>gi|26553602|ref|NP_757536.1| DNA-damage repair protein MucB [Mycoplasma penetrans HF-2] >gi|26453608|dbj|BAC43940.1| DNA-damage repair protein MucB [Mycoplasma penetrans HF-2] (386 aa)
Score = 1854, Expect = 0.0e+00, Identities = 386/386 (100%), Positives = 386/386 (100%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRSNR 386
           MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRSNR
  S:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRSNR 386
>gi|23099313|ref|NP_692779.1| DNA polymerase IV [Oceanobacillus iheyensis HTE831] >gi|38372232|sp|Q8EQ56|DPO4_OCEIH DNA polymerase IV (Pol IV) >gi|22777542|dbj|BAC13814.1| DNA damage inducible protein [Oceanobacillus iheyensis HTE831] (419 aa)
Score = 422, Expect = 1.7e-39, Identities = 120/382 (31%), Positives = 218/382 (57%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS---FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNN--EQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRSNR 386
           IFHIDM+ F+ASVE+A  P  +  PLA+         +I +++Y ARG GVK+ M I  AKK+CP L ++ PN ++Y + S +I+  L+ ++  ++  SIDE Y+D+++T Y     +  A+ ++  I    ++ C++G +   FLAKMA+++ KP G   L K   +  ++ + + ++ GIG    ++L  + +  I D+A  KN Y +++ +G++  +L+    GI    ++P+  +  K++G SQ++  + ++  E ++LI EL D++   +K ++   K+V I IRY D  + T+S   +N+++   +I L V  +LFEQ  +    +  + L   +   ME   N  EQL +F           K EK++  V+K   K   +  +S+ N+
  S:    12 IFHIDMNCFYASVEMAHNPSLKGKPLAIAGNPEERKGIIVTSSYEARGKGVKTTMPIWQAKKLCPDLILMRPNFDRYRAASREIFKMLAEITPYVQPVSIDEGYMDITDTIYAK-DPLVTANQLQQRILSGLDIPCSIGIAPNKFLAKMASDMKKPLGITVLRKREVEKLLWPMSVEEMYGIGEKTAQKLNSIEIKTIGDLAK-KNVYELKQLLGVNGERLQNRANGIDNRLVDPEAVHDFKSIGSSQTLPHDSTDVTELMQLIHELVDNVERRVKRKEAAGKTVQITIRYHDRKTITRSKKLYNYIDNHREI-LFVAKELFEQHWN----EAPVRLLGVSLQDMETKRNIGEQLDLF-----TYEAIEKKEKLKVTVDKLTKKYGSNIITSQKNK 395
>gi|89099009|ref|ZP_01171888.1| DNA polymerase IV [Bacillus sp. NRRL B-14911] >gi|89086139|gb|EAR65261.1| DNA polymerase IV [Bacillus sp. NRRL B-14911] (432 aa)
Score = 421, Expect = 2.3e-39, Identities = 116/373 (31%), Positives = 202/373 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY--------DQVINLSITANNIMENDNN-EQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKII 377
           I H+DM+SF+ASVE+A  PE +  PLA+         +I + +Y AR  GV++ M + +AKK+CPQL ++ PN  +Y + S  +++ L   S  +E  SIDE Y+D++++ YE    +E A  ++  I  + +L C++G +   FLAKMA+++ KP G   L K +  + ++ + +  + G+G     +L  L +  I  +A   ND  ++  +G++  +L+    GI   P++P+   + K++G S ++ R+ S  QE  K++  L++ +   LK +     ++ I IRY D  + T+S    N          V L E ++ FS+         D V  L +TA  ++E D    QL +F    +K + +  L K    +      KII
  S:    12 ILHVDMNSFYASVEMAYNPELKGKPLAIAGNAEERRGIIVTCSYEARKFGVRTTMPLWEAKKLCPQLIVMTPNFERYRAASMGMFNILGQYSGLVEPVSIDEGYVDITDS-YEYGAPLEIAGSIQKQILDQLDLPCSIGVAPNKFLAKMASDMKKPMGITVLRKRDIGNILWPMPVEVMHGVGKKTAEKLRTLQIETIGSLAEA-NDLQLKGLLGINGPRLKERANGIDRRPVDPESAAEFKSVGNSTTLPRDVSNQQELFKVLDMLSEKVAVRLKKKKVYASALGITIRYKDRKTITRSRKLDN---------PVSLKEDLAAFSRKLFIRHWNGDPVRLLGVTAQELVEQDQAVRQLDLFS--YEKEARKEPLFKTLADLRTKFGDKII 389
>gi|149181624|ref|ZP_01860117.1| DNA polymerase IV [Bacillus sp. SG-1] >gi|148850602|gb|EDL64759.1| DNA polymerase IV [Bacillus sp. SG-1] (417 aa)
Score = 409, Expect = 6.2e-38, Identities = 112/373 (30%), Positives = 211/373 (56%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISD-FSKY---DQVINLSITANNIMENDNNE-QLTIF--DSPTQKISTESKLEKIRKQVNKTLNKKII 377
           I H+DM+SF+ASVE A  PE +  PLA+         +I + +Y ARG GVK+ M + +AKK+CPQL I+ PN ++Y + S  ++  L   S+ +E  SIDE Y+D++++ Y     +  A  ++N I  + +L  ++G +   FLAK A+++ KP G   L K +    I+ L + ++ GIG    ++L  + +H I ++A   N+ +++ ++G++  +L+    G    P++PD  Y  K++G S ++ R+ +  +E L  + +L+  + S +K +D +  +V + +R+ D  + T+S    N     P+    D+F      F ++   + +  L +T  +++E D+   QL IF  +   +K      +EK++ +  K + ++ I
  S:    12 ILHVDMNSFYASVEAAYNPELKGKPLAIAGNPDERRGIIVTCSYEARGYGVKTTMPLWEAKKLCPQLIIMRPNFDRYRAASQGMFEILRQYSQLVEPVSIDEGYVDITDS-YSLGSPLFIAESIQNQILSQQDLPSSIGIAPNKFLAKTASDMKKPMGITVLRKRDLPERIWPLDVKEMHGIGEKTAQKLYSMEIHTIGELAKA-NEIVLKSQLGINGLRLKARANGTDDRPVDPDSVYDFKSVGNSTTLPRDTANQKELLNTLNQLSGKVASRMKSKDILALTVMLTMRFKDRKTITRSKKLKN-----PVGSQDDIFAAAKALFLQHWNGNSIRLLGVTGQDLVERDDAALQLDIFSYEEHAKKEPLYQTIEKLQDKFGKQMIQRGI 393
>gi|163763760|ref|ZP_02170820.1| Propionyl-CoA carboxylase [Bacillus selenitireducens MLS10] >gi|160355585|gb|EDP82238.1| Propionyl-CoA carboxylase [Bacillus selenitireducens MLS10] (429 aa)
Score = 409, Expect = 6.4e-38, Identities = 92/291 (31%), Positives = 167/291 (57%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           IFH+DM+SF+ASVE A  P     PLA+         ++ +A+Y AR  GVK  M + +A+K CP L +  P+ ++Y +MS K++  L S +  +E  SIDE Y+DV+N  +E    +E A ++++ I    +L  ++G +   FLAKMA+++ KP G   L K      ++ L   ++ G+G     +L  L L  I+D+A   + + + +K G+   ++     GI   P++P+  +  K++G S ++ ++ +  Q+  ++++ L+D ++  LK +D    ++ + IRY D  + T+S
  S:     7 IFHVDMNSFYASVEAAYDPSLRGKPLAIAGNAKERRGIVVTASYEARAKGVKPPMPLWEAEKACPGLLVRPPDFDRYRTMSRKMFEILYSYTPLVEPVSIDEGYMDVTNVHFEGTHGLELAKIIQDHIYHDLHLPSSIGVAPNKFLAKMASDMKKPMGITVLRKREVPDILWPLRAVEMHGVGEKTADKLSRLGLFTIEDLAKA-DPFFLTEKFGVAGKRMHEKANGIDFRPVDPESIHDFKSIGNSTTLPKDTANRQDITRILRNLSDSVSRRLKKKDVYAGNIQLTIRYHDRKTITRS 305
>gi|52080931|ref|YP_079722.1| DNA polymerase IV [Bacillus licheniformis ATCC 14580] >gi|52786306|ref|YP_092135.1| DNA polymerase IV [Bacillus licheniformis ATCC 14580] >gi|52004142|gb|AAU24084.1| UMUC-like DNA-repair protein DinB1 [Bacillus licheniformis ATCC 14580] >gi|52348808|gb|AAU41442.1| YqjH [Bacillus licheniformis DSM 13] (418 aa)
Score = 404, Expect = 2.3e-37, Identities = 96/296 (32%), Positives = 175/296 (59%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN 300
           IFHIDM+SF+ASVE+A  P  +  PLA+         ++ + +Y AR  GVK  M + +AK++CP+L +  PN ++Y S S +++  L   +  +E  SIDE Y+D+++T Y N +  E A  ++  ++++  L  ++G +   FLAKMA+++ KP G   L K      ++ + IS++ G+G     +L  L +  I D+A   ++Y +++ +G++  +L+    GI    +NPD  Y+ K++G S ++  + ++ +E   LI +L+  ++  LK ++ M   V I IR++D  + T+S   +N
  S:    11 IFHIDMNSFYASVEMAYDPSLKGRPLAIAGNAKERKGIVVTCSYEARARGVKPPMPLWEAKRLCPELIVKPPNFDRYRSSSREMFQVLREYTDLVEPVSIDEGYMDLTDTPYRN-RACETAKEIQERLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKREVPRILWPMDISEMYGVGRKTAEKLKTLEIEKIGDLA-AADEYALKRLLGINGPRLKRRANGIDTGEVNPDRIYEFKSVGNSSTLPHDSTDEKELFGLIDKLSISVSDRLKRKEVMAAKVFIMIRFADWTNITRSKTLLN 313
>gi|169632191|ref|YP_001705927.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Acinetobacter baumannii SDF] >gi|169150983|emb|CAO99608.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Acinetobacter baumannii] (363 aa)
Score = 401, Expect = 4.3e-37, Identities = 102/312 (32%), Positives = 168/312 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI----EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFE 315
           KI HIDMD+F+ASVEL ERP+   LP+ +       VIA+A+Y AR  G++SAM++  A+K+CPQ+ II PN  KY ++S +I+S     +  IE  S+DE YLDV+    EN K+I    E A  ++  I ++  L  + G +   FLAK+A++  KP+G   +      S+I DL + KI G+G     +L +L LH + D+  ++   L+    G +  +L +   GI   P+  +  R+ + +  +  +     +       L + +   L+ +    + VNIK++  +  +   S +F N     P+H   DL +
  S:     3 KIIHIDMDAFYASVELRERPDLRHLPVVISSHHPRAVIAAASYPAREFGLRSAMSMSQARKLCPQVVIIEPNFEKYRAISAQIHSIFQQYTTLIEPLSLDEAYLDVT----ENLKQIASATEVAMHIREDIFRQTGLTASAGVAPNKFLAKVASDWNKPNGLFVIKPSQVASFIQDLPLKKIPGVGKVTQEKLQQLELHTLGDLQKIEEAVLVH-HFGKYGQQLYLYAQGIDNRPVQAERARQQISKETTFDSDFTLAQCQSYWHGLAEKVWQSLEKKQLNARGVNIKLKLKNFQTLQHSKSFKN-----PIHSQQDLIQ 312
>gi|169797618|ref|YP_001715411.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Acinetobacter baumannii AYE] >gi|184156526|ref|YP_001844865.1| nucleotidyltransferase/DNA polymerase [Acinetobacter baumannii ACICU] >gi|169150545|emb|CAM88453.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Acinetobacter baumannii] >gi|183208120|gb|ACC55518.1| Nucleotidyltransferase/DNA polymerase [Acinetobacter baumannii ACICU] >gi|193076069|gb|ABO10667.2| DNA polymerase IV [Acinetobacter baumannii ATCC 17978] (351 aa)
Score = 401, Expect = 4.9e-37, Identities = 102/312 (32%), Positives = 168/312 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI----EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFE 315
           KI HIDMD+F+ASVEL ERP+   LP+ +       VIA+A+Y AR  G++SAM++  A+K+CPQ+ II PN  KY ++S +I+S     +  IE  S+DE YLDV+    EN K+I    E A  ++  I ++  L  + G +   FLAK+A++  KP+G   +      S+I DL + KI G+G     +L +L LH + D+  ++   L+    G +  +L +   GI   P+  +  R+ + +  +  +     +       L + +   L+ +    + VNIK++  +  +   S +F N     P+H   DL +
  S:     3 KIIHIDMDAFYASVELRERPDLRHLPVVISSHHPRAVIAAASYPAREFGLRSAMSMSQARKLCPQVVIIEPNFEKYRAISAQIHSIFQQYTTLIEPLSLDEAYLDVT----ENLKQIASATEVAMHIREDIFRQTGLTASAGVAPNKFLAKVASDWNKPNGLFVIKPSQVASFIQDLPLKKIPGVGKVTQEKLQQLELHTLGDLQKIEEAVLVH-HFGKYGQQLYLYAQGIDNRPVQAERARQQISKETTFDSDFTLAQCQPYWHGLAEKVWQSLEKKQLNARGVNIKLKLKNFQTLQHSKSFKN-----PIHSQQDLIQ 312
>gi|163941893|ref|YP_001646777.1| DNA polymerase IV [Bacillus weihenstephanensis KBAB4] >gi|163864090|gb|ABY45149.1| DNA-directed DNA polymerase [Bacillus weihenstephanensis KBAB4] (412 aa)
Score = 396, Expect = 1.6e-36, Identities = 104/366 (28%), Positives = 205/366 (56%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN--FQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVNK 370
           I H+DM+ FFASVE+A  P  +  PLA+         +I + +Y AR  G+++ M + +AK++CPQL + +PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+   ++++ GIG     +L ++++H I+ +A   ++++IR KIG H   L+    G+    ++P+   + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N  ++ ++       L++Q  D    D V  L +TA  +  + ++ +QL +F    ++ + E  L  +  Q+N+
  S:    12 ILHVDMNCFFASVEIAHDPSLQGKPLAIAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRHPNFTLYREASFQMFQILSRFTEQIQPFSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEIIWPRSVAEMHGIGEKTAEKLKDIHIHTIEQLAK-GDEHIIRAKIGKHGVDLQKRAKGMDDREVDPNQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKNAIWEERVIFQAASRLWKQHWD---GDSVRLLGVTATELEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQINE 382
>gi|167038401|ref|YP_001665979.1| DNA-directed DNA polymerase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038865|ref|YP_001661850.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514] >gi|166853105|gb|ABY91514.1| DNA-directed DNA polymerase [Thermoanaerobacter sp. X514] >gi|166857235|gb|ABY95643.1| DNA-directed DNA polymerase [Thermoanaerobacter pseudethanolicus ATCC 33223] (389 aa)
Score = 396, Expect = 1.9e-36, Identities = 115/381 (30%), Positives = 209/381 (54%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASL-VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL-HVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPS 381
           MK KI H+DMD+FFASVE  + PEY+  P+ VG L    V+++ +Y AR  G+ SAM +  A+K+CP    +   + +Y  +S +I+  L S++  +E  SIDE YLDV++      K  E  +L +K  +K+   L  + G S+  FLAK+A++  KPDGF+ +T+D     +  L +SK+ GIG     +L  + ++ I D+  +  + L+    K+G+   ++ + + GI   P+    + K++G+ +++ ++  + +  L+  K  +D I+  L  +    ++V +KI+ SD    TKS     +   I L   + D+  +I +  K DQ I L   + + +     EQL+  D   +++    K E + +++NK + ++++   S
  S:     1 MKRKIIHVDMDAFFASVEQHDNPEYKGKPVIVGGLSGRGVVSTCSYEARKYGIHSAMPMYMARKLCPHGIFLSVRRKRYEEVSAQIFDILYSITPLVEPVSIDEAYLDVTDID----KNPEIIALEIKKKVKETTGLTISAGVSYNKFLAKLASDWNKPDGFMVITEDMIPDILKPLPVSKVYGIGQKSEERLKSMGINTIGDLLKLSQENLVEIFGKVGV---EIYLRIRGIDERPVETMREIKSIGKEKTLEKDTKDKKLLLRYAKLFSDIISEELFRERLYARTVTVKIKTSDFTVHTKSKTLNKY---IRLGEDIYDVAYEIIESLKLDQYIRLIGLSVSNLSAVKYEQLSFLD---KRVIKFIKAENVVREINKKMGQEVVKKAS 377
>gi|16079444|ref|NP_390268.1| DNA polymerase IV [Bacillus subtilis subsp. subtilis str. 168] >gi|1731071|sp|P54545|DPO41_BACSU DNA polymerase IV 1 (Pol IV 1) >gi|1303959|dbj|BAA12614.1| YqjH [Bacillus subtilis] >gi|2634822|emb|CAB14319.1| yqjH [Bacillus subtilis subsp. subtilis str. 168] (414 aa)
Score = 395, Expect = 2.3e-36, Identities = 110/371 (29%), Positives = 215/371 (57%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV-GHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFS----KYDQVINLSITANNIMENDNN-EQLTIF-------DSPTQKISTESKLEKIRKQVNKTLNKK 375
           IFHIDM+SF+ASVE+A  P     P+AV G++     ++ + +Y AR  GVK+ M +  AK+ CP+L ++ PN ++Y + S  +++ L   +  +E  SIDE Y+D+++T Y + + +E A  +++ ++++  L  ++G +   FLAKMA+++ KP G   L K      ++ L + ++ G+G     +L  L +H I ++A   +++ +++ +G++  +L+    GI   P++P+  Y+ K++G S ++  + S+ +E L + ++L   ++  L+ ++ M   + I IRY+D  + T+S    N     P+    D+ ++         K + V  L IT  +++E +   +QL +F       D P Q++     +EK+ K+    L +K
  S:     8 IFHIDMNSFYASVEMAYDPALRGKPVAVAGNVKERKGIVVTCSYEARARGVKTTMPVWQAKRHCPELIVLPPNFDRYRNSSRAMFTILREYTDLVEPVSIDEGYMDMTDTPYSS-RALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKRQVPDILWPLPVGEMHGVGKKTAEKLKGLGIHTIGELA-AADEHSLKRLLGINGPRLKNKANGIHHAPVDPERIYEFKSVGNSSTLSHDSSDEEELLGVFRKLAASVSDRLQRKEVMASKLFIMIRYADWRTITRSTTLRN-----PIDQKNDILKEAEHLFFKHWKKNPVRLLGITGTDLVEKEQAYKQLDLFSFNEDAKDEPIQQM-----MEKLNKKYGTKLIRK 387
>gi|161511022|ref|NP_980507.2| DNA polymerase IV [Bacillus cereus ATCC 10987] (412 aa)
Score = 392, Expect = 5.4e-36, Identities = 108/365 (29%), Positives = 198/365 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    12 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLKDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGVDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 381
>gi|42739188|gb|AAS43115.1| DNA-damage-inducible protein P, putative [Bacillus cereus ATCC 10987] (409 aa)
Score = 392, Expect = 5.8e-36, Identities = 108/365 (29%), Positives = 198/365 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:     9 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLKDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGVDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 378
>gi|194016993|ref|ZP_03055606.1| DNA polymerase IV 1 (Pol IV 1) [Bacillus pumilus ATCC 7061] >gi|194011599|gb|EDW21168.1| DNA polymerase IV 1 (Pol IV 1) [Bacillus pumilus ATCC 7061] (412 aa)
Score = 391, Expect = 6.0e-36, Identities = 115/375 (30%), Positives = 210/375 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSIRNYS-EYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISD-FSKY--DQVIN-LSITANNIMENDNN-EQLTIF-------DSPTQKISTESKLEKIRKQVNKTLNKK 375
           M N IFHIDM++F+A+VE+A  P     PLA+         ++ + +Y AR LGVK  M + +AK++CP L +  PN ++Y S S ++++ L   S  +E  SIDE Y+D+++T Y     ++ A  ++  + ++  L  ++G +   FLAKMA+N  KP G   L K +    ++ L    + G+G     +L  + +H I+D+A   N+Y +++ +G++  +L+    G     ++P+  Y+ K++G S ++ + S +  E + LI +L+  +++ L+ ++ M   + I IRY+   + T+S    N     P     DLFE     F K+  DQ +  L +T  +++E     +QL +F       + P Q I     LE ++++  K+L ++
  S:     1 MSNIIFHIDMNAFYANVEMAYDPSLRGKPLAISGNAKERKGIVVTCSYEARALGVKPPMPLWEAKRLCPGLIVRTPNFDRYRSSSQEMFTILREYSDLVEPVSIDEGYIDLTHTPYAE-HAVKTAHDIQTRLVEELMLPSSIGIAPNKFLAKMASNWKKPMGITILRKRDVPQMLWPLPAGDMHGVGQKTADKLKTIGIHTIEDLAKA-NEYTLKELLGINGPRLKQKANGEHDGIVDPERIYEFKSVGNSSTLPHDSDDPDELVALIDKLSQSVSARLRRKEVMANRLLIMIRYASWKNITRSVTLTN-----PTDRKEDLFEAARQVFLKHWNDQPVRLLGVTGTDLVERKEAVKQLDLFSYTEDAKEEPLQTI-----LEGLKEKYGKSLVQR 384
>gi|31544777|ref|NP_853355.1| UmuC/DinP-like [Mycoplasma gallisepticum R] >gi|31541623|gb|AAP56923.1| UmuC/DinP-like [Mycoplasma gallisepticum R] (405 aa)
Score = 391, Expect = 6.4e-36, Identities = 129/377 (34%), Positives = 209/377 (55%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSS-LSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF---NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKN-DYLIRKKIGLHWSKLRMNVLGIICDPINPDYK-RKNLGRSQSIRN-YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDN-NEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIH 378
           +  IFHID D+FFASVE    PEY   PL VG      +++SANY+AR  GV+SAM I  AKK+CP L I   +  KY  +S  ++S+L   +S  +E  SIDE Y+DV++   +N  EI  + L K   KQ +    L  ++G S   FLAKMA++  KP+G   +  D  +  ++ L I K+  IG      L +LN+  I + A  +N + LI     ++W     +  G   D ++ +   RK++  S++IR+  S+Y+  LKL  +L DD+ S LK  + + K++++ IR     S + SF   + +  +  +  +DLFE++ +      V N+SI+  NI         + I++  +++      L+KI  Q+NK  NK++++
  S:    10 RKTIFHIDFDAFFASVEENFNPEYNNKPLVVGSKSNGSIVSSANYIARKFGVRSAMPIFQAKKLCPSLIIAEVDYPKYERVSAYVFSYLRDFVSNKMEVASIDECYMDVTDILEKN-SEISASDLAKKIQKQIYELTQLTVSIGISSNLFLAKMASDQNKPNGVYEIWPDEIEEKLWPLEIKKMYLIGSKKIPLLNQLNIKNIGNFAQFENKELLIDIFKNMYWDHYN-HAHGKGSDFVDYERNSRKSISVSKNIRHKVSDYESLLKLFNDLFDDVYSRLKNHNLLAKNISVSIRTEKVRSLSFSFKQYSDKKTLFYNKAIDLFERLHN---NQLVANISISFGNITNKYKFMPNINIYEELSKEQKDTMLLKKIVNQINKEYNKELVN 393
>gi|47568207|ref|ZP_00238911.1| DNA-damage-inducible protein P [Bacillus cereus G9241] >gi|47555197|gb|EAL13544.1| DNA-damage-inducible protein P [Bacillus cereus G9241] (412 aa)
Score = 391, Expect = 6.7e-36, Identities = 108/365 (29%), Positives = 198/365 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    12 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLNDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGVDDREVDPSQMGQHKSVGNSTTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSRQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 381
>gi|161511201|ref|NP_833857.2| DNA polymerase IV [Bacillus cereus ATCC 14579] >gi|168136610|ref|ZP_02579839.1| DNA polymerase IV [Bacillus cereus B4264] (412 aa)
Score = 391, Expect = 7.4e-36, Identities = 105/344 (30%), Positives = 189/344 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIF 348
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L E+++H I+ +A   ++++IR KIG H   L+    G     ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F
  S:    12 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQVLSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLSVEAMHGIGEKTAEKLNEIHIHTIEQLAK-GDEHIIRAKIGKHGIDLQKRAKGTDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLF 362
>gi|83316493|gb|ABC02422.1| DinB [Bacillus weihenstephanensis] (334 aa)
Score = 391, Expect = 7.5e-36, Identities = 89/296 (30%), Positives = 171/296 (57%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN 300
           I H+DM+ FFASVE+A  P  +  PLA+         +I + +Y AR  G+++ M + +AK++CPQL + +PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+   ++++ GIG     +L ++++H I+ +A   ++++IR KIG H   L+    G+    ++P+   + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N
  S:    15 ILHVDMNCFFASVEIAHDPSLQGKPLAIAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRHPNFTLYREASFQMFQILSRFTEQIQPFSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEIIWPRSVAEMHGIGEKTAEKLKDIHIHTIEQLAK-GDEHIIRAKIGKHGVDLQKRAKGMDDREVDPNQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN 317
>gi|167935815|ref|ZP_02522890.1| DNA polymerase IV [Bacillus cereus AH1134] (412 aa)
Score = 390, Expect = 8.1e-36, Identities = 105/344 (30%), Positives = 189/344 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIF 348
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L E+++H I+ +A   ++++IR KIG H   L+    G     ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F
