPEIKPCLPQKLHFIHAEELRQLYPDLEPKCREHAITKKYGAVFIIGIGCKLSDGEKHDGRAPDYDDYTSEGLNGLPGLNGDLLLWDDVLQRSIELSSMGIRVDKEALQRQLKQEGEEKRLELYFHKRLMSDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRQECKEHNIYLI 345
>gi|104774114|ref|YP_619094.1| asparagine synthetase AsnA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116241259|sp|P54264|ASNA_LACDA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|103423195|emb|CAI97996.1| Aspartate-ammonia ligase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (338 aa)
Score = 794, Expect = 9.5e-83, Identities = 163/323 (50%), Positives = 221/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++I ET+KAI++I++ FQ     A+ L R++AP+ ++++ G+ND+L+G E PV+FT  DGN    +I  SLAKWKR  L  Y     EG++ +MNAIRKDE  L ++HS+YVDQWDWE  I K+ER   TL+  V++I+E I+  +  V   Y   A +L PEEI+F++SE+L  R+P+ TP ERE  I  +  AVF+  IG  L    KPHDLRAPDYDDW LNGD++ W E  + A E+SSM IRVDE  L EQL  +    R +L FH+ L+  + PYSIGGGIGQSRLC  LL K HIGEVQ+S+WP +I+E+ +   I+LL
  S:    14 MTIRETEKAIRYIRETFQTEFGTAMNLERISAPMFVKKSSGLNDNLSGWEKPVSFTLHDGNEGELQIVHSLAKWKRWALKHYGFSHGEGLFTNMNAIRKDEEVLDNLHSVYVDQWDWEKVIDKSERTEATLRQTVQRIFETIKGMEYHVRALYPQAAYHL-PEEISFVTSEELEARWPSLTPSEREDKICQEKGAVFLEHIGGALPLSKKPHDLRAPDYDDWTLNGDLLFWYEPLQRAFEVSSMSIRVDEDRLQEQLKLAGAEDRLDLPFHQALLKGDLPYSIGGGIGQSRLCMLLLGKAHIGEVQASIWPDEIVEKCQAAKIQLL 338
>gi|89096087|ref|ZP_01168980.1| asparagine synthetase AsnA [Bacillus sp. NRRL B-14911] >gi|89088941|gb|EAR68049.1| asparagine synthetase AsnA [Bacillus sp. NRRL B-14911] (336 aa)
Score = 794, Expect = 1.0e-82, Identities = 167/323 (51%), Positives = 215/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENL---LPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +++++T+KA+K +KD F+  L+  L L +V+APL+LE   GIND+LNG E   T  +     + E+ QSLAKWKRM L +Y     EG+Y DM AIRKDE L  +HSIYVDQWDWE  I K +RN +TLK  V  IYE I    KE  KK  +   +L   LPE+I+FI+S+ L   +P+   K+RE  IA K  AVFI+ IG +L  G  HD R+PDYDDW LNGD+I W      ++E+SSMGIRVDE SL  QL +  N  R EL FHK L++ + P++IGGGIGQSRLC FLL K HIGEVQ+S+W   I +E +  NI LL
  S:    15 MNLIDTEKALKNVKDCFEKELSERLNLTKVSAPLLLESRTGINDNLNGVERMATIEAKDLAETLEVVQSLAKWKRMALARYGFSEGEGLYTDMRAIRKDEELDQLHSIYVDQWDWEKVIPKNKRNKQTLKAEVVSIYESI----KETEKKLFYSCSHLVPVLPEQISFITSQQLEDMFPDLPAKQREDRIAEKLGAVFIMNIGGSLLSGSKHDSRSPDYDDWNLNGDLIFWYAPLNRSIEISSMGIRVDEKSLRSQLKECGNEERLELPFHKALLDGKLPFTIGGGIGQSRLCMFLLKKAHIGEVQASVWNSRIRKECQDANIPLL 336
>gi|28377779|ref|NP_784671.1| asparagine synthetase AsnA [Lactobacillus plantarum WCFS1] >gi|47115778|sp|Q88Y39|ASNA_LACPL Aspartate--ammonia ligase (Asparagine synthetase A) >gi|28270612|emb|CAD63518.1| aspartate--ammonia ligase [Lactobacillus plantarum WCFS1] (322 aa)
Score = 793, Expect = 1.2e-82, Identities = 157/309 (50%), Positives = 213/309 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPK 312
           LS+ ETQ+AI++I++ FQ      L L R++AP+ +E+  G+ND+LNG E PV+FT    G    EI  SLAKWKR+ L +Y   +HEG+Y +MNAIRKDE L + HS YVDQWDWE  I K ER +ETLK  V++I+++I+  + EV  K+   A + LP+EI F+++++L   YP+ TP+ERE  I  K   VF++ IG  L  G+ HD RAPDYDDWKLNGDI+ W E    A+E+SSMGIRVD  S+ +QL   +   R  L +H+ ++N + PY+IGGGIGQSRLC  LL K H+GEVQ++LW K
  S:    13 LSVKETQQAIRYIRETFQDEFGKQLNLSRLSAPMFVEKKTGLNDNLNGVEKPVSFTMQDMGDEQIEIVHSLAKWKRVALKRYGFDMHEGLYTNMNAIRKDEDLDNYHSAYVDQWDWEKVISKEERTVETLKAAVRQIFKVIKHMEHEVWYKFPQ-AVHHLPDEIHFLTTQELEDMYPDMTPRERENAICKKLGCVFLMQIGWKLDSGERHDGRAPDYDDWKLNGDILFWYEPLDQAIEISSMGIRVDAESMKKQLKDVDAEDRLSLPYHQMILNADVPYTIGGGIGQSRLCMLLLGKAHVGEVQAALWHK 321
>gi|160889292|ref|ZP_02070295.1| hypothetical protein BACUNI_01715 [Bacteroides uniformis ATCC 8492] >gi|156861299|gb|EDO54730.1| hypothetical protein BACUNI_01715 [Bacteroides uniformis ATCC 8492] (415 aa)
Score = 793, Expect = 1.4e-82, Identities = 168/323 (52%), Positives = 221/323 (68%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E  VTF   D      E+  SLAKWKR+ L +Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I   +RN+E LK +V +IY  +   +  V + Y    +  LP+++ FI +E+L Q YP+  PK RE  I  KY AVFIIGIG  LSDGK HD RAPDYDD+          LNGD+++W+   + ++ELSSMGIRVD+ +L+ QL +     R EL FHK+L+N   P SIGGGIGQSRLC F L K HIGE+Q+S+WP+D+ +E +++NI L+
  S:    84 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGVERAVTFPIKDLGDAKAEVVHSLAKWKRLTLAEYHIEPGYGIYTDMNAIRADEELGNLHSLYVDQWDWERVITAEDRNVEFLKEIVTRIYAAMVRTEYMVYEMYPQI-KPCLPQKLHFIHAEELRQLYPDLEPKCREHAICKKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTSKGLNDLPGLNGDLLLWDHILQRSIELSSMGIRVDKEALLRQLKEEGEEERLELYFHKRLMNDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKECKEHNIHLI 415
>gi|154495775|ref|ZP_02034471.1| hypothetical protein BACCAP_00054 [Bacteroides capillosus ATCC 29799] >gi|150274973|gb|EDN02021.1| hypothetical protein BACCAP_00054 [Bacteroides capillosus ATCC 29799] (337 aa)
Score = 790, Expect = 2.7e-82, Identities = 151/323 (46%), Positives = 209/323 (64%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKY-EWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +TQKAI  +K LF+  L  AL L RV+APL +E + G+NDDLNG E  V+F     G   ++  SLAKWKRM L +Y+  + EG+Y DMNAIR+DE   ++HS+YVDQWDWE  I   +R +E L+  V+ I + +   Q  +   + +  A  L+  E++F+++++L  ++P+ TPKERE      +   F++GIG  L  GKPHD RAPDYDDW LNGDI++WN   + A E+SSMGIRV   SL +QL  +  + R+ L FHK L+  + P +IGGGIGQSRLC  LL K HIGEVQ+S+W  + L   E   + LL
  S:    14 LNLYDTQKAIAILKRLFEDTLGGALHLRRVSAPLFVEASTGLNDDLNGVERAVSFDIPAAGHDAQVVHSLAKWKRMALYRYQFSVGEGLYTDMNAIRRDEQPDNLHSVYVDQWDWEKVIAPRDRTVEYLQTTVRTIVDCLCKTQSTLRSMFPQLTALPLIHSEVSFVTTQELEDKWPDLTPKEREDAWVKDHPTTFLMGIGGALKSGKPHDGRAPDYDDWSLNGDILLWNPVLERAFEISSMGIRVSPESLDKQLTIAGCDDRRNLPFHKMLLEGKLPLTIGGGIGQSRLCMLLLGKAHIGEVQASVWDSETLSACENAGVILL 337
>gi|187604915|ref|ZP_02991120.1| Aspartate--ammonia ligase [Exiguobacterium sp. AT1b] >gi|187483110|gb|EDU21109.1| Aspartate--ammonia ligase [Exiguobacterium sp. AT1b] (326 aa)
Score = 787, Expect = 6.1e-82, Identities = 156/322 (48%), Positives = 210/322 (65%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++ E Q+ I  +K LF+  ++  L L +V APL +E   G+ND LNG E  + F +   G   EI QSLAKWKR  LG+Y   + EG+Y  M AIR+DE L + HS++VDQWDWE  I + ER +E LK  V+ IY  +R  + EV K Y    E +LPE I FI+S++L   YP  TPKERE  I  +Y AVFI  IGD L+ G  HD RA DYDDW LNGDI+VW+   +SA ELSSMGIRVDEV+L  QL K++   ++   FH+ ++    P +IGGGIGQSR+  +LL  +HIGEVQ+S+WP+++++  ++  I LL
  S:     7 TMKERQQTIAAVKALFEEKVSRELGLIQVQAPLFVESASGVNDHLNGVERIIQFDTMYPGHELEIVQSLAKWKREALGRYGFGVGEGLYTQMRAIRRDEELDATHSLFVDQWDWERVIAREERTMEYLKATVESIYAALRETEAEVEKTYG--VEAILPEVIHFITSQELEDSYPTMTPKERETAICKEYGAVFISQIGDLLASGMKHDGRAADYDDWSLNGDILVWHPELESAFELSSMGIRVDEVALDAQLKKADAEEKRAYPFHQGVLEGTLPLTIGGGIGQSRVAMYLLRARHIGEVQTSVWPQEVIQSCKEAGISLL 326
>gi|160885227|ref|ZP_02066230.1| hypothetical protein BACOVA_03225 [Bacteroides ovatus ATCC 8483] >gi|156109577|gb|EDO11322.1| hypothetical protein BACOVA_03225 [Bacteroides ovatus ATCC 8483] (345 aa)
Score = 783, Expect = 1.8e-81, Identities = 168/323 (52%), Positives = 218/323 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +T+  IK IK+ FQ+NL+  L+L RVTAPL + +  GINDDLNG E PV+F   D      E+  SLAKWKR+ L  Y I    GIY DMNAIR DE L ++HS+YVDQWDWE  I   +RN+  LK +V +IY  +   +  V + Y    +  LP+++ FI SE+L Q YP+  PK RE  I  KY AVFIIGIG  LSDGK HD RAPDYDD+          LNGD+++W+   + ++ELSSMGIRVD+ +L  QL +     R EL FHK+L+N   P SIGGGIGQSRLC F L K HIGE+Q+S+WP+D+ +E E+ +I L+
  S:    14 LDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYHIEPGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVITNEDRNVNFLKEIVNRIYAAMIRTEYMVYEMYPQI-KPCLPQKLHFIHSEELRQLYPDLEPKCREHAICQKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTTKGLNDLPGLNGDLLLWDNVLQRSIELSSMGIRVDKEALQRQLKEEKEEKRLELYFHKRLMNDTLPLSIGGGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKECEELDIHLI 345
>gi|67484544|ref|XP_657492.1| aspartate--ammonia ligase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56474745|gb|EAL52102.1| aspartate--ammonia ligase, putative [Entamoeba histolytica HM-1:IMSS] (345 aa)
Score = 782, Expect = 2.5e-81, Identities = 170/323 (52%), Positives = 216/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGK-PHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L+  +T+ AI+ IK  F+ NL + L L R+TAPL +E   G+NDDLNG E PV F   G N    E+  SLAKWKR+ L + +IP+ EGI  DMNAIR  E L +IHSIYVDQWDWE  I K +R L+ LK VVKKIY  I   ++ +  +Y      L P+EITF+ +ED+ + YPN +PKERE  +A KY AV +IGIG  L   K  HD R+PDYDDW          LN DIIVWN+  + +LELSSMGIRVD  +L  QL+  N   R++  FH+ L+  E P SIGGGIGQSRLC F L K HIGE+Q+S+W  +  E+  ++NI LL
  S:    13 LNSFQTEIAIRKIKQEFEKNLTYDLDLLRITAPLFVESGYGLNDDLNGVEVPVHFPVKGMNNSVVEVVHSLAKWKRLQLHELKIPIGEGIVTDMNAIRPMEDLDNIHSIYVDQWDWEKSISKEDRTLDYLKNVVKKIYHTIYKTEEYICNEYSQLKRRL-PKEITFLHTEDMEKEYPNLSPKEREHTVAKKYGAVCVIGIGYPLPLSKVTHDGRSPDYDDWSSETKEGYHGLNCDIIVWNDVLQQSLELSSMGIRVDPTALKRQLEMRNATDREKFMFHQMLLKGELPLSIGGGIGQSRLCMFYLQKAHIGEIQASVWNHETKEQLAQHNIFLL 345
>gi|167389223|ref|XP_001738869.1| aspartate--ammonia ligase, putative [Entamoeba dispar SAW760] >gi|165897698|gb|EDR24780.1| aspartate--ammonia ligase, putative [Entamoeba dispar SAW760] (345 aa)
Score = 782, Expect = 2.6e-81, Identities = 170/323 (52%), Positives = 215/323 (66%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGK-PHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L+  +T+ AI+ IK  F+ NL + L L R+TAPL +E   G+NDDLNG E PV F   G N    E+  SLAKWKR+ L + +IP+ EGI  DMNAIR  E L +IHSIYVDQWDWE  I K  R LE LK VVKKIY  I   ++ +  +Y      L P++ITF+ +ED+ + YPN +PKERE  +A KY AV +IGIG  L   K  HD R+PDYDDW          LN DIIVWN+  + +LELSSMGIRVD  +L  QL+  N   R++  FH+ L+  E P SIGGGIGQSRLC F L K HIGE+Q+S+W  +  E+  ++NI LL
  S:    13 LNSFQTEIAIRKIKQEFEKNLTYDLDLLRITAPLFVESGYGLNDDLNGIEVPVHFPVKGMNNSVVEVVHSLAKWKRLQLHELKIPVGEGIVTDMNAIRPMEDLDNIHSIYVDQWDWEKTISKENRTLEYLKSVVKKIYHTIYKTEEYICNEYSQLKRRL-PKDITFLHTEDMEKEYPNLSPKEREHTVAKKYGAVCVIGIGYPLPISKVTHDGRSPDYDDWSSLTKEGYHGLNCDIIVWNDVLQQSLELSSMGIRVDSTALKRQLEMRNATDREKFMFHQMLLKGELPLSIGGGIGQSRLCMFYLQKAHIGEIQASVWNHETKEQLAQHNIFLL 345
>gi|160915885|ref|ZP_02078093.1| hypothetical protein EUBDOL_01908 [Eubacterium dolichum DSM 3991] >gi|158432361|gb|EDP10650.1| hypothetical protein EUBDOL_01908 [Eubacterium dolichum DSM 3991] (338 aa)
Score = 778, Expect = 7.7e-81, Identities = 162/323 (50%), Positives = 224/323 (69%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L I+ T+ AIK++KDLF+  LAH L L R++APL + ++ G+NDDLNG E PV+F   +      EI  SLAKWKRM L +Y I   +GIY DMNAIR+DE L ++HS YVDQWDWE  I++ +R L+ LK+ V  I + ++  +KEVN  +E   E  + E++ FI++++L  +YP+ +PK+RE  +  +YK VF++ IGD L  G+ HD RAPDYDDWKLNGD++++      A+E+SSMGIRV+  SL EQL K+    R +L FH+ L+  E P +IGGGIGQSR+C  LL+K HIGEVQ S W   ++EE EK++I LL
  S:    16 LDIISTEVAIKYVKDLFERRLAHHLNLMRISAPLYVRKSSGLNDDLNGVERPVSFDIKEIENDDMEIVHSLAKWKRMALSRYHIGYGKGIYTDMNAIRRDEVLDNLHSTYVDQWDWEKIIEEKDRTLDFLKLTVTHIMKALKETEKEVNIVFENL-EPFIHEDVYFITTQELENKYPDLSPKQREYEVTKQYKTVFLMQIGDVLESGEKHDGRAPDYDDWKLNGDLLLYYPLLDCAVEISSMGIRVNAQSLKEQLVKAKCEERLQLPFHQLLLRDELPLTIGGGIGQSRICLILLNKAHIGEVQVSQWSDAMIEECEKHHITLL 338
>gi|160943794|ref|ZP_02091025.1| hypothetical protein FAEPRAM212_01292 [Faecalibacterium prausnitzii M21/2] >gi|158444968|gb|EDP21971.1| hypothetical protein FAEPRAM212_01292 [Faecalibacterium prausnitzii M21/2] (337 aa)
Score = 778, Expect = 7.9e-81, Identities = 155/323 (47%), Positives = 205/323 (63%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLP---EEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +TQ+AI  +K LF   L   L L+RV+APL LE + G+NDDLNG E  VTF    +G   ++ QSLAKWKR  L  Y+  + +G+Y DMNAIR+DE L ++HS+YVDQWDWE  I   +RN   LK VV+ I   +  C  E+N    +     LP     +TF+++++L  +YP+ TPKERE     +    F++ IG  L  GKPHD RAPDYDDW LNGD++ WN+  + + ELSSMGIRV   S+  QL  +  + R+ L FHK ++  E PY+IGGGIGQSRLC  LL   HIGEVQ+S+W K   E   K  I LL
  S:    14 LNLYDTQRAIGTVKRLFADTLCATLNLYRVSAPLFLEASTGLNDDLNGVERKVTFDIKDSGTEAQVVQSLAKWKRQALKDYDFRVGKGLYCDMNAIRRDEELDNLHSVYVDQWDWEKIITVEDRNETYLKNVVRCIVSAV--CATEMNLHAMFPQLQDLPLHTPNVTFVTTQELEDKYPDLTPKERENAFVKENGTTFLMKIGAPLRSGKPHDGRAPDYDDWDLNGDLLFWNDPLQCSYELSSMGIRVSPESMDRQLTMAGCDDRRTLPFHKAVLAGELPYTIGGGIGQSRLCMLLLGSVHIGEVQASVWDKATREACAKAGIPLL 337
>gi|146320303|ref|YP_001200014.1| asparagine synthetase AsnA [Streptococcus suis 98HAH33] >gi|145691109|gb|ABP91614.1| Asparagine synthetase A [Streptococcus suis 98HAH33] (330 aa)
Score = 765, Expect = 2.0e-79, Identities = 160/315 (50%), Positives = 213/315 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++     G+ D+L+G EN VT         + E+  SLAKWKR  L ++     EG++  M A+R DE SL  IHS+YVDQWDWE  I    RNL  LK  V++IY+ IRL +  V  +Y+   E++LP++ITFI +EDL++ +P+ TPKERE ++A +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   SA ELSSMGIRVDE +L  Q+  + +  R E D+H+ L+N  FP SIGGGIGQSRL  FLL K+HIGEVQSS+WP+++ +  E
  S:     4 SFIHQQEEISFVKNTFTQYLKDKLEIVEVQGPILSRVGDGMQDNLSGVENAVTVNVKLIPDATYEVVHSLAKWKRHTLARFGFHEGEGLFVHMKALRPDEDSLDPIHSVYVDQWDWEKVIPDGRRNLAYLKETVEQIYKAIRLTELAVEARYD--IESVLPKKITFIHTEDLVKNFPDLTPKERENVVAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTSPSEAGYKGLNGDILVWNEALGSAFELSSMGIRVDEEALKRQVAITGDEDRLEFDWHRALLNGLFPLSIGGGIGQSRLAMFLLRKKHIGEVQSSVWPQEVRDNFE 327
>gi|162448071|ref|YP_001621203.1| aspartate--ammonia ligase [Acholeplasma laidlawii PG-8A] >gi|161986178|gb|ABX81827.1| aspartate--ammonia ligase [Acholeplasma laidlawii PG-8A] (333 aa)
Score = 764, Expect = 3.2e-79, Identities = 165/323 (51%), Positives = 211/323 (65%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ +TQ AI FIK++FQ NL   L L RVTAPL +    G+ND LNG ENPV F         EI  SLAKWKRM L + +  +  G+Y DMNA+RK+E+L +IHSIYVDQWDWE  I++T+R L+ LK  VK I E I      V  KY        P+E+ FI S+ L   YPN T KERE  I    K VFI+ IG NL+ G PHDLRAPDYDDW LNGD++ ++ET   A+E+SSMGIRVDE SL +QL+  +     +  +H+ ++N+  P +IGGGIGQSRLC  LL K HIGEVQ+S+W  + + EA K+ + LL
  S:    14 LNLYDTQTAIGFIKNVFQHNLGLELNLKRVTAPLFVLSETGLNDGLNG-ENPVQFVIPSMNKQAEIVHSLAKWKRMALYQNDFYVGNGLYTDMNAVRKEETLDNIHSIYVDQWDWEKVIERTDRTLDYLKETVKSIVEAIANTSNTVMLKYPEITYQA-PDEVFFIDSQALENLYPNLTSKEREYQIVKDKKVVFIMRIGHNLASGMPHDLRAPDYDDWDLNGDLLYYHETLDMAIEISSMGIRVDETSLRKQLEMKHRLEDLKYPYHQMIMNETLPLTIGGGIGQSRLCLILLEKAHIGEVQASVWDDETI-EACKDKVVLL 333
>gi|15901793|ref|NP_346397.1| asparagine synthetase AsnA [Streptococcus pneumoniae TIGR4] >gi|111658858|ref|ZP_01409479.1| hypothetical protein SpneT_02000029 [Streptococcus pneumoniae TIGR4] >gi|148985550|ref|ZP_01818739.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP3-BS71] >gi|148993169|ref|ZP_01822735.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP9-BS68] >gi|148998501|ref|ZP_01825942.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP11-BS70] >gi|149003629|ref|ZP_01828494.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP14-BS69] >gi|149007445|ref|ZP_01831088.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP18-BS74] >gi|149012440|ref|ZP_01833471.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP19-BS75] >gi|149021921|ref|ZP_01835908.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP23-BS72] >gi|168484269|ref|ZP_02709221.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC1873-00] >gi|168487108|ref|ZP_02711616.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC1087-00] >gi|168489975|ref|ZP_02714174.1| aspartate--ammonia ligase [Streptococcus pneumoniae SP195] >gi|168492055|ref|ZP_02716198.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC0288-04] >gi|168494789|ref|ZP_02718932.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC3059-06] >gi|168576629|ref|ZP_02722495.1| aspartate--ammonia ligase [Streptococcus pneumoniae MLV-016] >gi|169834463|ref|YP_001695325.1| aspartate--ammonia ligase [Streptococcus pneumoniae Hungary19A-6] >gi|182684906|ref|YP_001836652.1| asparagine synthetase AsnA [Streptococcus pneumoniae CGSP14] >gi|194396704|ref|YP_002038553.1| aspartate--ammonia ligase [Streptococcus pneumoniae G54] >gi|21263435|sp|Q97NQ0|ASNA_STRPN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|14973477|gb|AAK76037.1| aspartate--ammonia ligase [Streptococcus pneumoniae TIGR4] >gi|147755694|gb|EDK62740.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP11-BS70] >gi|147758361|gb|EDK65361.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP14-BS69] >gi|147761017|gb|EDK67986.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP18-BS74] >gi|147763496|gb|EDK70432.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP19-BS75] >gi|147922270|gb|EDK73391.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP3-BS71] >gi|147928143|gb|EDK79161.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP9-BS68] >gi|147929959|gb|EDK80947.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP23-BS72] >gi|168996965|gb|ACA37577.1| aspartate--ammonia ligase [Streptococcus pneumoniae Hungary19A-6] >gi|172042516|gb|EDT50562.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC1873-00] >gi|182630240|gb|ACB91188.1| asparagine synthetase AsnA [Streptococcus pneumoniae CGSP14] >gi|183569978|gb|EDT90506.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC1087-00] >gi|183571616|gb|EDT92144.1| aspartate--ammonia ligase [Streptococcus pneumoniae SP195] >gi|183573716|gb|EDT94244.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC0288-04] >gi|183575315|gb|EDT95843.1| aspartate--ammonia ligase [Streptococcus pneumoniae CDC3059-06] >gi|183577644|gb|EDT98172.1| aspartate--ammonia ligase [Streptococcus pneumoniae MLV-016] >gi|194356371|gb|ACF54819.1| aspartate--ammonia ligase [Streptococcus pneumoniae G54] (330 aa)
Score = 756, Expect = 2.3e-78, Identities = 156/315 (49%), Positives = 216/315 (68%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G ENPV+         + E+  SLAKWKR  L ++     EG++  M A+R DE SL + HS+YVDQWDWE  I   +RN+  LK  V+KIY+ IRL +  V  +Y+   E++LP++ITFI +E+L++RYP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE+   A ELSSMGIRVDE +L  Q++ + +  R EL++HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++ +  E
  S:     4 SFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGMQDNLSGVENPVSVKVLQIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDEDSLDATHSVYVDQWDWEKVIPNGKRNIVYLKETVEKIYKAIRLTELAVEARYD--IESILPKQITFIHTEELVERYPDLTPKERENAICKEFGAVFLIGIGGELPDGKPHDGRAPDYDDWTSESENGYKGLNGDILVWNESLGGAFELSSMGIRVDEETLRRQVEITGDEDRLELEWHKSLLNGLFPLTIGGGIGQSRMAMFLLRKRHIGEVQTSVWPQEVRDTYE 327
>gi|148989970|ref|ZP_01821245.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP6-BS73] >gi|147924630|gb|EDK75716.1| asparagine synthetase AsnA [Streptococcus pneumoniae SP6-BS73] (330 aa)
Score = 756, Expect = 2.4e-78, Identities = 156/315 (49%), Positives = 216/315 (68%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G ENPV+         + E+  SLAKWKR  L ++     EG++  M A+R DE SL + HS+YVDQWDWE  I   +RN+  LK  V+KIY+ IRL +  V  +Y+   E++LP++ITFI +E+L++RYP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE+   A ELSSMGIRVDE +L  Q++ + +  R EL++HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++ +  E
  S:     4 SFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGMQDNLSGVENPVSVKVLQIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDEDSLDATHSVYVDQWDWEKVIPDGKRNIVYLKETVEKIYKAIRLTELAVEARYD--IESILPKQITFIHTEELVERYPDLTPKERENAICKEFGAVFLIGIGGELPDGKPHDGRAPDYDDWTSESENGYKGLNGDILVWNESLGGAFELSSMGIRVDEETLRRQVEITGDEDRLELEWHKSLLNGLFPLTIGGGIGQSRMAMFLLRKRHIGEVQTSVWPQEVRDTYE 327
>gi|148377332|ref|YP_001256208.1| asparagine synthetase AsnA [Mycoplasma agalactiae PG2] >gi|148291378|emb|CAL58762.1| Aspartate-ammonia ligase (AsnA) [Mycoplasma agalactiae PG2] (326 aa)
Score = 753, Expect = 5.0e-78, Identities = 159/323 (49%), Positives = 213/323 (65%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ ETQ+AI+ +K  F   L   L L RV+APL +  N  IND LNG + PV F+ +    + EI  SLAKWKR  L +Y+    EG++ DMNAIRKD+ +   HS+YVDQWDWEL I K +RN+  LK +V+ IY+ IR  + +VN KY   ++ L P  +TFISSE L + YP+ +P+ERE ++A KY AVFI  IG  L DG PH  RA DYDDW LNGD++ ++    +ALE+SSMGIRVD  SL +Q    N       ++H+ ++ ++ PY+IGGGIGQSRL  FLL K+HIGEVQ+S+WP +  E  EK  + LL
  S:     6 LTLKETQQAIQDLKFAFTKKLNQELNLTRVSAPLFVTSNSKINDGLNG-DIPVIFSPNKWSENIEIVHSLAKWKRSALSRYKFLPGEGLWTDMNAIRKDDEVDYKHSLYVDQWDWELIINKEDRNINFLKKIVETIYKSIRYVENKVNFKYPALSQKL-PVNLTFISSEQLYREYPSVSPEERENIVARKYGAVFIYKIGHTLPDGLPHSKRAFDYDDWNLNGDLVFYDAVNDAALEISSMGIRVDADSLTKQAKICNKTDNDMGEYHRAILTQKLPYTIGGGIGQSRLSMFLLEKKHIGEVQASVWPDEHKESFEKQGVNLL 326
>gi|55822354|ref|YP_140795.1| asparagine synthetase AsnA [Streptococcus thermophilus CNRZ1066] >gi|116627289|ref|YP_819908.1| asparagine synthetase AsnA [Streptococcus thermophilus LMD-9] >gi|81676612|sp|Q5M189|ASNA_STRT1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|122268108|sp|Q03M60|ASNA_STRTD Aspartate--ammonia ligase (Asparagine synthetase A) >gi|55738339|gb|AAV61980.1| asparagine synthetase A [Streptococcus thermophilus CNRZ1066] >gi|116100566|gb|ABJ65712.1| aspartate-ammonia ligase [Streptococcus thermophilus LMD-9] (330 aa)
Score = 753, Expect = 5.5e-78, Identities = 158/315 (50%), Positives = 212/315 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S ++ QK I F+K+ F   L   L +  V  P++ +   G+ D+LNG ENPVT         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL + HS+YVDQWDWE  I    RN+  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI SE+L+++YP+ TPKERE  I  +Y AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE    A ELSSMGIRVDE +L  Q++ + +  R +LD+H+ L++ +FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP  + E  E
  S:     4 SFIDQQKEISFVKNTFTQYLIDKLDVVEVQGPILSKVGDGMQDNLNGIENPVTVNVLQIPDATYEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDATHSVYVDQWDWEKVIPDGHRNIAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHSEELVEKYPDLTPKERENAITKEYGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTESEKGYHGLNGDILVWNEQLGHAFELSSMGIRVDEDALKRQVEITGDQDRLKLDWHQALLHGQFPLTIGGGIGQSRMAMFLLRKKHIGEVQTSVWPDAVRETYE 327
>gi|195977712|ref|YP_002122956.1| aspartate--ammonia ligase AsnA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974417|gb|ACG61943.1| aspartate--ammonia ligase AsnA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (330 aa)
Score = 753, Expect = 6.2e-78, Identities = 155/310 (50%), Positives = 209/310 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           S +  Q+ I F+K+ F   L   L +  V  P++     G+ D+L+G ENPV+    +    + E+  SLAKWKR  L ++     EG+  +M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI +E+L+ RYP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+D + +  R + D+HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++
  S:     4 SFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGMQDNLSGVENPVSVHVLNIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDQTHSVYVDQWDWEKVIPDGQRNLAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHTEELVARYPDLTPKERENAITKEFGAVFLIGIGGVLPDGKPHDGRAPDYDDWTSESENGYHGLNGDILVWNEQLGTAFELSSMGIRVDEEALKRQVDITGDQERLQFDWHKSLLNGLFPLTIGGGIGQSRMAMFLLRKKHIGEVQTSVWPQEV 322
>gi|55820469|ref|YP_138911.1| asparagine synthetase AsnA [Streptococcus thermophilus LMG 18311] >gi|81676761|sp|Q5M5S6|ASNA_STRT2 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|55736454|gb|AAV60096.1| asparagine synthetase A [Streptococcus thermophilus LMG 18311] (330 aa)
Score = 753, Expect = 6.4e-78, Identities = 158/315 (50%), Positives = 211/315 (66%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S ++ QK I F+K+ F   L   L +  V  P++ +   G+ D+LNG ENPVT         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL + HS+YVDQWDWE  I    RN+  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI SE+L+++YP+ TPKERE  I  +Y AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE    A ELSSMGIRVDE +L  Q++ + +  R +LD+H+ L+  +FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP  + E  E
  S:     4 SFIDQQKEISFVKNTFTQYLIDKLDVVEVQGPILSKVGDGMQDNLNGIENPVTVNVLQIPDATYEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDATHSVYVDQWDWEKVIPDGHRNIAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHSEELVEKYPDLTPKERENAITKEYGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTESEKGYHGLNGDILVWNEQLGHAFELSSMGIRVDEDALKRQVEITGDQDRLKLDWHQALLQGQFPLTIGGGIGQSRMAMFLLRKKHIGEVQTSVWPDAVRETYE 327
>gi|133723115|gb|ABO37804.1| asparagine synthetase [Lactococcus garvieae] (311 aa)
Score = 752, Expect = 8.3e-78, Identities = 149/299 (49%), Positives = 201/299 (67%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHI 302
           L + +TQ AI FIK  F+  L  +LKL RV+APL ++   G+ND+L+GSE PV F       +GEI  SLAKWKR  L +Y+  +  G+YADMNAIR+DE L ++HSIYVDQWDWE  I K +R+L+ LK  V+ +   I      ++ KY    ++++   I FI+S++L+  YPN T KERE     ++   FI+ IGD LS G+PHD RAPDYDDW LNGD++ W+E    A+ELSSMGIRVD+ +L+ QL+K+N N R    FH++++N E P +IGGGIGQSR+C  LL K HI
  S:    14 LDVYDTQTAIGFIKRCFEEALTGSLKLKRVSAPLFVDDRSGLNDNLSGSERPVKFDVPVLNYNGEIVHSLAKWKRAALKQYDFHVGNGLYADMNAIRRDEELDNLHSIYVDQWDWERVISKEQRSLDYLKETVQNLVNAIAETSSRLHTKYPK-VKSVIDTNIAFITSQELVDLYPNLTAKERENAYVKEHPTTFILQIGDVLSHGEPHDQRAPDYDDWSLNGDLLFWHEPLGCAIELSSMGIRVDDKALLTQLEKANANDRLAYPFHQQILNNELPLTIGGGIGQSRMCMLLLSKVHI 311
>gi|15903827|ref|NP_359377.1| asparagine synthetase AsnA [Streptococcus pneumoniae R6] >gi|15459469|gb|AAL00588.1| Aspartate--ammonia ligase (asparagine synthetase A) [Streptococcus pneumoniae R6] (332 aa)
Score = 748, Expect = 2.2e-77, Identities = 155/315 (49%), Positives = 215/315 (68%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G ENPV+         + E+  SLAKWKR  L ++     EG++  M A+R DE SL + HS+YVDQWDWE  I   +RN+  LK  V+KIY+ IRL +  V  +Y+   E++LP++ITFI +E+L++RYP+ T KERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE+   A ELSSMGIRVDE +L  Q++ + +  R EL++HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++ +  E
  S:     6 SFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGMQDNLSGVENPVSVKVLQIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDEDSLDATHSVYVDQWDWEKVIPNGKRNIVYLKETVEKIYKAIRLTELAVEARYD--IESILPKQITFIHTEELVERYPDLTSKERENAICKEFGAVFLIGIGGELPDGKPHDGRAPDYDDWTSESENGYKGLNGDILVWNESLGGAFELSSMGIRVDEETLRRQVEITGDEDRLELEWHKSLLNGLFPLTIGGGIGQSRMAMFLLRKRHIGEVQTSVWPQEVRDTYE 329
>gi|116515784|ref|YP_817190.1| asparagine synthetase AsnA [Streptococcus pneumoniae D39] >gi|122277964|sp|Q04IJ8|ASNA_STRP2 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|47115800|sp|Q8CWN8|ASNA_STRR6 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|116076360|gb|ABJ54080.1| aspartate--ammonia ligase [Streptococcus pneumoniae D39] (330 aa)
Score = 748, Expect = 2.2e-77, Identities = 155/315 (49%), Positives = 215/315 (68%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G ENPV+         + E+  SLAKWKR  L ++     EG++  M A+R DE SL + HS+YVDQWDWE  I   +RN+  LK  V+KIY+ IRL +  V  +Y+   E++LP++ITFI +E+L++RYP+ T KERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWNE+   A ELSSMGIRVDE +L  Q++ + +  R EL++HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++ +  E
  S:     4 SFIHQQEEISFVKNTFTQYLKDKLEVVEVQGPILSKVGDGMQDNLSGVENPVSVKVLQIPDATYEVVHSLAKWKRHTLARFGFGEGEGLFVHMKALRPDEDSLDATHSVYVDQWDWEKVIPNGKRNIVYLKETVEKIYKAIRLTELAVEARYD--IESILPKQITFIHTEELVERYPDLTSKERENAICKEFGAVFLIGIGGELPDGKPHDGRAPDYDDWTSESENGYKGLNGDILVWNESLGGAFELSSMGIRVDEETLRRQVEITGDEDRLELEWHKSLLNGLFPLTIGGGIGQSRMAMFLLRKRHIGEVQTSVWPQEVRDTYE 327
>gi|153093197|gb|EDN74208.1| aspartate--ammonia ligase [Mannheimia haemolytica PHL213] (330 aa)
Score = 747, Expect = 2.4e-77, Identities = 159/315 (50%), Positives = 205/315 (65%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L +  V  P++ E   G+ D+L+G E  V          + E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN + LK  V +IY+ IRL +  V  +++    ++LP++ITF+ SEDL+QRYPN T KERE  I  +  AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E+D+HK L+    P SIGGGIGQSRL  FLL K+HIGEVQSS+WPK + EE E
  S:     4 SFILQQQEISFVKNTFTQYLIDKLGIIEVQGPILSEVGNGMQDNLSGIEKAVKVNVKCIPSATYEVVHSLAKWKRHTLARFGFKEGEGLFVHMKALRPDEDSLDRTHSVYVDQWDWEKVIPEGRRNFDFLKETVNEIYKAIRLTELAVEARFD--IPSVLPKQITFVHSEDLVQRYPNMTSKERENAICKECGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESEQGYKGLNGDILVWNEELGTAFELSSMGIRVDETALRLQVALTGDEDRLEMDWHKDLLAGRLPLSIGGGIGQSRLVMFLLRKKHIGEVQSSVWPKAVFEEFE 327
>gi|15675438|ref|NP_269612.1| asparagine synthetase AsnA [Streptococcus pyogenes M1 GAS] >gi|71911082|ref|YP_282632.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS5005] >gi|21263436|sp|Q99YU0|ASNA_STRP1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|13622628|gb|AAK34333.1| putative asparagine synthetase A [Streptococcus pyogenes M1 GAS] >gi|71853864|gb|AAZ51887.1| aspartate--ammonia ligase [Streptococcus pyogenes MGAS5005] (330 aa)
Score = 745, Expect = 4.2e-77, Identities = 154/310 (49%), Positives = 208/310 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           S +  Q+ I F+K+ F   L   L +  V  P++     G+ D+L+G+ENPV+         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI +E+L+ +YP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWN+   SA ELSSMGIRVDE +L  Q++ + +  R   D+HK L+N  FP +IGGGIGQSR+  FLL KQHIGEVQ+S+WP+++
  S:     4 SFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGMQDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHTEELVAKYPDLTPKERENAITKEFGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTETENGYHGLNGDILVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGDQDRLGFDWHKSLLNGLFPLTIGGGIGQSRMVMFLLRKQHIGEVQTSVWPQEV 322
>gi|94990793|ref|YP_598893.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS10270] >gi|166219932|sp|Q1JFZ5|ASNA_STRPD Aspartate--ammonia ligase (Asparagine synthetase A) >gi|94544301|gb|ABF34349.1| Aspartate--ammonia ligase [Streptococcus pyogenes MGAS10270] (330 aa)
Score = 745, Expect = 4.7e-77, Identities = 154/310 (49%), Positives = 207/310 (66%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           S +  Q+ I F+K+ F   L   L +  V  P++     G+ D+L+G+ENPV+         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI +E+L+ +YP+ TPKERE  I   + AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWN+   SA ELSSMGIRVDE +L  Q++ + +  R   D+HK L+N  FP +IGGGIGQSR+  FLL KQHIGEVQ+S+WP+++
  S:     4 SFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGMQDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHTEELVAKYPDLTPKERENAITKVFGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTETENGYHGLNGDILVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGDQDRLAFDWHKSLLNGLFPLTIGGGIGQSRMVMFLLRKQHIGEVQTSVWPQEV 322
>gi|25010567|ref|NP_734962.1| asparagine synthetase AsnA [Streptococcus agalactiae NEM316] >gi|47115812|sp|Q8E6R5|ASNA_STRA3 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|23094920|emb|CAD46141.1| Unknown [Streptococcus agalactiae NEM316] (330 aa)
Score = 744, Expect = 5.8e-77, Identities = 156/315 (49%), Positives = 213/315 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G E+PV+    +      E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL+ LK  V+KIY+ IRL +  V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:     4 SFIHQQQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGMQDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEGRLEFEWHKTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFE 327
>gi|22536630|ref|NP_687481.1| asparagine synthetase AsnA [Streptococcus agalactiae 2603V/R] >gi|76787967|ref|YP_329184.1| asparagine synthetase AsnA [Streptococcus agalactiae A909] >gi|123602298|sp|Q3K2R9|ASNA_STRA1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|47115810|sp|Q8E1B0|ASNA_STRA5 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|22533468|gb|AAM99353.1|AE014212_12 aspartate--ammonia ligase [Streptococcus agalactiae 2603V/R] >gi|76563024|gb|ABA45608.1| aspartate--ammonia ligase [Streptococcus agalactiae A909] (330 aa)
Score = 743, Expect = 7.3e-77, Identities = 156/315 (49%), Positives = 213/315 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G E+PV+    +      E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL+ LK  V+KIY+ IRL +  V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:     4 SFIHQQQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGMQDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEDRLEFEWHKTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFE 327
>gi|152978184|ref|YP_001343813.1| asparagine synthetase AsnA [Actinobacillus succinogenes 130Z] >gi|171704239|sp|A6VLN1|ASNA_ACTSZ Aspartate--ammonia ligase (Asparagine synthetase A) >gi|150839907|gb|ABR73878.1| Aspartate--ammonia ligase [Actinobacillus succinogenes 130Z] (330 aa)
Score = 743, Expect = 8.0e-77, Identities = 161/315 (51%), Positives = 198/315 (62%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F K+ F   LA  L L  V  P++ +   GI D+L+G E PV          + E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL  LK  V+ IY  I   Q+ V +K+   A   LP+EITFI SEDL + YP+ T KERE  I  KY AVF+IGIG +L DGKPHD+RAPDYDDW          LNGDI+VWN     A ELSSMGIRVDE +L  QL  +++  R    +H+ LIN   P SIGGGIGQSRL   LL K HIGEVQSS+WPK ++E+ E
  S:     4 SFILQQQEISFAKNTFTTKLAEHLGLVEVQGPILSQVGNGIQDNLSGKEKPVQVNVKMIEDATFEVVHSLAKWKRHTLARFGFAEGEGLFVHMKALRPDEDSLDQTHSVYVDQWDWEKVIPAGRRNLNYLKETVRSIYAAIVETQEAVEQKFGLKA--FLPKEITFIHSEDLARDYPHMTDKERENEICKKYGAVFLIGIGGDLPDGKPHDMRAPDYDDWTTSSEGEYKGLNGDILVWNPVLNRAFELSSMGIRVDETALRRQLALTHDEERLNFAWHQDLINGRMPLSIGGGIGQSRLAMLLLQKHHIGEVQSSVWPKTVMEQFE 327
>gi|50914636|ref|YP_060608.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS10394] >gi|73914169|sp|Q5XAY8|ASNA_STRP6 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|50903710|gb|AAT87425.1| Aspartate--ammonia ligase [Streptococcus pyogenes MGAS10394] (330 aa)
Score = 742, Expect = 9.7e-77, Identities = 152/310 (49%), Positives = 208/310 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           S +  Q+ I F+K+ F   L   L +  V  P++     G+ D+L+G+ENPV+         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI +E+L+ +YP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGD++VWN+   SA ELSSMGIRVDE +L  Q++ + +  R   D+HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++
  S:     4 SFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGMQDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHTEELVAKYPDLTPKERENAITKEFGAVFLIGIGGGLPDGKPHDGRAPDYDDWTTETENGYHGLNGDLLVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGDQDRLAFDWHKSLLNGLFPLTIGGGIGQSRMVMFLLRKKHIGEVQTSVWPQEV 322