  S:    12 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQVLSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWTLPVEAMHGIGEKTAEKLNEIHIHTIEQLAK-GDEHIIRAKIGKHGIDLQKRAKGTDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLF 362
>gi|38372183|sp|Q818U9|DPO4_BACCR DNA polymerase IV (Pol IV) >gi|29897783|gb|AAP11058.1| DNA polymerase IV [Bacillus cereus ATCC 14579] (415 aa)
Score = 390, Expect = 8.7e-36, Identities = 105/344 (30%), Positives = 189/344 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIF 348
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L E+++H I+ +A   ++++IR KIG H   L+    G     ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F
  S:    15 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQVLSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLSVEAMHGIGEKTAEKLNEIHIHTIEQLAK-GDEHIIRAKIGKHGIDLQKRAKGTDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLF 365
>gi|189424136|ref|YP_001951313.1| DNA-directed DNA polymerase [Geobacter lovleyi SZ] >gi|189420395|gb|ACD94793.1| DNA-directed DNA polymerase [Geobacter lovleyi SZ] (409 aa)
Score = 388, Expect = 1.5e-35, Identities = 105/317 (33%), Positives = 169/317 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV---GH-LVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKN--DYLIRKKIGLHWSKLRMNVLGIICDPI---NPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQI 317
           M   I HIDM++FFASVE    P+ +  P+AV   GH  VI +A+Y AR  GVK+ M I + ++ CP+L II  +  KYT  S +I   +   +  +E  SIDE +LDV++++         A  +K  I+Q+  L C+VG +    LAK+A+++ KPDG   +  D  K+ +  + I  + GIG  L R+   LNL  IK    +    + L+ +K G+   +LR    GI   P+     D + K++G S ++ ++    Q+ L+ + +L + +    +      K+V+I IR++D         F N Q QI L   ++L   I
  S:     1 MDRAILHIDMNAFFASVEQQANPDLQGKPVAVVGSGHRTVITTASYEARRFGVKTGMAIWEGRRACPELIIIVGDNKKYTHASRQIIGMMRQYTPLVEVFSIDEAFLDVTHSRALFGSAETIAHQLKARIRQELGLTCSVGIAPNKLLAKLASDMQKPDGLTVIAPDQIKAVLESVTIGDLCGIGKKLERR---LNLLGIKSCGQLGRFPEELLSRKFGIIGPRLREMGQGIDDSPVLATEGDEQVKSVGHSMTLHKDIDTRQDILRYLLQLAEMVGRRARRYGVSGKTVSIYIRFAD--------FFTNIQKQITLDSYINLSNDI 316
>gi|75761968|ref|ZP_00741887.1| DNA polymerase IV [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490548|gb|EAO53845.1| DNA polymerase IV [Bacillus thuringiensis serovar israelensis ATCC 35646] (415 aa)
Score = 388, Expect = 1.6e-35, Identities = 105/344 (30%), Positives = 189/344 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIF 348
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L E+++H I+ +A   ++++IR KIG H   L+    G     ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F
  S:    15 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQVLSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMMQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVEAMHGIGEKTAEKLNEIHIHTIEQLAK-GDEHIIRAKIGKHGIDLQKRAKGTDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLF 365
>gi|157692892|ref|YP_001487354.1| DNA polymerase IV [Bacillus pumilus SAFR-032] >gi|157681650|gb|ABV62794.1| DNA-directed DNA polymerase IV [Bacillus pumilus SAFR-032] (414 aa)
Score = 387, Expect = 1.8e-35, Identities = 114/375 (30%), Positives = 210/375 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSIRNYS-EYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISD-FSKY--DQVIN-LSITANNIMENDNN-EQLTIF-------DSPTQKISTESKLEKIRKQVNKTLNKK 375
           M N IFHIDM++F+A+VE+A  P     PLA+         ++ + +Y AR LGVK  M + +AK++CP L +  PN ++Y S S ++++ L   S  +E  SIDE Y+D+++T Y     ++ A  ++  + ++  L  ++G +   FLAKMA+N  KP G   L K +    ++ L    + G+G     +L  + +H I+D+A   N+Y +++ +G++  +L+    G     ++P+  Y+ K++G S ++ + S +  E + LI +L+  +++ L+ ++ M   + I IRY+   + T+S    N     P     DL+E     F K+  DQ +  L +T  +++E     +QL +F       + P Q I     LE ++++  K+L ++
  S:     3 MSNIIFHIDMNAFYANVEMAYDPSLRGKPLAISGNAKERKGIVVTCSYEARALGVKPPMPLWEAKRLCPGLIVRTPNFDRYRSSSQEMFTILREYSDLVEPVSIDEGYIDLTHTPYAE-HAVKTAHDIQTRLVEELMLPSSIGIAPNKFLAKMASNWKKPMGITILRKRDVPQMLWPLPAGDMHGVGQKTADKLKTIGIHTIEDLAKA-NEYTLKELLGINGPRLKQKANGEHDGIVDPERIYEFKSVGNSSTLPHDSDDPDELVALIDKLSQSVSARLRRKEVMANRLLIMIRYASWKNITRSVTLTN-----PTDRKEDLYEAARQLFLKHWNDQPVRLLGVTGTDLVERKAAVKQLDLFSYTEDAKEEPLQTI-----LEGLKEKYGKSLVQR 386
>gi|53712423|ref|YP_098415.1| DNA damage-inducible protein [Bacteroides fragilis YCH46] >gi|52215288|dbj|BAD47881.1| DNA damage-inducible protein [Bacteroides fragilis YCH46] (364 aa)
Score = 386, Expect = 2.6e-35, Identities = 100/331 (30%), Positives = 177/331 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQ----VINLSIT 332
           + KI HIDMD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV+SAM+   AK++CPQL  +      Y S+S +++      +  IE  S+DE +LDV+  +      ++ A  +K  I+++ +L  + G S+  FLAK+A++  KPDG  T+  D    +I  L I    G+GP   R++  L +H    +    ++ L+R+  K+GL +        G+   P+     RK++G   ++ ++       +  +  +  ++   L+ ++F   ++ +KI++ D    T+S      Q    L  ++ L +Q+    +Y+Q    +I LS++
  S:     3 ERKIIHIDMDAFYASVEQRDHPELRGKPLAVGHAEERGVVAAASYEARRYGVRSAMSSQKAKRLCPQLIFVPGRMEVYKSVSRQVHEIFHEYTDLIEPLSLDEAFLDVTENKQGILLAVDIAKAIKQRIREELSLVASAGVSYNKFLAKIASDFRKPDGLCTIHPDQAIDFIARLPIESFWGVGPVTARKMHLLGIHNGLQLRECSSEMLVRQFGKVGLLYYDF---ARGVDLRPVEAVRIRKSIGCEHTLEKDIHVRSSVIIELYHVATELVERLQQKEFRGNTLTLKIKFHDFSQITRS--MTQAQELTNLERILPLAKQLLKEVEYEQHPIRLIGLSVS 339
>gi|78043703|ref|YP_360472.1| DNA polymerase IV - AMBIGUITY [Carboxydothermus hydrogenoformans Z-2901] >gi|77995818|gb|ABB14717.1| DNA polymerase IV - AMBIGUITY [Carboxydothermus hydrogenoformans Z-2901] (391 aa)
Score = 385, Expect = 3.1e-35, Identities = 95/297 (31%), Positives = 164/297 (55%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL--KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           K  I H+DMD+FFA+VE  + PE +  P+ VG +     V+A+A+Y AR  GV+SAM++ +A ++CP    I  N  KY  +S+KI+      +  +E  S+DE YLDV+ +Q       E    +K  I ++  L  +VG +   FLAK+A+ + KPDGF  + +DN   ++  L +  + G+G  +  +L ++ +  ++D   +  ++ +RKK G+    L     GI    + P+   K+LG+  +++  S   ++L  KL+  LT  +  GL+ + F    +++KIR S   + T+   F
  S:     3 KRVIIHVDMDAFFAAVEQRDNPELKGKPVIVGGVPGERGVVAAASYEARKFGVRSAMSLWEAARLCPHGIFIPGNHKKYQEVSEKIFRIFREYTPLVEPVSLDEAYLDVTGSQKLFGPGAEIGKKIKKRIFEETELTASVGVAPNKFLAKLASEVNKPDGFCEVREDNVLDFLAPLPVEMLWGVGEKMKERLNDMGIKTVQDFWELP-EFFLRKKFGVLGQNLYYLSRGIDFREVIPERVPKSLGKEITLQKDSSDVDYLLGKLLG-LTMAVGRGLRREGFYAGGISVKIRLSSFITYTRHSRF 304
>gi|182418367|ref|ZP_02949662.1| DNA polymerase IV [Clostridium butyricum 5521] >gi|182377749|gb|EDT75293.1| DNA polymerase IV [Clostridium butyricum 5521] (348 aa)
Score = 385, Expect = 3.3e-35, Identities = 110/348 (31%), Positives = 199/348 (57%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF---NFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIF 348
           M N I H+DMD+FFASVE  + PE +  P+ VG +    V+++ +Y AR  GV SAM I  AK+ CP    +     +YT +S +I+  LS ++  IE  SIDE YLD+S +++EN   I+ A  +KN + ++  L  +VG S+  FLAK+A++  KP+G   +++      +  L +SKI G+G     +L  + + YIKD+ N++  + I + +G +   +   + GI    I    +RK++G+ ++++ +    +E L+ +KE + +I   L  ++ + K+V +K +  D ++ T+S    N++++   I  +V  +L E   +     ++I +SI++    +    EQ+T+F
  S:     1 MNNNILHVDMDAFFASVEQMDNPELKGKPVIVGGVSERGVVSTCSYEARKYGVHSAMPIFMAKEKCPNGIFVAGRYGRYTKISQEIFKILSDVTPIIEQVSIDEGYLDLSQSRFEN--GIDAARYIKNKVFKEIGLTISVGISYNKFLAKLASDWNKPNGIKEISRSMIPDILLPLPLSKIHGLGKISVGKLNNMGIFYIKDLYNMEKKFYI-EYLGKNGLDIYDRIRGIDNRKIETIRERKSVGKERTLKFDTDNKEELLQYLKEFSFEIEEMLCAKNVVGKTVTLKFKTKDFENHTRSRTLNNYISYHEDI-FNVSKELLES-EELKSNLRLIGVSISS---FKEKEIEQMTLF 348
>gi|154495142|ref|ZP_02034147.1| hypothetical protein PARMER_04189 [Parabacteroides merdae ATCC 43184] >gi|154085692|gb|EDN84737.1| hypothetical protein PARMER_04189 [Parabacteroides merdae ATCC 43184] (364 aa)
Score = 384, Expect = 4.3e-35, Identities = 92/295 (31%), Positives = 163/295 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M+ KI HIDMD+F+ASVE  + PE   +PLAVGH     V+A+A+Y AR  GV+SAM+   AK++CPQLT +    + Y ++S +I+      +  +E  S+DE +LDV+  +      ++ A  +K  I+++ +L  + G S+  FLAK+A++  KPDG  T+     + +I  L I    GIGP   +++  L +H  + +     + L R+  K G+ + +      GI   P+     RK++G   ++ ++ S+    +  +  +  ++   L+   F   ++ +KI++ D +  T+S
  S:     1 MERKIIHIDMDAFYASVEQRDNPELRGIPLAVGHAEERGVVAAASYEARKFGVRSAMSSQRAKRLCPQLTFVSGRMDVYKAVSRQIHEIFHEYTDIVEPLSLDEAFLDVTENKQNIPLAVDIAKAIKQKIREELHLIASAGVSYNKFLAKIASDYRKPDGLCTIHPSQAEEFIKRLPIESFWGIGPVTAQRMHSLGIHNGEQLRACSQEMLTRQFGKAGILYYEFSR---GIDLRPVEAVRIRKSVGCEHTLEKDISQQSSVIIELYHVATELIERLQRTGFKGNTLTLKIKFHDFNQKTRS 299
>gi|84496193|ref|ZP_00995047.1| DNA-directed DNA polymerase [Janibacter sp. HTCC2649] >gi|84382961|gb|EAP98842.1| DNA-directed DNA polymerase [Janibacter sp. HTCC2649] (417 aa)
Score = 383, Expect = 5.7e-35, Identities = 89/291 (30%), Positives = 159/291 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H+DMD+F+A   L   PE    P+ +G     V+ SA Y AR  GV SAM +  A+++CPQ T++ P+ + Y ++S  +     +++ +IE  S+DE +LDVS             + ++++I  +  + C+VG S T F+AK+A+ LAKPDG + + +D    ++  L +  + G+G     QL  L L  + DIA+     LIR   +  G H  +L     G    P+  + + K++G  ++   +  + QE  + + +L+D + + L+      ++V+IK+R+SD  + T++
  S:    24 ILHVDMDAFYAMATLLSHPELVGTPVIIGGGNRGVVLSATYEARKFGVASAMPMTRARRLCPQATVLAPDHSLYAAISSAVMETFRAVTPDIEPLSLDEAFLDVSGAIRRLGSPATIGAQIRDTIHDEQGITCSVGVSSTKFVAKIASGLAKPDGMVVVPRDEVIPFVQQLPVGALWGVGEKTEEQLTRLGLRTVADIAHTPLPTLIRGLGEATGNHLYEL---AWGRDPRPVAREQREKSIGADETFEYDIDDPQEIHRHLLKLSDRVAARLRGARLTGRTVSIKVRFSDFTTITRA 318
>gi|116254503|ref|YP_770339.1| DNA polymerase IV [Rhizobium leguminosarum bv. viciae 3841] >gi|115259151|emb|CAK10264.1| putative DNA polymerase [Rhizobium leguminosarum bv. viciae 3841] (370 aa)
Score = 383, Expect = 6.2e-35, Identities = 108/344 (31%), Positives = 178/344 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFN----LNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL--IRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIP--LHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTI 347
           KI H+DMD+F+ASVE  + PE   LPLAVG      V+A+A+Y AR  GV SAM  V AK+ CP L  + P    Y  +S +I    +  +  IE  S+DE YLDV+    EN K +E A+ +   I+ K      LN + G S+  FLAKMA++L KP+G   +T  N   ++  L + K  G+GP+   +   +  H I+   ++K+  L  +++  G           GI    + PD  RK++G   + + +   +      ++ L + +    +  D   K+V +KI+YSD   AT+S       + +   L +   L   +  F +  +++ +++++ N  E+    QL +
  S:    19 KIIHVDMDAFYASVEQRDNPELHGLPLAVGGSAARGVVAAASYEARVFGVHSAMPSVTAKRKCPDLIFVPPRFEVYRQVSQQIREIFAEYTPLIEPLSLDEAYLDVT----ENLKGMEIATEIALEIRAKIKAVTGLNASAGISYNKFLAKMASDLNKPNGQAVITPKNGPGFVEALPVKKFHGVGPATAER---MKRHGIETGLDLKSKSLAFLQQHFGKSGPYFYGIARGIDERQVRPDRIRKSVGAEDTFVEDIDNFDLAKAELRPLAEKVRRYCEAHDITGKTVTVKIKYSDFSQATRSQTVSGAVSDVDQMLEIAETLLASVFPFKRPVRLLGVTLSSLNTEESGQEPQLDL 368
>gi|163841242|ref|YP_001625647.1| DNA polymerase IV [Renibacterium salmoninarum ATCC 33209] >gi|162954718|gb|ABY24233.1| DNA polymerase IV [Renibacterium salmoninarum ATCC 33209] (424 aa)
Score = 382, Expect = 6.8e-35, Identities = 86/291 (29%), Positives = 156/291 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H+DMD+FF +VEL ERPE    P+ VG      V+ SA+Y AR  GV+SAM +  A ++CPQ  I  P  ++Y  +S  +     S++  +E  S+DE +LDV+ ++      +E A L++  ++ +  +  +VG + T F+AK+A+  +KPDG L +  ++  ++++ L    + G+G    + L ++ +H +  IAN    +++R+ +G     +     GI    + P    K++G  ++    +   E L + +  L       L+   ++ ++V IKIR+ D    T+S
  S:    29 ILHVDMDAFFVAVELLERPELVGQPVIVGFPQGRSVVLSASYEARAFGVRSAMPMAAAMRLCPQAVICEPKHSRYYEVSKVLMQIFESITDKVEPLSVDEAFLDVAGSRRRLGSALEIARLIRTRVRNELGITASVGIASTKFVAKIASTQSKPDGLLLIPHEDTVAFLHTLPAQALWGVGAKTRKVLADMGIHTVAQIANTPV-HMLRRVLGATGDHVYRLSWGIDPRAVTPVRIDKSIGSEETFAEDTRDDEILHRELLRLAHRTGQRLRSAGYLARTVAIKIRFEDFSVITRS 323
>gi|90962137|ref|YP_536053.1| DNA polymerase IV [Lactobacillus salivarius UCC118] >gi|90821331|gb|ABD99970.1| DNA polymerase IV [Lactobacillus salivarius UCC118] (357 aa)
Score = 381, Expect = 9.1e-35, Identities = 111/341 (32%), Positives = 185/341 (54%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRS----QSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHV--VV----DLFEQISDFSKYDQVINLSITANNIMENDN 341
           M+ KI HIDMD+F+AS+E+ + PEY   PL +        G  V+A+ANYVAR  G+ SAM+   A   CP      P+  KY  +S +I++     +  IE  ++DE YLD++  +      +E A  ++  I  K  L C+ G S+  FLAK+A++ +KP G   +T D+ + +++++ I K  G+G     ++ E  ++Y  D+ N K   LI K  KIG     L   V GI   P+    +RK++G+     Q ++   E    L+LI      I +  + +    K++ IK+R +D ++ TK       Q+ IP  V  +V     LFE++ D     +++ L++T  + +  +N
  S:     1 MERKILHIDMDAFYASIEMRDNPEYLNKPLVIARNPKHTAGKGVVATANYVARKYGIHSAMSAQKALDKCPHAIFKTPDFAKYRRVSSQIHTIFHEYTDKIENVALDEAYLDITENKLGIKSAVEVACRIQREIYLKTKLTCSTGVSYNKFLAKLASDYSKPFGITVVTPDDVQDFLFNMPIKKFRGVGKKTLPKMYEEGIYYGIDLYNKKEIDLINKFGKIG---HILYQRVRGIDMRPVEWKRERKSVGKERTFDQPLKTVEEVDSQLRLIATKLVGITTSRQIRG---KTLVIKVRNNDFETVTKR---TTLQDYIPNDVENIVFYGKQLFEEVQDIDIDVRLLGLTLTNLDTVNFEN 352
>gi|154686649|ref|YP_001421810.1| DNA polymerase IV [Bacillus amyloliquefaciens FZB42] >gi|189027657|sp|A7Z6F3|DPO4_BACA2 DNA polymerase IV (Pol IV) >gi|154352500|gb|ABS74579.1| YqjH [Bacillus amyloliquefaciens FZB42] (414 aa)
Score = 381, Expect = 1.1e-34, Identities = 111/371 (29%), Positives = 208/371 (56%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV-GHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSIRNYS-EYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIP--LHVVVDLFEQISDFSKYDQVINLSITANNIMENDNN-EQLTIFDSPTQKISTESKLEKIRKQVNKTLNKK 375
           IFHIDM+SF+ASVE+A  P     P+AV G++     +I + +Y AR  GVK+ M +  AK++CP+L ++ PN ++Y S S +++S L   +  +E  SIDE Y+D+++T + + +  E A  ++  ++++  L  ++G +   FLAKMA+++ KP G   L K      ++ L I ++ GIG     ++  L +  I D+A   +++ ++  +G++  +L+    GI    +NP+  Y+ K++G S ++ + S ++ E   +   L   ++  L+ ++ M   + I IRY+D  + T+S    N  +Q    +   ++LF++       + V  L IT   ++E     +QL +F         ++K E I + +N+ LN+K
  S:     8 IFHIDMNSFYASVEMAYDPSLRGKPIAVAGNVKERKGIIVTCSYEARARGVKTTMPVWRAKRLCPELIVVPPNFDRYRSSSKEMFSILREYTDLVEPVSIDEGYMDITDTPHSH-RAYETAEDIQARLQKELLLPSSIGIAPNKFLAKMASDMKKPLGITILRKRELPDVLWPLPIEEMHGIGTKTAEKIKTLGIKTIGDLAK-GDEHALKTLLGINGPRLKDKANGIHPAEVNPERIYEFKSVGNSSTLSHDSADWDELTGVFDRLALSVSERLQRKEVMACRLFIMIRYADWKTVTRSMTLSNPADQKKDIMEAAMELFDK---HWNQNPVRLLGITGTELVEKQQAYKQLDLF-----SFKEDAKDEPIFQMMNE-LNEK 379
>gi|30264219|ref|NP_846596.1| DNA polymerase IV [Bacillus anthracis str. Ames] >gi|47529662|ref|YP_021011.1| DNA polymerase IV [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187049|ref|YP_030301.1| DNA polymerase IV [Bacillus anthracis str. Sterne] >gi|161761257|ref|YP_038208.2| DNA polymerase IV [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|165871209|ref|ZP_02215859.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0488] >gi|166995720|ref|ZP_02262180.1| DNA polymerase IV [Bacillus cereus AH820] >gi|167633521|ref|ZP_02391845.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0442] >gi|167639433|ref|ZP_02397704.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0193] >gi|170687127|ref|ZP_02878345.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0465] >gi|170705636|ref|ZP_02896099.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0389] >gi|177652672|ref|ZP_02935088.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0174] >gi|190565825|ref|ZP_03018744.1| putative DNA-damage-inducible protein P [Bacillus anthracis Tsiankovskii-I] >gi|196034995|ref|ZP_03102402.1| putative DNA-damage-inducible protein P [Bacillus cereus W] >gi|196038607|ref|ZP_03105915.1| putative DNA-damage-inducible protein P [Bacillus cereus NVH0597-99] >gi|196047181|ref|ZP_03114397.1| putative DNA-damage-inducible protein P [Bacillus cereus 03BB108] >gi|38372186|sp|Q81M86|DPO4_BACAN DNA polymerase IV (Pol IV) >gi|30258864|gb|AAP28082.1| DNA-damage-inducible protein P, putative [Bacillus anthracis str. Ames] >gi|47504810|gb|AAT33486.1| DNA-damage-inducible protein P, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180976|gb|AAT56352.1| DNA-damage-inducible protein P, putative [Bacillus anthracis str. Sterne] >gi|164713128|gb|EDR18655.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0488] >gi|167512492|gb|EDR87867.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0193] >gi|167530927|gb|EDR93614.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0442] >gi|170129176|gb|EDS98040.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0389] >gi|170668744|gb|EDT19489.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0465] >gi|172082007|gb|EDT67075.1| putative DNA-damage-inducible protein P [Bacillus anthracis str. A0174] >gi|190562744|gb|EDV16710.1| putative DNA-damage-inducible protein P [Bacillus anthracis Tsiankovskii-I] >gi|195992534|gb|EDX56495.1| putative DNA-damage-inducible protein P [Bacillus cereus W] >gi|196021930|gb|EDX60621.1| putative DNA-damage-inducible protein P [Bacillus cereus 03BB108] >gi|196030330|gb|EDX68929.1| putative DNA-damage-inducible protein P [Bacillus cereus NVH0597-99] (412 aa)
Score = 380, Expect = 1.2e-34, Identities = 107/365 (29%), Positives = 197/365 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A     +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    12 ILHVDMNCFFASVEIAHDSSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLIVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLNDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGMDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLQRLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 381
>gi|118479340|ref|YP_896491.1| DNA polymerase IV [Bacillus thuringiensis str. Al Hakam] >gi|49330115|gb|AAT60761.1| possible DNA-damage-inducible protein P, DNA polymerase IV [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118418565|gb|ABK86984.1| possible DNA-damage-inducible protein P, DNA polymerase IV [Bacillus thuringiensis str. Al Hakam] (415 aa)
Score = 380, Expect = 1.2e-34, Identities = 107/365 (29%), Positives = 197/365 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A     +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    15 ILHVDMNCFFASVEIAHDSSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLIVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLNDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGMDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLQRLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 384
>gi|118579997|ref|YP_901247.1| DNA-directed DNA polymerase [Pelobacter propionicus DSM 2379] >gi|118502707|gb|ABK99189.1| DNA-directed DNA polymerase [Pelobacter propionicus DSM 2379] (410 aa)
Score = 380, Expect = 1.3e-34, Identities = 90/284 (31%), Positives = 158/284 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           I H+DM++FFASVE    PE    P+AV       VI +A+Y AR LGVK+ M I +A++ CPQLT++  +  KYTS S +I   +   +  +E  SIDE +LDV+++          A L+K  I   F L C++G +    LAKMA+++ KPDG   +        +  L ++++ GIG S+ R L+ + +    ++     + L R + G+   +L+    GI   P+ P  ++   K++G S ++ R+  + Q+ LK + +L++ +    +      ++V++ +R++D