>gi|46143487|ref|ZP_00135167.2| COG2502: Asparagine synthetase A [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209299|ref|YP_001054524.1| asparagine synthetase AsnA [Actinobacillus pleuropneumoniae L20] >gi|165977277|ref|YP_001652870.1| asparagine synthetase AsnA [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190151193|ref|YP_001969718.1| aspartate-ammonia ligase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166219921|sp|A3N3D3|ASNA_ACTP2 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|126098091|gb|ABN74919.1| aspartate-ammonia ligase [Actinobacillus pleuropneumoniae L20] >gi|165877378|gb|ABY70426.1| asparagine synthetase A [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916324|gb|ACE62576.1| aspartate-ammonia ligase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (330 aa)
Score = 742, Expect = 1.0e-76, Identities = 156/308 (50%), Positives = 205/308 (66%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F   L   L +  V  P++ +   G+ D+L+G E  V        G + E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN + LK  V +IY+ IRL +  V  +++    ++LP++ITF+ SE+L+QRYPN T KERE  I  ++ AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q++ + +  R E+D+HK L+    P SIGGGIGQSRL  FLL K HIGEVQSS+WPK +LE+
  S:     9 QQEISFVKNTFTQYLIDKLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPGATFEVVHSLAKWKRHTLARFGFKEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFDFLKETVNEIYKAIRLTELAVEARFD--IPSILPKQITFVHSEELVQRYPNMTGKERENAICKEHGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNEQLGTAFELSSMGIRVDEKALRLQVELTGDQDRLEMDWHKDLLAGRLPLSIGGGIGQSRLVMFLLRKAHIGEVQSSVWPKAMLEK 325
>gi|19746488|ref|NP_607624.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS8232] >gi|21910726|ref|NP_664994.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS315] >gi|28895584|ref|NP_801934.1| asparagine synthetase AsnA [Streptococcus pyogenes SSI-1] >gi|71903869|ref|YP_280672.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS6180] >gi|94988893|ref|YP_596994.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS9429] >gi|94992785|ref|YP_600884.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS2096] >gi|94994772|ref|YP_602870.1| asparagine synthetase AsnA [Streptococcus pyogenes MGAS10750] >gi|123639584|sp|Q48SJ3|ASNA_STRPM Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166219930|sp|Q1JAR8|ASNA_STRPB Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166219931|sp|Q1JKW9|ASNA_STRPC Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166219933|sp|Q1J5R0|ASNA_STRPF Aspartate--ammonia ligase (Asparagine synthetase A) >gi|54036769|sp|P63626|ASNA_STRP8 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|54040838|sp|P63625|ASNA_STRP3 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|19748694|gb|AAL98123.1| putative asparagine synthetase A [Streptococcus pyogenes MGAS8232] >gi|21904929|gb|AAM79797.1| putative asparagine synthetase A [Streptococcus pyogenes MGAS315] >gi|28810833|dbj|BAC63767.1| putative asparagine synthetase A [Streptococcus pyogenes SSI-1] >gi|71802964|gb|AAX72317.1| aspartate--ammonia ligase [Streptococcus pyogenes MGAS6180] >gi|94542401|gb|ABF32450.1| aspartate--ammonia ligase [Streptococcus pyogenes MGAS9429] >gi|94546293|gb|ABF36340.1| Aspartate--ammonia ligase [Streptococcus pyogenes MGAS2096] >gi|94548280|gb|ABF38326.1| Aspartate--ammonia ligase [Streptococcus pyogenes MGAS10750] (330 aa)
Score = 742, Expect = 1.0e-76, Identities = 153/310 (49%), Positives = 208/310 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           S +  Q+ I F+K+ F   L   L +  V  P++     G+ D+L+G+ENPV+         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI +E+L+ +YP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWN+   SA ELSSMGIRVDE +L  Q++ + +  R   D+HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++
  S:     4 SFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGMQDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHTEELVAKYPDLTPKERENAITKEFGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTETENGYHGLNGDILVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGDQDRLAFDWHKSLLNGLFPLTIGGGIGQSRMVMFLLRKKHIGEVQTSVWPQEV 322
>gi|139473440|ref|YP_001128156.1| asparagine synthetase AsnA [Streptococcus pyogenes str. Manfredo] >gi|166219934|sp|A2RDJ5|ASNA_STRPG Aspartate--ammonia ligase (Asparagine synthetase A) >gi|134271687|emb|CAM29920.1| aspartate--ammonia ligase [Streptococcus pyogenes str. Manfredo] (330 aa)
Score = 740, Expect = 1.9e-76, Identities = 153/310 (49%), Positives = 207/310 (66%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           S +  Q+ I F+K+ F   L   L +  V  P++     G+ D+L+G+ENPV+         + E+  SLAKWKR  L ++     EG+  +M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY++IRL +  V  +Y+   E +LP++ITFI +E+L+  YP+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWN+   SA ELSSMGIRVDE +L  Q++ + +  R   D+HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQ+S+WP+++
  S:     4 SFIHQQEEISFVKNTFTQYLIAKLDVVEVQGPILSRVGDGMQDNLSGTENPVSVNVLKIPNATFEVVHSLAKWKRHTLARFGFNEGEGLVVNMKALRPDEDSLDQTHSVYVDQWDWEKVIPDGKRNLAYLKETVETIYKVIRLTELAVEARYD--IEAVLPKKITFIHTEELVAEYPDLTPKERENAITKEFGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTETENGYHGLNGDILVWNDQLGSAFELSSMGIRVDEEALKRQVEMTGDQDRLAFDWHKSLLNGLFPLTIGGGIGQSRMVMFLLRKKHIGEVQTSVWPQEV 322
>gi|76797768|ref|ZP_00780035.1| aspartate--ammonia ligase [Streptococcus agalactiae 18RS21] >gi|76586916|gb|EAO63407.1| aspartate--ammonia ligase [Streptococcus agalactiae 18RS21] (330 aa)
Score = 739, Expect = 2.5e-76, Identities = 156/315 (49%), Positives = 212/315 (67%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L++  V  P++ +   G+ D+L+G E+PV+    +      E+  SLAKWKR  L +      EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL+ LK  V+KIY+ IRL +  V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:     4 SFIHQQQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGMQDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARXGFNEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEDRLEFEWHKTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFE 327
>gi|146318121|ref|YP_001197833.1| asparagine synthetase AsnA [Streptococcus suis 05ZYH33] >gi|145688927|gb|ABP89433.1| aspartate--ammonia ligase [Streptococcus suis 05ZYH33] (317 aa)
Score = 738, Expect = 2.7e-76, Identities = 154/297 (51%), Positives = 204/297 (68%)
  Q:    23 NLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           +L   L++  V  P++     G+ D+L+G EN VT         + E+  SLAKWKR  L ++     EG++  M A+R DE SL  IHS+YVDQWDWE  I    RNL  LK  V++IY+ IRL +  V  +Y+   E++LP++ITFI +EDL++ +P+ TPKERE ++A +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   SA ELSSMGIRVDE +L  Q+  + +  R E D+H+ L+N  FP SIGGGIGQSRL  FLL K+HIGEVQSS+WP+++ +  E
  S:     9 HLKDKLEIVEVQGPILSRVGDGMQDNLSGVENAVTVNVKLIPDATYEVVHSLAKWKRHTLARFGFHEGEGLFVHMKALRPDEDSLDPIHSVYVDQWDWEKVIPDGRRNLAYLKETVEQIYKAIRLTELAVEARYD--IESVLPKKITFIHTEDLVKNFPDLTPKERENVVAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTSPSEAGYKGLNGDILVWNEALGSAFELSSMGIRVDEEALKRQVAITGDEDRLEFDWHRALLNGLFPLSIGGGIGQSRLAMFLLRKKHIGEVQSSVWPQEVRDNFE 314
>gi|52424091|ref|YP_087228.1| asparagine synthetase AsnA [Mannheimia succiniciproducens MBEL55E] >gi|81691520|sp|Q65WL7|ASNA_MANSM Aspartate--ammonia ligase (Asparagine synthetase A) >gi|52306143|gb|AAU36643.1| AsnA protein [Mannheimia succiniciproducens MBEL55E] (330 aa)
Score = 738, Expect = 3.3e-76, Identities = 159/315 (50%), Positives = 203/315 (64%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F K+ F   LA  L L  V  P++ +   GI D+L+G+E  V          + E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RNL+ LK  V++IY  I   +  V+KKY    ++ LP+EITFI SEDL++ YP  T KERE  +  KY AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWN     A E+SSMGIRVDE +L +QL  + +  R + D+H+ LIN   P SIGGGIGQSRL   LL K+HIGEVQSS+WPK ++E+ E
  S:     4 SFILQQQEISFTKNTFTEKLAEHLGLVEVQGPILSQVGNGIQDNLSGTEKAVQVNVKMITDAAFEVVHSLAKWKRHTLARFGFAEGEGLFVHMKALRPDEDSLDQTHSVYVDQWDWEKVIPEGRRNLDYLKETVREIYAAILETEAAVDKKYG--LKSFLPKEITFIHSEDLVKDYPGMTDKERENELCKKYGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTTSEGEYKGLNGDILVWNPILNRAFEVSSMGIRVDETALRKQLSITGDEDRLKFDWHQDLINGRMPLSIGGGIGQSRLAMLLLQKRHIGEVQSSVWPKAVMEQYE 327
>gi|171778743|ref|ZP_02919839.1| hypothetical protein STRINF_00691 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282700|gb|EDT48124.1| hypothetical protein STRINF_00691 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (330 aa)
Score = 737, Expect = 4.1e-76, Identities = 155/315 (49%), Positives = 210/315 (66%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L +  V  P++ +   G+ D+LNG E+PV+           E+  SLAKWKR  L ++     EG++  M A+R DE  L  IHSIYVDQWDWE  I    RN+E LK  V+++Y+ IRL +  V  +++   E +LP++ITFI +E+L++RYP+ TPKERE   A ++ A+F+IGIG  L DG+ HD RAPDYDDW          LNGDIIVWNE   SA ELSSMGIRVDE +L  Q+  + +  R +L++HK L+N  FP +IGGGIGQSR+  FLL K+HIGEVQSS+WPK++ +  E
  S:     4 SFIHQQQEISFVKNTFTQYLIDKLGIVEVQGPILSQVGDGMQDNLNGVEHPVSVHVKRIPNAEYEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDEEELDPIHSIYVDQWDWEKVIPNGRRNIEYLKETVEQVYKAIRLTELAVEARFD--IEAVLPKKITFIHTEELVERYPDLTPKERENAAAKEFGAIFLIGIGGILPDGQRHDGRAPDYDDWTSESENGYHGLNGDIIVWNEVLGSAFELSSMGIRVDEEALKRQVKITGDEDRLQLEWHKALLNGLFPLTIGGGIGQSRMAMFLLRKKHIGEVQSSVWPKEVRDTYE 327
>gi|15603439|ref|NP_246513.1| asparagine synthetase AsnA [Pasteurella multocida subsp. multocida str. Pm70] >gi|21263438|sp|Q9CKN6|ASNA_PASMU Aspartate--ammonia ligase (Asparagine synthetase A) >gi|12721967|gb|AAK03658.1| AsnA [Pasteurella multocida subsp. multocida str. Pm70] (330 aa)
Score = 737, Expect = 4.5e-76, Identities = 155/313 (49%), Positives = 203/313 (64%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           S +  Q+ I F K+ F   LA  L +  V  P++ +   GI D+L+G+E  V          + E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I   +RNL  LK  V+ IY  I   ++ V+KK+       LP++I F+ SE+L+QR+PN   KERE  I  +Y AVF+IGIG  LSDGKPHD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVDE +L +QL  +NN  R + D+H+ L+N   P SIGGGIG+SRL   LL K+HIGEVQSS+WPK ++E+
  S:     4 SFILQQQEISFAKNTFTEKLAEHLGIVEVQGPILSQVGNGIQDNLSGAEKAVQVNVKQITDATFEVVHSLAKWKRHTLARFNFAQGEGLFVHMTALRPDEDSLDQTHSVYVDQWDWEKVISAEQRNLAYLKETVRAIYAAILETEEAVSKKFG--LATFLPKDIQFVHSEELVQRFPNMNDKERENAICKEYGAVFLIGIGGKLSDGKPHDVRAPDYDDWTTPSEGEYKGLNGDILVWNPILERAFELSSMGIRVDETALRKQLALTNNEDRLKFDWHQDLVNGRLPLSIGGGIGRSRLVMLLLQKKHIGEVQSSVWPKWVMEQ 325
>gi|167768921|ref|ZP_02440974.1| hypothetical protein ANACOL_00238 [Anaerotruncus colihominis DSM 17241] >gi|167668561|gb|EDS12691.1| hypothetical protein ANACOL_00238 [Anaerotruncus colihominis DSM 17241] (337 aa)
Score = 737, Expect = 4.6e-76, Identities = 146/323 (45%), Positives = 198/323 (61%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L + +TQ AI  I   F  +L  AL L R +APL ++   G+NDDLNG E PV+F     G   ++  SLAKWKRM L +Y      G+Y +MNAIR+DE L ++HSIYVDQWDWE  I +  R    LK  V+KI   I     E+ + Y      L   +++F+++++L   YP  +PKERE     +++  F++ IGD L  G  HD RAPDYDDWKLNGDI+ W++    A E+SSMGIRVD  S+ EQL K+  + R+ L FH+ +++   P ++GGGIGQSRL   LL K HIGEVQ+SLW  D +   E+  + LL
  S:    16 LGLYDTQAAINEIHSRFAAHLCGALHLTRASAPLFVDPKSGLNDDLNGVERPVSFDIKETGKIAQVVHSLAKWKRMALYRYGFQPGFGLYTEMNAIRRDEELDNLHSIYVDQWDWEKVIDREHRTQVYLKATVQKIVGAICDTLDELKEDYPSLRTEL-SRDVSFVTTQELEDLYPGFSPKERENAYLKEHRTAFVMQIGDLLKSGLKHDGRAPDYDDWKLNGDIVFWSDVLGCAFEVSSMGIRVDAQSMDEQLSKAGADERRGLPFHRMVMDGTLPLTMGGGIGQSRLSMLLLGKAHIGEVQASLWDDDTVTACERAGVTLL 337
>gi|148827756|ref|YP_001292509.1| asparagine synthetase AsnA [Haemophilus influenzae PittGG] >gi|166219927|sp|A5UH70|ASNA_HAEIG Aspartate--ammonia ligase (Asparagine synthetase A) >gi|148718998|gb|ABR00126.1| asparagine synthetase AsnA [Haemophilus influenzae PittGG] (330 aa)
Score = 732, Expect = 1.4e-75, Identities = 154/308 (50%), Positives = 205/308 (66%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N +  E+  SLAKWKR  L ++     EG++  M A+R DE SL S HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVDE +L  Q+  + +  R ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDSTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDRLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|68249160|ref|YP_248272.1| asparagine synthetase AsnA [Haemophilus influenzae 86-028NP] >gi|81336433|sp|Q4QMY5|ASNA_HAEI8 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|68057359|gb|AAX87612.1| aspartate--ammonia ligase [Haemophilus influenzae 86-028NP] (330 aa)
Score = 729, Expect = 3.3e-75, Identities = 154/308 (50%), Positives = 204/308 (66%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N I  E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVDE +L  Q+  + +  R ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAIF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDRLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|145628946|ref|ZP_01784746.1| asparagine synthetase AsnA [Haemophilus influenzae 22.1-21] >gi|145633484|ref|ZP_01789213.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae 3655] >gi|145635353|ref|ZP_01791055.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae PittAA] >gi|144979416|gb|EDJ89102.1| asparagine synthetase AsnA [Haemophilus influenzae 22.1-21] >gi|144985853|gb|EDJ92461.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae 3655] >gi|145267359|gb|EDK07361.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae PittAA] (330 aa)
Score = 728, Expect = 4.3e-75, Identities = 153/308 (49%), Positives = 204/308 (66%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N +  E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVDE +L  Q+  + +  R ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDRLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|13357923|ref|NP_078197.1| asparagine synthetase AsnA [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762014|ref|YP_001752446.1| aspartate--ammonia ligase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920437|ref|ZP_02691442.2| aspartate--ammonia ligase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508743|ref|ZP_02690277.2| aspartate--ammonia ligase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701713|ref|ZP_02971405.1| aspartate--ammonia ligase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189046377|sp|B1AJ02|ASNA_UREP2 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|21263439|sp|Q9PQC8|ASNA_UREPA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|11272063|pir||G82900 aspartate-ammonia ligase UU363 [imported] - Ureaplasma urealyticum >gi|6899344|gb|AAF30772.1|AE002133_5 aspartate-ammonia ligase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827591|gb|ACA32853.1| aspartate--ammonia ligase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902886|gb|EDT49175.1| aspartate--ammonia ligase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675673|gb|EDT87578.1| aspartate--ammonia ligase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700980|gb|EDU19262.1| aspartate--ammonia ligase [Ureaplasma parvum serovar 6 str. ATCC 27818] (329 aa)
Score = 728, Expect = 4.6e-75, Identities = 156/321 (48%), Positives = 215/321 (66%)
  Q:     6 ILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDF-HKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           I +TQKAI  IK+ FQ + A  L L RVTAPL +E   G+ND L+  +  V+F +     + EI QSLAKWKR+ L  Y   L+EG+Y DMNAIR D+ +  IHSIYVDQWDWE+ I   + NL+ LK +V KIY  IR+ Q E+++ Y    + +LP+ ITFISS++L   YP+ +P  RE   A  +KA+FI  IG  L  G    +R+P+YD+W LNGD+IV+++    A+ELSSMGIRV +   ++Q + +N  + +E +F H+ ++N + P +IGGGIGQSRLC FLL+K+HIGEVQ S+WP +  +E  K  IKLL
  S:     9 INQTQKAIVEIKNSFQKHFAKNLNLSRVTAPLFVEGQSGLNDHLDHKQKAVSFYAKKLDKTLEIVQSLAKWKRLALLDYGFSLYEGLYTDMNAIRADDDIDEIHSIYVDQWDWEILINNQDCNLDFLKSIVNKIYSTIRIVQLEIDQLYN-PKQIILPDSITFISSQELEDLYPHLSPSRREYEFAKIHKAIFIYQIGYPLKSGYIQSIRSPEYDNWNLNGDLIVYHKLNDQAIELSSMGIRVSKQDFIKQTNFANLKNDQENNFYHQMILNNQLPQTIGGGIGQSRLCMFLLNKKHIGEVQVSVWPNEYKDELLKKGIKLL 329
>gi|53733087|ref|ZP_00155556.2| COG2502: Asparagine synthetase A [Haemophilus influenzae R2846] >gi|145637396|ref|ZP_01793055.1| asparagine synthetase AsnA [Haemophilus influenzae PittHH] >gi|145269342|gb|EDK09286.1| asparagine synthetase AsnA [Haemophilus influenzae PittHH] (330 aa)
Score = 728, Expect = 4.8e-75, Identities = 153/308 (49%), Positives = 204/308 (66%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N +  E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVDE +L  Q+  + +  R ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNAIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDRLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|1321874|emb|CAA61602.1| aspartate-ammonia ligase [Lactobacillus delbrueckii] (336 aa)
Score = 725, Expect = 1.0e-74, Identities = 152/300 (50%), Positives = 203/300 (67%)
  Q:    27 ALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLS-DGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           A+ L R++AP+ ++++ G+ND+L+G E PV+FT  DGN    +I  SLAKWKR  L  Y     EG++ +MNAIRKDE  L ++HS+YVDQWDWE  I K+ER   TL+  V++I+E I+  +  V   Y   A +L PEEI+F++SE+L  R+P+ TP ERE  I  +  AVF+  IG  L    KPHDLRAPDYDDW LNGD++ W E  + A E+SSM IRVDE  L EQL  +    R +L FH+ L+  + PYSIGGGIGQSRLC  LL   H GEVQ+S+WP +I+E+ +   I+LL
  S:    36 AMNLERISAPMFVKKSSGLNDNLSGWEKPVSFTLHDGNEGELQIVHSLAKWKRWALKHYGFSHGEGLFTNMNAIRKDEEVLDNLHSVYVDQWDWEKVIDKSERTEATLRQTVQRIFETIKGMEYHVRALYPQAAYHL-PEEISFVTSEELEARWPSLTPSEREDKICQEKGAVFLEHIGGALPLSKKPHDLRAPDYDDWTLNGDLLFWYEPLQRAFEVSSMSIRVDEDRLQEQLKLAGAEDRLDLPFHQALLKGDLPYSIGGGIGQSRLCMLLLQGPH-GEVQASIWPDEIVEKCQAAKIQLL 336
>gi|33152895|ref|NP_874248.1| asparagine synthetase AsnA [Haemophilus ducreyi 35000HP] >gi|47115739|sp|Q7VKJ0|ASNA_HAEDU Aspartate--ammonia ligase (Asparagine synthetase A) >gi|33149120|gb|AAP96637.1| asparagine synthetase A [Haemophilus ducreyi 35000HP] (330 aa)
Score = 724, Expect = 1.4e-74, Identities = 154/315 (48%), Positives = 203/315 (64%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F+K+ F   L   L +  V  P++ +   G+ D+L+G E  V        G   E+  SLAKWKR  L ++     EG++  M A+R DE SL   HSIYVDQWDWE  I + +RN   LK  V +IY+ IRL +  V  +++    + LP++ITFI SE+L QRYPN + KERE  I  ++ A+F+IGIG  LSDGK HD RAPDYDDW          LNGDI+VWNE   SA ELSSMGIRVD+ +L  Q+  + +  R  +D+H+ L+    P SIGGGIGQSRL  FLLHK+HIGEVQSS+WP ++L + E
  S:     4 SFILQQQEISFVKNTFTQYLIDQLDIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPGAVFEVVHSLAKWKRHTLARFGFKQGEGLFVHMKALRPDEDSLDPTHSIYVDQWDWEKVIPEGQRNFAYLKQTVNQIYKAIRLTELAVEARFD--IPSSLPKQITFIHSEELAQRYPNMSSKERENAICKEHGAIFLIGIGGKLSDGKAHDGRAPDYDDWTTESENGYKGLNGDILVWNEELGSAFELSSMGIRVDQQALRLQVSLTGDEDRLTMDWHQDLLAGRLPLSIGGGIGQSRLVMFLLHKKHIGEVQSSVWPTEMLTQFE 327
>gi|148825160|ref|YP_001289913.1| asparagine synthetase AsnA [Haemophilus influenzae PittEE] >gi|166219926|sp|A5U9S9|ASNA_HAEIE Aspartate--ammonia ligase (Asparagine synthetase A) >gi|148715320|gb|ABQ97530.1| asparagine synthetase AsnA [Haemophilus influenzae PittEE] (330 aa)
Score = 723, Expect = 1.6e-74, Identities = 152/308 (49%), Positives = 203/308 (65%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N +  E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVD+ +L  Q   + +  R ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDQSALRLQAGLTGDEDRLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|188158981|ref|ZP_02511968.2| asparagine synthetase AsnA [Mycoplasma mycoides subsp. mycoides LC str. GM12] (326 aa)
Score = 723, Expect = 1.6e-74, Identities = 166/323 (51%), Positives = 205/323 (63%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI +TQ+AI+ IK      L   L L RV+APL +     IND LNG + PV FT +      EI  SLAKWKR  L KY     EGI+ADMNAIRKD+ +   HS+YVDQWDWEL I K +RNLE LK +  KIY+ IR  + ++N KY    + L P+++TFI S DL  +YPN T ++RE  +A +YKAVFI  IG +L D KPH  RA DYDDW LNGD+I ++     ALE+SSMGIRVD  SL EQ    N        +H +++N + P +IGGGIGQSRL  FLL K HIGEVQ S+W K   EE +K  I LL
  S:     6 LSIKQTQQAIQDIKFGLTKQLKQNLNLTRVSAPLFVTSESKINDGLNG-DIPVVFTPNQWNEDLEIVHSLAKWKRYALDKYNFNFGEGIWADMNAIRKDDVVDYKHSLYVDQWDWELIISKEQRNLEFLKQIATKIYDSIRYVEHKINFKYPDLIDKL-PKQLTFIDSLDLYNKYPNLTAEQREDEVAREYKAVFIYKIGYDLPDKKPHSKRAFDYDDWNLNGDLIFYDLVNDKALEISSMGIRVDAKSLSEQTKMLNKTDSDLGLYHDQVLNDKLPLTIGGGIGQSRLSMFLLEKAHIGEVQVSVWEKQYKEELKKQGIILL 326
>gi|171920928|ref|ZP_02696258.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178888|ref|ZP_02554939.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024222|ref|ZP_02570399.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039396|ref|ZP_02998167.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 8] >gi|188518583|ref|ZP_03004038.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524534|ref|ZP_02558507.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530918|ref|ZP_02546762.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568558|ref|ZP_02828371.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 2] >gi|188592368|ref|ZP_03005745.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 10] >gi|171903157|gb|EDT49446.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209144|gb|EDU06187.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018877|gb|EDU56917.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997820|gb|EDU66917.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659604|gb|EDX52984.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (329 aa)
Score = 723, Expect = 1.9e-74, Identities = 154/321 (47%), Positives = 213/321 (66%)
  Q:     6 ILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDF-HKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           I +TQKAI  IK+ FQ   A  L L RVTAPL +E   G+ND L+  +  V+F +     + EI QSLAKWKR+ L  Y   L+EG+Y DMNAIR D+ +  IHSIYVDQWDWE+ I K +  L+ LK +V KIY  I+  Q E+++ Y    + +LP+ ITFI S++L   YP+ TP +RE   A  ++A+FI  IG  L  G    +R+P+YD+W LNGD+IV+++    A+ELSSMGIRV +   ++Q + +N  + +E +F H+ ++N + P +IGGGIGQSRLC FLL+K+HIGEVQ S+WP +  +E  K  IKLL
  S:     9 INQTQKAIVEIKNRFQKYFAKNLNLSRVTAPLFVEGQSGLNDHLDHKQKAVSFYAKKLNKTLEIVQSLAKWKRLALLDYGFSLYEGLYTDMNAIRADDDIDEIHSIYVDQWDWEILINKQDCTLDFLKSIVNKIYSTIKTVQLEIDQLYN-PKQIILPDSITFIGSQELEDLYPHLTPSQREYEFAKMHQAIFIYQIGYPLKSGYIQSIRSPEYDNWNLNGDLIVYHKLNDQAIELSSMGIRVSKQDFIKQTNFANLKNDQENNFYHQMILNDQLPQTIGGGIGQSRLCMFLLNKKHIGEVQVSVWPNEYKDELLKKGIKLL 329
>gi|53733329|ref|ZP_00156382.2| COG2502: Asparagine synthetase A [Haemophilus influenzae R2866] >gi|145638527|ref|ZP_01794136.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae PittII] >gi|145272122|gb|EDK12030.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae PittII] (330 aa)
Score = 722, Expect = 2.3e-74, Identities = 152/308 (49%), Positives = 203/308 (65%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N +  E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVDE +L  Q+  + +    ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNAIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDHLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|16272507|ref|NP_438721.1| asparagine synthetase AsnA [Haemophilus influenzae Rd KW20] >gi|145631757|ref|ZP_01787518.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae 22.4-21] >gi|145640538|ref|ZP_01796122.1| asparagine synthetase AsnA [Haemophilus influenzae R3021] >gi|1168531|sp|P44338|ASNA_HAEIN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|1573551|gb|AAC22222.1| aspartate--ammonia ligase (asnA) [Haemophilus influenzae Rd KW20] >gi|144982618|gb|EDJ90164.1| ribulose-phosphate 3-epimerase [Haemophilus influenzae R3021] >gi|145275124|gb|EDK14986.1| asparagine synthetase AsnA [Haemophilus influenzae 22.4-21] (330 aa)
Score = 722, Expect = 2.4e-74, Identities = 152/308 (49%), Positives = 203/308 (65%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSD--GNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           Q+ I F+K+ F  NL   L +  V  P++ +   G+ D+L+G E  V        N +  E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I +  RN   LK  V  IY  IRL +  V  +++    ++LP++ITF+ SEDL++RYP+ + KERE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN+    A ELSSMGIRVDE +L  Q+  + +    ++D+H+ L+N + P +IGGGIGQSRL   LL K+HIGEVQSS+WPK++LEE
  S:     9 QQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQDNLSGIEKAVQVNVKCIPNAVF-EVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFD--IPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDHLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE 325
>gi|195867897|ref|ZP_03079896.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660474|gb|EDX53732.1| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (329 aa)
Score = 722, Expect = 2.5e-74, Identities = 154/321 (47%), Positives = 213/321 (66%)
  Q:     6 ILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDF-HKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           I +TQKAI  IK+ FQ   A  L L RVTAPL +E   G+ND L+  +  V+F +     + EI QSLAKWKR+ L  Y   L+EG+Y DMNAIR D+ +  IHSIYVDQWDWE+ I K +  L+ LK +V KIY  I+  Q E+++ Y    + +LP+ ITFI S++L   YP+ TP +RE   A  ++A+FI  IG  L  G    +R+P+YD+W LNGD+IV+++    A+ELSSMGIRV +   ++Q + +N  + +E +F H+ ++N + P +IGGGIGQSRLC FLL+K+HIGEVQ S+WP +  +E  K  IKLL
  S:     9 INQTQKAIVEIKNRFQKYFAKNLNLSRVTAPLFVEVQSGLNDHLDHKQKAVSFYAKKLNKTLEIVQSLAKWKRLALLDYGFSLYEGLYTDMNAIRADDDIDEIHSIYVDQWDWEILINKQDCTLDFLKSIVNKIYSTIKTVQLEIDQLYN-PKQIILPDSITFIGSQELEDLYPHLTPSQREYEFAKMHQAIFIYQIGYPLKSGYIQSIRSPEYDNWNLNGDLIVYHKLNDQAIELSSMGIRVSKQDFIKQTNFANLKNDQENNFYHQMILNDQLPQTIGGGIGQSRLCMFLLNKKHIGEVQVSVWPNEYKDELLKKGIKLL 329
>gi|77413566|ref|ZP_00789754.1| aspartate--ammonia ligase [Streptococcus agalactiae 515] >gi|77160395|gb|EAO71518.1| aspartate--ammonia ligase [Streptococcus agalactiae 515] (315 aa)
Score = 720, Expect = 3.6e-74, Identities = 151/303 (49%), Positives = 205/303 (67%)
  Q:    17 KDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           K+ F       L++  V  P++ +   G+ D+L+G E+PV+    +      E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL+ LK  V+KIY+ IRL +  V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:     1 KNTFTQYFFDKLEIVEVQGPILSQVGDGMQDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEGRLEFEWHKMLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFE 312
>gi|42561528|ref|NP_975979.1| asparagine synthetase AsnA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42561551|ref|NP_976002.1| asparagine synthetase AsnA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42493027|emb|CAE77621.1| ASPARTATE-AMMONIA LIGASE [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42493050|emb|CAE77644.1| Aspartate--ammonia ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (326 aa)
Score = 720, Expect = 3.7e-74, Identities = 165/323 (51%), Positives = 205/323 (63%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI +TQ+AI+ IK      L   L L RV+APL +     IND LNG + PV FT +      EI  SLAKWKR  L KY     EGI+ADMNAIRKD+ +   HS+YVDQWDWEL I K +RNLE LK +  KIY+ IR  + ++N KY    + L P+++TFI S DL  +YPN T ++RE  +A +YKAVFI  IG +L D KPH  RA DYDDW LNGD+I ++     ALE+SSMGIRVD  SL EQ    N        +H +++N + P +IGGGIGQSRL  FLL K HIGEVQ S+W K   E+ +K  I LL
  S:     6 LSIKQTQQAIQDIKFGLTKQLKQNLNLTRVSAPLFVTSESKINDGLNG-DIPVVFTPNQWKEDLEIVHSLAKWKRYALDKYNFNFGEGIWADMNAIRKDDVVDYKHSLYVDQWDWELIISKEQRNLEFLKQIATKIYDSIRYVEHKINFKYPDLVDKL-PKQLTFIDSLDLYNKYPNLTAEQREDEVAREYKAVFIYKIGYDLPDKKPHSKRAFDYDDWNLNGDLIFYDLVNDKALEISSMGIRVDAKSLSEQTKILNKTDSDLGLYHDQVLNDKLPLTIGGGIGQSRLSMFLLEKAHIGEVQVSVWEKQYKEDLKKQGIVLL 326
>gi|113461583|ref|YP_719652.1| asparagine synthetase AsnA [Haemophilus somnus 129PT] >gi|112823626|gb|ABI25715.1| aspartate-ammonia ligase [Haemophilus somnus 129PT] (333 aa)
Score = 717, Expect = 8.1e-74, Identities = 154/315 (48%), Positives = 198/315 (62%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F K+ F   L   L +  V  P++ +   GI D+L+G+E  V            E+  SLAKWKR  L ++    +EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL  LK  V+ IY+ I   +  V++K+       LP EITFI SE+L+QRYP    K+RE  I  +Y AVF+IGIG  LSDGKPHD RAPDYDDW          LNGDI+VWN   + A E+SSMGIRVDE +L +QL  + +  R + D+H+ L+N   P SIGGGIGQSRL   LL K+HIGEVQSS+WPK + E+ E
  S:     7 SFILQQQEISFAKNTFTEKLIEHLGIIEVQGPILSQVGNGIQDNLSGTEKAVQVNVKQITDAKFEVVHSLAKWKRHTLARFNFAENEGLFVHMKALRPDEDSLDQTHSVYVDQWDWEKVIPTGRRNLAYLKETVRSIYQAILETEDAVHQKFG--LSKFLPREITFIHSEELVQRYPELNDKQRENAICKEYGAVFLIGIGGVLSDGKPHDKRAPDYDDWTTPSEGEYLGLNGDILVWNPVLERAFEVSSMGIRVDETALRKQLALTGDEDRLQFDWHQDLVNGRLPLSIGGGIGQSRLAMLLLQKKHIGEVQSSVWPKVVTEQFE 330
>gi|170718744|ref|YP_001783931.1| aspartate--ammonia ligase [Haemophilus somnus 2336] >gi|189046375|sp|B0US32|ASNA_HAES2 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|168826873|gb|ACA32244.1| Aspartate--ammonia ligase [Haemophilus somnus 2336] (330 aa)
Score = 713, Expect = 2.2e-73, Identities = 153/315 (48%), Positives = 198/315 (62%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F K+ F   L   L +  V  P++ +   GI D+L+G+E  V            E+  SLAKWKR  L ++    +EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL  LK  V+ IY+ I   +  V++K+       LP EITFI SE+L+QRYP    K+RE  I  +Y AVF++GIG  LSDGKPHD RAPDYDDW          LNGDI+VWN   + A E+SSMGIRVDE +L +QL  + +  R + D+H+ L+N   P SIGGGIGQSRL   LL K+HIGEVQSS+WPK + E+ E
  S:     4 SFILQQQEISFAKNTFTEKLIEHLGIIEVQGPILSQVGNGIQDNLSGTEKAVQVNVKQITDAKFEVVHSLAKWKRHTLARFNFAENEGLFVHMKALRPDEDSLDQTHSVYVDQWDWEKVIPTGRRNLAYLKETVRSIYQAILETEDAVHQKFG--LSKFLPREITFIHSEELVQRYPELNDKQRENAICKEYGAVFLMGIGGVLSDGKPHDKRAPDYDDWTTPSEGEYLGLNGDILVWNPVLERAFEVSSMGIRVDETALRKQLALTGDEDRLQFDWHQDLVNGRLPLSIGGGIGQSRLAMLLLQKKHIGEVQSSVWPKVVTEQFE 327
>gi|83319586|ref|YP_424764.1| asparagine synthetase AsnA [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283472|gb|ABC01404.1| aspartate--ammonia ligase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (326 aa)
Score = 704, Expect = 2.7e-72, Identities = 162/323 (50%), Positives = 203/323 (62%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L+I +TQ+AI+ IK      L   L L RV+APL +     IND LNG + PV FT        EI  SLAKWKR  L KY   + EGI+ADMNAIRKD+ +   HS+YVDQWDWEL I   +RN E LK VV KIY+ IR  + ++N KY    + L P+++ FI S DL  +YPN T ++RE  I  ++KAVFI  IG NL D  PH  RA DYDDW LNGD+I ++     ALE+SSMGIRV+  SL EQ+   N  +     +H +++N + P +IGGGIGQSRL  FLL K HIGEVQ S+W K   EE +K  I LL
  S:     6 LTIKQTQQAIQDIKFGLTKQLKQNLNLTRVSAPLFVTSESKINDGLNG-DIPVEFTPKQWTEDLEIVHSLAKWKRYALDKYNFNIGEGIWADMNAIRKDDIVDYKHSLYVDQWDWELIISDDQRNFEFLKEVVIKIYDSIRYVEHKINFKYPELVDKL-PKQLIFIDSLDLYNKYPNLTAEQREDEIVKEFKAVFIYKIGHNLPDNLPHSKRAFDYDDWNLNGDLIFYDRVNDKALEISSMGIRVNAKSLSEQIKILNKTNSDLGLYHDQVLNNKLPLTIGGGIGQSRLSMFLLEKAHIGEVQVSVWEKQYKEELKKQGITLL 326
>gi|50118968|ref|YP_048135.1| asparagine synthetase AsnA [Pectobacterium atrosepticum SCRI1043] >gi|81693493|sp|Q6DB95|ASNA_ERWCT Aspartate--ammonia ligase (Asparagine synthetase A) >gi|49609494|emb|CAG72927.1| putative asparagine synthetase A [Erwinia carotovora subsp. atroseptica SCRI1043] (330 aa)
Score = 697, Expect = 1.8e-71, Identities = 146/310 (47%), Positives = 192/310 (61%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           +E Q+ I F+K  F   L   L L  V AP++     G  D+L+G+E  V          + E+  SLAKWKR  LG Y+    EGIY  M A+R DE  LS IHS+YVDQWDWE  ++  ERN E LK  V +IY+ I+  +  V++ +    +  LPE+I F+ +E LL+RYP+   K RER IA +  AVF+IGIG  LS G  HD+RAPDYDDW          LNGDI+VWN     A E+SSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP+ + E
  S:     6 IEKQQQISFVKSFFSSQLEQLLGLIEVQAPILSRIGDGTQDNLSGTEKAVQVKVKALPDATFEVVHSLAKWKRKTLGAYDFSFGEGIYTHMKALRPDEDRLSPIHSVYVDQWDWERVMEDGERNAEYLKSTVTRIYQGIKATEAAVHQAFG--IQPFLPEQIHFVHTETLLKRYPDLDAKGRERAIAKELGAVFLIGIGGKLSSGHSHDVRAPDYDDWTTPGEQELAGLNGDIVVWNPVLNDAFEISSMGIRVDAEALTRQLALTQDEERLKLEWHQALLRGEMPQTIGGGIGQSRLVMLLLQLPHIGQVQCGVWPQPLRE 324
>gi|77973812|ref|ZP_00829357.1| COG2502: Asparagine synthetase A [Yersinia frederiksenii ATCC 33641] (330 aa)
Score = 693, Expect = 4.9e-71, Identities = 149/305 (48%), Positives = 191/305 (62%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           F+K  F   L   L L  V AP++     G  D+L+GSE  V          + E+  SLAKWKR  LG+++    +GIY  M A+R DE  LS+IHS+YVDQWDWE  +   ERNL  LK  V KIY  I+  + E     E+  +  LP+ I FI SE L  R+P+   K RER IA +  AVF+IGIG  L+DGK HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  +++  R +L++H+ L+N E P +IGGGIGQSRL   LL KQHIG+VQ  +W  +I E+ E
  S:    14 FVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQDNLSGSEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGRFDFGADQGIYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIK--ETEAAISAEFGVKPFLPDHIQFIHSETLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGKSHDVRAPDYDDWTSPSAEGFAGLNGDIIVWNPVLEDAFEISSMGIRVDAEALKRQLALTSDEDRLKLEWHQSLLNGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVE 327
>gi|194684364|emb|CAR46001.1| aspartate-ammonia ligase (asparagine synthetase A) [Proteus mirabilis HI4320] (330 aa)
Score = 693, Expect = 5.1e-71, Identities = 147/309 (47%), Positives = 198/309 (64%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKD 313
           S ++TQ+ I F+K  F   L   L L  V  P++     G  D+L+G E  V         S  E+  SLAKWKR  LG++     +G+Y  M A+R DE  L+ IHS+YVDQWDWE  ++  ER L  LK  V KIY+ I+  +K V+   E+     LP++I FI +E+LL+RYP+   K RE+ IA +Y AVF+IGIG  LS G+ HD+RAPDYDDW          LNGDI+VWN   + A E+SSMGIRVD  +L+ QL  +++  R ELD+HK L++ + P +IGGGIGQSRL   LL K+HIG+VQ  +W +D
  S:     4 SFIQTQQQISFVKSYFSRLLEKELGLIEVQGPILSRLGDGTQDNLSGHEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFGFSSGQGLYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMEGEERTLPYLKQTVGKIYQAIKETEKAVSD--EFGLTPFLPDQIQFIHTEELLRRYPDLDAKGREKAIAKEYGAVFLIGIGGKLSSGEAHDVRAPDYDDWTTPNEDGFAGLNGDILVWNPVLQDAFEVSSMGIRVDPETLMRQLTLTDDTQRLELDWHKALMHGDMPQTIGGGIGQSRLVMLLLQKEHIGQVQCGVWQQD 321
>gi|77977924|ref|ZP_00833361.1| COG2502: Asparagine synthetase A [Yersinia intermedia ATCC 29909] (330 aa)
Score = 693, Expect = 5.8e-71, Identities = 149/305 (48%), Positives = 192/305 (62%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           F+K  F   L   L L  V AP++     G  D+L+GSE  V          + E+  SLAKWKR  LG+++    +GIY  M A+R DE  LS+IHS+YVDQWDWE  +   ERNL  LK  V KIY  I+  + EV    E+  +  LPE I FI SE L  R+P+   K RER IA +  AVF+IGIG  L+DGK HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  +++  R +L++H+ L++ E P +IGGGIGQSRL   LL +QHIG+VQ  +W  +I E+ E