  S:     6 ILHMDMNAFFASVEQQANPELRGKPIAVVGSGARSVITTASYEARRLGVKTGMAIWEARRCCPQLTLVVGDNRKYTSTSRRIMEMMGEYTPALEVFSIDEAFLDVTHSLNLFGSAERIACLIKARILHTFGLTCSIGIAPNKLLAKMASDMKKPDGLTVIQPGEITRTMERLPVAELCGIGRSMERNLLLMGIRTCGELGRCDEERLTR-RFGIVGKRLKEMGQGIDDSPVIPQEEQEEVKSVGHSMTLARDILQRQDILKFLLQLSEMVGRRARRYGVSGRTVHLYVRFAD 296
>gi|167357472|ref|ZP_02292139.1| DNA-directed DNA polymerase [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075739|gb|EDR79548.1| DNA-directed DNA polymerase [Rhizobium leguminosarum bv. trifolii WSM1325] (365 aa)
Score = 380, Expect = 1.3e-34, Identities = 106/314 (33%), Positives = 168/314 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFN----LNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQI 317
           KI H+DMD+F+ASVE  + PE   LP+AVG      V+A+A+Y AR  GV SAM  V A++ CP L  + P  + Y ++S +I +  +  +  IE  S+DE YLDV+    EN K +E A+ +   I+ K      L  + G S+  FLAKMA++  KPDG   +T  N  +++  L + K  G+GP+   ++  L +    D+     D+L+    K G ++  +     GI    + PD  RK++G     SQ I ++   +E L   + L   + S  +  +   K+V +K++Y+D    T+S          PL  + DL E +
  S:    13 KIVHVDMDAFYASVEQRDNPELRGLPVAVGSPAARGVVAAASYEARKFGVHSAMPSVTAQRKCPDLIFVKPRFDVYKAVSLQIRTVFAEYTPMIEPLSLDEAYLDVT----ENLKGMEIATEIAAEIRAKIKATTGLTASAGISYNKFLAKMASDQNKPDGQFVITPKNGPAFVERLPVKKFHGVGPATAEKMQRLGIETGADLKERTLDFLVEHFGKSGPYFYGI---ARGIDNRQVKPDRVRKSIGAEDTFSQDIHSFEPAREGL---QPLISKVWSYCEANEIGAKTVTLKVKYADFSQITRSKTV-----PAPLPAITDLDEVV 325
>gi|51246050|ref|YP_065934.1| DNA-damage-inducible protein P [Desulfotalea psychrophila LSv54] >gi|50877087|emb|CAG36927.1| probable DNA-damage-inducible protein P [Desulfotalea psychrophila LSv54] (376 aa)
Score = 380, Expect = 1.4e-34, Identities = 99/312 (31%), Positives = 162/312 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFE 315
           KI HIDMD+FFAS+E  +RPE  K PL VG L     V+A+  Y AR  G+ SAM+   A K+CP    + P    Y  +S +I +     +K +E  S+DE +LDV+     N      A  +   IK + +L+ + G S+  FLAK+A++L KP G  T+  +  + +I  L I K  G+G     ++  L +   KD+     D+L+ K+ G   S    N  G+   P+ P   RK++G+  + +++ +  +E   ++  L+  +   L+    + +++ +KIRYSD  + T+S +      Q P     D+ E
  S:     5 KIIHIDMDAFFASIEQRDRPELRKKPLIVGGLPRGRGVVATCCYEARRYGIHSAMSANRAYKLCPHAVFVKPRMVLYKEVSLQIMAIFREYTKKVEPLSLDEAFLDVTEYLQINGSATLLAREICALIKLRTDLSASAGVSYNKFLAKIASDLKKPGGISTVPPEEARQFIDRLSIGKFYGVGKITKSKMQSLGIQTGKDLRQYSKDFLM-KRFGKAGSFFFYNARGLDERPVCPYQNRKSIGKETTLVQDTNRPEEIRDILINLSSLLGKALENNSQLAQTLTLKIRYSDFTTTTRSLSL-----QKPFSCPADIEE 316
>gi|161763548|ref|YP_085477.2| DNA polymerase IV [Bacillus cereus E33L] (412 aa)
Score = 380, Expect = 1.4e-34, Identities = 107/365 (29%), Positives = 197/365 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A     +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    12 ILHVDMNCFFASVEIAHDSSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLIVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLNDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGMDDRQVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 381
>gi|152976551|ref|YP_001376068.1| DNA polymerase IV [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025303|gb|ABS23073.1| DNA-directed DNA polymerase [Bacillus cereus subsp. cytotoxis NVH 391-98] (412 aa)
Score = 380, Expect = 1.4e-34, Identities = 106/365 (29%), Positives = 201/365 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A  P  +  PLA+         +I + +Y AR  G+++ M + +AKK+CP L +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     IE A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    ++   +  + GIG     +L E++++ I+ +A   ++++IR K+G H   L+    GI    ++P+   + K++G S +  ++  E +E L ++K+L+  ++S L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D +  L +TA  +  + ++ +QL +F    ++ + E  L  + +Q+N
  S:    12 ILHVDMNCFFASVEIAHDPSLKGKPLAIAGNEKERKGIIVTCSYEAREYGIRTTMQLWEAKKLCPHLIVKQPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGTPIEIAKMIQQTLVTELQLPCSIGIAPNLFLAKTASDMQKPLGITVLRKRDIPYMLWPRSVESMHGIGKKTAEKLNEIHIYTIEQLAK-GDEHIIRAKLGKHGVDLQKRAKGIDDRKVDPNQIGQHKSVGNSMTFSKDMDEEKELLDMLKKLSKSVSSRLQKRTLVSYNIQIIIKYYDRRTITRSKQLKN-----AVWEERDIFQAASRLWKQHWNGDSIRLLGVTATELEWKTESVKQLDLFS--FEQDAKEEPLLAVIEQIN 381
>gi|81686316|sp|Q635E0|DPO4_BACCZ DNA polymerase IV (Pol IV) >gi|51974822|gb|AAU16372.1| possible DNA-damage-inducible protein P, DNA polymerase IV [Bacillus cereus E33L] (415 aa)
Score = 380, Expect = 1.5e-34, Identities = 107/365 (29%), Positives = 197/365 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A     +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    15 ILHVDMNCFFASVEIAHDSSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLIVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLNDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGMDDRQVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 384
>gi|189467708|ref|ZP_03016493.1| hypothetical protein BACINT_04099 [Bacteroides intestinalis DSM 17393] >gi|189435972|gb|EDV04957.1| hypothetical protein BACINT_04099 [Bacteroides intestinalis DSM 17393] (367 aa)
Score = 379, Expect = 1.5e-34, Identities = 101/331 (30%), Positives = 178/331 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYD----QVINLSIT 332
           + KI HIDMD+F+ASVE  + PE    P+AVG+     V+++A+Y AR  GV+SAM    AK++CPQL  ++     Y  +S +I+      +  IE  S+DE +LDV+  +      ++ A  +K  I+ + NL  + G S+  FLAK+A++  KPDG  T+  D    +I  L I    G+GP   +++  L +H  + +       L+R+  K+G L++   R    GI   P+     RK++G   ++ ++ S+    +  +     ++   L++ DF   ++ +KI++ D    T+S      +  I L V++ L +Q+     Y+    ++I LS++
  S:     8 ERKIIHIDMDAFYASVEQRDNPELRGKPIAVGYAEERGVVSAASYEARRYGVRSAMASTKAKRMCPQLIFVHGRMEVYHEISRQIHEIFHEYTDIIEPLSLDEAFLDVTENKPGILLAVDIAKEIKQKIRNELNLVASAGISYNKFLAKIASDYRKPDGLCTIHPDQAMDFIARLPIESFWGVGPVTAKKMHSLGIHNGEQLRACSQAMLLREFGKVGALYYDCAR----GIDLRPVEAVRIRKSIGCEHTLEKDISQRSSVIIELYHAAVELVGRLEHNDFKGNTLTLKIKFHDFSQITRS--ITQSKELITLDVILPLAKQLLKEVDYEHHPIRLIGLSVS 344
>gi|163724955|ref|ZP_02132482.1| DNA-directed DNA polymerase [Desulfatibacillum alkenivorans AK-01] >gi|161401871|gb|EDQ26112.1| DNA-directed DNA polymerase [Desulfatibacillum alkenivorans AK-01] (501 aa)
Score = 379, Expect = 1.6e-34, Identities = 87/294 (29%), Positives = 163/294 (55%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           +N I H+DMD+F+ASVEL + PE     + VG      V+ SA+Y AR LGV+SAM IV A+K+CP+   +   + +Y  +S K++      +  +E  S+DE ++DV+++        E A+ ++  I+    +  + G +    +AK+A++L KP+G L +  D  + ++  L IS++ G+GP+   +LI L +  I+D+  +  + ++    G +   +     G+   P+ P    K++GR  +  RN    +E  K +  L++ +   ++ ++   ++VNIK++Y+D    T+S
  S:   108 ENLIIHVDMDAFYASVELLDNPELRGQCVIVGGASNRGVVCSASYEARALGVRSAMPIVTARKLCPRGVFLPVRRARYQEISRKVFEIFHQYTPLVEPISLDEAFMDVTSSTRLFGSGEEIAANIRRQIESSLGITASAGIAKNKLVAKIASDLCKPNGLLVVPADQTQEFLDPLPISRLWGVGPASRNKLISLGVKTIRDVRKLTQE-MLSANFGRNGEVIYAFARGMDDRPVEPPGAAKSIGREITFDRNVYTLEEAYKWMLFLSERVARRMRKEEATGRTVNIKVKYADFIQVTRS 405
>gi|166981768|ref|ZP_02253219.1| DNA polymerase IV [Bacillus cereus AH187] >gi|168161476|ref|ZP_02596709.1| DNA polymerase IV [Bacillus cereus H3081.97] (412 aa)
Score = 379, Expect = 1.7e-34, Identities = 107/365 (29%), Positives = 196/365 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIFDSPTQKISTESKLEKIRKQVN 369
           I H+DM+ FFASVE+A     +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++  +  +  L C++G +   FLAK A+++ KP G   L K +    I+ L +  + GIG     +L ++++  I+ +A   N+++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F    ++ + E  L  +  Q+N
  S:    12 ILHVDMNCFFASVEIAHDSSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLIVRRPNFTLYREASFQMFQILSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQVLLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEMIWPLPVGAMHGIGEKTAEKLKDIHIQTIEQLAK-GNEHIIRAKIGKHGVDLQRRAKGVDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLFS--FEEDAKEEPLLAVIDQIN 381
>gi|154486727|ref|ZP_02028134.1| hypothetical protein BIFADO_00552 [Bifidobacterium adolescentis L2-32] >gi|154084590|gb|EDN83635.1| hypothetical protein BIFADO_00552 [Bifidobacterium adolescentis L2-32] (471 aa)
Score = 379, Expect = 1.8e-34, Identities = 88/290 (30%), Positives = 160/290 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYS-FLSSLSKNIETGSIDEWYLDVSNTQYENWKEIE-FASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKK-IGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           + HIDMD+FFAS+E+A  PEY   P+ +G     V+++ANY AR  G+ SAM    A+K+CP    +  + + Y  MS +I++   S ++  IE  S+DE Y+DVS      WK      + +++ + +++++ C+VG +    +AKMA+  AKPDG L +       ++  + +  I GIGPSL ++L    +  + D+A +  + L +     +    L M   G+   P+ P  + K++G  ++  ++  + ++   +++   DD+   L+ +  M + V +K+R+ D   ATK
  S:    51 VLHIDMDAFFASLEVARHPEYADKPVIIGIGNRSVVSAANYEARKYGINSAMASSRARKLCPNGVFLPVDIHYYREMSRRIFTEVFSRVTDRIEQVSVDECYMDVSGALLR-WKSPRAIGAWIRDQVARRYHITCSVGIAANKLVAKMASTNAKPDGMLMIPVARHAEFVQMMPLRGIPGIGPSLEKRLNAWGVDSVADLAKMSMESLEQATGSAISARGLYMAARGLDDRPVAPRAQEKSVGAERTFDKDTQDMRQVTSMLRWCCDDVAGTLRRRGLMARKVMVKLRFPDLSYATK 346
>gi|69246405|ref|ZP_00603927.1| DNA-directed DNA polymerase [Enterococcus faecium DO] >gi|68195277|gb|EAN09729.1| DNA-directed DNA polymerase [Enterococcus faecium DO] (372 aa)
Score = 377, Expect = 3.3e-34, Identities = 99/338 (29%), Positives = 175/338 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQE-FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN--FQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDN 341
           KI HIDMD+FFASVE  + PE+   PL +        G  V+ +ANY AR  G+ SAM+   A ++CPQ      + +KY+ +S ++       +  +E  SIDE YLDV+  +      I+ A +++  I +   L C+ G S+  FLAK+A++  KP G   +   +   ++  L I K  G+G     ++ EL ++  KD+       LIR    + +S  R  V GI   P+N   +RK++G+  +     + +E  L  +++L + +   L+      K+V +K+RY+D  + TK        ++ +   +    ++E+I    K  +++ +++T  + M  +N
  S:    14 KIIHIDMDAFFASVEERDHPEFRGHPLVIARHPSDTGGRGVVTTANYEARKFGIHSAMSAQKAYELCPQAIFKPGDHHKYSDISKQVREVFYRYTDIVEPVSIDEAYLDVTENKINCKSAIKIARMIQADIWESVQLTCSAGVSYNKFLAKLASDYQKPRGITVVAPQDAVPFLKALPIEKFHGVGKKTVPRMHELGIYTGKDLYECTEMMLIRNFGKMGYSLYR-KVRGIHDSPVNVTRERKSVGKEHTYGQPLQTEEAVLTQLRQLAEKVEEALRRVQKHGKTVVLKVRYTDYSTVTKRVTLPEYIYKKEALFYQASLIWEEILGVEKGIRLLGITLTNLDPMTYEN 361
>gi|119025321|ref|YP_909166.1| DNA-damage-inducible protein P [Bifidobacterium adolescentis ATCC 15703] >gi|118764905|dbj|BAF39084.1| DNA-damage-inducible protein P [Bifidobacterium adolescentis ATCC 15703] (471 aa)
Score = 376, Expect = 3.3e-34, Identities = 88/290 (30%), Positives = 160/290 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYS-FLSSLSKNIETGSIDEWYLDVSNTQYENWKEIE-FASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKK-IGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           + HIDMD+FFAS+E+A  PEY   P+ +G     V+++ANY AR  G+ SAM    A+K+CP    +  + + Y  MS +I++   S ++  IE  S+DE Y+DVS      WK      + +++ + +++++ C+VG +    +AKMA+  AKPDG L +       ++  + +  I GIGPSL ++L    +  + D+A +  + L +     +    L M   G+   P+ P  + K++G  ++  ++  + ++   +++   DD+   L+ +  M + V +K+R+ D   ATK
  S:    51 VLHIDMDAFFASLEVARHPEYADKPVIIGIGNRSVVSAANYEARKYGINSAMASSRARKLCPNGVFLPVDIHYYREMSRRIFTEVFSRVTDRIEQVSVDECYMDVSGALLR-WKSPRAIGAWIRDQVARRYHITCSVGIAANKLVAKMASTNAKPDGMLMIPVARHAEFVQMMPLRGIPGIGPSLEKRLNAWGVDSVADLAKMSMESLEQATGSAISARGLYMAARGLDDRPVAPRAQGKSVGAERTFDKDTQDMRQVTSMLRWCCDDVAGTLRRRGLMARKVMVKLRFPDLSYATK 346
>gi|168140124|ref|ZP_02583353.1| DNA polymerase IV [Bacillus cereus G9842] (412 aa)
Score = 376, Expect = 4.2e-34, Identities = 102/344 (29%), Positives = 188/344 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKY----DQVINLSITANNI-MENDNNEQLTIF 348
           I H+DM+ FFASVE+A  P  +  PLAV         +I + +Y AR  G+++ M + +AK++CPQL +  PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+   +  + GIG     +L ++++  I+ +A   ++++IR KIG H   L+    G+    ++P    + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N      +    D+F+  S   K     D V  L +TA  I  + ++ +QL +F
  S:    12 ILHVDMNCFFASVEIAHDPSLQGKPLAVAGNEKERKGIIITCSYEAREYGIRTTMPLWEAKRLCPQLVVRRPNFTLYREASFQMFQVLSRFTEKIQPVSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPELIWPRPVGAMHGIGEKTAEKLNDIHIQTIEQLAK-GDEHIIRAKIGKHGVDLQRRAKGMDDREVDPSQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN-----AIWEERDIFQAASRLWKQHWDGDSVRLLGVTATEIEWKTESVKQLDLF 362
>gi|123443410|ref|YP_001007383.1| DNA polymerase IV [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|189044619|sp|A1JNY3|DPO4_YERE8 DNA polymerase IV (Pol IV) >gi|122090371|emb|CAL13239.1| DNA-damage-inducible protein P [Yersinia enterocolitica subsp. enterocolitica 8081] (352 aa)
Score = 375, Expect = 4.3e-34, Identities = 97/291 (33%), Positives = 155/291 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CPQL +I      Y   S  I    +  +  IE  S+DE YLDVS+ Q  +      A  ++ +I  + NL  + G +   FLAK+A++L KP+G   +T D    ++ DL +SKI G+G    ++L EL L    D+ N     L+ K+ G     L     GI    ++PD  RK++G  Q++  +  +++    LI++L  ++ + L+    D       +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDDPSLRDIPIAIGGSRDRRGVISTANYPARRYGVRSAMPTAMALKLCPQLKVIPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVSDCQACSGSATLIAQEIRQAIAMELNLTASAGIAPIKFLAKIASDLNKPNGQYVITPDQVLPFLRDLPLSKIPGVGKVTAKRLQELGLITCSDVQNYSQAELL-KRFGKFGHVLWERSHGIDEREVSPDRLRKSVGVEQTLAEDIHDWESCESLIEKLYIELETRLRKVRPDLHIARQGVKLKFHDFQQTTQ 300
>gi|20806775|ref|NP_621946.1| nucleotidyltransferase/DNA polymerase involved in DNA repair [Thermoanaerobacter tengcongensis MB4] >gi|22095608|sp|P58965|DPO4_THETN DNA polymerase IV (Pol IV) >gi|20515235|gb|AAM23550.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Thermoanaerobacter tengcongensis MB4] (384 aa)
Score = 375, Expect = 4.8e-34, Identities = 106/355 (29%), Positives = 194/355 (54%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKI 355
           MK KI H+DMD+FFAS+E  + PEY   P+ VG L    V+++ +Y AR  G+ SAM +  AKK+CPQ   +   + +Y  +S++I+  L  ++  +E  SIDE YLDV++   +N ++I     +K  +K    L  +VG S+  FLAK+A++  KPDG + +T+D     +  L ++K+ GIG     +L  + +  ++D+  +  + LI +  G    ++   + GI   P+    + K++G+ +++   ++ +E L + +KE ++ ++  L  +    ++V +KI+ +D    TKS     ++ F   I   V   + E+     +Y ++I LS++    +     EQL+  D    K+
  S:     1 MKRKIIHVDMDAFFASIEQQDNPEYRGKPVIVGGLSGRGVVSTCSYEARKYGIHSAMPMYMAKKLCPQGIFLPVRRKRYEEVSEQIFRILYDITPFVEPVSIDEAYLDVTHVD-KNPEDIALE--IKKRVKDATGLTVSVGISYNKFLAKLASDWNKPDGLMVITEDMVPEILKPLPVTKVHGIGEKSAEKLRSIGIETVEDLLKLPQENLI-ELFGKTGVEIYNRIRGIDERPVETMREIKSIGKEKTLEKDTKNKELLIQHLKEFSEIVSEELIKERLYCRTVTVKIKTADFAVHTKSKTVDKYIRFSEDI-YEVAKGILEEWK-LEQYVRLIGLSVSN---LSPVKYEQLSFLDKRLVKV 354
>gi|148263204|ref|YP_001229910.1| DNA-directed DNA polymerase [Geobacter uraniireducens Rf4] >gi|146396704|gb|ABQ25337.1| DNA-directed DNA polymerase [Geobacter uraniireducens Rf4] (408 aa)
Score = 374, Expect = 6.6e-34, Identities = 95/303 (31%), Positives = 157/303 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           +  I HIDM++FFASVE    P     P+AV       +I +A+Y ARG GVK+ M I +A++ CP L  +  N  +YTS+S +I + L   +  +E  SIDE +LD++ +          A L+K  I+ +F L C++G +    LAK+A+ + KPDG   + ++   + + +L I ++ GIG    R L  L +    ++       L R + G+   KL    LGI   P+ P       K++G S ++ R+ +E  E L ++  L + +    +      K+V + IRY+D  + +      N+ NQ
  S:     3 QRTILHIDMNAFFASVEQQTDPALRGKPVAVTGKSARTIILTASYEARGYGVKTGMRIFEARQKCPDLICVPGNNRRYTSISRRIMAMLHDYTPLVEVFSIDEAFLDITGSLRLFGSASRIAHLIKARIRHRFGLTCSIGIAPNKLLAKLASEMKKPDGLTVIHQERVAAILENLPIRELCGIGRQTERTLTLLGIRTCGELGRFPVHILTR-RFGVVGEKLHRMGLGIDDAPVVPAEAAPDVKSVGHSTTLERDITERGEILAILLRLAEMVGRRARKHAVAGKTVTLTIRYADFSTFSLQATAGNYTNQ 312
>gi|168213536|ref|ZP_02639161.1| DNA polymerase IV [Clostridium perfringens CPE str. F4969] >gi|168217689|ref|ZP_02643314.1| DNA polymerase IV [Clostridium perfringens NCTC 8239] >gi|170714869|gb|EDT27051.1| DNA polymerase IV [Clostridium perfringens CPE str. F4969] >gi|182380253|gb|EDT77732.1| DNA polymerase IV [Clostridium perfringens NCTC 8239] (359 aa)
Score = 374, Expect = 6.8e-34, Identities = 115/346 (33%), Positives = 191/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF---QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN---DNNEQLTIFD 349
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I +L I K  G+G     +L  + +   +D+     + LI     R KI   +++      GI   P+NP   RK++G+  ++R +  +  E ++++  +   I+  L   +   K+V +K++++D    T+S    +F   Q +I +  V DL   I DF K  +V  L IT +++ EN   +  EQL+ FD
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGQPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNLVEPLSLDEAFVDVSKSKRCKGSATLIALEIKERIFKEVGLTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRNLPIGKFFGVGRVTKNKLNNIGIFKGEDLLKFSEEELIDIFSDRGKILYEFAR------GIDNRPVNPYRIRKSIGKEITLREDIEDIDEMIEILDRIAGRISESLCLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEQKEI-MECVKDLI-SIVDF-KNKKVRLLGITISSLEENIITEEREQLS-FD 358
>gi|167763232|ref|ZP_02435359.1| hypothetical protein BACSTE_01604 [Bacteroides stercoris ATCC 43183] >gi|167698526|gb|EDS15105.1| hypothetical protein BACSTE_01604 [Bacteroides stercoris ATCC 43183] (365 aa)
Score = 373, Expect = 9.4e-34, Identities = 106/345 (30%), Positives = 188/345 (54%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYD----QVINLSITANNIMENDNN---EQLT 346
           + KI HIDMD+F+ASVE  + PE    P+AVGH     V+A+A+Y AR  GV+SAM+   AK++CPQL  I    + Y S+S +I+      +  IE  S+DE +LDV+  +      ++ A  +K  ++++ +L  + G S+  FLAK+A++  KPDG  T+  D    +I  L I    G+GP   R++  L +H    +       L+R+  K+G +++   R    GI   P+     RK++G   ++ ++ +     +  +     ++ + L++++F   ++ +KI++ D    T+S      +    L V++ L +Q+     Y+    ++I LS++ N   E+D     EQL+
  S:     3 ERKIIHIDMDAFYASVEQRDNPELRGKPVAVGHAEERGVVAAASYEARRFGVRSAMSSQKAKRLCPQLIFIPGRMDVYKSVSRQIHEIFHEYTDVIEPISLDEAFLDVTENKPGILLAVDIAREIKRKVRERLSLVASAGVSYNKFLAKIASDYRKPDGLCTIHPDQALDFIAHLPIESFWGVGPVTARKMHVLGIHTGGQLRACSQAMLLREFGKVGNIYYDFAR----GIDLRPVEAVRIRKSVGCEHTLEKDINRRSSVIIELYHTAVELVTRLEHKNFRGNTLTLKIKFHDFSQITRS--VTQSRELTALDVILPLAKQLLREVDYEHHPIRLIGLSVS-NPREESDEKGVWEQLS 355
>gi|110799334|ref|YP_696252.1| DNA polymerase IV [Clostridium perfringens ATCC 13124] >gi|123344702|sp|Q0TQ38|DPO4_CLOP1 DNA polymerase IV (Pol IV) >gi|110673981|gb|ABG82968.1| DNA polymerase IV [Clostridium perfringens ATCC 13124] (359 aa)
Score = 372, Expect = 1.0e-33, Identities = 113/346 (32%), Positives = 193/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF---QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN---DNNEQLTIFD 349
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I ++ I K  G+G     +L  + +   +D+     + LI     R KI   +++      GI   P+NP   RK++G+  ++R +  +  E +++++ + + ++  L   +   K+V +K++++D    T+S    +F   Q +I +  V DL   I DF K  +V  L IT +++ EN   +  EQL+ FD
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGKPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNLVEHLSLDEAFVDVSKSKRCKGSATLMALEIKERIFKEVGLTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRNIPIGKFFGVGRVTKNKLNNIGVFKGEDLLKFSEEELIDIFSDRGKILYEFAR------GIDNRPVNPYRIRKSIGKEITLREDIEDIDEMIEILERIAERVSESLCLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEQKEI-MECVKDLI-SIVDF-KNKKVRLLGITISSLEENIITEEREQLS-FD 358
>gi|78222653|ref|YP_384400.1| UMUC-like DNA-repair protein [Geobacter metallireducens GS-15] >gi|78193908|gb|ABB31675.1| UMUC-like DNA-repair protein [Geobacter metallireducens GS-15] (407 aa)