  S:    14 FVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQDNLSGSEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGRFDFGADQGIYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYTAIK--ETEVAISAEFGVKPFLPENIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGKSHDVRAPDYDDWTSPSAEGFAGLNGDIIVWNPVLEDAFEISSMGIRVDAEALKRQLALTSDEDRLKLEWHQSLLSGEMPQTIGGGIGQSRLVMLLLQQQHIGQVQCGVWGPEISEKVE 327
>gi|123440406|ref|YP_001004400.1| asparagine synthetase AsnA [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166219935|sp|A1JHR0|ASNA_YERE8 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|122087367|emb|CAL10148.1| aspartate-ammonia ligase [Yersinia enterocolitica subsp. enterocolitica 8081] (330 aa)
Score = 692, Expect = 7.2e-71, Identities = 146/305 (47%), Positives = 194/305 (63%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           F+K  F   L   L L  V AP++     G  D+L+GSE  V          + E+  SLAKWKR  LG+++    +GIY  M A+R DE  LS+IHS+YVDQWDWE  +   ERNL  LK  V KIY  I+  +  ++ +++   +  LPE+I FI SE L  ++P+   K RER IA +  AVF+IGIG  L+DGK HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  +++  R +L++H+ L+N E P +IGGGIGQSRL   LL +QHIG+VQ  +W  +I E+ E
  S:    14 FVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQDNLSGSEKAVQVKVKSLPDATFEVVHSLAKWKRKTLGRFDFGADQGIYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFD--IKPFLPEQIHFIHSESLRAKFPDLDAKGRERAIAKELGAVFLIGIGGKLADGKSHDVRAPDYDDWTSPSAEGFAGLNGDIIVWNPVLEDAFEISSMGIRVDAEALKRQLALTSDEDRLKLEWHQSLLNGEMPQTIGGGIGQSRLVMLLLQQQHIGQVQCGVWGPEISEKVE 327
>gi|172056620|ref|YP_001813080.1| aspartate--ammonia ligase [Exiguobacterium sibiricum 255-15] >gi|171989141|gb|ACB60063.1| Aspartate--ammonia ligase [Exiguobacterium sibiricum 255-15] (324 aa)
Score = 691, Expect = 8.5e-71, Identities = 142/323 (43%), Positives = 204/323 (63%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +S+ +TQ+AI  +K  F+   +  L L RV APL +E   G+ND LNG+E  + F +  +    EI QSLAKWKR  L  Y     EG+Y  M+AIR+DE L   HSI+VDQWDWE  I K ER ++ L+  V+ IY  IR  ++EV ++     E +LPE I F+++++L   YP  + KERE  +  +Y AVF++ IG  L+ G+ HD RA DYDDW LNGDI+V +     A ELSSMGIRVD  +L+ Q++ +  +++ +  FH+ ++ +  P +IGGGIGQSR+  FLL K+HIGEVQ+S+W ++      +  + LL
  S:     5 VSMKQTQEAITLVKKRFEEQFSAQLGLTRVEAPLFVESTLGVNDHLNGTERVIRFDAIDHQAELEIVQSLAKWKRQALHTYGFAKGEGLYTLMHAIRRDEVLDETHSIHVDQWDWERVISKEERTIDYLQKTVQAIYASIRQVEREVEEQLA--IEAILPETIHFMTTQELEDAYPTLSTKERETEVTKEYGAVFLMQIGGALASGEKHDGRAADYDDWTLNGDILV-HHPEIGAFELSSMGIRVDRETLLAQIETTGEHAKLDFPFHQGVLAETLPLTIGGGIGQSRMAMFLLKKRHIGEVQASVWSEETRASYREQGVHLL 324
>gi|37524084|ref|NP_927428.1| asparagine synthetase AsnA [Photorhabdus luminescens subsp. laumondii TTO1] >gi|47115707|sp|Q7NA83|ASNA_PHOLL Aspartate--ammonia ligase (Asparagine synthetase A) >gi|36783507|emb|CAE12347.1| Aspartate--ammonia ligase (Asparagine synthetase A) [Photorhabdus luminescens subsp. laumondii TTO1] (330 aa)
Score = 690, Expect = 1.0e-70, Identities = 151/315 (47%), Positives = 197/315 (62%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +E Q+ I F+K  F   L   L L  V  P++     GI D+L+G E  V         S  E+  SLAKWKR  LG++     +G+Y  M A+R DE  L+ IHS+YVDQWDWE  ++  +R+L  LK  V KIYE I+  +K VNK  E+     LP++I F+ SE LL RYP+   K RER IA +  AVF+IGIG  LSDG+ HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  +++  R + D+H+ L+  + P SIGGGIGQSRL   LL  +HIG+VQ S+W  ++ E  E
  S:     4 SFIEKQQQISFVKSFFSRLLESKLGLIEVQGPILSCLGDGIQDNLSGHEKAVQVKVKTLPDSTFEVVHSLAKWKRRTLGRFGFQPEQGLYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMEDGQRSLAYLKQTVGKIYEAIKETEKAVNK--EFGLAPFLPDQIHFVHSETLLSRYPDLDAKGRERAIAKELGAVFLIGIGAKLSDGQSHDVRAPDYDDWTTPNSDGFVGLNGDIIVWNPVLEDAFEISSMGIRVDAEALERQLALTSDEERLQYDWHQALLKGDMPQSIGGGIGQSRLVMLLLQMKHIGQVQCSIWSPEVRETVE 327
>gi|71404075|ref|XP_804776.1| asparagine synthetase A, putative [Trypanosoma cruzi strain CL Brener] >gi|71424438|ref|XP_812804.1| asparagine synthetase A, putative [Trypanosoma cruzi strain CL Brener] >gi|70867915|gb|EAN82925.1| asparagine synthetase A, putative [Trypanosoma cruzi] >gi|70877628|gb|EAN90953.1| asparagine synthetase A, putative [Trypanosoma cruzi] (348 aa)
Score = 690, Expect = 1.1e-70, Identities = 152/310 (49%), Positives = 199/310 (64%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK-------------------------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           + ++ Q+ I  +K +F   LA  L L  V APL+     G  D+L+G+E  V     G   S  E+  SLAKWKR  LG ++ P+ +GIY  M A+R +E L + HS++VDQWDWEL +   ERNL  LK  V+++Y  IR  ++ +  KY    + +LP  I F+ +E LL+ YP    KERER I  KY AVF+IGIG NL+ G+PHDLRAPDYDDW                          LNGDI+V+N      LELSSMGIRVD  +L  QL   +N  R    +HK+L+  EFP +IGGGIGQSRL   LL K+HIGEVQ S+WPK++
  S:     8 AFIQLQEQIVTVKQVFSSALAKELNLVEVQAPLLACCGDGTQDNLSGTEKAVQVHVKGIPDSKFEVVHSLAKWKRQTLGDHKFPVGQGIYVHMKALRVEEELDTTHSVFVDQWDWELVMPPQERNLTFLKNTVQRLYAAIRQTEEAICSKYN--LDRVLPANIQFLHAEHLLKMYPEMNMKERERAIVKKYGAVFLIGIGGNLTSGEPHDLRAPDYDDWSSPVSAADITFPCGDPTMNSLASLPGLNGDILVYNPVLDDVLELSSMGIRVDAETLRRQLTLLSNEDRLGYVWHKRLLAGEFPQTIGGGIGQSRLLMLLLKKKHIGEVQCSVWPKEM 341
>gi|77411430|ref|ZP_00787776.1| aspartate--ammonia ligase [Streptococcus agalactiae CJB111] >gi|77162516|gb|EAO73481.1| aspartate--ammonia ligase [Streptococcus agalactiae CJB111] (279 aa)
Score = 690, Expect = 1.1e-70, Identities = 139/252 (55%), Positives = 181/252 (71%)
  Q:    68 EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL+ LK  V+KIY+ IRL +  V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+IGIG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:    17 EVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEGRLEFEWHKTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFE 276
>gi|77361705|ref|YP_341280.1| asparagine synthetase AsnA [Pseudoalteromonas haloplanktis TAC125] >gi|76876616|emb|CAI87838.1| asparagine synthetase A [Pseudoalteromonas haloplanktis TAC125] (331 aa)
Score = 688, Expect = 1.9e-70, Identities = 152/300 (50%), Positives = 190/300 (63%)
  Q:    13 IKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHI-KKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPK 312
           I  +K  F   L   L L  V AP++     G  D+L+G EN V         S  E+  SLAKWKR  LG +     EGIY  M A+R DE SLS IHS+YVDQWDWE  I + +ER L TLK  V+ IY  I+  ++ V+ K+       LP  ITF+ SE+L + YP+ + K+RE+ IA +Y AVF+IGIG  LSDGK HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRV    L +QL  +++  R E D+HK LI  +FP +IGGGIGQSRL   LL K HIG+VQ S WP+
  S:    12 ISQVKHFFSQQLEQQLGLIEVQAPILARVGDGTQDNLSGHENAVAVNIKAIPDSRYEVVHSLAKWKRKTLGDHSFSHGEGIYTQMKALRPDEDSLSPIHSVYVDQWDWEKVICQDSERTLTTLKQTVEAIYTGIKKTEQFVSDKFG--ITPFLPSSITFVHSEELREMYPDFSAKQREKAIAQEYGAVFLIGIGGKLSDGKIHDVRAPDYDDWSTPTCDKYAGLNGDILVWNPLLEDAFELSSMGIRVSPDVLQKQLSMTSDEDRLEFDWHKALIQNKFPQTIGGGIGQSRLVMLLLQKPHIGQVQVSAWPQ 321
>gi|145297345|ref|YP_001140186.1| asparagine synthetase AsnA [Aeromonas salmonicida subsp. salmonicida A449] >gi|166219922|sp|A4SHR6|ASNA_AERS4 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|142850117|gb|ABO88438.1| aspartate-ammonia ligase [Aeromonas salmonicida subsp. salmonicida A449] (330 aa)
Score = 687, Expect = 2.4e-70, Identities = 144/308 (46%), Positives = 194/308 (62%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           + +Q+ I F+K++F   LA  L L  V AP++     G  D+L+GSEN V        G S E+  SLAKWKR  LG++     EGIY  M A+R DE  L+ IHS+YVDQWDWE  +    R+L  L+  V+ I+  I+  ++ V  ++E      LP EI F+ SE LL RYP+   K RER IA +  AVF+IGIG  LS G+ HD+RAPDYDDW          LNGDI+VWN   + + E+SSMGIRVD  +L  QL  + +  R + D+H+ L+ +  P +IGGGIGQSRL   LL K+HIG+VQ  +WP ++
  S:     6 IRSQQQISFVKEMFSRQLAQQLGLMEVQAPILSRVGDGTQDNLSGSENAVQVKVKTLPGHSYEVVHSLAKWKRQTLGRFGFGPGEGIYTHMKALRPDEDKLTPIHSVYVDQWDWEKVMPSERRDLAYLQETVRGIWAAIKATERAVCAEHE--LTPFLPGEIQFLHSEALLARYPDLDAKGRERAIAKELGAVFLIGIGGALSHGERHDVRAPDYDDWSSHSELGLAGLNGDILVWNPVLEDSFEISSMGIRVDAEALRRQLAITGDEGRLQYDWHRDLLAERMPQTIGGGIGQSRLAMLLLQKEHIGQVQVGVWPSEM 322
>gi|77958198|ref|ZP_00822236.1| COG2502: Asparagine synthetase A [Yersinia bercovieri ATCC 43970] (330 aa)
Score = 686, Expect = 3.2e-70, Identities = 145/302 (48%), Positives = 189/302 (62%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           F+K  F   L   L L  V AP++     G  D+L+GSE  V          + E+  SLAKWKR  LG+++    +G+Y  M A+R DE  LS+IHS+YVDQWDWE  +   ERNL  LK  V KIY  I+  + E     E+  +  LPE+I F+ SE L  R+P+   K RER IA +  AVF+IGIG  L+DG+ HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  + +  R +L++H+ L+N E P +IGGGIGQSRL   LL +QHIG+VQ  +W  +I E
  S:    14 FVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQDNLSGSEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGRFDFGADQGLYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIK--ETEATVSAEFGIKPFLPEQIHFVHSETLRSRFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWTSPCAEGFTGLNGDIIVWNPVLEDAFEISSMGIRVDAEALKRQLALTADEDRLKLEWHQSLLNGEMPQTIGGGIGQSRLVMLLLQQQHIGQVQCGVWGPEISE 324
>gi|77961828|ref|ZP_00825658.1| COG2502: Asparagine synthetase A [Yersinia mollaretii ATCC 43969] (330 aa)
Score = 686, Expect = 3.3e-70, Identities = 145/303 (47%), Positives = 191/303 (63%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEE 317
           F+K  F   L   L L  V AP++     G  D+L+GSE  V          + E+  SLAKWKR  LG+++    +GIY  M A+R DE  LS+IHS+YVDQWDWE  +   ERNL  LK  V KIY  I+  +  V+   E+  +  LPE+I F+ SE L  R+P+   K RER IA +  AVF+IGIG  L+DG+ HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  + +  R +L++H+ L+N E P +IGGGIGQSRL   LL +QHIG+VQ  +W  ++ E+
  S:    14 FVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQDNLSGSEKAVQVKVKSLPDATFEVVHSLAKWKRKTLGRFDFGADQGIYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAVSA--EFGIKPFLPEQIHFVHSETLRSRFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWTSPSAEGFAGLNGDIIVWNPVLEDAFEISSMGIRVDAEALKRQLALTADEDRLKLEWHQSLLNGEMPQTIGGGIGQSRLVMLLLQQQHIGQVQCGVWGPEVSEK 325
>gi|161505597|ref|YP_001572709.1| asparagine synthetase AsnA [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866944|gb|ABX23567.1| hypothetical protein SARI_03773 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (350 aa)
Score = 686, Expect = 3.5e-70, Identities = 144/307 (46%), Positives = 187/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LPE I F+ S+DLL RYP+   K RER I     AVF++GIG  LSDGK HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:    29 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPERIHFVHSQDLLSRYPDLDAKGRERAIVKALGAVFLVGIGGTLSDGKRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLQLTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 344
>gi|16120356|ref|NP_403669.1| asparagine synthetase AsnA [Yersinia pestis CO92] >gi|22123925|ref|NP_667348.1| asparagine synthetase AsnA [Yersinia pestis KIM] >gi|45439868|ref|NP_991407.1| asparagine synthetase AsnA [Yersinia pestis biovar Microtus str. 91001] >gi|51594362|ref|YP_068553.1| asparagine synthetase AsnA [Yersinia pseudotuberculosis IP 32953] >gi|108806001|ref|YP_649917.1| asparagine synthetase AsnA [Yersinia pestis Antiqua] >gi|108810169|ref|YP_645936.1| asparagine synthetase AsnA [Yersinia pestis Nepal516] >gi|145601140|ref|YP_001165216.1| asparagine synthetase AsnA [Yersinia pestis Pestoides F] >gi|150260933|ref|ZP_01917661.1| aspartate-ammonia ligase [Yersinia pestis CA88-4125] >gi|153947913|ref|YP_001399007.1| asparagine synthetase AsnA [Yersinia pseudotuberculosis IP 31758] >gi|162419901|ref|YP_001604648.1| asparagine synthetase AsnA [Yersinia pestis Angola] >gi|165926130|ref|ZP_02221962.1| aspartate--ammonia ligase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939984|ref|ZP_02228521.1| aspartate--ammonia ligase [Yersinia pestis biovar Orientalis str. IP275] >gi|166009615|ref|ZP_02230513.1| aspartate--ammonia ligase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213201|ref|ZP_02239236.1| aspartate--ammonia ligase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401540|ref|ZP_02307034.1| aspartate--ammonia ligase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422856|ref|ZP_02314609.1| aspartate--ammonia ligase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425564|ref|ZP_02317317.1| aspartate--ammonia ligase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468634|ref|ZP_02333338.1| aspartate--ammonia ligase [Yersinia pestis FV-1] >gi|170026418|ref|YP_001722923.1| aspartate--ammonia ligase [Yersinia pseudotuberculosis YPIII] >gi|186897456|ref|YP_001874568.1| aspartate--ammonia ligase [Yersinia pseudotuberculosis PB1/+] >gi|81691950|sp|Q66GH8|ASNA_YERPS Aspartate--ammonia ligase (Asparagine synthetase A) >gi|123073667|sp|Q1CNU4|ASNA_YERPN Aspartate--ammonia ligase (Asparagine synthetase A) >gi|123372786|sp|Q1CC50|ASNA_YERPA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166219936|sp|A4TSI1|ASNA_YERPP Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166988303|sp|A7FCM9|ASNA_YERP3 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|21263430|sp|Q8ZJT3|ASNA_YERPE Aspartate--ammonia ligase (Asparagine synthetase A) >gi|21956659|gb|AAM83599.1|AE013601_3 asparagine synthetase A [Yersinia pestis KIM] >gi|45434723|gb|AAS60284.1| aspartate-ammonia ligase [Yersinia pestis biovar Microtus str. 91001] >gi|51587644|emb|CAH19243.1| aspartate-ammonia ligase [Yersinia pseudotuberculosis IP 32953] >gi|108773817|gb|ABG16336.1| aspartate-ammonia ligase [Yersinia pestis Nepal516] >gi|108777914|gb|ABG11972.1| aspartate-ammonia ligase [Yersinia pestis Antiqua] >gi|115345835|emb|CAL18693.1| aspartate-ammonia ligase [Yersinia pestis CO92] >gi|145212836|gb|ABP42243.1| aspartate-ammonia ligase [Yersinia pestis Pestoides F] >gi|149290341|gb|EDM40418.1| aspartate-ammonia ligase [Yersinia pestis CA88-4125] >gi|152959408|gb|ABS46869.1| aspartate--ammonia ligase [Yersinia pseudotuberculosis IP 31758] >gi|162352716|gb|ABX86664.1| aspartate--ammonia ligase [Yersinia pestis Angola] >gi|165912110|gb|EDR30750.1| aspartate--ammonia ligase [Yersinia pestis biovar Orientalis str. IP275] >gi|165921990|gb|EDR39167.1| aspartate--ammonia ligase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991537|gb|EDR43838.1| aspartate--ammonia ligase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205499|gb|EDR49979.1| aspartate--ammonia ligase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958248|gb|EDR55269.1| aspartate--ammonia ligase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048922|gb|EDR60330.1| aspartate--ammonia ligase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055578|gb|EDR65371.1| aspartate--ammonia ligase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752952|gb|ACA70470.1| Aspartate--ammonia ligase [Yersinia pseudotuberculosis YPIII] >gi|186700482|gb|ACC91111.1| aspartate--ammonia ligase [Yersinia pseudotuberculosis PB1/+] (330 aa)
Score = 683, Expect = 6.9e-70, Identities = 147/305 (48%), Positives = 189/305 (61%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           F+K  F   L   L L  V AP++     G  D+L+GSE  V         S  E+  SLAKWKR  LG+++    +G+Y  M A+R DE  LS+IHS+YVDQWDWE  +   ERNL  LK  V KIY  I+  + E     E+  +  LP+ I FI SE L  R+P+   K RER IA +  AVF+IGIG  L+DG+ HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRVD  +L  QL  + +  R EL++H+ L+  E P +IGGGIGQSRL   LL KQHIG+VQ  +W  +I E+ +
  S:    14 FVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQDNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIK--ETEAAISAEFGVKPFLPDHIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWTSPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQSLLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVD 327
>gi|62182360|ref|YP_218777.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167554001|ref|ZP_02347743.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167560405|ref|ZP_02353408.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168234389|ref|ZP_02659447.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239648|ref|ZP_02664706.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168245188|ref|ZP_02670120.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263223|ref|ZP_02685196.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168823144|ref|ZP_02835144.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194449810|ref|YP_002047908.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472337|ref|ZP_03078321.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736421|ref|YP_002116820.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|75505458|sp|Q57HW6|ASNA_SALCH Aspartate--ammonia ligase (Asparagine synthetase A) >gi|62129993|gb|AAX67696.1| asparagine synthetase A [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|194408114|gb|ACF68333.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194458701|gb|EDX47540.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711923|gb|ACF91144.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (330 aa)
Score = 683, Expect = 7.0e-70, Identities = 143/307 (46%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LPE+I F+ S++LL RYP+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPEQIQFVHSQELLSRYPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|157373136|ref|YP_001481125.1| asparagine synthetase AsnA [Serratia proteamaculans 568] >gi|166988302|sp|A8GLK7|ASNA_SERP5 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|157324900|gb|ABV43997.1| Aspartate--ammonia ligase [Serratia proteamaculans 568] (330 aa)
Score = 681, Expect = 1.2e-69, Identities = 145/305 (47%), Positives = 186/305 (60%)
  Q:    15 FIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
            +K  F   L   L L  V AP++     G  D+L+GSE  V          + E+  SLAKWKR  LG Y+    EG+Y  M A+R DE  LS+IHS+YVDQWDWE  +   ER+ + L+  V+ IY  I+  + EV+++Y       LPE+I F+ SE LLQRYP    K RER IA +  AVF+IGIG  LS GK HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL ++ +  R  L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +W   + E  E
  S:    14 LVKSFFSRQLEQQLGLIEVQAPILSRLGDGTQDNLSGSEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGSYDFGAGEGLYTHMKALRPDEDRLSAIHSVYVDQWDWERVMGDGERSQDYLESTVRSIYAAIKATEGEVSREYG--LTPFLPEQIHFVHSETLLQRYPELDAKGRERAIAKELGAVFLIGIGGKLSHGKSHDVRAPDYDDWTTPAAEGLAGLNGDILVWNPVLQDAFELSSMGIRVDASALKRQLAQTGDEDRLALEWHQSLLRGEMPQTIGGGIGQSRLVMLLLQLSHIGQVQCGVWSPQVREAVE 327
>gi|157871075|ref|XP_001684087.1| asparagine synthetase a, putative; aspartate--ammonia ligase, putative [Leishmania major] >gi|68127155|emb|CAJ04936.1| asparagine synthetase a, putative; aspartate--ammonia ligase, putative [Leishmania major] (353 aa)
Score = 681, Expect = 1.2e-69, Identities = 141/308 (45%), Positives = 202/308 (65%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPV-TFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK------------------------------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           ++ Q  I  +K +F   LA+AL L +V  P++     G  D+L+G E  V     +  G + E+  SLAKWKRM LG ++ P+  GI+ +M+A+R +E+L SIHS+YVDQWDWE  I   +R LE L+  V+ +YE++R  ++ +  ++   A  +LP+ ITF+ +E LL+RYP   PK RE     ++ AVF+IGIG  LS G  HD RAPDYDDW                               LNGDI+V+N     ALELSSMGIRVD+ +L  QL+ +  + R +  +H+ ++N + P +IGGGIGQSR   F+L K+HIGEVQ S+WP ++
  S:     9 IDLQTRILRVKTIFAEELANALNLIQVEGPILARVGDGTQDNLSGVEKAVQVHVKEIPGENYEVVHSLAKWKRMTLGNHKFPVGRGIFTNMHALRVEETLDSIHSVYVDQWDWERVIAPADRCLEYLQATVRSLYEVLRETERRLCTEFPDIAP-ILPDSITFVHAEQLLKRYPELDPKSRELEAVKQFGAVFLIGIGCKLSHGDHHDARAPDYDDWSSPVSVDSSKIGFPTADDEKPSVNTIMSLQGLNGDILVYNPVLNDALELSSMGIRVDQEALRRQLEITGTSDRLKCRWHQCVLNGDLPQTIGGGIGQSRTVMFMLRKRHIGEVQCSVWPYEV 346
>gi|167546593|ref|ZP_02342157.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] (330 aa)
Score = 681, Expect = 1.3e-69, Identities = 143/307 (46%), Positives = 190/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V         S  E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LPE+I F+ S++LL R+P+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDSQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPEQIQFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|16767161|ref|NP_462776.1| asparagine synthetase AsnA [Salmonella typhimurium LT2] >gi|167994885|ref|ZP_02575975.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168464784|ref|ZP_02698676.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|21263431|sp|Q8ZKW4|ASNA_SALTY Aspartate--ammonia ligase (Asparagine synthetase A) >gi|16422452|gb|AAL22735.1| asparagine synthetase A [Salmonella typhimurium LT2] >gi|195632182|gb|EDX50666.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (330 aa)
Score = 680, Expect = 1.6e-69, Identities = 142/307 (46%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LPE+I F+ S++LL R+P+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPEQIQFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|157144380|ref|YP_001451699.1| asparagine synthetase AsnA [Citrobacter koseri ATCC BAA-895] >gi|157081585|gb|ABV11263.1| hypothetical protein CKO_00084 [Citrobacter koseri ATCC BAA-895] (350 aa)
Score = 680, Expect = 1.6e-69, Identities = 145/307 (47%), Positives = 188/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+E I+  +  V+K  E+     LPE+I F+ S++LL RYP+   K RER IA +  AVF++GIG  LSDGK HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R  L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:    29 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFATLKSTVEAIWEGIKATEAAVSK--EFGLAPFLPEQIHFVHSQELLARYPDLDAKGRERAIAKELGAVFLVGIGGKLSDGKRHDVRAPDYDDWSSASDLGHAGLNGDILVWNPVLEDAFELSSMGIRVDADALKRQLALTGDEDRLSLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 344
>gi|168223040|ref|ZP_02648272.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Agona str. SL483] (330 aa)
Score = 680, Expect = 1.7e-69, Identities = 143/307 (46%), Positives = 188/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LPE+I F+ S++LL RYP+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L +H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPEQIQFVHSQELLSRYPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLVWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|194444112|ref|YP_002043125.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194402775|gb|ACF62997.1| aspartate--ammonia ligase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (330 aa)
Score = 680, Expect = 1.8e-69, Identities = 143/307 (46%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LPE+I F+ S++LL RYP+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKLHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPEQIQFVHSQELLSRYPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|168228999|ref|ZP_02654230.1| hypothetical protein Sententeric_24728 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (330 aa)
Score = 679, Expect = 1.9e-69, Identities = 142/307 (46%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LP++I F+ S++LL RYP+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|16762449|ref|NP_458066.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143937|ref|NP_807279.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|21263429|sp|Q8Z2Q9|ASNA_SALTI Aspartate--ammonia ligase (Asparagine synthetase A) >gi|25293478|pir||AB0953 asparagine synthetase A [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504754|emb|CAD03118.1| asparagine synthetase A [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139573|gb|AAO71139.1| asparagine synthetase A [Salmonella enterica subsp. enterica serovar Typhi Ty2] (330 aa)
Score = 679, Expect = 2.3e-69, Identities = 141/307 (45%), Positives = 190/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LP++I F+ S++LL R+P+   K RER IA +  AVF++GIG  LSDG+ HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPDQIHFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGRRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|15639545|ref|NP_218995.1| asparagine synthetase AsnA [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025784|ref|YP_001933556.1| asparagine synthetase [Treponema pallidum subsp. pallidum SS14] >gi|21263421|sp|O83567|ASNA_TREPA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|3322850|gb|AAC26560.1| asparagine synthetase (asnA) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018359|gb|ACD70977.1| asparagine synthetase [Treponema pallidum subsp. pallidum SS14] (330 aa)
Score = 679, Expect = 2.3e-69, Identities = 146/315 (46%), Positives = 194/315 (61%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           S +  Q+ I F K  F   L   L L  V  PL+ +   GI D L+G E  V+ +     G + E+  SLAKWKR  L +Y    +EG++  M A+R DE  L  + S+ VDQWDWE  +    RNL  LK  V+K+Y  +R  +  V++++   A   LP +I F+ SE+L++RYP+   K RE  I  ++ AVF+IGIG  LSDGKPHD+RAPDYDDW          LNGDI+VWN     A E+SSMGIRVDE +L  QL  + +       +H+ LIN   P SIGGGIGQSRL   LL ++HIGEVQ+S+WP+ + EE E
  S:     4 SFILQQQGISFAKHTFTQKLMEHLGLIEVQGPLLSQVGDGIQDGLSGREKAVSVSVKQIPGTAFEVVHSLAKWKRHTLARYGFQDNEGLFVHMIALRPDEDFLDQVRSVCVDQWDWEKVVPVGSRNLAYLKDTVRKVYGALRESEVLVSERFGLRA--FLPADIVFVQSEELVRRYPHLDSKGREDAICKEHGAVFLIGIGGVLSDGKPHDVRAPDYDDWTTPSEGEYKGLNGDILVWNPVLGRAFEVSSMGIRVDEGALRTQLALTGDEDSLACSWHQDLINGRLPQSIGGGIGQSRLAMLLLQRKHIGEVQASVWPRSVREEFE 327
>gi|146313750|ref|YP_001178824.1| asparagine synthetase AsnA [Enterobacter sp. 638] >gi|166988300|sp|A4WGE3|ASNA_ENT38 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|145320626|gb|ABP62773.1| aspartate-ammonia ligase [Enterobacter sp. 638] (330 aa)
Score = 678, Expect = 2.4e-69, Identities = 145/305 (47%), Positives = 190/305 (62%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  L++IHS+YVDQWDWE  +   ER++ TLK  V+ IY  I+  +  V+K  E+     LP+ I FI S+DLL R+P+   K RER IA +  AVF+IGIG  LSDGK HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP+ +
  S:     9 QRQISFVKSHFSRQLEEKLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKTLPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLTAIHSVYVDQWDWERVMGDGERHVGTLKSTVEAIYAGIKATETAVSK--EFGLTPFLPDTIHFIHSQDLLSRFPDLDAKGRERAIAKELGAVFLIGIGGKLSDGKRHDVRAPDYDDWSTSGESERAGLNGDILVWNPILEDAFELSSMGIRVDADALKRQLAVTGDEDRLKLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLSHIGQVQCGVWPQQV 322
>gi|183597125|ref|ZP_02958618.1| hypothetical protein PROSTU_00364 [Providencia stuartii ATCC 25827] >gi|188023435|gb|EDU61475.1| hypothetical protein PROSTU_00364 [Providencia stuartii ATCC 25827] (330 aa)
Score = 676, Expect = 5.0e-69, Identities = 146/312 (46%), Positives = 190/312 (60%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           S +E Q+ I F+K  F   L   L L  V  P++     G  D+L+G E  V          + E+  SLAKWKR  LG+++    +G+Y  M A+R DE  L+ IHS+YVDQWDWE  +   ER L  LK  V KIY+ I+  Q E     E+     LP++I FI SE+LLQRYP+   K RER IA +  AVF+IGIG  LS+G+ HD+RAPDYDDW          LNGDIIVWN   + A E+SSMGIRV    L  QL  + +  R EL++H+ L+  + P +IGGGIGQSRL   LL +QHIG+VQ  +W  +  E
  S:     4 SFIEQQQQISFVKSYFSRLLEKELGLIEVQGPILSRLGDGTQDNLSGHEKAVQVKVKSIPDATFEVVHSLAKWKRKTLGRFDFKQGQGLYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMADEERTLPYLKQTVGKIYQAIK--QTEAAISSEFGLAPFLPDQIHFIHSEELLQRYPDLDAKGRERAIAKELGAVFLIGIGGKLSNGEAHDVRAPDYDDWTTENEDGFKGLNGDIIVWNPVLQDAFEISSMGIRVSPECLTRQLSLTGDEKRMELEWHQALVEGKMPQTIGGGIGQSRLVMLLLQRQHIGQVQCGVWSPETRE 324
>gi|56415745|ref|YP_152820.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161617000|ref|YP_001590965.1| asparagine synthetase AsnA [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|81678013|sp|Q5PJY0|ASNA_SALPA Aspartate--ammonia ligase (Asparagine synthetase A) >gi|189046376|sp|A9MXC1|ASNA_SALPB Aspartate--ammonia ligase (Asparagine synthetase A) >gi|56130002|gb|AAV79508.1| asparagine synthetase A [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161366364|gb|ABX70132.1| hypothetical protein SPAB_04821 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (330 aa)
Score = 676, Expect = 5.1e-69, Identities = 141/307 (45%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  + EV+K++       LP++I F+ S++LL R+P+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPDQIHFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|94967607|ref|YP_589655.1| asparagine synthetase AsnA [Acidobacteria bacterium Ellin345] >gi|94549657|gb|ABF39581.1| aspartate-ammonia ligase [Acidobacteria bacterium Ellin345] (379 aa)
Score = 675, Expect = 7.0e-69, Identities = 146/319 (45%), Positives = 203/319 (63%)
  Q:     8 ETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGIND--DLNGSENPVTF----TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENL---LPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDW-------------KLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           +TQKAI  +K   + +L   L L   + PL+++   G+ND  D +GS  P+TF      D + I  ++ Q+  KWKRM L ++++   EG+  DM+A+RKD  L   HS+YVDQWDWE  I   +R+LE LK +V KI+ +I   ++    K+    +     LPE++TF+ +ED+L+ YP+   K+RE +I  KY AVFIIGIG  L DG PH++RA DYDDW              LNGDI+VWN  TK   ELSSMGIRV+  +L +QL  +N        +HK +++   P SIGGGIGQSR    +L K H+GEV  S+WPK + E   K NI +L
  S:    38 QTQKAIYAVKTYIEEHLCQELNLIMTSVPLIVDMESGVNDYLDRDGSRTPITFHIPNDHDVHPIDAQVVQAATKWKRMALKQFDMKPGEGLCTDMHAVRKDYFLDHDHSVYVDQWDWERTITAQQRSLEFLKTIVSKIWTVIVGAERFALNKFPELNDPRCPKLPEKLTFLHAEDILEMYPDLPRKQRETMILQKYPAVFIIGIGWTLKDGYPHEMRAADYDDWVTETESAEGKMMHGLNGDILVWNPVTKRRHELSSMGIRVNAETLKQQLKATNQEHFLNFPYHKAILDGTIPLSIGGGIGQSRTLMQILRKAHLGEVTVSVWPKILKEICAKKNIFVL 378
>gi|146089599|ref|XP_001470424.1| asparagine synthetase a, putative; aspartate--ammonia ligase, putative [Leishmania infantum] >gi|134070457|emb|CAM68799.1| asparagine synthetase a, putative; aspartate--ammonia ligase, putative [Leishmania infantum] (353 aa)
Score = 674, Expect = 8.4e-69, Identities = 140/308 (45%), Positives = 197/308 (63%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPV-TFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK------------------------------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           ++ Q  I  +K +F   LA AL L +V  P++     G  D+L+G E  V     +  G + E+  SLAKWKRM LG +  P+  GI+ +M A+R +E+L +IHS+YVDQWDWE  I   +R LE L+  V+ +YE++R  +  +  ++   A  +LP+ I F+ +E LL+RYP   PK RER    K  AVF+IGIG  LS G  HD+RAPDYDDW                               LNGDI+V+N      LELSSMGIRVD+ +L  QL+ +  + R +  +H+ ++N + P +IGGGIGQSR   F+L K+HIGEVQ S+WP ++
  S:     9 IDLQTRILRVKTIFAEELASALNLIQVECPMLACVGDGTQDNLSGVEKAVQVHVKEIPGANYEVVHSLAKWKRMTLGNHRFPVGRGIFTNMRALRVEETLDNIHSVYVDQWDWERVIAPADRCLEYLQATVRSLYEVLRETESRLCTEFPDIAP-ILPDSIKFVHTEQLLKRYPELDPKSREREAVKKLGAVFLIGIGCKLSHGDHHDVRAPDYDDWSSPVSVDSSKIGFPTADDEKPSVNTIMSLQGLNGDILVYNPVLDDVLELSSMGIRVDQEALRRQLEITGTSDRLQCRWHQCVLNGDLPQTIGGGIGQSRTVMFMLRKRHIGEVQCSVWPHEV 346
>gi|170767060|ref|ZP_02901513.1| aspartate--ammonia ligase [Escherichia albertii TW07627] >gi|170124498|gb|EDS93429.1| aspartate--ammonia ligase [Escherichia albertii TW07627] (330 aa)
Score = 672, Expect = 1.2e-68, Identities = 143/307 (46%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP    K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R EL++H+ L+  E P +IGGGIGQSRL   LL  QHIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDDERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPGLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLQHIGQVQCGVWPTQVRE 324
>gi|168478078|ref|ZP_02707101.1| hypothetical protein Salmoentericaenterica_25806 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (330 aa)
Score = 672, Expect = 1.4e-68, Identities = 140/307 (45%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   +LK  V+ I+  I+  + EV+K++       LP++I F+ S++LL R+P+   K RER IA +  AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L+ QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSSLKSTVEAIWAGIKATEAEVHKQFG--LAPFLPDQIHFVHSQELLARFPDLDAKGRERAIAKELGAVFLVGIGGKLSDGHRHDVRAPDYDDWSSASELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLMRQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAQVRE 324
>gi|24115047|ref|NP_709557.1| asparagine synthetase AsnA [Shigella flexneri 2a str. 301] >gi|30064951|ref|NP_839122.1| asparagine synthetase AsnA [Shigella flexneri 2a str. 2457T] >gi|110807568|ref|YP_691088.1| asparagine synthetase AsnA [Shigella flexneri 5 str. 8401] >gi|122957078|sp|Q0SYT2|ASNA_SHIF8 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|47115768|sp|Q83PJ4|ASNA_SHIFL Aspartate--ammonia ligase (Asparagine synthetase A) >gi|24054307|gb|AAN45264.1| asparagine synthetase A [Shigella flexneri 2a str. 301] >gi|30043212|gb|AAP18933.1| asparagine synthetase A [Shigella flexneri 2a str. 2457T] >gi|110617116|gb|ABF05783.1| asparagine synthetase A [Shigella flexneri 5 str. 8401] (330 aa)
Score = 672, Expect = 1.4e-68, Identities = 143/307 (46%), Positives = 187/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER L TLK  V+ I+  I+  +  VN+  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQLSTLKSTVEAIWAGIKATEAAVNE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|152972653|ref|YP_001337799.1| asparagine synthetase AsnA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166219928|sp|A6TG48|ASNA_KLEP7 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|150957502|gb|ABR79532.1| asparagine synthetase AsnA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (330 aa)
Score = 671, Expect = 1.6e-68, Identities = 143/307 (46%), Positives = 189/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  L+ IHS+YVDQWDWE  +   ER++ TLK  V+ IY  I+  +  V++  E+     LPE+I F+ S++LL RYP    K RER IA +  AVF+IGIG  L+DGK HD+RAPDYDDW          LNGDI+VWN   + A E+SSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEEKLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKTLPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLTPIHSVYVDQWDWERVMGDEERHVGTLKATVEAIYAGIKATELAVSQ--EFGLTPFLPEQIHFVHSQELLSRYPELDAKGRERAIAKELGAVFLIGIGGKLADGKRHDVRAPDYDDWSTEVSEGFAGLNGDILVWNPVLEDAFEISSMGIRVDAEALKRQLALTGDEDRLKLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLDHIGQVQCGVWPAQVRE 324
>gi|117618980|ref|YP_858493.1| asparagine synthetase AsnA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560387|gb|ABK37335.1| aspartate--ammonia ligase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (370 aa)