Score = 372, Expect = 1.1e-33, Identities = 106/358 (29%), Positives = 188/358 (52%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSN--TQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHV--VVDLFE---QISDFSKYDQVIN-LSITANNIMENDNNEQLTIFDSPTQKISTESKLEKI 364
           H+DM++FFASVE    P     P+AV       VI +A+Y AR  GVK+ M +  A++ CPQ+ ++  +  KYT  S +I   +   +  +E  SIDE +LDV+   + Y + + I F  L+K  I+  F L C++G +    LAK+A+ + KPDG   +  D+    +  L I ++ GIG  +  QL  L +    ++     D L+R K G+   KL +   GI   P+ P  +    K++G S ++  +  + +E L+ + +L++ +    +  +   K+V + IRY+D D+      +V  Q  +P H+    D++     I D    +Q +  L +  +N+    N  QL +F+   +K+     ++++
  S:     2 HVDMNAFFASVEQQHDPALRGKPIAVIGSAARTVITTASYEARAFGVKTGMTVWQAQQKCPQIILVTGDNRKYTYTSARIVEMMKQFTPLVEVFSIDEAFLDVTGSLSLYSSAERIAF--LLKAEIRHHFGLTCSIGIAPNKLLAKLASEMKKPDGLTVIKPDDVAPVLETLPIKELCGIGAKMECQLNLLGIRTCGELGRYPVDRLMR-KFGIVGEKLHLMGQGIDDSPVVPHEEAEEVKSVGHSTTLEHDIEDRREILRWLLQLSEMVGRRARRYNVWGKTVTLSIRYADFDT------WVGRQETLPHHINQSDDIYRAAVAILDTLVLEQPVRLLGVRLSNLRYESN--QLPLFEEERKKVLLAGAMDQV 364
>gi|169350490|ref|ZP_02867428.1| hypothetical protein CLOSPI_01258 [Clostridium spiroforme DSM 1552] >gi|169292810|gb|EDS74943.1| hypothetical protein CLOSPI_01258 [Clostridium spiroforme DSM 1552] (407 aa)
Score = 371, Expect = 1.5e-33, Identities = 104/350 (29%), Positives = 194/350 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT-QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR-KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVIN-LSITANNIME-NDNNEQLTIFDSPTQK 354
           IFHID+++F+AS E+A  P+ +  PL +       +I +A+Y AR  G+ SAM +  A + C  L ++  +   Y  +S+  ++ ++S S  +E  SIDE Y+DV+   Q  N+  I+ A  ++  + ++ +L C++G S   FLAKMA+++ KP G   LT+ N K  ++ L I  + G+G   T +L E  ++ IKDIA+  N  ++R+ +G +   L     GI    ++P     K++G S ++  + S+       +K+L   ++S  K ++ +  S++I I+Y+  +S ++     ++ N     +++   + + D +   + +  L ++ NN ++  D  EQL+IFDS   K
  S:    10 IFHIDLNAFYASAEIARNPKLKNKPLVISGQSRRSIITTASYEARKFGIHSAMPLFQAYQKCKDLIVLPVDFEYYHQLSNDFFNIIASYSDVLEVASIDECYVDVTKIIQERNFHPIKLAKEIQQDVYRQLHLKCSIGISPNKFLAKMASDMKKPMGITILTRSNLKELMWPLDIQNMFGVGKKTTIKLKEAGINTIKDIADYSNYDILRQIVGKNALLLYRKANGIDSRMVDPQQNELKSVGNSTTLPYDTSDEVILYDTLKKLAKKVSSRAKNRNLISNSISITIKYTRFESISRQTTINSYIND--YEIILSTAKMLFDANYNGRAVRLLGVSLNNTIDKKDYKEQLSIFDSSNDK 366
>gi|168209362|ref|ZP_02634987.1| DNA polymerase IV [Clostridium perfringens B str. ATCC 3626] >gi|170712467|gb|EDT24649.1| DNA polymerase IV [Clostridium perfringens B str. ATCC 3626] (359 aa)
Score = 369, Expect = 2.4e-33, Identities = 111/346 (32%), Positives = 192/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF--QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN---DNNEQLTIFD 349
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I ++ I K  G+G     +L  + +   +D+     + LI     R KI   +++      GI   P+NP   RK++G+  ++R +  +  E +++++ + + ++  L   +   K+V +K++++D    T+S    +F  + +  +  V DL   I DF K  +V  L IT +++ EN   +  EQL+ FD
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGKPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNLVEPLSLDEAFVDVSKSKRCKGSATLMALEIKERIFKEVALTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRNIPIGKFFGVGRVTKNKLNNIGVFKGEDLLKFSEEELIDIFSDRGKILYEFAR------GIDNRPVNPYRIRKSIGKEITLREDIEDIDEMIEILERIAERVSESLCLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEKKEIMECVKDLI-SIVDF-KNKKVRLLGITISSLEENIITEEREQLS-FD 358
>gi|58336751|ref|YP_193336.1| DNA-damage-inducible protein [Lactobacillus acidophilus NCFM] >gi|58254068|gb|AAV42305.1| DNA-damage-inducible protein [Lactobacillus acidophilus NCFM] (412 aa)
Score = 369, Expect = 2.5e-33, Identities = 111/346 (32%), Positives = 192/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIY--PNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYK--RKNLG--RSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK-------SFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFD 349
           +I H+DMD+F+ASVE+   PEY+   L VG        H V+A+ NYVAR  GV SAM  + A ++ P+  I++  P+   Y S+S +I+SF+  ++  +E+ ++DE YLDV+  +   +  ++ A  ++  I+ + NLN + G S+  FLAKM +  AKP G + +  D  K ++    I K  GIGP    +L  +N+H   D+  + + +++ KK       L  +  GI   PI  D +  RK++G  R+     YS   E L  ++     +   LK +DF    V +K+R ++ ++ TK       S +++ F +     +V  LF+  S F + + +  L +T  +  + +N + + +FD
  S:    54 RIIHLDMDAFYASVEINRHPEYKDKALVVGQDPRDNNGHGVVATCNYVARKYGVHSAMASIQALRLVPKDKIVFVPPDFETYRSVSAQIHSFMHEITDQVESIALDEAYLDVTKNKIGEYSAVQIALNLQKRIRAELNLNSSFGVSYNKFLAKMGSEYAKPFGRVVILPDEAKRFLGMQRIEKFPGIGPKTQEELHSMNVHTGADLQKI-DPWILLKKFKKMGYILAQHAHGIDLRPIVADSEINRKSIGIERTYEPAIYSR-DEALTKMRRYCKHLEGELKKRDFRANVVVLKLRDNNFNTITKRKKLPSSSDSYLEFYD-----IVQGLFDSTSGFLE-EGIRLLGVTVTD-FKKENYQSINLFD 411
>gi|163790782|ref|ZP_02185208.1| DNA-damage-inducible protein P [Carnobacterium sp. AT7] >gi|159873962|gb|EDP68040.1| DNA-damage-inducible protein P [Carnobacterium sp. AT7] (377 aa)
Score = 369, Expect = 2.6e-33, Identities = 102/338 (30%), Positives = 181/338 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF---NFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDN 341
           KI HIDMD+FFASVE  E P+ +  P+ +        G  V+A+ANY AR  GV SAM+   A ++CP    I  +   Y  +S ++ +     +  IE  S+DE YLDV+  +      I  A L++  I Q+  L  + G S+  F+AK+A++  KP G   +  D    ++ +L I K  G+G     ++ EL ++  +D+   K++  + ++ G     L   V GI   P+    +RK++GR  +  +N +  QE L  ++ + + +   L+      K+V +K+RYS+ ++ATK     N+V    +I  H   +++++I   S+  +++ +++T  + M  +N
  S:    18 KIIHIDMDAFFASVEERENPDLKGKPVIIARHPKETGGKGVVATANYEARKFGVHSAMSAQKAFELCPHGNFISGHYELYREISKQVRAIFERYTDIIEPLSLDEAYLDVTENKKNLTSAIYIAKLIQRDIWQEVRLTSSAGVSYNKFIAKLASDYHKPAGITVIPPDKALEFLRELPIEKFYGVGKKTVEKMHELGIYTGEDLYQ-KDEMELIQRFGRMGYSLYRKVRGIDNAPVQVSRERKSVGRELTYGKNLTTEQEVLSELRFIANKVQLSLQKNQKHGKTVVLKVRYSNFETATKRITLPNYVKDGEEIFFH-AQNIWDEIGVISRGIRLLGITVTNLDPMAYEN 365
>gi|138895203|ref|YP_001125656.1| DNA polymerase IV [Geobacillus thermodenitrificans NG80-2] >gi|196248210|ref|ZP_03146911.1| DNA-directed DNA polymerase [Geobacillus sp. G11MC16] >gi|134266716|gb|ABO66911.1| DNA polymerase IV [Geobacillus thermodenitrificans NG80-2] >gi|196211935|gb|EDY06693.1| DNA-directed DNA polymerase [Geobacillus sp. G11MC16] (409 aa)
Score = 368, Expect = 2.9e-33, Identities = 88/291 (30%), Positives = 165/291 (56%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARG-LGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINP--DYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           IFH+D +SFFAS E+A  P  +K P+ V         ++ +A+YVA+   G+ + M + +AKK CP L +  P+   Y  +S +++  L   S  +E  SIDE YLD++  +      +  A  ++  + ++ ++  ++G +   FLAKMA+++ KP G   L K +    ++ L +  + G+G  + ++L  L+LH I DIA    + L R+  G++  +L+    GI   P++P    KRK++G S ++  +  E Q  L ++++L + +++ +  +  + ++V + IRY D  + T+S
  S:    12 IFHVDANSFFASCEIARDPSLQKKPVVVAGDPKERKGIVLAASYVAKQQFGIYTTMPLWEAKKRCPSLVVRPPDFALYREVSRRLFQCLQRFSPVLERASIDEGYLDMTG-RTSTVHPLALAHHIQQELLERLSIPVSIGIAPNKFLAKMASDMKKPLGITVLRKRDVPRVLWPLPVEHMHGVGDKMAKKLHALDLHTIGDIAKADRERL-RQTFGIYGLRLQEKANGIDPRPVDPVAAEKRKSIGHSTTLPYDMDEEQNLLVVLRQLAESVSARMNEKRVVSRTVQLTIRYYDFQTITRS 310
>gi|160915110|ref|ZP_02077323.1| hypothetical protein EUBDOL_01118 [Eubacterium dolichum DSM 3991] >gi|158432909|gb|EDP11198.1| hypothetical protein EUBDOL_01118 [Eubacterium dolichum DSM 3991] (389 aa)
Score = 368, Expect = 3.0e-33, Identities = 104/369 (28%), Positives = 190/369 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNN-EQLTIFDSPTQKISTE-SKLEKIRKQVNKTLN 373
           IFHID++SFFAS E+ +    E  P+ V  +    V+++A+Y AR  GV SAM +  A + CPQL ++  +   Y  +S + ++++   S  +E  SIDE Y+DV+       + ++ A  ++  + +   L C++G   + FLAKMA+++ KP G   L +   +  ++ L I+ + GIG      L    ++ I D AN  N+  I   +G H  +L  N  G   + ++ +   +++ +S ++  N  EY+E   + K L + ++   K +D     ++I IRY+D  +A +S     + N   + L   + LF+Q    +   ++ +L I   ++       +Q+ +F    Q +  E +    I KQ+NK L+
  S:     6 IFHIDLNSFFASAEVLKNSALEGQPVVVAGMHRRSVVSTASYEARNYGVHSAMPLHMALEKCPQLVVVQGDYAWYEELSRRFFNYVKRFSPYLEPASIDECYIDVTEAIRAYKRPLDLAWRIQKGVYEDLRLPCSIGVGPSKFLAKMASDMRKPMGITVLRRQEIERKLWPLSIADMFGIGKKTVPLLERQGIYTIGDFANPANEAKIMALMGKHAYQLIQNARGFGSNRLDYNTSVQSISQSTTLDTNIVEYEEVKSVFKRLANKLSQRAKQEDLRGALISISIRYADFTNAVRSTTISEYTNDADVLLEHALLLFDQ---HNNGKEIRHLGIGLGSLFSKTRTVDQINLF----QDVKAEPTDSTDILKQLNKQLS 376
>gi|15614035|ref|NP_242338.1| DNA polymerase IV [Bacillus halodurans C-125] >gi|22095640|sp|Q9KCU7|DPO41_BACHD DNA polymerase IV 1 (Pol IV 1) >gi|10174089|dbj|BAB05191.1| BH1472 [Bacillus halodurans C-125] (413 aa)
Score = 368, Expect = 3.1e-33, Identities = 93/291 (31%), Positives = 160/291 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLV------IASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           IFH+DM+SF+ASVE+A  P  +   +AV   V      + +++Y AR  GV+S + +  A + CP+L +I PN ++Y S S KI+S L   +  +E  SIDE Y+DV+ T  +    +E A  ++  I  + +L C++G +   FLAKMA+++ KP G   L K +    ++ L I ++ GIG        +  LH I D+A     +L  KK G++  +L     GI   P++P+  +  K++G S ++  + +       ++ +L+  ++  +K +      V + IRY D  + T+S
  S:     7 IFHVDMNSFYASVEMAYDPSLKGKAIAVAGSVKDRRGIVVTSSYEARAKGVRSPIPVWQALRKCPELILIPPNFDRYRSASQKIFSLLEEYTPLVEKVSIDEGYMDVTTT-IKKVHPLELAKEIQQRILAEMDLPCSIGIAPNKFLAKMASDMKKPLGITVLRKRDIAEKLWSLPIEEMYGIGRRSVDTYKKYQLHTIGDLAKADPAWL-EKKFGINGPRLHCRANGIDERPVDPEAVFHFKSVGNSTTLPEDTTNEGRLTDVLHQLSHSVHVRMKRKHVFCYGVQLTIRYDDRKTITRS 304
>gi|50955060|ref|YP_062348.1| DNA polymerase IV [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951542|gb|AAT89243.1| DNA polymerase IV [Leifsonia xyli subsp. xyli str. CTCB07] (414 aa)
Score = 368, Expect = 3.2e-33, Identities = 99/360 (27%), Positives = 178/360 (49%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKI 364
           I H+DMD+FFA+VEL +RP+    P  VGH     V+ SA Y AR  GV+SAM +  A ++CP   I+ P+ +KYT  S ++      ++  +E  SIDE +LD++  +         A L+++ ++++  L C+VG + T FLAK+A+  AKPDG L +   +  +Y+  L +  + G+G S    L  + +  + D+A+     L R        +L     G     I  + + K++G   +   +  +  E  + +  L+  +   L+      ++V IK+R+SD  + ++S       N  +       D+FE I    +   +  + + A  + +    + L ++DS  +   TE  L+ +
  S:    13 ILHVDMDAFFAAVELLDRPDARGKPAIVGHAGGRGVVTSATYEARKFGVRSAMPVSQALRLCPTAIILPPHYDKYTECSRRVMGIFHEITPLVEPLSIDEAFLDIAGARRLLGPPRRIAELIRSRVREETGLTCSVGVAGTKFLAKLASGRAKPDGLLVIPPADAIAYLRPLPVGALWGVGSSTQASLERMGMRTVADLADAPLPVLERAVGKASAHRLHELANGRDARTIVTESREKSIGHENTFPVDVDDPGELRRELLRLSGRVGERLRKHGMAGRTVAIKVRFSDFRTLSRSRTLKEPTNVGRRLFEEAWDVFEAIGIHLRETPIRLIGVRAEQLADT-GGDALALWDSDEEWRQTERALDAV 378
>gi|189461486|ref|ZP_03010271.1| hypothetical protein BACCOP_02145 [Bacteroides coprocola DSM 17136] >gi|189431820|gb|EDV00805.1| hypothetical protein BACCOP_02145 [Bacteroides coprocola DSM 17136] (374 aa)
Score = 367, Expect = 4.3e-33, Identities = 101/311 (32%), Positives = 174/311 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLF 314
           KI HIDMD+F+ASVE  + P+ +  P+AVGH     V+A+A+Y AR  GV+SAM+ V A KICP+L  +    + Y S+S +I+      +  IE  S+DE +LDV+  + +    ++ A  +K  I+++ NL  + G S+  FLAK+A++L KPDG  T+  D  + +I  L I    G+GP   +++  L ++    + N   + L R+  K+G +++   R    GI   P+     RK++G   ++ ++ S     +  +  +  ++   LK +DF   ++ +K+++ D    T+S + VN Q    LH + D+ 
  S:    14 KIIHIDMDAFYASVEQRDNPDLKGKPVAVGHSEKRGVVAAASYEARKYGVRSAMSSVKALKICPELIFVEGRMDVYKSVSAQIHEIFHEYTDIIEPISLDEAFLDVTENKKDIKLAVDIAREIKIRIRKELNLVASAGISYNKFLAKVASDLRKPDGLCTIHPDQAEEFIAGLPIEAFWGVGPVTAKKMHTLGIYNGSTLRNCSLEMLTRQFGKMGQVYYDFAR----GIDNRPVEAIRIRKSIGCEHTLEKDISLKSSVIIELYHVACELAERLKAKDFQGSTLTLKVKFHDFTQITRSIS-VNKQ----LHTLQDIL 323
>gi|84388967|ref|ZP_00991175.1| putative DNA-damage-inducible protein P [Vibrio splendidus 12B01] >gi|84377031|gb|EAP93903.1| putative DNA-damage-inducible protein P [Vibrio splendidus 12B01] (353 aa)
Score = 366, Expect = 5.4e-33, Identities = 97/283 (34%), Positives = 158/283 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSE--------YQEFLKLIKELTDD---INSG--LKYQDFMFKSVNIK 283
           M  KI HID+D ++A+VE+ + PE   +PLA+G       VI++ NY+AR  GV+SAM    A K+CP L +I  +  KY ++S +I++  +  +  IE  S+DE YLDV+++Q         A  ++ +I+ + NL  + G +   F+AK+A+++ KP+G   +T D    ++ DL +  I G+G     +L  L L+   D+ N  + +++ K  G   S L     GI    + P   RK+LG     +Q I   SE        Y E ++   +++ D   I  G  LK+ DF   +V  K
  S:     1 MLKKIIHIDLDCYYAAVEMRDYPELRDIPLAIGGSQNQRGVISTCNYIARKYGVRSAMATAHALKLCPNLMVIGGDMEKYKAVSKQIHAIFARYTDLIEPISLDEAYLDVTDSQLFRGSATLIAEDIRKAIESELNLTASAGIAPIKFVAKVASDINKPNGICVVTPDEIDRFVNDLELGLIPGVGKVTLEKLHNLGLYQGIDVKNY-DQHMLLKHFGKFGSSLWERCHGIDRREVTPTRIRKSLGVERTFAQDILTESECLEVIESLYDELVRRFSKVSQDKRIIRQGLKLKFDDFQQTTVEHK 304
>gi|171324034|ref|ZP_02912551.1| DNA-directed DNA polymerase [Geobacillus sp. WCH70] >gi|171090003|gb|EDT36317.1| DNA-directed DNA polymerase [Geobacillus sp. WCH70] (414 aa)
Score = 365, Expect = 6.9e-33, Identities = 91/298 (30%), Positives = 175/298 (58%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARG-LGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN-FQ 302
           IFH+D +SFFAS E+A  P  +   + V         V+ +ANY+A+   G+ + M + +AKK CPQL ++ P+ + Y  +S+K++ FL++ +  +E  SIDE YLD+++  Y     ++ A  ++  + Q  ++  ++G +   FLAKMA+N+ KP G   L K +    ++ L + ++ GIG    ++L  + +  I ++A  +    ++  +G+   +L+    GI   P++P+   K K++G S ++ RN +E +  L+++++L   +++ +K +  +  +V I IRYS+  + T+S  + N FQ
  S:    12 IFHVDCNSFFASCEIARDPSLKGKAVVVAGDPKERKGVVLAANYIAKQRFGIYTTMPLWEAKKRCPQLVVLKPDFHLYREISEKVFQFLATFTPVLERASIDEGYLDITDC-YSLGSPLDIAEQIQKELLQTLHIPVSIGIAPNKFLAKMASNMKKPLGITVLRKRDVPKVLWPLPVQEMHGIGDKTAKKLNSIGIFTIGELAKAEK-VTLQNLLGITGVRLKEWANGIDPRPVDPESGEKWKSIGSSTTLPRNVTEERILLEVLRDLAQSVSNRMKQKGVVSSTVQIMIRYSNFQTITRSKTWENPFQ 318
>gi|161506978|ref|YP_001576932.1| DNA-damage-inducible protein [Lactobacillus helveticus DPC 4571] >gi|160347967|gb|ABX26641.1| DNA-damage-inducible protein [Lactobacillus helveticus DPC 4571] (406 aa)
Score = 365, Expect = 7.7e-33, Identities = 113/346 (32%), Positives = 188/346 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICP--QLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPI--NPDYKRKNLG--RSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHV--VVDLFEQISDF-SKYDQVINLSITANNIMENDNNEQLTIFD 349
           +I H+DMD+F+ASVE    PE +   L +G        H V+A+ NYVAR  GV SAM  + A K+ P  +L  + P+  KY S+S KI+SF+  ++  +E+ ++DE YLDV++ +      ++ A  ++  I+ +  LN + G S+  FLAKM +  AKP G   +     K ++    I K  G+GP    QL E+ ++   D+  V +  LI+  KK+G     L  +  GI   P+  + D  RK++G  R+     Y+   E L  I+     +   LK ++F  ++V IK+R +D D+ TK        N    +     +LF++ S+F  K  ++I +++T     + D  + + +FD
  S:    48 RIIHLDMDAFYASVETQRNPELKNKALVIGQDPRNNGGHGVVATCNYVARKYGVHSAMPAIKAVKLIPKSELVFVRPDFKKYRSVSAKIHSFMHEITDKVESIALDEAYLDVTHNKLGQNLAVQVAIGLQRRIRTELGLNSSFGVSYNKFLAKMGSEYAKPFGRTVILPYEAKQFLGMQKIEKFPGVGPKTQEQLHEMGIYTGADLQKVADFVLIKKFKKMGYF---LAQHAHGIDLRPVIADSDTNRKSIGMERTYEPAIYTR-DEALTHIRHYCKHLEDELKKRNFFAQTVVIKVRDNDFDTVTKRRKLTKPSNSQYDYYDSARELFDKTSNFLEKGIRLIGVTVTD---FKKDEYQTINLFD 405
>gi|160887214|ref|ZP_02068217.1| hypothetical protein BACOVA_05231 [Bacteroides ovatus ATCC 8483] >gi|156107625|gb|EDO09370.1| hypothetical protein BACOVA_05231 [Bacteroides ovatus ATCC 8483] (363 aa)
Score = 365, Expect = 8.0e-33, Identities = 102/331 (30%), Positives = 176/331 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQ----VINLSIT 332
           + KI HIDMD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV+SAM    AK++CPQL  +    + Y S+S +I+      +  IE  S+DE +LDV+  + +    ++ A  +K  I+++ NL  + G S+  FLAK+A++  KPDG  T+  +    +I  L I    G+GP   +++  L +H    +     + L     K   L++   R    GI   P+     RK++G  +++ R+ S     +  +  +  ++   L+ +DF   ++ +KI++ D    T+S      Q    L  V+ L +++    +++Q    +I LS++
  S:     3 QRKIIHIDMDAFYASVEQRDNPELRGKPLAVGHAEERGVVAAASYEARRYGVRSAMASQKAKRLCPQLIFVPGRMDVYKSVSRQIHEIFHEYTDIIEPLSLDEAFLDVTENKKDISLAVDIAKEIKQKIREQLNLVASAGVSYNKFLAKIASDYRKPDGLCTIHPEQALDFIARLPIESFWGVGPVTAKKMHLLGIHNGLQLRKCSLEMLTAHFGKAGALYYECSR----GIDERPVEAIRIRKSIGCERTLERDISARSSVIIELYHVAVELIERLQRKDFKGNTLTLKIKFHDFSQITRS--LTQSQELTTLDRVLPLAKELLKSVEFEQHPIRLIGLSVS 339
>gi|171911427|ref|ZP_02926897.1| DNA polymerase IV [Verrucomicrobium spinosum DSM 4136] (361 aa)
Score = 363, Expect = 1.2e-32, Identities = 97/292 (33%), Positives = 158/292 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIE--------FASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFK-SYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           + H+DMD+FFAS+E  + PE++  P+ VG       V+ +A+Y AR   V SAM    A K+CPQ   + P  + Y + S KI   L + S  IE  S+DE YLDVS + Y+N+ + +         A  +K  IKQ+  L  TVG     FLAK+ +   KPDG LTL ++  K +++  L +  I G+GP   ++L E     + D+   +    +   +G   + L+   LG    P++P  +RK++    +  N ++ +  L+  +KEL  D+   L  +     ++ +K+RYSD  + T+  
  S:     7 VMHVDMDAFFASIEQRDHPEFQGKPVIVGSPPDQRGVVCAASYEARAFKVHSAMPSRTAGKLCPQGIFVRPRMSVYRAESAKIMQVLQNFSACIEQVSVDEAYLDVSPS-YQNYDDQDTALEAAETMAREIKARIKQEVQLTATVGLGSNKFLAKLGSGFQKPDG-LTLIRERDKIAFLRPLPVGAIHGVGPVTAKELNERGFMTVGDLQ--ETTIPLTDILGSWSATLKQRALGTDERPVDPTDERKSISSENTFLNDTDDRPTLRAALKELALDVAQTLGKEGVGALTIQVKVRYSDFTTLTRQL 309
>gi|85859606|ref|YP_461807.1| DNA polymerase IV [Syntrophus aciditrophicus SB] >gi|85722697|gb|ABC77640.1| DNA polymerase IV [Syntrophus aciditrophicus SB] (362 aa)
Score = 363, Expect = 1.3e-32, Identities = 90/292 (30%), Positives = 160/292 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           +I HIDMD+FFASVE   +PE +  P+ +G +       V+++ANY AR  G+ SAM +  A K+CP+   +  +   Y ++S    + L +++  +E   IDE YLD+S  +  + K    +  +K  I +K  L C++G +    LAK+A+++ KPDG    + ++ ++ ++ L I K+ GIGP     L  LN+  I  +A +  + L+ +    +   L     GI   PI   ++ K+  R  + + +   +Q   + + ELT ++ S L  + +  ++V +KIRYSD  + T++
  S:    15 RILHIDMDAFFASVEENRKPELKGKPVVIGGMGDPSKRGVVSTANYEARKYGISSAMPLRTAYKLCPRAIFLPVDYKAYLAVSRYFKAVLLNITTIMEDVGIDEAYLDISENRDTDEK---ISEKIKTGIYEKTGLTCSIGIAPNKLLAKIASDMNKPDGLTIFSGEDIENRLWPLPIRKLYGIGPKTEEHLKALNIATIGQLAALPPEVLVARFGPSYGHYLHEASRGIDESPIITSWEPKSFSREITFQVDEKNWQAIARTLAELTKEVVSDLAEKGYAARNVILKIRYSDFRTVTRA 311
>gi|50122391|ref|YP_051558.1| DNA polymerase IV [Pectobacterium atrosepticum SCRI1043] >gi|81644156|sp|Q6D1H8|DPO4_ERWCT DNA polymerase IV (Pol IV) >gi|49612917|emb|CAG76367.1| DNA polymerase IV [Erwinia carotovora subsp. atroseptica SCRI1043] (352 aa)
Score = 362, Expect = 1.5e-32, Identities = 95/291 (32%), Positives = 157/291 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD F+A++E+ + P    +PLA+G       VI++ANY AR  GV+SAM    A ++CP LT++      Y S S +I    S  +  IE  S+DE YLDV+++ + N      A  ++ +I  + NL  + G +   FLAK+A+ L KP+G   +T +    ++  L + KI G+G    ++L E  LH   D+       L++   K G + W + +    GI    I+PD +RK++G     +Q I N+ + +    LI++L  ++   LK    D       +K+++ D    T+
  S:     3 KIIHVDMDCFYAAIEMRDNPRLRDIPLAIGGSADRRGVISTANYPARRYGVRSAMATATALRLCPHLTLLPGRMEVYKSTSRQIREIFSRYTSLIEPLSLDEAYLDVTDSPHCNGSATRIAEEIRRTIADELNLTASAGIAPIKFLAKVASELNKPNGQYVITPEQVDDFLLALPLEKIPGVGKVTAKRLEERGLHTCADVRVYALADLLKAFGKFGRVLWERCQ----GIDDRQISPDRQRKSVGVEKTLAQDIHNWDQCE---NLIEQLYQELEVRLKRVKPDLHIARQGVKLKFDDFQQTTQ 300
>gi|88804692|ref|ZP_01120212.1| DNA polymerase IV [Robiginitalea biformata HTCC2501] >gi|88785571|gb|EAR16740.1| DNA polymerase IV [Robiginitalea biformata HTCC2501] (366 aa)
Score = 362, Expect = 1.8e-32, Identities = 93/298 (31%), Positives = 164/298 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF 301
           KI HIDMD+FFASVE  ++PE    P+AVG      V+A+A+Y AR  GV+SAM+ V A+++CP+L  + P  ++Y  +S +I       +  +E  S+DE YLDV+     N K +  A+L+   I+++      L  + G S   F+AK+A++  KP+G  T+  ++ + ++  L I K  G+G     ++  L +    D+      +L     K G H+ ++   V G+   P+ P    K+LG  ++   N S     ++ + ++ ++++  L+ ++   K++ +KIRYSD    T+S     +
  S:     9 KIIHIDMDAFFASVEQRDQPELRGRPIAVGGGAKRGVVAAASYEARTFGVRSAMSGVQARRLCPELVFVKPRFDRYREVSRQIRGIFLEYTDLVEPLSLDEAYLDVT----ANRKGMPSATLIAREIRRRILEETGLTASAGISVNKFIAKVASDFNKPNGQKTVPPEDVQEFLESLEIRKFHGVGKVTAEKMNALGIFTGADLRRQSEHFLTGHFGKSGHHYYRV---VRGVHDSPVQPSRVPKSLGAERTFSENLSSEVFMVEKLTKIAEELSRRLRTRNRSGKTITLKIRYSDFSLQTRSRTLAEY 310
>gi|77957138|ref|ZP_00821202.1| COG0389: Nucleotidyltransferase/DNA polymerase involved in DNA repair [Yersinia bercovieri ATCC 43970] (352 aa)
Score = 361, Expect = 2.0e-32, Identities = 95/291 (32%), Positives = 155/291 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CPQL +I      Y   S  I    +  +  IE  S+DE YLDVS+    +      A  ++ SI  + NL  + G +   FLAK+A++L KP+G   +T D    +++DL +SKI G+G    ++L E+ L    D+ N     L+ K+ G     L     GI    ++PD  RK++G  +++  +  +++    LI++L  ++ + L+    D       +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDDPGLRDIPIAIGGSRDRRGVISTANYPARRYGVRSAMPTAMALKLCPQLKVIPGRMAAYKEASLHIREIFARYTPLIEPLSLDEAYLDVSDCLACSGSATLIAQEIRQSIADELNLTASAGIAPIKFLAKIASDLNKPNGQYVITPDQILPFLHDLPLSKIPGVGKVTAKRLQEVGLVTCSDVQNYPQAELL-KRFGKFGHVLWERSHGIDERDVSPDRLRKSVGVERTLAEDIHDWESCESLIEQLYIELETRLRKVRPDLHIARQGVKLKFHDFQQTTQ 300
>gi|171741291|ref|ZP_02917098.1| hypothetical protein BIFDEN_00367 [Bifidobacterium dentium ATCC 27678] >gi|171276905|gb|EDT44566.1| hypothetical protein BIFDEN_00367 [Bifidobacterium dentium ATCC 27678] (447 aa)
Score = 361, Expect = 2.0e-32, Identities = 85/290 (29%), Positives = 154/290 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYS-FLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           + HIDMD+F+AS+E+A  PEY   P+ +G     V+++A+Y AR  G+ SAM    A ++CP    +  +   Y +MS +I++   S ++  IE  S+DE Y+DVS             + ++  +  ++++ C+VG +    +AKMA+  AKP+G L +       ++  + +  I GIGPSL R+L    ++ + D+A +    L       I  H   L M   G+   P+ P    K++G  ++   +  + ++   +++   D++ S L+ +  M + V +K+R+ D   ATK
  S:    40 VLHIDMDAFYASLEVARHPEYTGKPVIIGTGNRSVVSAASYEARAYGINSAMASSRAHQLCPNGIFLPVDMQYYRAMSRRIFTEVFSRITDRIEQVSVDECYMDVSGALLRWRTASAIGAWIREQVAARYHVTCSVGIAANKLVAKMASTNAKPNGMLMIPLARHAEFVQMMPLRGIPGIGPSLERRLRTWGINSVADVARMDETTLAEATGSTIAAH--GLYMASHGLDDRPVTPYTPEKSIGSERTFDTDTQDMRQVCSMLRHCCDEVASTLRRRGLMARKVMVKLRFPDLSYATK 335
>gi|169828922|ref|YP_001699080.1| DNA polymerase IV 1 [Lysinibacillus sphaericus C3-41] >gi|168993410|gb|ACA40950.1| DNA polymerase IV 1 [Lysinibacillus sphaericus C3-41] (411 aa)
Score = 361, Expect = 2.0e-32, Identities = 107/373 (28%), Positives = 205/373 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISD-FSK---YDQVINLSITANNIME-NDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKII 377
           I HID++ F+ASVE    P  +  P+A+         ++ + +Y AR  GV + MN+ +A++ CP+L ++ PN ++Y + S   +  L   S  ++  SIDE Y+ +   + +N   +E    ++N I  +  L C++G +   FLAKMA+++ KP G   L K +  S ++ LH+ ++ GIG S   +L EL +  I ++A   ++Y +++K G++  +L+    G    P++P+  Y  K++G S ++  + ++  E  K++  L++ +   LK +     +V+I IR +  ++ T+S +  N      + +  D+ EQ  + F+K    + V  L +T +N+ +  +  +QLT FD   + I  E  + K+  Q+ +   K +I
  S:     7 ILHIDLNCFYASVEQIYDPSLKGKPIAIAGNPKERRGIVITCSYEARKSGVYTTMNVGEARRKCPELIVLPPNFDRYRAASKSFFGLLKEYSDILQPVSIDEGYIQLPIIEGQN--VLEHVHGIQNRIWNELQLPCSIGIAPNKFLAKMASDMRKPMGITILRKRDVPSVLWPLHVKEMHGIGKSTAEKLKELGIQTIGELA-AADEYTLKQKFGINGLRLKQKANGEDDRPVDPEAIYDTKSVGNSTTLSHDTTDRDELYKILTTLSEKVAERLKAKKLAGVTVSIIIRTASWETYTRSKSVNN-----AIFLKEDIVEQAWNLFNKNWNEEPVRLLGVTISNVSDIKEMTQQLTFFDF-EEHIKDEPII-KLVDQIEQKFGKGVI 383
>gi|120437709|ref|YP_863395.1| DNA polymerase IV 2 [Gramella forsetii KT0803] >gi|117579859|emb|CAL68328.1| DNA polymerase IV 2 [Gramella forsetii KT0803] (363 aa)
Score = 361, Expect = 2.2e-32, Identities = 105/341 (30%), Positives = 176/341 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS--FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQ 344
           KI HIDMD+F+ASVE  + PE     +AVG      V+++A+Y AR  GV+SAM+ V AK+ CP L  + P   +Y  +S +I       +  +E  S+DE YLDV+  +  N      A  +++ IK+K  LN + G S   F+AK+A+++ KP+G  T+  +   +++ +L I K  G+G     ++  L +   KD+     +YL     K G H+  +   V GI    + P   RK+LG  ++   N S     L+ ++ + ++I   L       K++ +KI+YSD    T+S   NF      + L +  +L  Q        +++ +S++  N  + D  E+
  S:     6 KIIHIDMDAFYASVEQLDNPELRGKAVAVGGSSQRGVVSAASYEARKFGVRSAMSSVIAKRNCPDLIFVKPRFERYKEISGQIREIFFEYTDLVEPLSLDEAYLDVTENKKGNPSATLIAKQIRDRIKEKTGLNASAGISINKFIAKIASDVNKPNGQKTVQPEEVIAFLEELDIRKFYGVGKVTAEKMYRLGIFTGKDLKLKSEEYLTEHFGKSGTHFYNV---VRGIHLSEVKPHRIRKSLGAERTFNENISSEIFMLERLENIAEEIERRLTKSKVAGKTITLKIKYSDFTQQTRSRTINFYIANKDLILEIAKELLYQ-EKMKNSVRLLGISLSNLNTEKGDKKEE 351
>gi|77974373|ref|ZP_00829914.1| COG0389: Nucleotidyltransferase/DNA polymerase involved in DNA repair [Yersinia frederiksenii ATCC 33641] (352 aa)
Score = 361, Expect = 2.2e-32, Identities = 95/291 (32%), Positives = 153/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CPQL +I      Y   S  I    +  +  IE  S+DE YLDVS+    +      A  ++ SI  + NL  + G +   FLAK+A++L KP+G   +T D    +++DL +SKI G+G     +L EL L    D+ +     L+ K+ G     L     GI    ++PD  RK++G  +++  +  ++     LI++L  ++ + L+    D       +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDDPSLRDIPIAIGGSRDRRGVISTANYPARRYGVRSAMPTAMALKLCPQLKVIPGRMAAYKEASLHIREIFARYTSLIEPLSLDEAYLDVSDCPACSGSATLIAQEIRQSIAAELNLTASAGIAPIKFLAKIASDLNKPNGQYVITPDKVLPFLHDLPLSKIPGVGKVTASKLQELGLLTCSDVQHFSQAELL-KRFGKFGHVLWERSHGIDEREVSPDRLRKSVGVERTLAEDIHDWSSCESLIEQLYTELETRLRKVRPDLHIARQGVKLKFHDFQQTTQ 300
>gi|188534725|ref|YP_001908522.1| Damage inducible protein P (DNA polymerase IV) [Erwinia tasmaniensis] >gi|188029767|emb|CAO97646.1| Damage inducible protein P (DNA polymerase IV) [Erwinia tasmaniensis] (351 aa)
Score = 360, Expect = 2.4e-32, Identities = 93/291 (31%), Positives = 160/291 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGL-KYQ-DFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM+   A K+CP LT+I      Y   S +I    S  +  IE  S+DE YLDV+++Q+        A  ++++I ++ NL  + G +   FLAK+A+++ KP+G   +T +    ++  L ++KI G+G    R+L EL L    D+       L+ K+ G     L     GI    +  + +RK+LG  +++ ++   ++  L++I  L D++   L K + D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPSLRDIPVAIGGSETQRGVISTANYPAREYGVRSAMSTAMALKLCPHLTVIRGRYEAYKEASAQIRDIFSRYTPLIEPLSLDEAYLDVTDSQHCQGSATLIARQIRDTISRELNLTASAGVAPIKFLAKIASDINKPNGQFVITPEEVPDFLQRLPLAKIPGVGKVTARKLEELGLTTCADVQKTDLATLL-KRFGKFGRVLWERCNGIDDREVIVERERKSLGVERTLSQDIHSWEACLEIIDLLYDELERRLCKIKPDRLIARQGVKLKFTDFQQTTQ 300
>gi|169197876|ref|ZP_02857219.1| DNA-directed DNA polymerase [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169089669|gb|EDS68382.1| DNA-directed DNA polymerase [Rhizobium leguminosarum bv. trifolii WSM2304] (363 aa)
Score = 360, Expect = 2.7e-32, Identities = 101/315 (32%), Positives = 166/315 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQIS 318
           KI H+DMD+F+ASVE  + PE    P+AVG      V+A+A+Y AR  GV SAM  V AK+ CP+L  + P  + Y ++S +I    +  +  IE  S+DE YLDV++         E A  ++  IK+   LN + G S+  FLAKMA++L KP+G   +T  N  +++  L + K  G+GP+   ++  L +     +     ++L+    K G ++  +     GI    + P+  RK++G     SQ +  +   +E L   + L + + +  +      K+V +K++Y+D +  T+S          PL  + DL E IS
  S:    12 KIVHVDMDAFYASVEQRDNPELRGKPIAVGGSAARGVVAAASYEARKFGVHSAMPSVTAKRKCPELIFVPPRFDVYKAVSQQIREIFAEYTPLIEPLSLDEAYLDVTHNLKGMEIATEIALEIRARIKEVTGLNASAGISYNKFLAKMASDLNKPNGQAVITPKNGPAFVEALPVKKFHGVGPATAERMHRLGIDTGASLKEKSLEFLVEHFGKSGPYFYGI---ARGIDERQVKPNRVRKSVGAEDTFSQDLHTFEPAREGL---QPLIEKVWAYCEANGIGAKTVTLKVKYADFNQITRSKTV-----PAPLPAIADLEEIIS 325
>gi|51892170|ref|YP_074861.1| DinP-like DNA-damage-inducible protein [Symbiobacterium thermophilum IAM 14863] >gi|81610604|sp|Q67QM6|DPO4_SYMTH DNA polymerase IV (Pol IV) >gi|51855859|dbj|BAD40017.1| DinP-like DNA-damage-inducible protein [Symbiobacterium thermophilum IAM 14863] (361 aa)
Score = 360, Expect = 2.7e-32, Identities = 86/283 (30%), Positives = 153/283 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYS 287
           + H+DMD+FFAS+E  + P     P+ VG       V+++ +Y AR  GV+SAM   +A ++CPQ   I PN  KY ++  ++ + +   +  IE  SIDE +LDVS         +  A  +K +I+ + +L  + G S+  FLAK+A+++ KPDG   +T +  +  +  L + K+ G+GP+  + L  L ++   D+     D L RK  G    +L +   GI   P+ P  + K++G   +       +E+L +L++   D++   L+ Q    ++V +KI+++
  S:     7 VIHLDMDAFFASIEQRDNPRLRGKPVIVGGSPNSRGVVSTCSYEARRFGVRSAMPSREALRLCPQAVFIRPNHAKYAAVGRQVRAIMRRFTDVIEPLSIDEAFLDVSGQD-----AVRVARELKEAIRAELHLTGSAGVSYCKFLAKLASDMQKPDGLTVITWERAQELLPTLPVRKLWGVGPASEQALHALGIYTCGDLLAYDPDTL-RKHFGKRADELILLARGIDPRPVVPYREAKSIGEENTFPVDQTDREYLSRLLERYADNLAEELRRQGLYARTVTVKIKWN 289
>gi|86360880|ref|YP_472767.1| DNA polymerase IV [Rhizobium etli CFN 42] >gi|86284982|gb|ABC94040.1| DNA-directed DNA polymerase protein [Rhizobium etli CFN 42] (363 aa)
Score = 360, Expect = 2.9e-32, Identities = 102/312 (32%), Positives = 163/312 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFE 315
           KI HIDMD+++ASVE  + PE    P+AVG      V+A+A+Y AR  GV SAM  V AK+ CP L  + P  + Y ++S +I    +  +  IE  S+DE YLDV++         E A  ++  IK    LN + G S+  FLAKMA++L KP+G   +T  N  +++  L + K  G+GP+   ++  L +    D+     ++L+    K G ++  +     GI    + P+  RK++G     SQ +  Y   +E L   + L + +    +      K+V +K++Y+D +  T+S         IPL  + DL E
  S:    12 KIIHIDMDAYYASVEQRDNPELRGKPIAVGGSAARGVVAAASYEARKFGVHSAMPSVTAKRKCPDLIFVPPRFDIYKAVSQQIREIFAEYTPMIEPLSLDEAYLDVTHNLKGMEIATEIALEIRARIKAITGLNASAGISYNKFLAKMASDLNKPNGQAVITPRNGPAFVEALPVKKFHGVGPATAEKMHRLGIDTGADLKGKTLEFLVEHFGKSGPYFYGI---ARGIDERQVKPNRVRKSVGAEDTFSQDLHAYEPAREAL---QPLIEKVWGYCEANGIGAKTVMLKVKYADFNQITRSKTV-----PIPLAAIADLEE 322
>gi|169823974|ref|YP_001691585.1| DNA polymerase IV [Finegoldia magna ATCC 29328] >gi|167830779|dbj|BAG07695.1| DNA polymerase IV [Finegoldia magna ATCC 29328] (347 aa)
Score = 359, Expect = 3.5e-32, Identities = 94/301 (31%), Positives = 166/301 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF 301
           M     H D+D+FFAS E+ + P+ + +P+ VG      +I +ANY AR  G+ SAM I  AKKI P L I+ P+  KY   S+K++  LSS S  I+  SIDE  +D+S+ + +    +E A+L++ +++ K  L+ ++G S+   LAK+A++  KP G   +T+D+  + + DL + KI GIG     +L ++ +  + D+ ++  + L R+  G     +   + GI    ++    RK++G   +  R+   Y E L    E +++++  L  ++   K++ IKI+ +D    TKS     +
  S:     1 MDLNFLHFDLDAFFASCEILDNPKLKHVPMVVGGRSQRGIITTANYEARKYGLHSAMPIFQAKKIVPNLVIVAPDFEKYRRNSEKVFKVLSSFSNKIQKMSIDEGCMDISHIRMD---RLELANLIQENVRIKTGLSISIGISYNMSLAKLASDWNKPHGIKIITQDDIPNILLDLKVGKIQGIGRKSEEKLNKIGIKKVSDLYDLSRNNL-RELFGKFGEVIYDRIRGIDERQLDLSRIRKSIGVEYTFERDLKNYNELLNKASEFSEELSDDLHKKNIKAKTIRIKIKLNDFSVITKSMTLEEY 302
>gi|88711765|ref|ZP_01105853.1| DNA polymerase IV [Flavobacteriales bacterium HTCC2170] >gi|88710706|gb|EAR02938.1| DNA polymerase IV [Flavobacteriales bacterium HTCC2170] (366 aa)
Score = 359, Expect = 3.5e-32, Identities = 95/292 (32%), Positives = 157/292 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI H+DMD+F+ASVE  + PE +  PLAVG      V+++ANY AR  GV+SAM+ V AK+ CP LT + P  N+Y  +S +I +     +  +E  S+DE YLDV+  +  N      A  ++  I+ +  L  + G S   F+AK+A++  KP+G  T+  +    ++ DL I    G+G     ++ +L +   K++     ++LI    K G H+ K+   V GI    + P    K++G  ++   N S     L+ ++ + +++   L       K+V +KI+YSD    T+S
  S:     9 KIIHVDMDAFYASVEEMDNPELKGKPLAVGGNEVRGVVSAANYEARKFGVRSAMSGVMAKRNCPHLTFVKPRYNRYKEISKQIRNIFFDYTDLVEPLSLDEAYLDVTVNKKGNPSATLIAQEIRKRIQDEVGLKASAGISVNKFVAKVASDFNKPNGQKTVNPEEVLQFLEDLEIRSFFGVGKVTAEKMYKLGIFTGKELKTKSEEFLIENFGKSGSHYHKV---VRGIHNGAVKPHRVPKSVGAERTFSENLSSEIFMLERLEHIANELERRLSKTKIAGKTVTLKIKYSDFTLQTRS 304
>gi|60680582|ref|YP_210726.1| putative DNA polymerase IV [Bacteroides fragilis NCTC 9343] >gi|60492016|emb|CAH06778.1| putative DNA polymerase IV [Bacteroides fragilis NCTC 9343] (354 aa)
Score = 359, Expect = 3.6e-32, Identities = 95/323 (29%), Positives = 171/323 (52%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQ----VINLSIT 332
           MD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV+SAM+   AK++CPQL  +      Y S+S +++      +  IE  S+DE +LDV+  +      ++ A  +K  I+++ +L  + G S+  FLAK+A++  KPDG  T+  D    +I  L I    G+GP   R++  L +H    +    ++ L+R+  K+GL +        G+   P+     RK++G   ++ ++       +  +  +  ++   L+ ++F   ++ +KI++ D    T+S      Q    L  ++ L +Q+    +Y+Q    +I LS++
  S:     1 MDAFYASVEQRDHPELRGKPLAVGHAEERGVVAAASYEARRYGVRSAMSSQKAKRLCPQLIFVPGRMEVYKSVSRQVHEIFHEYTDLIEPLSLDEAFLDVTENKQGILLAVDIAKAIKQRIREELSLVASAGVSYNKFLAKIASDFRKPDGLCTIHPDQAIDFIARLPIESFWGVGPVTARKMHLLGIHNGLQLRECSSEMLVRQFGKVGLLYYDF---ARGVDLRPVEAVRIRKSIGCEHTLEKDIHVRSSVIIELYHVATELVERLQQKEFRGNTLTLKIKFHDFSQITRS--MTQAQELTNLERILPLAKQLLKEVEYEQHPIRLIGLSVS 329
>gi|114566886|ref|YP_754040.1| DNA-directed DNA polymerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337821|gb|ABI68669.1| DNA-directed DNA polymerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (393 aa)
Score = 359, Expect = 3.6e-32, Identities = 95/291 (32%), Positives = 156/291 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIG----LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR---NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+D+FFASVE  + P     P+ VG       V+++ +Y AR  G++SAM I  A ++CPQ   +  N  +Y  +S +++S LS  S   E  SIDE +LD+S          +   L+   +  +  L  +VG S+  FLAK+A+++ KP+G   +T+      +  L +S+I GIG    + L +L +  I DI +   ++L   KIG    L W        GI    + P+++RK+LGR ++     N + Y E  KLI +   ++   L+ +     ++ IK+RYS+  + T+S
  S:     7 ILHCDLDAFFASVEQLDNPSLRGKPVVVGGSMHSRGVVSTCSYEARKFGIRSAMPIAQAYRLCPQAVFLPVNMPRYLEISKQVFSILSRYSPIKEIISIDEAFLDISGCSSLYGSPEKIGCLINEQVYSELGLTISVGISYNKFLAKLASDMDKPNGLRIITESEALELLRPLPVSRIWGIGQKTEQSLDKLGIKTIGDIQDSPPEWL-EDKIGSAGRLFWELAH----GIDRRAVEPEHERKSLGREETFPEDINDTAYLE--KLIVQFAAELCRKLRQEALFAATITIKLRYSNFKTITRS 302
>gi|167756956|ref|ZP_02429083.1| hypothetical protein CLORAM_02505 [Clostridium ramosum DSM 1402] >gi|167703131|gb|EDS17710.1| hypothetical protein CLORAM_02505 [Clostridium ramosum DSM 1402] (407 aa)
Score = 359, Expect = 3.6e-32, Identities = 105/382 (27%), Positives = 202/382 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENW-KEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR-KNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVIN-LSITANNIMENDN-NEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRSNR 386
           +FHID+++F+AS E++  P+ +  P+ +       +I +A+Y AR  G+ SAM +  A ++C  L ++  +   Y  +S+  +S ++S S+ +E  SIDE Y+DV+    +     I  A  ++ +I +  +L C++G +   FLAKMA+++ KP G   LT+ N K  ++ L I  + GIG     +L  + ++ I DIAN  N   +R+ IG +   L     GI    ++      K++G S ++   +  +E L+  +K L   +++    ++ +  S++I I+Y+  +S T+     +F N      ++   + + D +   + +  L I+ NN +   N  EQL IF+   +  + +  LE++   +N   +KK++   SS + +
  S:    11 VFHIDLNAFYASAEISRNPDLKGKPIVISGKSRRSIITTASYEAREFGIHSAMPLFQALELCKDLIVLPADFELYHRLSNDFFSIVASYSEILEVASIDECYVDVTKIIIDKQIHPILLAKEIQKNIYEHLSLRCSIGIAPNKFLAKMASDMKKPMGITILTRSNLKEIMWPLDIKDMFGIGKKTQPKLKAVGINTIGDIANYDNYNKLRQIIGKNALLLYRKANGIDNSAVDAKQNELKSVGNSTTLPYDTNDEEILRDTLKSLARQVSARANKRNLISNSISITIKYTRFESVTRQTTVNSFIND--YETILSTAKMLFDANYSGRPVRLLGISLNNTINKKNYKEQLNIFEMAQEDETNDDSLEQLLNAINNKFDKKLVTKASSFAKK 399
>gi|153809307|ref|ZP_01961975.1| hypothetical protein BACCAC_03620 [Bacteroides caccae ATCC 43185] >gi|149128077|gb|EDM19298.1| hypothetical protein BACCAC_03620 [Bacteroides caccae ATCC 43185] (363 aa)
Score = 358, Expect = 4.0e-32, Identities = 103/332 (31%), Positives = 178/332 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK-----------KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQ----VINLSIT 332
           ++ KI HIDMD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV+SAM+   AK++CPQL  +    + Y S+S +I+      +  IE  S+DE +LDV+  +      ++ A  +K  I+ + NL  + G S+  FLAK+A++  KPDG  T+  +    +I  L I    G+GP   +++          +  ++N   +RK           K+G L++   R    GI   P+     RK++G  +++ R+ S        +  +  ++   L+ ++F   ++ +KI++ D    T+S      Q    L  V+ L +++    +Y+Q    +I LS++
  S:     2 VQRKIIHIDMDAFYASVEQRDHPELRGKPLAVGHAEERGVVAAASYEARRYGVRSAMSSQKAKRLCPQLIFVPGRMDVYKSVSRQIHEIFHEYTDIIEPLSLDEAFLDVTENKKGISLAVDIAKEIKQKIRDQLNLVASAGISYNKFLAKIASDYRKPDGLCTIHPEQALEFIARLPIESFWGVGPVTAKRM---------HLLGIRNGLQLRKCSLETLTAHFGKVGSLYYECAR----GIDERPVEAVRIRKSIGCERTLERDISSRSSVFIELYHMAVELIERLQRKEFKGNTLTLKIKFHDFSQITRS--ITQSQELTTLDRVLPLAKELLKTVEYEQHPIRLIGLSVS 339
>gi|91772219|ref|YP_564911.1| DNA-directed DNA polymerase [Methanococcoides burtonii DSM 6242] >gi|91711234|gb|ABE51161.1| DNA-directed DNA polymerase [Methanococcoides burtonii DSM 6242] (354 aa)
Score = 358, Expect = 4.3e-32, Identities = 89/291 (30%), Positives = 161/291 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPL--------AVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           IFHIDMDSF++SVE+A  P+ + LP+         VG  V+++ +Y AR  G+KSAM I  A  +CP+   +  N   Y  +S+ I   L + S   +  S+DE YLDVS       +  + A  +K  + QK  + C+VG      +AK+A++  KPDG   ++ +N +S++Y L +S+I GIG   +  L ++ +  I ++A + N   +R+K G     +     G+    +    + K++ +  +    +   E+L+ ++  L++ +++ L  + ++FK+V IK+R  D  + T++
  S:     2 IFHIDMDSFYSSVEVAADPKLKGLPVVVGSDPLQGVGRGVVSTCSYEAREFGIKSAMAISKAYHLCPEAVYLRVNMPLYKKVSNSIMELLRNYSSKFQQVSVDEAYLDVSYIVSGFDEAKKLAMQIKKDVFQKEGITCSVGIGPNKSIAKIASDFQKPDGLTIVSPENVRSFLYPLDVSRISGIGKKTSVMLGQMGIRTIGELA-IHNVQDLREKFGKFGLVMHQLANGVDGRKVQESGEIKSISKEDTFDKDTSDMEYLESVVDTLSEHVHTSLSKKKYLFKTVTIKVRLEDFTTYTRA 300
>gi|168206793|ref|ZP_02632798.1| DNA polymerase IV [Clostridium perfringens E str. JGS1987] >gi|170661821|gb|EDT14504.1| DNA polymerase IV [Clostridium perfringens E str. JGS1987] (359 aa)
Score = 357, Expect = 5.4e-32, Identities = 113/346 (32%), Positives = 193/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF--QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN---DNNEQLTIFD 349
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I +L I K  G+G     +L  + +   +D+     + LI     R KI   +++      GI   P+NP   RK++G+  ++R +  + +E ++++ ++ + +N  L   +   K+V +K++++D    T+S    +F  + +  +  V DL   I DF K  +V  L IT +++ EN   +  EQL+ FD
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGKPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNLVEPLSLDEAFVDVSKSKRCKGSATLMALEIKARIFKEVGLTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRNLPIGKFFGVGRVTKNKLNNIGVFKGEDLLKFSEEELIDIFSDRGKILYEFAR------GIDNRPVNPYRIRKSIGKEITLREDIEDIEEMIEILDKIAERVNESLCLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEKKEIMECVKDLI-SIVDF-KNKKVRLLGITISSLEENIITEEREQLS-FD 358