Score = 671, Expect = 1.7e-68, Identities = 142/308 (46%), Positives = 192/308 (62%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           + +Q+ I F+K++F   LA  L L  V AP++     G  D+L+G EN V          S E+  SLAKWKR  LG++     EGIY  M A+R DE  L+ IHS+YVDQWDWE  +    R+L  L+  V+ I+  I+  ++ V  ++E      LP EI F+ SE+LL RYP+   K RER IA +  AVF+IGIG  LS G+ HD+RAPDYDDW          LNGDI+VWN   + + E+SSMGIRVD  +L  QL  + +  R + D+H+ L+    P +IGGGIGQSRL   LL K+HIG+VQ  +WP ++
  S:    46 IRSQQQISFVKEMFSRQLAQQLGLMEVQAPILSRVGDGTQDNLSGHENAVQVKVKTLPEHSYEVVHSLAKWKRQTLGRFGFGPGEGIYTHMKALRPDEDRLTPIHSVYVDQWDWEKVMPSERRDLAYLQETVRGIWAAIKATERAVCAEHE--LTPFLPAEIQFLHSEELLTRYPDLDAKGRERAIAKELGAVFLIGIGGALSHGERHDVRAPDYDDWSSHSELGLAGLNGDILVWNPVLQDSFEISSMGIRVDAEALRRQLAITGDEDRLQYDWHQDLLAARMPQTIGGGIGQSRLAMLLLQKEHIGQVQVGVWPAEM 362
>gi|119472961|ref|ZP_01614817.1| asparagine synthetase AsnA [Alteromonadales bacterium TW-7] >gi|119444630|gb|EAW25940.1| asparagine synthetase AsnA [Alteromonadales bacterium TW-7] (331 aa)
Score = 670, Expect = 2.2e-68, Identities = 147/304 (48%), Positives = 194/304 (63%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHI-KKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLW 310
           ++ Q  I  +K  F   L   L L  V AP++ +   G  D+L+G EN V         S  E+  SLAKWKR  LG+Y     EG+Y  M A+R DE SLS IHS+YVDQWDWE  I + TER+L TLK  V+ IY+ I+  ++ V++ +    +  LP +I F+ SE+L + YP+ T K RE+ IA KY AVF+IGIG  L DG+ HD+RAPDYDDW          LNGDI+VWN   + + E+SSMGIRV    L  QL  + ++ R +LD+HK L+  +FP +IGGGIGQSRL   LL K HIG+VQ  +W
  S:     6 VQQQLQISSVKQFFSRQLEKQLGLVEVQAPILAKVGDGTQDNLSGHENAVAVNVKAIADSQYEVVHSLAKWKRKTLGEYGFSKGEGLYTQMKALRPDEESLSPIHSVYVDQWDWEKVICESTERSLTTLKRTVESIYKGIKETEQFVSEHFS--LDPFLPSDIQFVHSEELRKIYPDLTAKNREKAIAKKYGAVFLIGIGGQLGDGQIHDVRAPDYDDWSTPTSEQYIGLNGDILVWNPILEDSFEISSMGIRVSPEVLKTQLRITGDDDRLQLDWHKALLKSQFPQTIGGGIGQSRLAMLLLQKGHIGQVQVGVW 319
>gi|91213271|ref|YP_543257.1| asparagine synthetase AsnA [Escherichia coli UTI89] >gi|117626015|ref|YP_859338.1| asparagine synthetase AsnA [Escherichia coli APEC O1] >gi|122421806|sp|Q1R4I8|ASNA_ECOUT Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166219924|sp|A1AHS4|ASNA_ECOK1 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|91074845|gb|ABE09726.1| asparagine synthetase A [Escherichia coli UTI89] >gi|115515139|gb|ABJ03214.1| asparagine synthetase AsnA [Escherichia coli APEC O1] (330 aa)
Score = 670, Expect = 2.6e-68, Identities = 143/307 (46%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+E I+  +  V++  E+     LP++I F+ S++LL RYP    K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R EL++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWEGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPELDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|4139528|pdb|11AS|A Chain A, Asparagine Synthetase Mutant C51a, C315a Complexed With L- Asparagine >gi|4139530|pdb|11AS|B Chain B, Asparagine Synthetase Mutant C51a, C315a Complexed With L- Asparagine >gi|4139532|pdb|12AS|A Chain A, Asparagine Synthetase Mutant C51a, C315a Complexed With L- Asparagine And Amp >gi|4139534|pdb|12AS|B Chain B, Asparagine Synthetase Mutant C51a, C315a Complexed With L- Asparagine And Amp (330 aa)
Score = 669, Expect = 3.2e-68, Identities = 142/307 (46%), Positives = 188/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G+E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R EL++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ+ +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGVWPAAVRE 324
>gi|187730769|ref|YP_001882419.1| aspartate--ammonia ligase [Shigella boydii CDC 3083-94] >gi|187427761|gb|ACD07035.1| aspartate--ammonia ligase [Shigella boydii CDC 3083-94] (330 aa)
Score = 667, Expect = 4.8e-68, Identities = 141/307 (45%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEECLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|16131612|ref|NP_418200.1| asparagine synthetase A [Escherichia coli str. K-12 substr. MG1655] >gi|89110263|ref|AP_004043.1| asparagine synthetase A [Escherichia coli W3110] >gi|110644085|ref|YP_671815.1| asparagine synthetase AsnA [Escherichia coli 536] >gi|157163226|ref|YP_001460544.1| asparagine synthetase AsnA [Escherichia coli HS] >gi|170022219|ref|YP_001727173.1| aspartate--ammonia ligase [Escherichia coli ATCC 8739] >gi|170083245|ref|YP_001732565.1| asparagine synthetase A [Escherichia coli str. K12 substr. DH10B] >gi|188496073|ref|ZP_03003343.1| aspartate--ammonia ligase [Escherichia coli 53638] >gi|191170592|ref|ZP_03032145.1| aspartate--ammonia ligase [Escherichia coli F11] >gi|114262|sp|P00963|ASNA_ECOLI Aspartate--ammonia ligase (Asparagine synthetase A) >gi|123343407|sp|Q0TAW5|ASNA_ECOL5 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|166988299|sp|A8A6K7|ASNA_ECOHS Aspartate--ammonia ligase (Asparagine synthetase A) >gi|189046374|sp|B1IWZ4|ASNA_ECOLC Aspartate--ammonia ligase (Asparagine synthetase A) >gi|147026|gb|AAA24248.1| asparagine synthetase A [Escherichia coli] >gi|147033|gb|AAA24253.1| asparagine synthetase A [Escherichia coli] >gi|290593|gb|AAA62096.1| asparagine synthetase A >gi|1790183|gb|AAC76767.1| asparagine synthetase A [Escherichia coli str. K-12 substr. MG1655] >gi|85676294|dbj|BAE77544.1| asparagine synthetase A [Escherichia coli W3110] >gi|110345677|gb|ABG71914.1| aspartate-ammonia ligase [Escherichia coli 536] >gi|157068906|gb|ABV08161.1| aspartate--ammonia ligase [Escherichia coli HS] >gi|169757147|gb|ACA79846.1| Aspartate--ammonia ligase [Escherichia coli ATCC 8739] >gi|169891080|gb|ACB04787.1| asparagine synthetase A [Escherichia coli str. K12 substr. DH10B] >gi|188491272|gb|EDU66375.1| aspartate--ammonia ligase [Escherichia coli 53638] >gi|190909400|gb|EDV68986.1| aspartate--ammonia ligase [Escherichia coli F11] (330 aa)
Score = 667, Expect = 5.3e-68, Identities = 142/307 (46%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R EL++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|40998|emb|CAA23512.1| asparagine synthetase A [Escherichia coli] (330 aa)
Score = 666, Expect = 6.2e-68, Identities = 142/307 (46%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R EL++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEIPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|194431155|ref|ZP_03063448.1| aspartate--ammonia ligase [Shigella dysenteriae 1012] >gi|194420610|gb|EDX36686.1| aspartate--ammonia ligase [Shigella dysenteriae 1012] (330 aa)
Score = 666, Expect = 6.8e-68, Identities = 141/307 (45%), Positives = 185/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R  L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSCQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLHLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|15804344|ref|NP_290383.1| asparagine synthetase AsnA [Escherichia coli O157:H7 EDL933] >gi|15833940|ref|NP_312713.1| asparagine synthetase AsnA [Escherichia coli O157:H7 str. Sakai] >gi|26250490|ref|NP_756530.1| asparagine synthetase AsnA [Escherichia coli CFT073] >gi|82779064|ref|YP_405413.1| asparagine synthetase AsnA [Shigella dysenteriae Sd197] >gi|168709497|ref|ZP_02741774.1| asparagine synthetase AsnA [Escherichia coli O157:H7 str. EC4045] >gi|168716581|ref|ZP_02748858.1| asparagine synthetase AsnA [Escherichia coli O157:H7 str. EC4206] >gi|168736745|ref|ZP_02769022.1| asparagine synthetase AsnA [Escherichia coli O157:H7 str. EC4115] >gi|168752412|ref|ZP_02777434.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4113] >gi|168753646|ref|ZP_02778653.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4401] >gi|168765050|ref|ZP_02790057.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4501] >gi|168777890|ref|ZP_02802897.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4196] >gi|168780648|ref|ZP_02805655.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4076] >gi|168786587|ref|ZP_02811594.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC869] >gi|168790954|ref|ZP_02815961.1| asparagine synthetase AsnA [Escherichia coli O157:H7 str. EC4042] >gi|168800969|ref|ZP_02825976.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC508] >gi|195936371|ref|ZP_03081753.1| asparagine synthetase AsnA [Escherichia coli O157:H7 str. EC4024] >gi|123561169|sp|Q329T3|ASNA_SHIDS Aspartate--ammonia ligase (Asparagine synthetase A) >gi|54036768|sp|P63624|ASNA_ECO57 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|54040837|sp|P63623|ASNA_ECOL6 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|12518604|gb|AAG58947.1|AE005606_3 asparagine synthetase A [Escherichia coli O157:H7 EDL933] >gi|26110920|gb|AAN83104.1|AE016769_219 Aspartate--ammonia ligase [Escherichia coli CFT073] >gi|13364161|dbj|BAB38109.1| asparagine synthetase A [Escherichia coli O157:H7 str. Sakai] >gi|81243212|gb|ABB63922.1| asparagine synthetase A [Shigella dysenteriae Sd197] >gi|187766971|gb|EDU30815.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4196] >gi|188013732|gb|EDU51854.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4113] >gi|189001572|gb|EDU70558.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4076] >gi|189359367|gb|EDU77786.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4401] >gi|189365069|gb|EDU83485.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC4501] >gi|189373229|gb|EDU91645.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC869] >gi|189376795|gb|EDU95211.1| aspartate--ammonia ligase [Escherichia coli O157:H7 str. EC508] (330 aa)
Score = 664, Expect = 1.1e-67, Identities = 141/307 (45%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|193063804|ref|ZP_03044891.1| aspartate--ammonia ligase [Escherichia coli E22] >gi|194428090|ref|ZP_03060634.1| aspartate--ammonia ligase [Escherichia coli B171] >gi|192930519|gb|EDV83126.1| aspartate--ammonia ligase [Escherichia coli E22] >gi|194413848|gb|EDX30126.1| aspartate--ammonia ligase [Escherichia coli B171] (330 aa)
Score = 664, Expect = 1.2e-67, Identities = 141/307 (45%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEERLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|74314230|ref|YP_312649.1| asparagine synthetase AsnA [Shigella sonnei Ss046] >gi|194435616|ref|ZP_03067719.1| aspartate--ammonia ligase [Escherichia coli 101-1] >gi|123615768|sp|Q3YVP8|ASNA_SHISS Aspartate--ammonia ligase (Asparagine synthetase A) >gi|73857707|gb|AAZ90414.1| asparagine synthetase A [Shigella sonnei Ss046] >gi|194425159|gb|EDX41143.1| aspartate--ammonia ligase [Escherichia coli 101-1] (330 aa)
Score = 664, Expect = 1.3e-67, Identities = 141/307 (45%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|90408222|ref|ZP_01216389.1| asparagine synthetase AsnA [Psychromonas sp. CNPT3] >gi|90310668|gb|EAS38786.1| asparagine synthetase AsnA [Psychromonas sp. CNPT3] (333 aa)
Score = 663, Expect = 1.4e-67, Identities = 141/306 (46%), Positives = 200/306 (65%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG---EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHI-KKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPK 312
           ++TQ+ I  +K +F + L + L L  V AP++ +   GI D L+GSE  V        +S    E+  SLAKWKR  L ++   + +G+Y  M A+R DE SLS IHS+YVDQWDWE  I +K +R+++ LK  V  +Y+ I+  +  + + Y       LPE+ITF+ S+DLL +YP+   K RER    ++ AVF+IGIG  LS+G+ HD+RAPDYDDW          LNGDI+VWN   K   E+SSMGIRV   +L +QL+   +++R ++ +HK L+  + P +IGGGIGQSRL   LL KQHIG+VQ  +WP+
  S:     6 IQTQQQISTVKQIFSMQLENELGLIEVQAPILAKVGDGIQDSLSGSEKAVAVKVSSLPVSDQNFEVVHSLAKWKRKTLAEHNFQIGQGLYTHMKALRPDEESLSPIHSVYVDQWDWEAVISEKEDRSIDFLKRTVNTLYQAIKKTESRLQELYA--LTPFLPEKITFMHSQDLLDQYPDLDSKGRERAAVKEFGAVFLIGIGGLLSNGEFHDVRAPDYDDWSTQTDAKYPGLNGDILVWNPILKDVFEISSMGIRVSPDALKKQLEICGDSARLQMPWHKMLVESKLPQTIGGGIGQSRLAMLLLQKQHIGQVQVGVWPE 323
>gi|157156517|ref|YP_001465234.1| asparagine synthetase AsnA [Escherichia coli E24377A] >gi|191169198|ref|ZP_03030954.1| aspartate--ammonia ligase [Escherichia coli B7A] >gi|166988298|sp|A7ZTV5|ASNA_ECO24 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|157078547|gb|ABV18255.1| aspartate--ammonia ligase [Escherichia coli E24377A] >gi|190900771|gb|EDV60564.1| aspartate--ammonia ligase [Escherichia coli B7A] (330 aa)
Score = 663, Expect = 1.5e-67, Identities = 141/307 (45%), Positives = 186/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEERLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|170683630|ref|YP_001746074.1| aspartate--ammonia ligase [Escherichia coli SMS-3-5] >gi|170521348|gb|ACB19526.1| aspartate--ammonia ligase [Escherichia coli SMS-3-5] (330 aa)
Score = 661, Expect = 2.9e-67, Identities = 141/307 (45%), Positives = 185/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYPN   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +W   + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMADGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPNLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGYAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWSAAVRE 324
>gi|72390882|ref|XP_845735.1| asparagine synthetase a, putative [Trypanosoma brucei TREU927] >gi|62175833|gb|AAX69960.1| asparagine synthetase a, putative [Trypanosoma brucei] >gi|70802271|gb|AAZ12176.1| asparagine synthetase a, putative [Trypanosoma brucei] (351 aa)
Score = 660, Expect = 3.1e-67, Identities = 145/305 (47%), Positives = 196/305 (64%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK----------------------------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           Q+ I  +K  F   L   L L  V AP++     G  D+L+G E  V          S E+  SLAKWKR  L  Y+     G+Y  M A+R D+ L +IHS+ VDQWDWE+ +K  +RNL  LK VV K+Y  IR  +  V +KY+   + +LPE I F+ +E LL  YPN T KERER IA +Y AVF+IGIG  LS G  HD RAPDYDDW                             LNGDI+++N T   +LE+SSMGIRV+  +L  Q+  + ++S  + ++H++L+N EFP ++GGGIGQSR+  F+L K+HIGEVQ S+WP++I
  S:    13 QEQILTVKRSFSEALEKELNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYK--QKPILPETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLYNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCSVWPEEI 344
>gi|66356322|ref|XP_625302.1| asparagine synthetase A (AsnA) like protein [Cryptosporidium parvum Iowa II] >gi|46226273|gb|EAK87293.1| asparagine synthetase A (AsnA) like protein [Cryptosporidium parvum Iowa II] (343 aa)
Score = 659, Expect = 4.6e-67, Identities = 151/298 (50%), Positives = 200/298 (67%)
  Q:    13 IKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHI------KKTERNLETLKVVVKKIYEIIRL---CQKEVNKKYEWFAEN-LLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLW 310
           I+FIK  FQ  L  +L L R++APL LE+  G+NDDL+G E  V+FT +   +  EI QSLAKWKR  L KYE+    G+YADMNAIRK E L ++HSIYVDQWDWE+ I       K E  ++  +++   IY + RL    +KE         EN ++ +E+  ISSE+LL  YPN +  +RER I  KY +VFI  IG  LS+   HDLRAPDYDDW+ NGD+I W+      +ELSSMG+RV++ SL++QL+  N+  R +L + K L+N E P +IGGGIGQSRLC  +L K+HI +VQ S W
  S:    23 IEFIKITFQQLLKESLDLIRISAPLFLEKESGLNDDLSGYEEKVSFTFNNKVL--EIVQSLAKWKRYALKKYEL---NGLYADMNAIRKSEELDNLHSIYVDQWDWEMVIDTNKGKTKDEILVDIARIIHNNIYNLERLYWNMKKEKQDIVNIPNENEMIKKELYIISSEELLNMYPNLSSNDREREICKKYGSVFIKQIGKKLSNNTVHDLRAPDYDDWEYNGDLIYWSNILNGPIELSSMGVRVNKESLIKQLEICNSTERLKLPYCKMLLNNELPETIGGGIGQSRLCMLILRKEHISQVQCSYW 325
>gi|88861115|ref|ZP_01135749.1| asparagine synthetase AsnA [Pseudoalteromonas tunicata D2] >gi|88816837|gb|EAR26658.1| asparagine synthetase AsnA [Pseudoalteromonas tunicata D2] (331 aa)
Score = 656, Expect = 9.1e-67, Identities = 142/309 (45%), Positives = 190/309 (61%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFT-SDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHI-KKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDIL 315
           ++TQ+ I   K LF   L   L L  V APL+ +   GI D+L+G E  V            E+  SLAKWKR  L  +   + EG+Y +M A+R DE  L+ IHS+YVDQWDWE  I  +TER+L  LK  V+ IY+ I+  + ++   Y       LP+ I F+ +E L + YP  + KERE+ +A ++ AVF+IGIG  LSDG  HD+RAPDYDDW          LNGDI+VWN       E+SSMGIRVD  +L  QL  + +  R    +H++L+  + P +IGGGIGQSRL   LL KQHIGEVQ  +WP ++L
  S:     6 IQTQQQISKAKALFATQLESKLGLIEVQAPLLAQVGNGIQDNLSGHEQAVAVKIKTMPDAQYEVVHSLAKWKRKTLADHGFSVGEGLYTNMKALRPDEDKLTPIHSVYVDQWDWEKVICIETERSLSFLKTTVETIYQSIKATELQLATLYG--LTPFLPQHIQFVHAEQLARDYPALSGKEREQKVAKEFGAVFLIGIGGQLSDGAIHDVRAPDYDDWSTATCEQFSGLNGDILVWNPILNDVFEISSMGIRVDAKALQHQLAITGDEDRLAFAWHQQLLADKLPQTIGGGIGQSRLVMLLLQKQHIGEVQVGIWPDEVL 324
>gi|82546096|ref|YP_410043.1| asparagine synthetase AsnA [Shigella boydii Sb227] >gi|123558243|sp|Q31UP3|ASNA_SHIBS Aspartate--ammonia ligase (Asparagine synthetase A) >gi|81247507|gb|ABB68215.1| asparagine synthetase A [Shigella boydii Sb227] (330 aa)
Score = 653, Expect = 2.3e-66, Identities = 140/307 (45%), Positives = 185/307 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RY +   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMGIRVD  +L  QL  + +  R +L++H+ L+  E P +IGGGIGQSRL   LL   HIG+VQ  +WP  + E