>gi|121998646|ref|YP_001003433.1| DNA-directed DNA polymerase [Halorhodospira halophila SL1] >gi|121590051|gb|ABM62631.1| DNA-directed DNA polymerase [Halorhodospira halophila SL1] (356 aa)
Score = 357, Expect = 5.7e-32, Identities = 83/291 (28%), Positives = 155/291 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           KI HIDMD+F+ASVE  + P     P+ VG       V+A+A+Y AR  G++SA     A++ CP+   + P  ++Y ++S +I+   +  +  IE  S+DE YLDV+ +Q         A  ++  I+++  L  + G S+   LAK+A++  KPDG   +  ++  +Y+    I ++ G+GP+   +L  L +  + D+ + +   L    +G     L     GI   P+ P   RK++G  ++   +  +  E  + +  L   + + L++ + + ++V +K+RY+D +S T+
  S:     5 KIIHIDMDAFYASVEQRDDPSLRGQPVVVGGSPEGRGVVAAASYEARAFGIRSAQPAAWARRRCPEAIFLRPRFDRYRAISRQIHGIFADFATTIEPLSLDEAYLDVTGSQRFRGSATHMAQAIRRRIREETGLTASAGVSYNKLLAKLASDEGKPDGLYVVPPEDGPAYVAAQPIRRLHGVGPATAARLERLGIRQVGDLLDWELADL-HVFLGNRAGTLHDAARGIDHRPVRPRRSRKSIGAERTFGDDTRDLGEIHQRLAPLITKVATRLEHHELVARTVTLKLRYADFESITR 300
>gi|77962907|ref|ZP_00826722.1| COG0389: Nucleotidyltransferase/DNA polymerase involved in DNA repair [Yersinia mollaretii ATCC 43969] (352 aa)
Score = 357, Expect = 6.5e-32, Identities = 95/291 (32%), Positives = 154/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CPQL +I      Y   S  I    +  +  IE  S+DE YLDVS+    +      A  ++ SI  + +L  + G +   FLAK+A++L KP+G   +T D    +++DL +SKI G+G    ++L E+ L    D+ N     L+ K+ G     L     GI    I+PD  RK++G  +++  +  ++     LI++L  ++ + L+    D       +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDDPGLRDIPIAIGGSRDRRGVISTANYPARRYGVRSAMPTAMALKLCPQLKVIPGRMAAYKEASLHIREIFARYTPLIEPLSLDEAYLDVSDCLVCSGSATLIAQEIRQSIADELHLTASAGIAPIKFLAKIASDLNKPNGQYVITPDQVLPFLHDLPLSKIPGVGKVTAKRLQEVGLVTCSDVQNYPQAELL-KRFGKFGHVLWERSHGIDEREISPDRLRKSVGVERTLAEDIHDWDSCESLIEQLYAELETRLRKVRPDLHIARQGVKLKFHDFQQTTQ 300
>gi|118580322|ref|YP_901572.1| DNA-directed DNA polymerase [Pelobacter propionicus DSM 2379] >gi|118503032|gb|ABK99514.1| DNA-directed DNA polymerase [Pelobacter propionicus DSM 2379] (411 aa)
Score = 357, Expect = 6.6e-32, Identities = 89/284 (31%), Positives = 153/284 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINP---DYKRKNLGRSQSIRNYSEYQE-FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           + H DM++FFASVE    PE    P+AV    G  VI +++Y AR  GVK+ M   +A ++CPQL I+  +  KYT  S +I   +   +  +E  SIDE ++D++++          A L+K  IK+ F + C++G +    LAK+A++L KPDG   +  +     +  + I ++ GIG     QL  +N++   ++       L R K G+  S+L+    GI   P+ P   D + K++G S ++R   E +E  LK + +L++ +    +      K+V + +R++D
  S:     7 VIHNDMNAFFASVEQQANPELRGKPIAVVGGGGRTVITTSSYEARAFGVKTGMAKWEALRVCPQLIIVVGDNKKYTYTSARIMEMMKEYTPLVEVFSIDEAWMDITHSLSIFGTPERIAYLLKARIKESFGITCSIGIAPNKLLAKLASDLHKPDGLTVIKPEEVSRVLERMPIKELCGIGKKTEYQLKVMNINTCGELGRCDESRLTR-KFGIIGSRLKQMGQGIDDSPVTPNEEDDEVKSVGHSMTLRRDVERREDILKYLLQLSEMVGRRARRYGVSGKTVTLHVRFAD 297
>gi|182704136|ref|ZP_02956548.1| DNA-directed DNA polymerase [Methylocella silvestris BL2] >gi|172066818|gb|EDT52942.1| DNA-directed DNA polymerase [Methylocella silvestris BL2] (370 aa)
Score = 357, Expect = 6.7e-32, Identities = 86/294 (29%), Positives = 156/294 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + KI HIDMD+FFASVE  + PE    P+AVG      V+A+A+Y AR  GV+SAM  V A++ CP+L  + P  + Y ++SD++ +  +  +  IE  S+DE YLDVS T        E A  ++  I+++ NL  + G S+  FLAK+A++  KPDG   +T     +++  L + K  G+GP+   ++  L +    D+   ++   ++++ G           G+   P+     RK++G   +   +   ++   + ++ + D +    +      +++ +K++Y+D    T+S
  S:    17 RRKIIHIDMDAFFASVEQRDNPELRGKPVAVGGSSQRGVVAAASYEARAFGVRSAMPSVTARRKCPELIFVKPRFDVYRAVSDEMRAIFAEYTPIIEPLSLDEAYLDVSETLNGALSATEIAQQIRAKIRERTNLTASAGVSYNKFLAKLASDHRKPDGLFVITPKMGPAFVEPLPVRKFHGVGPATAAKMKRLGIETGFDL-KAQSLAFMQQQFGKAGPYYYGVARGVDERPVRAHRIRKSVGAENTFFADLFTFEAAREAMEPIVDKVWRHCETAGAHGRTLTLKVKYADFQQITRS 314
>gi|191161076|ref|ZP_03022959.1| DNA-directed DNA polymerase [Geobacter sp. M21] >gi|190997807|gb|EDV73252.1| DNA-directed DNA polymerase [Geobacter sp. M21] (409 aa)
Score = 356, Expect = 7.5e-32, Identities = 88/299 (29%), Positives = 156/299 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN 303
           I HIDM++FFASVE    P     P+AV       +I + +Y AR  GVK+ MN  +A++ CP L  +  N  KY+  S +I S +   +  +E  SIDE +LDV+ +        + A L+K  I+++F L C+VG +    LAK+A+++ KPDG   +        +  L I  + GIG  + + L +  +    ++A    + L RK  G+   +L    LG+   P+ P+ +    K++G S ++  + +E  E L  + +L++ +    +      ++V + +RY+D  + +K  +  ++ N
  S:     7 ILHIDMNAFFASVEQQSNPALAGKPVAVIGAAKRTIITTCSYEARAFGVKTGMNSWEARQKCPHLIFVVGNNRKYSYTSKQIISIMREYTPQVEVFSIDEAFLDVTGSLSLFGSAEKIADLIKQQIRERFGLTCSVGIAPNKLLAKLASDMQKPDGLTIIEPGKVAQVMERLPIQALCGIGAKMQQHLAKFGIKTCGELARFPVETL-RKHFGVTGERLHFMGLGVDDSPVVPEDEAEEVKSVGHSTTLDCDITERSEILLHLLQLSEMVGRRARKYQVTGRTVTLTVRYADFTTFSKQQSRGDYTN 312
>gi|149196882|ref|ZP_01873935.1| DNA polymerase IV [Lentisphaera araneosa HTCC2155] >gi|149139992|gb|EDM28392.1| DNA polymerase IV [Lentisphaera araneosa HTCC2155] (354 aa)
Score = 355, Expect = 1.0e-31, Identities = 95/301 (31%), Positives = 162/301 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIA--NVKNDYLIRKKIGLHWSKLRMNVL-GIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKY-----QDFMFKSVNIKIRYSDGDSATKSFNFVNFQ 302
           K KI H+DMD FFA+VE+ ++PE +   +AVG       VIA+ANY AR  GV SA++   A + CP+L I+ PN +KY  +S +++      +  +E  S+DE +LDVS     +      A  +K  I  K  L  + G +   +LAK+A++  KPDG  T+  +N + ++  L + KI G+G    R+L +  L    D+   +VKN   + K IG + ++  + +  GI    +  + +RK+  R ++  +   + E    +K + D+    LK        +  K+  +K++++D  S T     +NF+
  S:     5 KRKIIHVDMDCFFAAVEVRDQPELKGKAVAVGGAAKRRGVIAAANYEARNFGVHSALSTAIALRRCPELIIVRPNMSKYKEVSTEVFKIFRKYTHLVEAISLDEAFLDVSECPLHHGSGTLIAEAIKKDIYAKTGLRASAGIAPNKYLAKIASDWMKPDGIYTIPPENIEKFVQQLPVKKIWGVGKETLRELRKFGLETCADLQKISVKN---LAKLIGTNRAEELLELAKGIDNREVKANRERKSYTRERTFDSDLSHGECSDALKVIFDECKKKLKAYLEEKPQYKIKTSVLKVKFADFTSTTVECGDLNFE 315
>gi|116493014|ref|YP_804749.1| nucleotidyltransferase/DNA polymerase for DNA repair [Pediococcus pentosaceus ATCC 25745] >gi|116103164|gb|ABJ68307.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Pediococcus pentosaceus ATCC 25745] (374 aa)
Score = 355, Expect = 1.0e-31, Identities = 97/329 (29%), Positives = 179/329 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN-FQNQIPLHVVV--DLFEQISDFSKYDQVINLSIT 332
           KI H+DMD+F+AS+E+ + P+++  PL V        GH V+ +ANY+AR  GV SAM  + A ++CP+     P+  KY ++S++I+      +  IE  + DE YLDVS  +      +  A  ++  I  +  L C+ G S+  FLAKMA+  +KP G   + KD+   ++ ++ I +  G+G     ++ EL +    D+  +  + LI       ++  R  V G    P+    +RK++G+ ++    +    E +E L++I +  +   + LK Q    K++ +K+RY D ++ TK       FQN +  +      + ++I+D S+  +++ +++T
  S:    16 KIIHVDMDAFYASIEMRDNPKFKTQPLVVAHDPRLTGGHGVVTTANYIARQFGVHSAMPAMKALELCPEAIFKDPDFTKYRAVSEQIHQIFHEYTDKIEPVAFDEAYLDVSEDKKGLGDAVLIAHEIQKVIFNETQLTCSTGISYNKFLAKMASEYSKPVGVAIIEKDDVAEFLKNIPIERFRGVGKKTVPKMHELGVFQGADLIKMSENDLIHYFGKFGYTLFRW-VRGQDDRPVEYLRERKSIGKEETYGKLLTTEMEVEERLRVIAK--NLFRAVLKRQKHG-KTIVLKLRYGDFETLTKRITLDEFFQNDVETYYFYAKQILDEIADISRGIRLLGITLT 355
>gi|158520246|ref|YP_001528116.1| DNA-directed DNA polymerase [Desulfococcus oleovorans Hxd3] >gi|158509072|gb|ABW66039.1| DNA-directed DNA polymerase [Desulfococcus oleovorans Hxd3] (384 aa)
Score = 355, Expect = 1.1e-31, Identities = 99/371 (26%), Positives = 184/371 (49%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDF----SKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEK----IRKQVNKTLNKK 375
           I H+DMD+FFASVE  + PE+    + VG      V+A+A+Y AR  GV SAM +  A K+CP   +  P   +Y  +S ++   L ++S  +E  SIDE YLD+S  +  +         +K  +     + C+VG +   FLAK+A+++ KPDG + +  +    +I  L + K+ G+G    +QL  + +  + D+  +  D ++ KK+G    +L+    GI    + P +  K++    ++ R+ +E QE    +     D+   L+  +   + V IKI+Y+D    T+           P+     ++ Q S      +   +V  + +    ++      Q+ +FD   ++ S   ++++    I ++  KT+ K+
  S:     2 ILHVDMDAFFASVEQLDHPEWRGRAVVVGRSSGRGVVAAASYEARVFGVHSAMPMSRALKLCPDAIVAPPRMERYKEVSARVMEILDAVSPLVEQVSIDEAYLDISGCERLHGTPETIGKNIKKQVFDTLGITCSVGVAPIKFLAKIASDMNKPDGLMVILPEAADRFIETLPVHKVPGVGSVTKKQLALMGIETLGDVVRLP-DGVLSKKLGKFGRRLKELSRGIDDSRVVPWHPAKSVSEETTLSRDTAEKQELRHHLLRQAGDVCRHLQKLNARARVVFIKIKYADFSQTTRQTTL-----DAPVQSSDTIYRQASALLEKQTLAQKVRLIGVGVTELVVTSGGVQMELFDGEARRDSRWEQVDRSVSAISEKFGKTMVKR 379
>gi|153216173|ref|ZP_01950312.1| DNA-damage-inducible protein P [Vibrio cholerae 1587] >gi|124114431|gb|EAY33251.1| DNA-damage-inducible protein P [Vibrio cholerae 1587] (360 aa)
Score = 355, Expect = 1.1e-31, Identities = 96/290 (33%), Positives = 156/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE-LTDDINSGLKY---QDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD FFA+VE+ + P Y ++PLAVG       VI++ NY AR  GV+SAM    A K+CPQL ++    + Y S+S +I +     +  IE  S+DE YLDVS +          A  ++  I Q+ NL  + G +   FLAK+A++L KPDG   +T D  +  +  L + KI G+G     +L +  L+   D+       L+  + G   + L     GI    +  + +RK++G   +  +N S +QE  ++I++ L  ++++ L     Q  + K   IK++++D    T
  S:     7 KIIHVDMDCFFAAVEMRDNPAYREIPLAVGGHEKQRGVISTCNYQARKFGVRSAMPTAQALKLCPQLHVVPGRMSVYKSVSQQIQTIFQRYTSLIEPLSLDEAYLDVSESTAYQGSATLIAQAIRRDIWQELNLTASAGVAPIKFLAKVASDLNKPDGLYVVTPDKVQEMVDSLPLEKIPGVGKVALEKLHQAGLYVGADVRRADYRKLLH-QFGRLGASLWKKSHGIDEREVVTERERKSVGVEYTFSQNISTFQECWQVIEQKLYPELDARLSRAHPQRGIIKQ-GIKVKFADFQQTT 304
>gi|77978372|ref|ZP_00833802.1| COG0389: Nucleotidyltransferase/DNA polymerase involved in DNA repair [Yersinia intermedia ATCC 29909] (352 aa)
Score = 355, Expect = 1.1e-31, Identities = 94/291 (32%), Positives = 155/291 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CPQL +I      Y   S  I    +  +  IE  S+DE YLDVS+    +      A  ++ +I  + +L  + G +   FLAK+A++L KP+G   +T +  + +++DL +SKI G+G    ++L EL L    D+ N     L+ K+ G     L     GI    I+PD  RK++G  +++  +  +++    LI +L  ++ + L+    D       +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDDPSLRDIPIAIGGSRDRRGVISTANYPARRYGVRSAMPTAMALKLCPQLKVIPGRMAAYKEASLHIREIFARYTPLIEPLSLDEAYLDVSDCTACSGSATLIAQEIRQAIFDELSLTASAGIAPIKFLAKIASDLNKPNGQYVITPNQIQPFLHDLPLSKIPGVGKVTAKRLQELGLVTCGDVQNYPQAELL-KRFGKFGHVLWERSHGIDEREISPDRLRKSVGVERTLAEDIHDWESCEALIDQLYIELETRLRKVRPDLHIARQGVKLKFHDFQQTTQ 300
>gi|160892192|ref|ZP_02073195.1| hypothetical protein BACUNI_04655 [Bacteroides uniformis ATCC 8492] >gi|156858670|gb|EDO52101.1| hypothetical protein BACUNI_04655 [Bacteroides uniformis ATCC 8492] (367 aa)
Score = 355, Expect = 1.2e-31, Identities = 97/329 (29%), Positives = 174/329 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYD----QVINLSIT 332
           KI HIDMD+F+ASVE  + P     P+AVGH     V+A+A+Y AR  GV+SAM+ + AK++CPQL  I      Y S+S +I+      +  IE  S+DE +LDV+  +      ++ A  +K  ++++ NL  + G S+  FLAK+A++  KPDG  T+       ++  L I    G+GP   +++  L +H  + +     + L R+  K+G  +        GI   P+     RK++G   ++ ++ S+    +  +     ++   L++ +F   ++ +KI++ D    T+S      +    L V++ L +Q+     Y+    ++I LS++
  S:     5 KIIHIDMDAFYASVEQRDNPALRGKPIAVGHAEERGVVAAASYEARRFGVRSAMSSLKAKRLCPQLIFIPGRMEVYKSVSRQIHEIFHEYTDVIEPISLDEAFLDVTENKPGIPLAVDIAKEIKRKVRERLNLVASAGISYNKFLAKIASDYRKPDGLCTIHPAQALDFVARLPIESFWGVGPVTAKKMHTLGIHNGEQLRMQSLEMLTREFGKVGTVYYDF---ARGIDTRPVEAVRIRKSVGCEHTLEKDISKRSSVIIELYHAAVELVGRLEHTNFRGNTLTLKIKFHDFSQITRS--MTQTKELGALDVILPLAKQLLQEVDYEHHPIRLIGLSVS 339
>gi|145617749|ref|ZP_01773812.1| DNA-directed DNA polymerase [Geobacter bemidjiensis Bem] >gi|144945796|gb|EDJ80858.1| DNA-directed DNA polymerase [Geobacter bemidjiensis Bem] >gi|197087501|gb|ACH38772.1| UMUC domain protein DNA-repair protein [Geobacter bemidjiensis Bem] (409 aa)
Score = 354, Expect = 1.2e-31, Identities = 97/363 (26%), Positives = 184/363 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIP--LHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQ 367
           I HIDM++FFASVE    P     P+AV       +I + +Y AR  GVK+ MN  +A++ CPQL  +  N  KY+  S +I + +   +  +E  SIDE +LDV+ +        + A L+K  I+++F L C+VG +    LAK+A+++ KPDG   +  +     +  L I  + GIG  + + L +  +    ++     + L +K  G+   KL    LG+   P+ P+ +    K++G S ++ R+ +   E L  + +L++ +    +      ++V + +RY+D  + +K  +  ++ N         V + + + D ++  +++ + I   N+    + EQL +F    +K    S ++ +  +
  S:     7 ILHIDMNAFFASVEQQSNPALAGKPVAVIGAAKRTIITTCSYEARAFGVKTGMNSWEARQKCPQLIFVVGNNRKYSYTSKQIIAIMREYTPQVEVFSIDEAFLDVTGSLSLFGSAKKIAYLIKQQIRERFGLTCSVGIAPNKLLAKLASDMQKPDGLTVVDPEKVAQVMERLPIQALCGIGAKMQQHLAKFGIKTCGELGRFPVETL-KKHFGITGEKLHFMGLGVDDSPVVPEDEAEEVKSVGHSTTLDRDITGRSEILLHLLQLSEMVGRRARKYQVTGRTVTLTVRYADFTTFSKQQSRGDYTNNSEEIYQTAVKILDNL-DLTQPVRLLGIKIA--NLRH--HTEQLPLFAEERKKALVASAMDNVNNK 373
>gi|150423953|gb|EDN15893.1| DNA-damage-inducible protein P [Vibrio cholerae AM-19226] (360 aa)
Score = 354, Expect = 1.2e-31, Identities = 96/290 (33%), Positives = 156/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE-LTDDINSGLKY---QDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD FFA+VE+ + P Y ++PLAVG       VI++ NY AR  GV+SAM    A K+CPQL ++    + Y S+S +I +     +  IE  S+DE YLDVS +          A  ++  I Q+ NL  + G +   FLAK+A++L KPDG   +T D  +  +  L + KI G+G     +L +  L+   D+       L+  + G   + L     GI    +  + +RK++G   +  +N S +QE  ++I++ L  ++++ L     Q  + K   IK++++D    T
  S:     7 KIIHVDMDCFFAAVEMRDNPAYREIPLAVGGHEKQRGVISTCNYQARKFGVRSAMPTAQALKLCPQLHVVPGRMSVYKSVSQQIQTIFQRYTTLIEPLSLDEAYLDVSESTAYQGSATLIAQAIRRDIWQELNLTASAGVAPIKFLAKVASDLNKPDGLYVVTPDKVQEMVDSLPLEKIPGVGKVALEKLHQAGLYVGADVRRADYRKLLH-QFGRLGASLWKKSHGIDEREVVTERERKSVGVEYTFSQNISTFQECWQVIEQKLYPELDARLSRAHPQRGIIKQ-GIKVKFADFQQTT 304
>gi|153801030|ref|ZP_01955616.1| DNA-damage-inducible protein P [Vibrio cholerae MZO-3] >gi|153826791|ref|ZP_01979458.1| DNA-damage-inducible protein P [Vibrio cholerae MZO-2] >gi|153828220|ref|ZP_01980887.1| DNA-damage-inducible protein P [Vibrio cholerae 623-39] >gi|124123384|gb|EAY42127.1| DNA-damage-inducible protein P [Vibrio cholerae MZO-3] >gi|148876309|gb|EDL74444.1| DNA-damage-inducible protein P [Vibrio cholerae 623-39] >gi|149739378|gb|EDM53620.1| DNA-damage-inducible protein P [Vibrio cholerae MZO-2] (360 aa)
Score = 354, Expect = 1.2e-31, Identities = 96/290 (33%), Positives = 156/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE-LTDDINSGLKY---QDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD FFA+VE+ + P Y ++PLAVG       VI++ NY AR  GV+SAM    A K+CPQL ++    + Y S+S +I +     +  IE  S+DE YLDVS +          A  ++  I Q+ NL  + G +   FLAK+A++L KPDG   +T D  +  +  L + KI G+G     +L +  L+   D+       L+  + G   + L     GI    +  + +RK++G   +  +N S +QE  ++I++ L  ++++ L     Q  + K   IK++++D    T
  S:     7 KIIHVDMDCFFAAVEMRDNPAYREIPLAVGGHEKQRGVISTCNYQARKFGVRSAMPTAQALKLCPQLHVVPGRMSVYKSVSQQIQTIFQRYTTLIEPLSLDEAYLDVSESTAYQGSATLIAQAIRRDIWQELNLTASAGVAPIKFLAKVASDLNKPDGLYVVTPDKVQEMVDSLPLEKIPGVGKVALEKLHQAGLYVGADVRRADYRKLLH-QFGRLGASLWKKSHGIDEREVVTERERKSVGVEYTFSQNISTFQECWQVIEQKLYPELDARLSRAHPQRGIIKQ-GIKVKFADFQQTT 304
>gi|85092716|ref|XP_959512.1| hypothetical protein NCU02457 [Neurospora crassa OR74A] >gi|28920947|gb|EAA30276.1| hypothetical protein NCU02457 [Neurospora crassa OR74A] (626 aa)
Score = 354, Expect = 1.2e-31, Identities = 95/327 (29%), Positives = 172/327 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV---KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFK--SYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNV---LGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIP--LHVVVDLFEQ-ISDFSKYDQVI 327
           +   I H+D D+F+A+VE  +RPE + LP AVG  V+ + NYVAR  G +S M    AKK+CP+L ++  +  KYT+ + ++   ++    N E+ SIDE YL++  T Y     +  A  V   +N I ++ ++  + G +    LAK+ +N+ KP+G   L  +      ++ DL   K+ GIG    R+L  L +H + DI +  N   +R   G   S+  ++    LG  C      Y+RK++G   + R+ S+  E    ++  ++D+   L+  +   +++ +K++         +F  +  Q  +P  +H+  DL++  +   +K +Q I
  S:   127 LSQHIVHVDCDAFYAAVEQLDRPELKDLPFAVGGGVLTTCNYVARKYGCRSGMAGFVAKKLCPELILLPISFEKYTAKAGEVREIIAEYDPNFESASIDEAYLNI--TDYCTRHAMAPADAVAKMRNDIHERTSITVSAGIAANTRLAKICSNMNKPNGQYVLPSERVAILEFMRDLPCRKVNGIGRVFERELAALGIHTLGDIYS--NRQYLRNLFGEKASEFLLHCFLGLGRTCVKPAETYERKSVGTESTFRDMSDPTELRNKLRRTSEDLEQDLRRAECKGRTLCLKVKL-------HTFEVLTRQTVLPRAVHLATDLYKHALPMLTKLEQEI 453
>gi|194681750|emb|CAR40935.1| DNA polymerase IV [Proteus mirabilis HI4320] (351 aa)
Score = 354, Expect = 1.3e-31, Identities = 91/285 (31%), Positives = 150/285 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSD 288
           KI H+DMD F+A++E+ + P  +++P+AVG       VI +ANY AR  GV+SAM+   A K+CP L ++      Y   S KI    +  +  IE  S+DE YLDVS++++ +      A  ++  I  + NL  + G +   FLAK+A++L KP+G   +T +    +I  L ++KI G+G     +L E+ L    D+       L+R  +G     L     GI    INP+  RK++G  +++  +   + E L L+  L D++   L     D       +K+++ D
  S:     3 KIIHVDMDCFYAAIEMRDNPTLKEIPIAVGGNASRRGVICTANYPARRFGVRSAMSTATALKLCPHLKVLPGRMALYKETSAKIRQIFARYTDLIEPLSLDEAYLDVSDSKHCHGSATLIAQQIRQQIFAELNLTASAGIAPIKFLAKIASDLNKPNGQYVITPEQMDDFILKLPLNKIPGVGKVTFARLQEMGLETCADVRGTDVISLVR-NLGKFGQSLWERSHGIDERLINPERLRKSVGVERTLAEDIDSWDECLALLDGLYDELEKRLSRVKPDLRIARQGVKLKFDD 294
>gi|24378896|ref|NP_720851.1| DNA polymerase IV [Streptococcus mutans UA159] >gi|81588384|sp|Q8DVR7|DPO4_STRMU DNA polymerase IV (Pol IV) >gi|24376778|gb|AAN58157.1|AE014887_5 putative DNA-damage-inducible protein P [Streptococcus mutans UA159] (370 aa)
Score = 354, Expect = 1.3e-31, Identities = 101/344 (29%), Positives = 176/344 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT--KSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTI 347
           KI HIDMD+FFA+VE  + P+ +  PL +G          V+++ANY+AR  G+ SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A L++  I ++F+L C+ G S+  FLAK+A++  KP G   +   + + ++  L I K  G+G     +L  L++   KD+  V    LI    G     L     GI   P+  D  RK++G  ++        E +KL + +    +   LK      K V IK+RYSD  + T  K+ +      ++       +F+ +++ +   +++ +++TA   +E+   E+L++
  S:    13 KIIHIDMDAFFAAVEERDNPKLKGKPLVIGADPRQTGGRGVVSTANYLAREFGIHSAMSSKEAYERCPQAIFIRGNHTKYRQIGLQVREIFRRYTDLVEPMSIDEAYLDVTENKLNIKSAVKIAKLIQRDIWEEFHLTCSAGVSYNKFLAKLASDYDKPHGLTVILPQDAEGFLATLPIEKFYGVGKKSVEKLHALHIFTGKDVQQVPEMTLI-DLFGRFGFDLYRKARGISNSPVKNDRIRKSIGSERTYGKLLYNDEDIKLELSKTARRVADSLKKHGRKGKIVVIKVRYSDFSTLTKRKTLDVPTQDFEVIERSAHRIFDHLTENNSGVRLLGVTVTA---LEDSTREELSL 363
>gi|16119697|ref|NP_396403.1| DNA polymerase IV [Agrobacterium tumefaciens str. C58] >gi|22095614|sp|Q8UJK7|DPO42_AGRT5 DNA polymerase IV 2 (Pol IV 2) >gi|15162281|gb|AAK90844.1| DNA polymerase IV [Agrobacterium tumefaciens str. C58] (357 aa)
Score = 354, Expect = 1.3e-31, Identities = 104/341 (30%), Positives = 177/341 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASA----NYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFA----SLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF---VNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITA-NNIMENDNNEQ 344
           KI H+DMD+F+ASVE  + PE    P+AVG           +Y AR  GV+SAM  V A + CP L  + P  + Y ++S +I +  +  ++ IE  S+DE YLDV+    EN K +E A    S ++  IKQ   LN + G S+  FLAKMA++L KP+G   +T  N  +++  L + K  G+GP+   ++    +    D+ + K+   + +  G   +       GI    + PD  RK++G   +   + ++       ++ L + +    + Q    K+V +K++YSD   AT+S      VN   +I L     L   +  F +  +++ +++++  N  E ++ EQ