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYLDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRE 324
>gi|123471797|ref|XP_001319096.1| hypothetical protein TVAG_340510 [Trichomonas vaginalis G3] >gi|121901871|gb|EAY06873.1| hypothetical protein TVAG_340510 [Trichomonas vaginalis G3] (318 aa)
Score = 651, Expect = 4.3e-66, Identities = 144/302 (47%), Positives = 198/302 (65%)
  Q:     9 TQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWEL-HIKKTERNLETLKVVVKKIY----EIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLW 310
           T + I++IK  F   L   L   RV++P+ LE++ G+NDDLNG E  V+FT  G  +  E+ QSLAKWKR+ L KY I   + +YADMNAIRKDE++   HS+YVDQWDWE+   +  E  +E +  +   IY    E+++     ++ + E   + ++P+ ITFI+SE L ++YPN + +ERE  IA  +KAVFI  IG  L DG  HD RAPDYDDW  NGDII W++    +LE+SSMG RV++ +LV QL K +   R E  + K ++N E P +IGGGIGQSRLC  L+ ++HI EVQS  W
  S:    10 TLEEIEYIKYAFPRLLKERLGFIRVSSPIFLEKSSGLNDDLNGVEEKVSFTHKGKVM--EVVQSLAKWKRVALKKYNI---KALYADMNAIRKDENVDKTHSMYVDQWDWEMVEEQGPEHVVEVVNTIHSCIYDLETELLKFMYPNISDE-ELENKKIIPKTITFITSEALRKKYPNISARERENKIAKLHKAVFIQQIGKELGDGSIHDSRAPDYDDWDNNGDIIYWSDALNESLEISSMGYRVNKDTLVPQLQKVHAVDRLENPYCKMIMNDELPQTIGGGIGQSRLCMLLMQRKHISEVQSGYW 310
>gi|154339249|ref|XP_001562316.1| asparagine synthetase a, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134062899|emb|CAM39346.1| asparagine synthetase a, putative; aspartate--ammonia ligase, putative [Leishmania braziliensis] (353 aa)
Score = 650, Expect = 4.5e-66, Identities = 137/304 (45%), Positives = 195/304 (64%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPV-TFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK------------------------------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLW 310
           ++ Q  I  +K +F   LA+AL L +V  P++     G  D+L+G E  V     +      E+  SLAKWKR  LG+++ P+  GI  +M A+R +++L + HS+YVDQWDWE  I   +R LE L+  V+ +YE++R  ++ +  ++      +LPE ITF+ +E LL+RYP   PK RER    ++ AVF+IGIG  LS G  HD+RAPDYDDW                               LNGDI+V+N      LELSSMGIRVD+ +L  QL+ + NN R +  +H+ L+N + P +IGGGIGQSR+  F+L K+HIGEVQ  +W
  S:     9 VDLQLRILKVKAIFTEELANALNLIQVECPMLARVGDGTQDNLSGVEKAVQVHVKEIPEEKYEVVHSLAKWKRKTLGEHKFPVGLGILTNMRALRVEDTLDNTHSVYVDQWDWERVIAPADRCLEYLQATVRSLYEVLRQTERRLCAEFPDITP-VLPESITFVHTEQLLKRYPELDPKSREREAVKEFGAVFLIGIGCKLSHGDYHDVRAPDYDDWSSPVSVDSSKIGFPTAGGEKPSVNAIMSLQGLNGDILVYNAALDDVLELSSMGIRVDQETLRRQLEMTGNNERLQCKWHQCLLNGDLPQTIGGGIGQSRMAMFMLRKKHIGEVQCGVW 342
>gi|85712067|ref|ZP_01043120.1| asparagine synthetase AsnA [Idiomarina baltica OS145] >gi|85694057|gb|EAQ32002.1| asparagine synthetase AsnA [Idiomarina baltica OS145] (326 aa)
Score = 639, Expect = 8.2e-65, Identities = 137/310 (44%), Positives = 190/310 (61%)
  Q:     7 LETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTF-TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           L  Q+ I FIK  F   L   ++L +   PL+ E+  G+ DDL+G E PV    S       ++  SLAKWKR +L  Y+ P+ +GI   M+A+R DE +L   HS++VDQWDWE  I + +R+++ LK  V+ IY  +   + ++   Y   +  +LP ++TFISSE L   YP  T K+RE  I   + AVF+ GIG  LSDGK HD RAPDYDDW          LNGD++VW+   + A+ELSSMGIRVD  +L +QL+ +    R +L +H++L   E P +IGGGIGQSR+   LL   HI +VQ  +W   I E
  S:     6 LAKQQKIDFIKREFLSRLCRQMQLVKCEGPLLTEQGTGLQDDLSGIERPVEVKVSALPDKQYQVVHSLAKWKRQLLADYQAPVGQGIVVTMSALRPDEETLDETHSVFVDQWDWEKVIAEEQRSIQYLKQQVQLIYAALTATEGKLRAIYGGLS--ILPRQLTFISSETLRAEYPELTAKQRENKITEAHGAVFVYGIGAPLSDGKKHDERAPDYDDWSTQTEHFGTGLNGDLLVWSPKLQKAIELSSMGIRVDAAALKKQLELTEQTDRLKLAWHQRLAAGELPLTIGGGIGQSRVVMLLLQADHIAQVQCGVWQPGIQE 324
>gi|116625617|ref|YP_827773.1| asparagine synthetase AsnA [Solibacter usitatus Ellin6076] >gi|116228779|gb|ABJ87488.1| aspartate-ammonia ligase [Solibacter usitatus Ellin6076] (376 aa)
Score = 637, Expect = 1.6e-64, Identities = 143/323 (44%), Positives = 199/323 (61%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGIND--DLNGSENPVTF----TSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENL---LPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDW-------------KLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           LSI +TQ+AI   K+  + +L  AL L  VT PLV++   G+ND  D +GS  P+ F      D + I  +I Q+  KWKR+ L ++ +   EG+  DM AIRKD  L   HS YVDQWDWE  I   E +L+ LK  V  I++++   +  + K++    ++    LP ++TF+ +ED+L  YP+   K+RE  +  +  AVF+IGIG  L DG PH++RA DYDDW              LNGDI+VWN  T+   ELSSMGIRV+  +L +QL  +N        +H+ ++  E P SIGGGIGQSR    LL K H+GEV  S+WPK + E     NI +L
  S:    31 LSIRDTQRAIFAGKNFIEEHLCQALNLMMVTVPLVVDTESGLNDLLDRDGSRTPIQFHIANDHDKHPIDAQIVQAATKWKRLALQRFGMKAGEGLCTDMRAIRKDYFLDHDHSAYVDQWDWEKVIHFYEHDLDFLKQAVNAIWKVLVDAESYLQKEFPALKDSRYPNLPRKLTFLHAEDVLDMYPDLPRKQRETRLLQECPAVFLIGIGWTLKDGYPHEMRAADYDDWCTETRSIDGRPCHGLNGDILVWNHVTRRRHELSSMGIRVNAETLQKQLRITNQLDFLRYPYHQAVVRHELPVSIGGGIGQSRTLMLLLRKAHLGEVTVSVWPKILKEICAAKNIHVL 375
>gi|156936124|ref|YP_001440040.1| asparagine synthetase AsnA [Enterobacter sakazakii ATCC BAA-894] >gi|166219925|sp|A7MMW6|ASNA_ENTS8 Aspartate--ammonia ligase (Asparagine synthetase A) >gi|156534378|gb|ABU79204.1| hypothetical protein ESA_04018 [Enterobacter sakazakii ATCC BAA-894] (330 aa)
Score = 636, Expect = 2.2e-64, Identities = 140/305 (45%), Positives = 184/305 (60%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER+L TLK  V+ I+  I+  + E+           LP+ I F+ SE L +R+P    K RER IA +  AVF+IGIG  L+DGK HD+RAPDYDDW          LNGDI+VWN   + A E+SSMGIRVD  +L  QL  + +  R  L++H+ L+N E P +IGGGIGQSRL   LL   HIG+VQ  +WP+ +
  S:     9 QRQISFVKAHFSRLLEEKLGLLEVQAPILSRVGDGTQDNLSGCEKAVQVNVKTLPQAQFEVVHSLAKWKRKTLGQHDFSAGEGLYTHMKALRPDEDRLSPVHSVYVDQWDWERVMGDGERHLGTLKQTVESIWSAIK--ETELAAAERSGLTPFLPDAIHFVHSETLQRRFPELDAKGRERAIAKELGAVFLIGIGGKLADGKRHDVRAPDYDDWTTPTESGFAGLNGDILVWNPLLEDAFEISSMGIRVDADTLKRQLALTGDQDRLALEWHQALLNGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPEQV 322
>gi|56459802|ref|YP_155083.1| asparagine synthetase AsnA [Idiomarina loihiensis L2TR] >gi|56178812|gb|AAV81534.1| Asparagine synthetase A [Idiomarina loihiensis L2TR] (326 aa)
Score = 618, Expect = 2.5e-62, Identities = 138/307 (44%), Positives = 190/307 (61%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILE 316
           Q+ I+F+K  F   L   L L  V +PL+ E   G+ DDL+G E  V            E+  SLAKWKR  LG+Y     EGI   M A+R DE +LSS+HS+YVDQWDWE  I + +R+L  L   V++IY  +R  +++  +++       LPE+I  + +EDL+  YP+ T K+RER +  ++ AVF++GIG  LS G  HD+RAPDYDDW          LNGDI+VW+     ALELSSMGIRVD+ +L  QL  S    + +L +H+ L+  E P +IGGGIGQSR+   +L   HI +VQ  +WP+ I E
  S:     9 QQKIQFVKAGFTQQLQLQLGLIEVQSPLLSELGSGVQDDLSGWEKAVAVKVKAVPDKDYEVVHSLAKWKRYTLGRYGFGAGEGIVTQMKALRPDEEALSSVHSVYVDQWDWEKVITEEQRSLAFLIQTVERIYAALRQTEQQYIEQHG--GTGTLPEKIQVVHAEDLITAYPDLTAKQRERKVVKQHGAVFLVGIGGELSHGHAHDVRAPDYDDWSSVNEQGSTGLNGDILVWHPVLDDALELSSMGIRVDQQALKRQLAISQQEEKLKLPWHQSLLAGELPLTIGGGIGQSRVVMQILQSDHIAKVQCGVWPEPIAE 324
>gi|54288745|gb|AAV31750.1| putative aspartate-ammonia ligase [Trypanosoma cruzi] (241 aa)
Score = 511, Expect = 5.9e-50, Identities = 109/214 (50%), Positives = 140/214 (65%)
  Q:    44 GINDDLNGSENPVTFTSDGNGISG-EIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK-------------------------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQL 257
           G  D+L+G+E  V     G   S  E+  SLAKWKR  LG ++ P+ +GIY  M A+R +E L + HS++VDQWDWEL +   ERNL  LK  V+++Y  IR  ++ +  KY    + +LP  I F+ +E LL+ YP    KERER I  KY AVF+IGIG NL+ G+PHDLRAPDYDDW                          LNGDI+V+N      LELSSMGIRVD  +L  QL
  S:     4 GTQDNLSGTEKAVQVHVKGIPDSKFEVVHSLAKWKRQTLGDHKFPVGQGIYVHMKALRVEEELDTTHSVFVDQWDWELVMPPQERNLTFLKNTVQRLYAAIRQTEEAICSKYN--LDRVLPANIQFLHAEHLLKMYPEMNMKERERAIVKKYGAVFLIGIGGNLTSGEPHDLRAPDYDDWSSPVSAADITFPCGDPTMNSLASLPGLNGDILVYNPVLDDVLELSSMGIRVDAETLRRQL 241
>gi|77408401|ref|ZP_00785141.1| aspartate--ammonia ligase [Streptococcus agalactiae COH1] >gi|77173004|gb|EAO76133.1| aspartate--ammonia ligase [Streptococcus agalactiae COH1] (190 aa)
Score = 507, Expect = 2.0e-49, Identities = 101/180 (56%), Positives = 133/180 (73%)
  Q:   140 YEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           Y+ IRL    V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+I IG  L+DGKPHD RAPDYDDW          LNGDI+VWNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:     1 YKAIRLTDLAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIXIGGELADGKPHDGRAPDYDDWTTPSENGFKGLNGDILVWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEDRLEFEWHKTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVKDTFE 187
>gi|147028|gb|AAA24249.1| asnA (253 aa)
Score = 492, Expect = 1.1e-47, Identities = 108/236 (45%), Positives = 141/236 (59%)
  Q:    10 QKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDG-NGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDES-LSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMG 245
           Q+ I F+K  F   L   L L  V AP++     G  D+L+G E  V            E+  SLAKWKR  LG+++    EG+Y  M A+R DE  LS +HS+YVDQWDWE  +   ER   TLK  V+ I+  I+  +  V++  E+     LP++I F+ S++LL RYP+   K RER IA    AVF++GIG  LSDG  HD+RAPDYDDW          LNGDI+VWN   + A ELSSMG
  S:     9 QRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSE--EFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMG 253
>gi|56807473|ref|ZP_00365419.1| COG2502: Asparagine synthetase A [Streptococcus pyogenes M49 591] (167 aa)
Score = 476, Expect = 8.2e-46, Identities = 90/150 (60%), Positives = 114/150 (76%)
  Q:   165 EITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWK---------LNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDI 314
           +ITFI +E+L+ + P+ TPKERE  I  ++ AVF+IGIG  L DGKPHD RAPDYDDW          LNGDI+VWN    SA ELSSMGIRVDE +L  Q++ + +  R   D+HK L+N  FP +IGGGIGQSR+  FLL KQHIGEVQ+S+WP+++
  S:     1 KITFIHTEELVAKCPDLTPKERENAITKEFGAVFLIGIGGVLPDGKPHDGRAPDYDDWTTETENGYHGLNGDILVWNGQLGSAFELSSMGIRVDEEALKRQVEMTGDQDRLAFDWHKSLLNGLFPLTIGGGIGQSRMVMFLLRKQHIGEVQTSVWPQEV 159
>gi|77405568|ref|ZP_00782658.1| aspartate--ammonia ligase [Streptococcus agalactiae H36B] >gi|77175790|gb|EAO78569.1| aspartate--ammonia ligase [Streptococcus agalactiae H36B] (236 aa)
Score = 472, Expect = 2.4e-45, Identities = 99/226 (43%), Positives = 145/226 (64%)
  Q:     5 SILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTS-DGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDE-SLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIV 230
           S +   + I F+K+ F   L   L++  V  P++ +   G+ D+L+G E+PV+    +      E+  SLAKWKR  L ++     EG++  M A+R DE SL   HS+YVDQWDWE  I    RNL+ LK  V+KIY+ IRL +  V  +++   E++LP+ ITFI +E+L+++YP+ +PKERE  IA +Y AVF+IGIG  L+DGKPHD RAPDYDDW  +  +++
  S:     4 SFIHQXQEISFVKNTFTQYLIDKLEIVEVQGPILSQVGDGMQDNLSGIEHPVSVKVLNIPEAEFEVVHSLAKWKRHTLARFGFNEGEGLFVHMKALRPDEDSLDPTHSVYVDQWDWEKVIPDGRRNLDYLKETVEKIYKAIRLTELAVEARFD--IESILPKRITFIHTEELVEKYPDLSPKERENAIAKEYGAVFLIGIGGELADGKPHDGRAPDYDDWTTHQKMVL 229
>gi|67581065|ref|XP_664830.1| hypothetical protein Chro.50501 [Cryptosporidium hominis TU502] >gi|54654710|gb|EAL34600.1| hypothetical protein Chro.50501 [Cryptosporidium hominis] (221 aa)
Score = 368, Expect = 2.4e-33, Identities = 98/201 (48%), Positives = 129/201 (64%)
  Q:    13 IKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHI------KKTERNLETLKVVVKKIYEIIRL---CQKEVNKKYEWFAEN-LLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHD 213
           I+FIK  FQ  L  +L L R++APL LE+  G+NDDL+G E  V+FT +   +  EI QSLAKWKR  L KYE+    G+YADMNAIRK E L ++HSIYVDQWDWE+ I       K E  ++  +++   IY + RL    +KE         EN ++ +E+  ISSE+LL  YPN +  +RER I  KY +VFI  IG  LS+   HD
  S:    16 IEFIKITFQQLLKESLDLIRISAPLFLEKESGLNDDLSGYEEKVSFTFNNKVL--EIVQSLAKWKRYALKKYEL---NGLYADMNAIRKSEELDNLHSIYVDQWDWEMVIDTNKGKTKDEILVDIARIIHNNIYNLERLYWNMKKEKQDIINIPNENEMIKKELYIISSEELLNMYPNLSSNDREREICKKYGSVFIKQIGKKLSNNTVHD 221
>gi|75759631|ref|ZP_00739716.1| Aspartate--ammonia ligase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492876|gb|EAO56007.1| Aspartate--ammonia ligase [Bacillus thuringiensis serovar israelensis ATCC 35646] (105 aa)
Score = 302, Expect = 1.1e-25, Identities = 55/104 (52%), Positives = 73/104 (70%)
  Q:   223 KLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           ++NGDI+ W+   +S+ ELSSMGIRVD  SL EQL K+  + ++E DFHK ++    P +IGGGIGQSR+C + L K HIGEVQSS+WP D+    +K NI L 
  S:     2 EINGDILFWHPVLQSSFELSSMGIRVDSKSLDEQLTKTGEDFKREYDFHKGILEDVLPLTIGGGIGQSRMCMYFLRKAHIGEVQSSVWPDDLRAACKKENIHLF 105
>gi|110003926|emb|CAK98266.1| hypothetical aspartate--ammonia ligase asparagine synthetase protein [Spiroplasma citri] (334 aa)
Score = 300, Expect = 2.1e-25, Identities = 87/323 (26%), Positives = 159/323 (49%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKY-----------EWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           L++ ET +AI  IK            L +V APL+    KG+NDD   +E P+ F      ++GEI QS  KW+R  + +YE+  +EGI      +R+D   S+  ++   +  ++L +++ +  L  +K  + K   II   +  +  K+            W ++  L + +  +S ++ L RY  +              A  + G+ +++++       + D  +W+L   I V++   + A+ +      V+   L  QL  +   S+   ++  K+   + P ++  G+ +S+L  FLL KQHIGEV +S+W  D LE A+KN I++L
  S:    13 LTLRETVEAISLIKRELVRRFIIQFNLLKVDAPLITTEEKGLNDDFQMTERPIDFDILPTNLTGEIFQSHNKWRRNAIKQYELLENEGILTTAMVLRRDIKQSNSQAVSFSEIGFDLLLEEKDITLLKIKETIDKATNIISDVEDILLLKFPQLNKKFKKKLNWTSQIELQKAMRLLSYQERLNRYTREN------------GATILYGLKNSITNNTIEISESQDVFNWELYAKIFVYDFVLEKAICIGYCAATVNRDVLKNQLAVTKETSKLRTEYDAKVATNDLPVTLSFGLFKSQLDLFLLEKQHIGEVIASVWSDDFLEYAKKNGIEIL 334
>gi|71894353|ref|YP_278461.1| asparagine synthetase AsnA [Mycoplasma synoviae 53] >gi|71851141|gb|AAZ43750.1| putative aspartate-ammonia ligase [Mycoplasma synoviae 53] (293 aa)
Score = 275, Expect = 1.6e-22, Identities = 86/278 (30%), Positives = 139/278 (50%)
  Q:    20 FQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQWDWELHIKKTERNLETLKVVVKKIYEIIRLCQKEVNKKYEWFAENLLPEEITFISSEDLLQRYPNKTPKERERLIASKYKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLL 297
            + NL   L L + T P+ L  N G     N +     F  D +  + +    L KW ++ L  ++   +EG+Y        +ES    +S       W   I  ++RNL  LK    K++  ++  +K   KKY    +  L E++  I+++ L ++YPN    +RE  I  ++K VF+  IG NL D KPH  +  D  DWKLNGD+  ++E  K A++L+S+GI VDE++L++Q      +      +H +++ +  PYSI G I Q +L   LL
  S:    21 LETNLVKKLNLVKKTPPVKLSGNFG-----NENNYVEFFVKDFSQYTSQ----LYKWNKISLKNFD--KYEGLYNMPGPYYLNES--GQYSYNAKLLSWAQVIDYSDRNLVFLKKSANKVFLALKATEKFFVKKYSLSKK--LGEKVFLITTDMLYKQYPNLDASQREDEITKEHKVVFVYKIGYNLPDKKPHSEKVFDDHDWKLNGDLFFYDEENKKAVKLASLGISVDEINLLKQKVYLKLSDTTLDRYHHEVLARSLPYSISGEIFQDQLIELLL 283
>gi|75759629|ref|ZP_00739714.1| Aspartate--ammonia ligase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492874|gb|EAO56005.1| Aspartate--ammonia ligase [Bacillus thuringiensis serovar israelensis ATCC 35646] (147 aa)
Score = 260, Expect = 9.0e-21, Identities = 55/112 (49%), Positives = 72/112 (64%)
  Q:     4 LSILETQKAIKFIKDLFQVNLAHALKLHRVTAPLVLERNKGINDDLNGSENPVTFTSDGNGISGEIPQSLAKWKRMMLGKYEIPLHEGIYADMNAIRKDESLSSIHSIYVDQ 115
           +++ ETQ AIK +K  F+  LA  L+L RV+APL + +  G+ND LNG E P+ F    +G   EI  SLAKWKR  L +Y     EG+Y +MNAIR+DE L + HSIYVD 
  S:     6 MTVRETQIAIKEVKTFFEDQLAKRLELFRVSAPLFVTKKSGLNDHLNGVERPIEFDMLHSGEELEIVHSLAKWKRFALHEYGYEAGEGLYTNMNAIRRDEELDATHSIYVDH 117
>gi|77405588|ref|ZP_00782678.1| aspartate--ammonia ligase [Streptococcus agalactiae H36B] >gi|77175810|gb|EAO78589.1| aspartate--ammonia ligase [Streptococcus agalactiae H36B] (93 aa)
Score = 258, Expect = 1.4e-20, Identities = 50/90 (55%), Positives = 65/90 (72%)
  Q:   230 VWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAE 319
           +WNE   +A ELSSMGIRVDE +L  Q+  + +  R E ++HK L+   FP +IGGGIGQSRL  FLL K+HIGEVQSS+WPK++ +  E
  S:     1 MWNEQLGTAFELSSMGIRVDEDALKRQVVLTGDEDRLEFEWHKTLLRGFFPLTIGGGIGQSRLAMFLLRKKHIGEVQSSVWPKEVRDTFE 90
>gi|188039721|ref|ZP_02529141.2| aspartate--ammonia ligase [Ureaplasma urealyticum serovar 8] (104 aa)
Score = 247, Expect = 3.0e-19, Identities = 47/102 (46%), Positives = 72/102 (70%)
  Q:   194 YKAVFIIGIGDNLSDGKPHDLRAPDYDDWKLNGDIIVWNETTKSALELSSMGIRVDEVSLVEQLDKSNNNSRKELDF-HKKLINKEFPYSIGGGIGQSRLCYF 295
           ++A+FI  IG  L  G    +R+P+YD+W LNGD+IV+++    A+ELSSMGIRV +   ++Q + +N  + +E +F H+ ++N + P +IGGGIGQSRLC F
  S:     2 HQAIFIYQIGYPLKSGYIQSIRSPEYDNWNLNGDLIVYHKLNDQAIELSSMGIRVSKQDFIKQTNFANLKNDQENNFYHQMILNDQLPQTIGGGIGQSRLCMF 104
>gi|24762277|gb|AAN64192.1| aspartate-ammonia ligase [Mycoplasma gallisepticum] (81 aa)
Score = 238, Expect = 3.0e-18, Identities = 49/81 (60%), Positives = 61/81 (75%)
  Q:   246 IRVDEVSLVEQLDKSNNNSRKELDFHKKLINKEFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           IRV++  L++QL++S  N R EL FHKKL+N E   +IGGGIGQSRLCYFLL K HIGEVQ+S W  +I+ EA+   IKLL
  S:     1 IRVNKEVLLKQLEESKQNERLELMFHKKLVNGELHQTIGGGIGQSRLCYFLLQKDHIGEVQASHWSDEIVAEAKAKGIKLL 81
>gi|133723129|gb|ABO37811.1| AsnA [Lactococcus garvieae] (49 aa)
Score = 140, Expect = 7.6e-07, Identities = 29/49 (59%), Positives = 35/49 (71%)
  Q:   278 EFPYSIGGGIGQSRLCYFLLHKQHIGEVQSSLWPKDILEEAEKNNIKLL 326
           E P +IGGGIGQSR+C  LL K HIGEVQ SLW ++ L  A K+ + LL
  S:     2 ELPLTIGGGIGQSRMCMLLLSKVHIGEVQVSLWDEETL-NACKDKVFLL 49