  S:     3 KIIHVDMDAFYASVEQRDNPELRGRPVAVGSAAARGVVAAASYEAREFGVRSAMPSVTAARRCPDLIFVPPRFDVYKAVSQQIRAIFAEYTRLIEPLSLDEAYLDVT----ENLKGMEIATEIASEIRERIKQITGLNASAGISYNKFLAKMASDLNKPNGQAVITPKNGPAFVEQLAVKKFHGVGPATAEKMHRFGIETGADLKS-KSLQFLAEHFGKSGAYFYGIARGIDERQVRPDRIRKSVGAEDTFSVDINDLDLATAELRPLAEKVWHHCEAQRVSGKTVTVKVKYSDFTQATRSRTSALPVNGIQEI-LEAASALLATVYPFRRSVRLLGVTLSSLTNDQEAEDEEQ 350
>gi|88602744|ref|YP_502922.1| DNA-directed DNA polymerase [Methanospirillum hungatei JF-1] >gi|88188206|gb|ABD41203.1| DNA-directed DNA polymerase [Methanospirillum hungatei JF-1] (368 aa)
Score = 354, Expect = 1.5e-31, Identities = 99/317 (31%), Positives = 161/317 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVS-NTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIP-LHVVVD-LFEQISDFS 321
           I H+DMDSF+ASVE+   P+    P+ +G          V+++ +Y AR  G+ SAM I  A  +CP    I P+   Y  +S  I   L  ++  IE  SIDE YLD+S +  YE       A+ +K  I+ +  L C+VG + +   AKMA+   KPDG   ++ D  +S++  L + KI GIG    + LI   L  I DIA      L +   G H  +L     G   + +    KR+++ R  + +R+ +   E L  +  +   +   L+ Q+   +++ I+IRY+   + TKS   +    ++  +   +D LF ++ D S
  S:    18 ILHLDMDSFYASVEIRNNPDLSGKPVVIGADPMQGTGRGVVSTCSYEARAFGIHSAMPISQAYHLCPHAIFIPPHMATYAQVSATIMQILRGIAGEIEQVSIDEAYLDLSCDRSYE--LAAHHAANIKQVIRNQVGLTCSVGLAPSRIYAKMASEQQKPDGLTVVSPDTLESFLKPLPVGKIPGIGKKSAQVLINAGLQTIGDIARCDIQTL-QDMFGSHAVRLHQIARGQDREGLRESGKRRSISREHTFLRDSTSPDEILGSLHTMILSLCHELEEQNIYSRTIGIRIRYTGFITRTKSVTLMQPTREVRVIECAIDGLFTEMWDRS 343
>gi|116748184|ref|YP_844871.1| DNA-directed DNA polymerase [Syntrophobacter fumaroxidans MPOB] >gi|116697248|gb|ABK16436.1| DNA-directed DNA polymerase [Syntrophobacter fumaroxidans MPOB] (425 aa)
Score = 353, Expect = 1.6e-31, Identities = 82/292 (28%), Positives = 156/292 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL---VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           +I H+DMD+F+ASVE A+RPE++  P+ VG     V+++A+Y AR  GV SAM +  AK++CP    +     +Y  +S  +   L  +S  +E  SIDE ++D++ T+  +         VK+ I+    + C+VG +   F+AK+A+++ KPDG   +  D  ++++  L + +I GIG   +  L  L +  I D+      + + K++G    KL     G+   P+    + K+     +   +  + +   K +   ++++   L+ + F  ++V +K++++D  S T+S
  S:    36 RIMHVDMDAFYASVEQADRPEFKGKPVIVGGARRGVVSAASYEARRFGVHSAMPVFQAKRLCPGGIFLPVRMGRYKEVSKVVMDILCGISPLVEQISIDEAFVDITGTEALHGSPESLGRRVKSQIRAATRVTCSVGIAPGKFVAKIASDIHKPDGLTIVEDDRVEAFLAPLPVERIPGIGKKTSEALRSLGVRAIGDVLRFPASFWV-KRLGAWGVKLHERARGVDPAPVIAYSQAKSCSAEDTFPEDVDDVETLEKWLFVQSEEVGKELRRESFRGRTVTLKVKFADFSSITRS 330
>gi|116670120|ref|YP_831053.1| DNA-directed DNA polymerase [Arthrobacter sp. FB24] >gi|116610229|gb|ABK02953.1| DNA-directed DNA polymerase [Arthrobacter sp. FB24] (408 aa)
Score = 353, Expect = 1.9e-31, Identities = 85/294 (28%), Positives = 154/294 (52%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGH----LVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE-----YQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           ++ I H+DMD+FF SVEL  RPE    P+ VG+     V+ SA+Y AR  GVKSAM +  A +ICP   II P    Y  +S ++ +   S++  +E  S+DE +LDV           E  ++++  ++ +  +  +VG + + F+AK+A+   KPDG L +  D   +Y++ L ++ + G+G      L  + +  + D+A      L +K +G     +     GI   P+ P    K++G  ++    +      ++E L+L     + + S       + +++++K+RY+D  + T+S
  S:    19 RSSIMHVDMDAFFVSVELRSRPELVGKPVIVGYPADRSVVLSASYEARKFGVKSAMPMAMAARICPSAVIIEPRHKLYYEVSAQLMAIFGSITDLVEPLSVDEAFLDVGGAIRRLGSPREIGAIIRRRVRDELGITASVGIAASKFVAKIASTRCKPDGLLLIGPDETVAYLHSLPVNALWGVGAKTGEVLARMGIRSVADVAATPPSAL-KKLLGASGEHVYRLSWGIDPRPVTPVRLEKSIGAEETFAVDTADDALLHRELLRLSHRTAERLRS----TGMVARTISLKLRYTDFSTITRS 316
>gi|190894484|ref|YP_001984777.1| DNA-directed DNA polymerase protein [Rhizobium etli CIAT 652] >gi|190700145|gb|ACE94227.1| DNA-directed DNA polymerase protein [Rhizobium etli CIAT 652] (362 aa)
Score = 353, Expect = 2.0e-31, Identities = 92/292 (31%), Positives = 156/292 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  +  +    P+AVG      V+A+A+Y AR  GV SAM  V AK+ CP+L  + P  + Y ++S +I    +  +  IE  S+DE YLDV++         E A  ++  IKQ   LN + G S+  FLAKMA++L KP+G   +T  N  +++  L + K  G+GP+   ++  L +    D+     ++L+    K G ++  +     GI    + P+  RK++G   +  ++   Y+   + ++ L + +    +      K+V +K++Y+D    T+S
  S:    11 KIVHIDMDAFYASVEQRDNQDLRGKPIAVGGSAARGVVAAASYEARAYGVHSAMPSVTAKRKCPELIFVAPRFDVYKAVSQQIREIFAEYTAVIEPLSLDEAYLDVTHNLKGMEIATEIALEIRAKIKQATGLNASAGISYNKFLAKMASDLNKPNGQAVITPKNGPAFVEALPVKKFHGVGPATADKMHRLGIDTGADLKGKTLEFLVEHFGKSGPYFHGI---ARGIDERQVKPNRVRKSVGAEDTFSQDLHAYEPARQGLQPLIEKVWGYCEANGIGAKTVTLKVKYADFHQITRS 306
>gi|81096181|ref|ZP_00874530.1| DNA-directed DNA polymerase [Streptococcus suis 89/1591] >gi|80977803|gb|EAP41337.1| DNA-directed DNA polymerase [Streptococcus suis 89/1591] (355 aa)
Score = 352, Expect = 2.3e-31, Identities = 93/332 (28%), Positives = 170/332 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSIT 332
           +  KI H+DMD+FFA++E+ + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A L++  I  + +L  + G S+  FLAK+A+++ KP G   +  ++    +  L + K  G+G     +L E+ ++  +D+ +V    LI  + G     L     GI   P+  D  RK++G+ ++ R   Y E ++ LK +  L   + + LK      +++ +K+RY D  + TK  +   + +Q       V  L E+I    K  +++ +++T
  S:    10 LSRKIIHVDMDAFFAAIEVRDNPALKGKPVIIGADPRLSGGRGVVSTCNYEARAFGIHSAMSSKEAYECCPQAIFISGNYEKYQEVGRQVREIFHRYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKFLAKIASDMEKPYGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLDVPEMVLI-DRFGRFGFDLYRKARGISNSPVKVDRVRKSIGKERTYRKLLYRE-EDVLKELISLCQRVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIEEIGKIEKGIRLLGVTVT 351
>gi|177672183|ref|ZP_02945030.1| DNA-directed DNA polymerase [Micrococcus luteus NCTC 2665] >gi|172071058|gb|EDT57105.1| DNA-directed DNA polymerase [Micrococcus luteus NCTC 2665] (431 aa)
Score = 352, Expect = 2.4e-31, Identities = 80/241 (33%), Positives = 128/241 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           I H+DMD+FF SVEL E+P+ E  P AV    G  V+ SA+Y AR  GV+SAM +  A+ +CP L +I P +  Y ++S ++ + L+ ++  +E  S+DE +LDV+  +           L++  ++    L CTVG S   F+AK A+  AKPDG L +       +++ L + ++ G+GP    +L    +  I D+A V    L       G  W+ L     GI   P+ P    +++G   +
  S:    15 ILHVDMDAFFLSVELREQPDLEGRPAAVAAPSGRSVVLSASYAARAYGVRSAMPLAHARALCPPLVVIPPRQQLYRAVSAEVMAVLADVTPVMEQLSVDEAFLDVAGARRRLGPPEHIGHLIRERVRSALGLPCTVGGSAVKFVAKTASTAAKPDGLLIVPPQRTLDFLHPLPVGRLWGVGPKAAERLARRGVATIGDLARVDPARLEASFGAAGREWASL---ARGIDPRPVAPRPAARSIGADHT 258
>gi|150008205|ref|YP_001302948.1| DNA damage-inducible protein [Parabacteroides distasonis ATCC 8503] >gi|149936629|gb|ABR43326.1| DNA damage-inducible protein [Parabacteroides distasonis ATCC 8503] (361 aa)
Score = 352, Expect = 2.5e-31, Identities = 90/294 (30%), Positives = 155/294 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN 297
           KI HIDMD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV+SAM    AK++CP L  ++   + Y S+S +I+      +  IE  S+DE +LDV++ +      ++ A  +K  I +  NL  + G S+  FLAK+A++  KP+G  T+       +I  L I    G+GP   R++  L +H    +     + L R+  K G+ + +      GI   P+     RK++G   ++ ++ S     +  +  +  ++   L+   F   ++ +K+++ D +  T+S +
  S:     3 KIIHIDMDAFYASVEQRDNPELRGKPLAVGHAEQRGVVAAASYEARKYGVRSAMASQKAKRLCPDLIFVHGRMDVYKSVSRQIHEIFHDYTDIIEPLSLDEAFLDVTDNKQGISLAVDIAKEIKKRIWENLNLIASAGVSYNKFLAKIASDYRKPNGLCTIHPSQALDFIARLPIESFWGVGPVTARKMHTLGIHNGLQLRECSGEMLTRQFGKAGILYYEF---ARGIDNRPVEAVRIRKSVGCEHTLEKDISRKSSVIIELYHVATELIGRLERSGFKGNTLTLKVKFHDFNQITRSLS 300
>gi|168485592|ref|ZP_02710100.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae CDC1087-00] >gi|183571184|gb|EDT91712.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae CDC1087-00] (353 aa)
Score = 351, Expect = 2.6e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITLTG 352
>gi|56963934|ref|YP_175665.1| DNA polymerase IV DinB [Bacillus clausii KSM-K16] >gi|56910177|dbj|BAD64704.1| DNA polymerase IV DinB [Bacillus clausii KSM-K16] (374 aa)
Score = 351, Expect = 2.6e-31, Identities = 105/345 (30%), Positives = 185/345 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGL-HWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISD----FSKYDQVINLSITANNIMENDNNEQLTIF 348
           KI HIDMD+FF+SVE  + P     P+ +        G  ++A+ANYVAR  G+ SAM+  +A K CP+   I  N + Y   S +I   +   +  +E  SIDE YLDV+    EN   I+ A+L+  +I+Q       L  + G S+  F+AK+A++  KP G   +T +   ++I+ L I K  GIGP  ++++ EL ++   D+  ++   LI    K G+ ++ K R    GI   P+N   +RK++G+  +  +  +     LK ++ L  ++ + L+      K++ +KIRY   ++ T+  +F       P+    D++   ++    F + D+ I L       +E   ++ +++F
  S:    19 KIIHIDMDAFFSSVEERDCPSLRGKPVIIAKHPRKTGGKGIVATANYVARQYGIHSAMSAYEAYKRCPEGIFIEGNFSAYREASLQIRDIMHRYTDLVEPMSIDEAYLDVT----ENKLNIKSATLLAKNIQQDIWRETRLTSSAGVSYNKFIAKIASDYRKPAGLTVITPEQALAFIHQLPIEKFPGIGPKTSKKMHELKIYTGADLYQMEQLDLIHHFGKAGISYYRKAR----GIDNKPLNLQRERKSVGKEHTYFQPLTSEAAVLKELRRLAKEVEAVLERHGKQCKTIVVKIRYRSFETLTRQTSFT-----APIRDSADIYSYAAELWDKFGQVDREIRLLGVTATKLEPVEHQLISLF 370
>gi|89889949|ref|ZP_01201460.1| DNA polymerase IV, damage-inducible protein [Flavobacteria bacterium BBFL7] >gi|89518222|gb|EAS20878.1| DNA polymerase IV, damage-inducible protein [Flavobacteria bacterium BBFL7] (361 aa)
Score = 351, Expect = 2.8e-31, Identities = 99/313 (31%), Positives = 162/313 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF--QNQIPLHVVVDLFEQ 316
           KI H+DMD+F+ASVE  + PE +  P+AVG      V+A+A+Y AR  GV+SAM  + AKK+CP L  +    +KY  +S +I       +  +E  S+DE YLDV+  +         A  ++  I +   L  + G S   F+AK+A++  KP+G  T+T +    ++ +L I K  GIG     ++    +     +     ++L     K G H+  +   V GI   P+ PD  RK+LG  ++       + F+K  + ++ ++I   L   D   K+V +KI+YSD  + T+S    +F     + L   ++L EQ
  S:     8 KIIHVDMDAFYASVEQRDFPELKGKPIAVGGGNNRGVVAAASYEARKYGVRSAMPSITAKKLCPDLIFVKHRFDKYREVSSQIRDIFLDYTDLVEPLSLDEAYLDVTENKLNYPSATVIAYDIRRRIYETTGLTASAGISINKFVAKIASDYNKPNGQKTITPEEVIPFLEELEIRKFHGIGKVTAEKMYLQGIFTGAHLKERSLEFLQEHFGKSGAHYYNI---VRGIHHSPVKPDRIRKSLGAERTFSENISSEIFMKERLTQIAEEIEKRLAKNDVAGKTVTLKIKYSDFKTQTRSKTLPHFIRTKDLILATAIELMEQ 326
>gi|149025457|ref|ZP_01836393.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP23-BS72] >gi|147929407|gb|EDK80403.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP23-BS72] (353 aa)
Score = 351, Expect = 2.9e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLRIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 352
>gi|148272607|ref|YP_001222168.1| DNA polymerase IV [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830537|emb|CAN01472.1| DNA polymerase IV [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (430 aa)
Score = 351, Expect = 3.0e-31, Identities = 97/322 (30%), Positives = 166/322 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDP--INPDYKRKNLGRSQSIRNYSEYQEFLK--LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQV 326
           I HIDMD+FFA+VEL ERPE    P+ VG      V+ SA Y AR  GV+SAM +  A ++CPQ T+I  +  KY   S  +      ++  +E  SIDE +LDV+  +       E  ++++  +  +  L C+VG + T F+AK+A+   KPDG L +       +++ L +  + G+G +    L+   L  + DIA+     L +  +G   +  R++ L    DP  ++   + K++G   +  +     E ++  L+ + T  +   L+      ++V++K+RYSD  + T+S          P  V   ++++I D   Y+QV
  S:    23 ILHIDMDAFFAAVELLERPELRGTPVIVGGSSGRGVVTSATYEARRFGVRSAMPMAQALRLCPQATVIGGHMEKYAHWSRVVMGIFRDVTPLVEPLSIDEAFLDVAGARGLFGSPAEIGAMIRRRVHAETGLTCSVGAASTKFVAKLASTRCKPDGLLVIPAAETLPFLHALPVGALWGVGKTTEEALLRRGLRTVADIADTPLPAL-QSMLG-ESAGARLHDLSWGRDPRRVSTHREEKSMGHENTFHDDVTDPEIVRRELLGQAT-RVAERLRRAGLTARTVSLKLRYSDFRTITRSRTLSE-----PTDVARRIYDEIRDV--YEQV 342
>gi|39996716|ref|NP_952667.1| ImpB/MucB/SamB family protein [Geobacter sulfurreducens PCA] >gi|39983597|gb|AAR34990.1| ImpB/MucB/SamB family protein [Geobacter sulfurreducens PCA] (409 aa)
Score = 351, Expect = 3.4e-31, Identities = 102/367 (27%), Positives = 187/367 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINP---DYKRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ----IPLHVVVDLFEQIS---DFSKYDQVIN-LSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKT 371
           I H+DM++FFASVE    P  +  P+AV       +I +A+Y AR  GV + M   +AK++CP+L ++  N  +YT +S  I+  L   +  +E  SIDE +LD++ +     +    A  +K  I+ +F L C++G +    LAK+A+++ KPDG   +  +N  S +    I  + GIGPS  ++L  L +    D+ +  +  L R   G   ++L+    GI   P+ P   + + K++  S +    + N  +  ++L ++ E+        K +    K+V + IRY+D         F  F  Q     PL+   D++  ++   D  +  Q I  L +  +N++    +EQL +F    +  +    ++++  +  +T
  S:     7 ILHLDMNAFFASVEQQADPSLQGKPVAVIGSGARTIITTASYEARAHGVGTGMTTHEAKRLCPELILVIGNNREYTRISKLIFEMLGQFTPLVEVFSIDEAFLDLTGSLRLFGRADVIAREIKARIRDRFGLTCSIGIAPNKLLAKLASDMQKPDGLTIIPPENVASLMKTTPIRSLCGIGPSTEQRLKYLGISTCNDLGHFSSKILTR-HFGAMGARLKQMGQGIDDSPVIPTTTEEEVKSVSHSTTLDHDLTNKDDIHKYLLMLSEMVGRRARRYKTKG---KTVTLTIRYAD---------FTTFSRQETLPSPLNRSGDIYRAVTALLDTLQLTQPIRLLGVAISNLVH--ASEQLPLFPEERRLTTLSQAMDQVNDRFGET 377
>gi|148988211|ref|ZP_01819674.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP6-BS73] >gi|147926675|gb|EDK77748.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP6-BS73] (353 aa)
Score = 350, Expect = 3.6e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSNPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 352
>gi|159901912|gb|ABX10645.1| DNA-directed DNA polymerase IV [uncultured planctomycete 3FN] (384 aa)
Score = 350, Expect = 3.9e-31, Identities = 84/291 (28%), Positives = 153/291 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H+DMD+F+AS+E  +RPE   LP+ VG       V+++ANYVAR  GV SAM    AK++CPQ   +      Y  +S +I       +  +E  ++DE +LDV+ +        E    +K +I  +  L  +VG +   FLAK+A++L KPDGF+ +      +++  L ++++ G+G +  R+L  + + +I  +  +  + L     G    +L +   GI    + PD   K++    +   +  + +    ++ +LT+ +   ++  +   ++V +KIRYSD  + T+S
  S:     2 IVHVDMDAFYASIEERDRPELRGLPVIVGGDAQRRGVVSAANYVARSFGVHSAMPAATAKRLCPQGVFLPTRMPHYVDVSCQIREIFGRFTPLVEPLALDEAFLDVTGSSRLFGPPEEIGRTIKTAIHDELQLVASVGIAPNKFLAKLASDLDKPDGFVVVNPKAIHAFLDPLPVTRLWGVGKAAARKLDLIGIQHIAQLRALPRESLA-DNFGASGDQLWLLANGIDDRDVIPDRDAKSISHETTFAVDVDDMERLRGVLAQLTEQVARRVRAAELRGRTVQLKIRYSDFQTYTRS 297
>gi|170781916|ref|YP_001710248.1| DNA polymerase IV [Clavibacter michiganensis subsp. sepedonicus] >gi|169156484|emb|CAQ01633.1| DNA polymerase IV [Clavibacter michiganensis subsp. sepedonicus] (430 aa)
Score = 350, Expect = 4.0e-31, Identities = 97/322 (30%), Positives = 165/322 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDP--INPDYKRKNLGRSQSIRNYSEYQEFLK--LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQV 326
           I HIDMD+FFA+VEL ERPE    P+ VG      V+ SA Y AR  GV+SAM +  A ++CPQ T+I  +  KY   S  +      ++  +E  SIDE +LDV+  +       E   +++  +  +  L C+VG + T F+AK+A+   KPDG L +       +++ L +  + G+G +    L+   L  + DIA+     L +  +G   +  R++ L    DP  ++   + K++G   +  +     E ++  L+ + T  +   L+      ++V++K+RYSD  + T+S          P  V   ++++I D   Y+QV
  S:    23 ILHIDMDAFFAAVELLERPELRGTPVIVGGSSGRGVVTSATYEARRFGVRSAMPMAQALRLCPQATVIGGHMEKYAHWSRVVMGIFRDVTPLVEPLSIDEAFLDVAGARGLFGSPAEIGVMIRRCVHAETGLTCSVGAASTKFVAKLASTRCKPDGLLVIPAAETLPFLHGLPVGALWGVGKTTEEALLRRGLRTVADIADTPLPAL-QSMLG-ESAGARLHDLSWGRDPRRVSTHREEKSMGHENTFHDDVADPEIVRRELLGQAT-RVAERLRRAGLTARTVSLKLRYSDFRTITRSRTLAE-----PTDVARRIYDEIRDV--YEQV 342
>gi|148983852|ref|ZP_01817171.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP3-BS71] >gi|147923999|gb|EDK75111.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP3-BS71] (353 aa)
Score = 350, Expect = 4.0e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 352
>gi|183603432|ref|ZP_02716781.2| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae CDC3059-06] >gi|183576835|gb|EDT97363.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae CDC3059-06] (373 aa)
Score = 350, Expect = 4.2e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    30 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSNPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 372
>gi|194535823|ref|YP_002070990.1| DNA-damage-inducible protein P [Vibrio cholerae RC385] >gi|150420617|gb|EDN12908.1| DNA-damage-inducible protein P [Vibrio cholerae RC385] (360 aa)
Score = 349, Expect = 4.5e-31, Identities = 95/290 (32%), Positives = 155/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE-LTDDINSGLKY---QDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD FFA+VE+ + P Y ++PLAVG       VI++ NY AR  GV+SAM    A K+CPQL ++    + Y S+S +I +     +  IE  S+DE YLDVS +          A  ++  I Q+ NL  + G +   FLAK+A++L KPDG   +T D  +  +  L + KI G+G     +L +  L+   D+       L+  + G   + L     GI    +  + +RK++G   +  +N   +QE  ++I++ L  ++++ L     Q  + K   IK++++D    T
  S:     7 KIIHVDMDCFFAAVEMRDNPAYREIPLAVGGHEKQRGVISTCNYQARKFGVRSAMPTAQALKLCPQLHVVPGRMSVYKSVSQQIQTIFQRYTTLIEPLSLDEAYLDVSESTAYQGSATLIAQAIRRDIWQELNLTASAGVAPIKFLAKVASDLNKPDGLYVVTPDKVQEMVDSLPLEKIPGVGKVALEKLHQAGLYVGADVRRADYRKLLH-QFGRLGASLWKKSHGIDEREVVTERERKSVGVEHTFSQNILTFQECWQVIEQKLYPELDARLSRAHPQRGIIKQ-GIKVKFADFQQTT 304
>gi|15900374|ref|NP_344978.1| DNA polymerase IV [Streptococcus pneumoniae TIGR4] >gi|14971928|gb|AAK74618.1| DNA-damage inducible protein P [Streptococcus pneumoniae TIGR4] (344 aa)
Score = 349, Expect = 4.6e-31, Identities = 102/333 (30%), Positives = 173/333 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           M  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S   +  +++ +++T 
  S:     1 MSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSKKERGVRLLGITMTG 343
>gi|86143650|ref|ZP_01062026.1| DNA polymerase IV [Flavobacterium sp. MED217] >gi|85829693|gb|EAQ48155.1| DNA polymerase IV [Leeuwenhoekiella blandensis MED217] (367 aa)
Score = 349, Expect = 4.7e-31, Identities = 95/295 (32%), Positives = 158/295 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           +  KI H+DMD+F+ASVE  + PE    P+AVG      V+++A+Y AR  GV+SAM    A+K+CP L  +    ++Y  +S +I       +  +E  S+DE YLDV+  +  N      A  ++  IK+K  LN + G S   F+AK+A+++ KP+G  T+  +    ++  L I K  G+G     ++ +L +    D+ +   ++L  K  K G H+  +   V GI    + P   RK+LG  ++   N S     L+ ++ + ++I   LK  +   K+V +KI+YSD    T+S
  S:     6 VNRKIIHVDMDAFYASVEQLDNPELRGKPVAVGGGSERGVVSAASYEARKFGVRSAMAGALARKLCPDLIFVKTRFDRYREISAQIREVFHEYTDLVEPLSLDEAYLDVTENKKGNPSATLIAKEIRAKIKEKTGLNASAGISINKFIAKVASDVNKPNGQKTVNPEEVLPFLEALDIRKFYGVGKVTAEKMYQLGIFTGNDLKSKSLEFLQEKFGKSGNHYYNV---VRGIHLSEVKPHRIRKSLGAERTFSENISSEIFMLERLENIAEEIERRLKKSNVAGKTVTLKIKYSDFTLKTRS 304
>gi|46109048|ref|XP_381582.1| hypothetical protein FG01406.1 [Gibberella zeae PH-1] (639 aa)
Score = 349, Expect = 4.8e-31, Identities = 84/285 (29%), Positives = 152/285 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSN-TQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKD--NFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNV-LGIICDPINP--DYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           +   I H+D D+F+A+VE  +RPE + LP AVG  V+ + NYVAR  G +S M    AKK+CP L ++ PN  KYT+ + ++   L +     E+ SIDE YL+++   Q       E    ++  + QK N+  + G +    LAK+ +N+ KP+G   L+ D     +++ DL    + GIG  L R+L+E+ +    D+   ++   +    G   S+      LG+    I P  +Y+RK++G   + R+ S+  +  + ++   +D+   +K  +   +++ +K++
  S:   130 LTQHIVHVDCDAFYAAVEQLDRPEIKDLPFAVGGGVLTTCNYVARKFGCRSGMAGFVAKKLCPNLILLKPNFQKYTAKAHEVREVLVNYDPRFESASIDEAYLNITEYCQEHQMGPAEVVEQMRREVHQKTNITVSAGIAANARLAKICSNMNKPNGQYVLSSDRPTILAFMRDLSTRSVNGIGRVLERELLEIGIKTCGDL--YEHRQYLNPLFGEKTSEFLFTCYLGLGRTKIQPAEEYERKSVGTESTFRDMSDPTQLREKLRSTAEDLEQDMKRAECKGRTLCLKVK 418
>gi|37525206|ref|NP_928550.1| DNA polymerase IV [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81572650|sp|Q7N7B6|DPO4_PHOLL DNA polymerase IV (Pol IV) >gi|36784633|emb|CAE13533.1| DNA polymerase IV (DNA-damage-inducible protein P) [Photorhabdus luminescens subsp. laumondii TTO1] (351 aa)
Score = 349, Expect = 5.2e-31, Identities = 90/285 (31%), Positives = 154/285 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSD 288
           KI HIDMD F+A++E+ + P    +P+AVG       VI++ANY AR  GV+SAM+   A K+CPQL ++      Y  +S  I+  LS  ++ IE  S+DE YL+V+++ +        A  ++ SI  +  L  + G +   FLAK+A+++ KP+G   +  D    +I  L + KI G+G  + ++L  + L    D+       L+ K++G     L     GI    +NPD  RK++G  +++ R+  ++++  +LI+ L  ++   L     D       IK+++ D
  S:     3 KIIHIDMDCFYAAIEMRDDPSLRHIPIAVGGNADRRGVISTANYPARRFGVRSAMSTAMALKLCPQLKVLPGRMALYREVSRHIHQILSRYTEWIEPLSLDEAYLNVTDSHHCYGSATLIAQEIRQSIFDELQLTASAGIAPVKFLAKIASDINKPNGQYVIPPDRVADFIKVLPLRKIPGVGKVMVQRLANMGLETCSDVQKYDVIVLV-KQLGKFGQVLWDRCHGIDERLVNPDRLRKSIGVERTLARDIHQWEQCTELIESLYLELEKRLSNVKPDLRIARQGIKLKFDD 294
>gi|146338544|ref|YP_001203592.1| DNA polymerase IV [Bradyrhizobium sp. ORS278] >gi|146191350|emb|CAL75355.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Bradyrhizobium sp. ORS278] (368 aa)
Score = 349, Expect = 5.3e-31, Identities = 93/292 (31%), Positives = 157/292 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFM---FKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + PE    P+AVG      V+A+A+Y AR  GV+SAM  + AK++CP L  + P    Y ++S +I +  +  +  IE  S+DE YLDV++         + A  ++  IK +  LN + G S+  FLAK+A++  KP+G   ++ +   +++  L + +  GIGP+   +   L +H   DI N    +L ++  G   S       GI   P+  +  RK++G   +    ++  EF  +  EL   I+   ++ D      ++V +K++++D D  T+S
  S:    17 KIIHIDMDAFYASVEQRDNPELRGRPVAVGGSRERGVVAAASYEARKFGVRSAMPSMTAKRLCPDLIFVKPRFEVYKAISQQIRAIFAEHTPIIEPLSLDEAYLDVTDNLQGIPLARDIALQIRARIKAETGLNASAGISYNKFLAKLASDHRKPNGQYVISPETGAAFVEGLPVGRFHGIGPATAAKFNALGIHTGLDIRNQTLPFL-QQHFGKAGSYYYWISRGIDHRPVRANRIRKSIGAENTFA--TDLIEFEPMAAELQPLIDKVWRHCDATGNRGRTVTLKVKFADFDVITRS 312
>gi|149185736|ref|ZP_01864052.1| DNA polymerase IV [Erythrobacter sp. SD-21] >gi|148830956|gb|EDL49391.1| DNA polymerase IV [Erythrobacter sp. SD-21] (370 aa)
Score = 349, Expect = 5.7e-31, Identities = 86/285 (30%), Positives = 147/285 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           KI H+DMD+FFASVE  + P+    P+AVG      V+A+A+Y AR  GVKSAM  V AK++CP L  +    + Y  +S +I +     +  +E  S+DE YLDV+  +         A L++  I+ K  L  + G S+  FLAK+A++  KPDG   +       ++  L + +  G+GP    ++  L +    ++A  K+   +R   G     L     GI   P+     RK++G  ++  R+ S   E  + ++++ D +   ++  +   ++V +K++Y D
  S:    17 KIIHVDMDAFFASVEQRDNPDLRGKPVAVGGSSGRGVVAAASYEARKFGVKSAMPSVTAKRLCPDLIFVKSRFDAYREVSQQIRAIFRHHTDLVEPLSLDEAYLDVTEDKLGIGSATRIAELIRQEIRAKTRLTASAGVSYNKFLAKLASDQNKPDGMCVIRPGEGADFVQSLPVRRFHGVGPKGAEKMDRLGIQTGAELA-AKDIEWLRAHFGSFADYLYRAARGIDLRPVRSSRIRKSVGGERTFSRDLSSGSELRETLEDIIDIVWGYIERAEAKGRTVTLKMKYID 305
>gi|149013645|ref|ZP_01834192.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP19-BS75] >gi|147762793|gb|EDK69749.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP19-BS75] (353 aa)
Score = 349, Expect = 5.7e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITLTG 352
>gi|182683425|ref|YP_001835172.1| DNA polymerase IV [Streptococcus pneumoniae CGSP14] >gi|182628759|gb|ACB89707.1| DNA polymerase IV [Streptococcus pneumoniae CGSP14] (375 aa)
Score = 348, Expect = 5.8e-31, Identities = 101/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    32 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITLTG 374
>gi|169342868|ref|ZP_02863899.1| DNA polymerase IV [Clostridium perfringens C str. JGS1495] >gi|169299125|gb|EDS81197.1| DNA polymerase IV [Clostridium perfringens C str. JGS1495] (359 aa)
Score = 348, Expect = 6.3e-31, Identities = 111/346 (32%), Positives = 193/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF--QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN---DNNEQLTIFD 349
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I +L I K  G+G     +L  + +   +D+     + LI     R KI   +++      GI   P+NP   RK++G+  ++R +  + +E +++++ + + ++  L   +   K+V +K++++D    T+S    +F  + +  +  V DL   + DF K  +V  L IT +++ EN   +  EQL+ FD
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGKPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNLVEPLSLDEAFVDVSKSKRCKGSATLMALEIKERIFKEVGLTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRNLPIGKFFGVGRVTKNKLNNIGVFKGEDLLKFSEEELIDIFSERGKILYEFAR------GIDNRPVNPYRIRKSIGKEITLREDIEDIEEMIEILEGIAERVSESLDLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEKKELMECVKDLI-SVVDF-KNKKVRLLGITISSLEENIITEEREQLS-FD 358
>gi|149005568|ref|ZP_01829307.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP18-BS74] >gi|147762508|gb|EDK69468.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP18-BS74] (353 aa)
Score = 348, Expect = 6.3e-31, Identities = 100/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I ++ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLRIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWKELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITLTG 352
>gi|110599682|ref|ZP_01387917.1| DNA-directed DNA polymerase [Geobacter sp. FRC-32] >gi|110549598|gb|EAT62789.1| DNA-directed DNA polymerase [Geobacter sp. FRC-32] (420 aa)
Score = 348, Expect = 6.3e-31, Identities = 104/375 (27%), Positives = 182/375 (48%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQIS-------DFSKYDQVIN-LSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHY 379
           I H+DM++FFASVE    P     P+AV       ++ + +Y AR  GVK+ M + +AK  CP L ++     +YT +S  I   +   +  +ET SIDE +LD+S +          ASL+K  I  +F L C++G +    LAK+A+++ KPDG   +        +    I  + GIG    + L  L +    D+       L+R+K G+    L +  LG+   P+ P  +    K++G S ++ ++  + ++ L+ + +L + +   ++      K+V + +RY+D         F NF  Q+ L    +L  +I        D  +  Q +  L +  +N+   D  EQL +F+   +K    + L K   +VN    +  + Y
  S:    15 IMHVDMNAFFASVEQQNDPRLRGKPVAVVGSSKRTIVTTCSYEARAFGVKTGMALWEAKSCCPNLILVVGKNREYTRISSLIMKLMYDFTPLVETFSIDEAFLDISGSLSLFGTPENIASLLKARIGDQFGLTCSIGIAPNKLLAKLASDMQKPDGLTVIKPAEVALTMDRTPIRDMCGIGKKTEKSLTMLGIRTCGDLGRFPVK-LLRQKFGIVGEALHLMGLGVDDSPVVPQEESDLVKSVGHSMTLEKDLEKREDILRYLLQLAEMVGRRMRRYGVAGKTVCLSVRYAD--------FFTNFSRQLTLPEYTNLSAEIYRGAVTLLDSVELTQPVRLLGVKLSNLRHQD--EQLPLFEGERKK----AHLAKAMDEVNSRFGEFSVTY 390
>gi|15902458|ref|NP_358008.1| DNA polymerase IV [Streptococcus pneumoniae R6] >gi|15457978|gb|AAK99218.1| DNA-damage-inducible protein P [Streptococcus pneumoniae R6] (356 aa)
Score = 348, Expect = 6.8e-31, Identities = 100/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY ++  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    13 LSRKIIHIDMDAFFAAVEIKDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 355
>gi|172079493|ref|ZP_02707651.2| DNA polymerase IV [Streptococcus pneumoniae CDC1873-00] >gi|172043839|gb|EDT51885.1| DNA polymerase IV [Streptococcus pneumoniae CDC1873-00] (373 aa)
Score = 348, Expect = 6.8e-31, Identities = 100/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY ++  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    30 LSRKIIHIDMDAFFAAVEIKDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 372
>gi|116516092|ref|YP_815927.1| DNA polymerase IV [Streptococcus pneumoniae D39] >gi|122279187|sp|Q04M21|DPO4_STRP2 DNA polymerase IV (Pol IV) >gi|73620814|sp|Q8DQZ7|DPO4_STRR6 DNA polymerase IV (Pol IV) >gi|116076668|gb|ABJ54388.1| DNA-damage inducible protein P [Streptococcus pneumoniae D39] (353 aa)
Score = 348, Expect = 6.8e-31, Identities = 100/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY ++  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIKDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 352
>gi|104774416|ref|YP_619396.1| DNA polymerase IV [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423497|emb|CAI98399.1| DNA polymerase IV [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (371 aa)
Score = 348, Expect = 6.9e-31, Identities = 91/291 (31%), Positives = 160/291 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICP--QLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           +I H+DMD+F+ASVE+ +RPE     + +        GH VIA+ANY AR  GV SAM    A K+ P  +L  + P+  KY  +S +++  +  L+  IE+ ++DE Y+DV+ ++      +E AS ++  I ++ +L  + G S+  FLAKM +  AKP G   L  D  + ++    I +  GIG     +L E  +   +DI N     L++  KK G +   + ++  GI   P+    +RK+LG+ ++    I +      +L   K+ +  + + LK ++ + + V +K+R  +  + T+
  S:    15 RIIHLDMDAFYASVEMRDRPELANKAVVIAQDPRKTGGHGVIATANYRARKYGVGSAMAAAQAVKLIPAEELVFVEPDFAKYHRVSGQVHGLMHELTDQIESVALDEAYMDVTRSKIPGKSALELASYLQEQIFRQLHLTSSFGVSYNKFLAKMGSEYAKPFGRTYLAPDRVQDFLDRQEIKRFPGIGKKTQERLKEAGVLTGRDIRNYGLSRLLKDYKKSGYY---MALHAYGIDLSPVQASRQRKSLGKERTFEPVIYDPDRADAYL---KDFSQTVAAELKGRNLLARVVVLKVRDRNFKTITR 315
>gi|152968821|ref|YP_001333930.1| DNA polymerase IV [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953670|gb|ABR75700.1| DNA polymerase IV [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (362 aa)
Score = 348, Expect = 7.1e-31, Identities = 89/285 (31%), Positives = 155/285 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSD 288
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDVS++++ +      A  ++ +I+++  L  + G +   FLAK+A+++ KP+G   +       ++  L ++KI G+G     +L  + L    D+ N     L+++  K G + W +      GI    I+ D +RK++G  +++  +  E+ E   +I+ L  ++   L     D +     IK++++D
  S:    14 KIIHVDMDCFFAAVEMRDNPALRDIPLAIGGSRVQRGVISTANYPARKFGVRSAMPTATALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVSDSEHCHGSATLIAQEIRQTIERELRLTASAGVAPVKFLAKIASDMNKPNGQFVIAPHQVAEFVRALPLAKIPGVGKVSAAKLENMGLRTCGDVQNSDLAMLLKRFGKFGRILWERSH----GIDEREIHNDRQRKSVGVERTLAEDIHEWPECEAIIENLYPELERRLAKVKPDLLIARQGIKLKFND 305
>gi|148653720|ref|YP_001280813.1| DNA-directed DNA polymerase [Psychrobacter sp. PRwf-1] >gi|148572804|gb|ABQ94863.1| DNA-directed DNA polymerase [Psychrobacter sp. PRwf-1] (369 aa)
Score = 348, Expect = 7.2e-31, Identities = 91/295 (30%), Positives = 156/295 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           ++ KI H+DMD+F+ASVE  + P+    PL VG       V+A+A+Y  R  GV+SAM+  +AK+ CP+   + P    Y  +S +I   + SL+  +E  S+DE YLDV+  +  +      A+ ++  I ++  L  + G SF   LAK+A+++ KP+G   +T D   ++I  L I +  GIG +  ++L E+ ++   D+     D L  +  K G  +S++     G    P+  + K K++G   + R N  +    L  I E   D    L  +  +  ++ +KI+Y+D    T+S
  S:    15 LQRKIIHLDMDAFYASVEQRDNPQLRGKPLVVGGDPSGRGVVAAASYEIRKFGVRSAMSCYEAKRRCPEAIFVRPRFEVYRQVSQQIRDIMLSLTDLVEPLSLDEAYLDVTGIKAHHGSATLMANWLRAQIYEQTQLRASAGVSFNKMLAKIASDINKPNGIAVITPDQADAFIATLPIERFHGIGKATAKRLHEMGIYTGADLRAAPVDTLEYEFGKRGRFYSEIAH---GNDNRPVKAERKHKSVGSETTFRDNLRDTDNLLVQIFEQNADAFEQLSKKGRLGHTITLKIKYADFTQITRS 314
>gi|148323149|gb|EDK88399.1| DNA-directed DNA polymerase III kappa subunit [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (351 aa)
Score = 348, Expect = 7.4e-31, Identities = 107/339 (31%), Positives = 182/339 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT-QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTL-TKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKY-------QDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M+  I H DMD+F+AS+E+   P+ +   L VG  ++ +A+Y AR  G+ SAM + DAK +CP+L ++  +K +Y  +S++I++ +  ++  +E  + DE Y+D+++  + EN K   FA   K  IK+  NL C+VG  F    AK+A+++ KP GF     ++ F  +I D  I  I G+G      L   N+ Y+KD+     DYL++K        L  +V GI  D +  +Y+++      SI N   +   L+   E+  + NS  +Y        +   +SV IK+RY+   + TKS   + F  +    +  ++ E I+ F K D+V  L +   +I +N
  S:     1 MERIIMHYDMDAFYASIEINRNPKLKSKALVVGENIVTTASYEARKYGIHSAMKVSDAKLLCPKLIVLPVDKTEYIRISNEIHNLILKITNKVEFVATDEGYIDLTDVIKAENKK--AFAIKFKQRIKELTNLTCSVGIGFNKLSAKIASDINKPFGFFIFKNEEEFIKHISDKKIKIIPGVGKKFFEILKNDNIFYVKDVFKYSLDYLVKKYGKSRGENLYCSVRGIDFDEV--EYQKE----IHSIGNEETFLIPLQNNSEIIREFNSLFEYTFERLIKNNVFTQSVTIKMRYTSFKTYTKS-KKLKFSTRSKDFIYNEMLELINSFEKEDEVRLLGVYFGDIRKN 339
>gi|50083505|ref|YP_045015.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Acinetobacter sp. ADP1] >gi|81613392|sp|Q6FFG4|DPO4_ACIAD DNA polymerase IV (Pol IV) >gi|49529481|emb|CAG67193.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Acinetobacter sp. ADP1] (351 aa)
Score = 348, Expect = 7.5e-31, Identities = 88/282 (31%), Positives = 150/282 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           KI HIDMD+F+ASVEL ERPE + LP+ +       VIA+A+Y AR  G++SAM +  A+K+CP L II PN +KY ++S +I+      +  IE  S+DE YLDV+          + A  ++  I ++ +L  + G +   FLAK+A++  KP+G   +       +I +L + KI G+G     +L +L L  + D+ +++   LI +  G +  +L +   GI    +  +  R+ + +  +        E       L + +   L+ ++   + VNIK++
  S:     3 KIIHIDMDAFYASVELRERPELKTLPVVISSHHPRAVIAAASYPARVYGLRSAMPMGQARKLCPDLIIIEPNFDKYRAVSHQIHQIFQQHTHIIEPLSLDEAYLDVTENLNNLPSATDVAIQIRQQIWEQTSLTASAGVAPNKFLAKIASDWNKPNGLCVIKPHQVMQFIQNLPLKKIPGVGRVTQDKLQQLKLETLGDLQHIEEAVLI-QHFGKYGKQLYLYAQGIDHRSVQAERVRQQISKETTFDQDLYLHECSSYWLMLAEKVWQSLQNKNLQARGVNIKLK 287
>gi|146320049|ref|YP_001199760.1| DNA polymerase IV [Streptococcus suis 98HAH33] >gi|189044615|sp|A4VZ21|DPO4_STRS2 DNA polymerase IV (Pol IV) >gi|145690855|gb|ABP91360.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Streptococcus suis 98HAH33] (355 aa)
Score = 347, Expect = 7.7e-31, Identities = 93/332 (28%), Positives = 169/332 (50%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSIT 332
           +  KI H+DMD+FFA++E+ + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A L++  I  + +L  + G S+  FLAK+A+++ KP G   +  ++    +  L + K  G+G     +L E+ ++  +D+ +V    LI  + G     L     GI   P+  D  RK+ G+ ++ R   Y E ++ LK +  L   + + LK      +++ +K+RY D  + TK  +   + +Q       V  L E+I    K  +++ +++T
  S:    10 LSRKIIHVDMDAFFAAIEVRDSPALKGKPVIIGADPRLSGGRGVVSTCNYEARAFGIHSAMSSKEAYERCPQAIFISGNYEKYQEVGRQVREIFHRYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKFLAKIASDMEKPHGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLDVPEMVLI-DRFGRFGFDLYRKARGISNSPVKVDRVRKSSGKERTYRKLLYRE-EDVLKELISLCQRVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIEEIGKIEKGIRLLGVTVT 351
>gi|150377463|ref|YP_001314058.1| DNA polymerase IV [Sinorhizobium medicae WSM419] >gi|150032010|gb|ABR64125.1| DNA-directed DNA polymerase [Sinorhizobium medicae WSM419] (378 aa)
Score = 347, Expect = 8.1e-31, Identities = 91/292 (31%), Positives = 154/292 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + PE    P+AVG+     V+A+A+Y AR  GV SAM  V AK+ CP L  +      Y ++S +I++  +  +  IE  S+DE YLDV+    EN K +E A+ +   I+ +      L  + G S+  FLAK+A++  KPDG   +T  +   ++  L + K  G+GP+   ++  L +    D+   ++   +++  G           GI    + PD  RK++G   + R +  + +   + ++ L D +    +      K+V +K+++SD    T+S
  S:    27 KIIHIDMDAFYASVEQRDNPELRGKPVAVGYPAARGVVAAASYEARKFGVHSAMPSVTAKRKCPDLIFVPHRFEVYRAVSRQIHAIFAEYTPLIEPLSLDEAYLDVT----ENLKGMELATEIAEEIRARIRAETGLTASAGVSYNKFLAKIASDQRKPDGLFVITPKHGPEFVQMLPVKKFHGVGPATAEKMKRLGIETGADL-KARDLAFLQQHFGKSGPYFYWIARGIDGREVKPDRIRKSVGAEDTFREDIHDLETAREGLRPLMDKVWHYCEAGSIRGKTVTLKVKWSDFTQITRS 322
>gi|149003686|ref|ZP_01828531.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP14-BS69] >gi|147758248|gb|EDK65249.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP14-BS69] (353 aa)
Score = 347, Expect = 8.5e-31, Identities = 100/333 (30%), Positives = 174/333 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY ++  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSIAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 352
>gi|116514514|ref|YP_813420.1| nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093829|gb|ABJ58982.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (371 aa)
Score = 347, Expect = 9.8e-31, Identities = 89/291 (30%), Positives = 158/291 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICP--QLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           +I H+DMD+F+ASVE+ +RPE     + +        GH VIA+ANY AR  GV SAM    A K+ P  +L  + P+  KY  +S +++  +  L+  IE+ ++DE Y+DV+ ++      +E AS ++  I ++ +L  + G S+  FLAKM +  AKP G   L  D  + ++    I +  GIG     +L E  +   +DI N     L++  KK G +   + ++  GI   P+    +RK+LG+ ++        +     +K+ +  + + LK ++ + + V +K+R  +  + T+
  S:    15 RIIHLDMDAFYASVEMRDRPELANKAVVIAQDPRKTGGHGVIATANYRARKYGVGSAMAAAQAVKLIPAEELVFVEPDFAKYHRVSGQVHGLMHELTDQIESVALDEAYMDVTRSKIPGKSALELASYLQEQIFRQLHLTSSFGVSYNKFLAKMGSEYAKPFGRTYLAPDRAQDFLDRQEIKRFPGIGKKTQERLKEAGVLTGRDIRNYGLSRLLKDYKKSGYY---MALHAYGIDLSPVQASRQRKSLGKERTFEPVIYDSDLADAYLKDFSQTVAAELKGRNLLARVVVLKVRDRNFKTITR 315
>gi|126647985|ref|ZP_01720479.1| DNA polymerase IV [Algoriphagus sp. PR1] >gi|126575578|gb|EAZ79888.1| DNA polymerase IV [Algoriphagus sp. PR1] (365 aa)
Score = 347, Expect = 9.8e-31, Identities = 96/313 (30%), Positives = 163/313 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN-QIPLHVVVDLFEQ 316
           KI H+DMD+F+ASVE  + PE+   PL VG      V+A+A+Y AR  GV SAM    A + CP L    P  ++Y  +S  I       +  +E  S+DE +LDV+  +      I  A  ++  IK+K NLN + G S+  FLAK+A++L KP+G   +  ++ + ++  L I K  GIG     ++ ++ +H   D+      +L +K  K GLH+  +   V GI    + P   RK+L    +   + +  +E L  ++ + +++   L       ++V +K++YSD    T+S     + + ++   +  +L EQ
  S:    11 KIIHVDMDAFYASVEQMDHPEWRGKPLVVGGSRARGVVAAASYEARKYGVYSAMASSIAVRKCPHLIFAKPRFDRYRELSLMIREVFYEYTDLVEPLSLDEAFLDVTENKKGINSAILIARQIRQKIKEKTNLNASAGVSYNKFLAKIASDLNKPNGQAYILPEDAEEFLEKLPIGKFFGIGKVTAEKMQKIGIHNGADLKQFSLQFLSKKFGKSGLHYFNI---VRGIHLSEVQPHRVRKSLSAENTFEVDLTTDEELLNKLQPIYEEVIRRLDKSGIKGRTVTLKLKYSDFSLQTRSKTLEQYPDKEMIWEIAKELLEQ 328
>gi|153956047|ref|YP_001396812.1| DinB [Clostridium kluyveri DSM 555] >gi|189027659|sp|A5N2U5|DPO4_CLOK5 DNA polymerase IV (Pol IV) >gi|146348905|gb|EDK35441.1| DinB [Clostridium kluyveri DSM 555] (400 aa)
Score = 346, Expect = 1.0e-30, Identities = 114/374 (30%), Positives = 195/374 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR--KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFV------------------NFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKI-STESKLEKIRKQVNKTLNK 374
           M   IF +DM++FF S E    PE    P AV         +I +ANY AR  GVK+ M +    K+CP + II P+   Y   S ++   LS  +  IE  SIDE +LD++  +    +  + A  +   I  +  L+C++G S   FLAKMA+ + KP G   L K + +  ++ L +  + GIG    R+L E+ +  I ++AN    YLI KK+G   +++     GI   P+ P   +  K++G+S ++  + S+ +    ++ EL+D +    +  +    +V I I+YS+  S T+                       N+  ++P+ +   L   +S FSKY++  +  I+  N++E DN +      S  +KI   E+ ++ IRK+   ++ K
  S:     1 MHRVIFLVDMNAFFISCESTRHPEIIGKPAAVAGDPKNRSGIILTANYEARKFGVKTTMVLHKVLKLCPNIIIIPPDHCFYKQKSKEVMGILSKYTPVIEKNSIDEAWLDMTGCERIFGRSYQTAECIMKHINSELGLDCSIGISENKFLAKMASQMKKPLGITKLWKKDIELKLWPLPVEFMNGIGKQTARKLREMKIKTIGELANFDRRYLI-KKLGKVGAEIHQFANGIDVSPVTPHSHKDVKSIGKSITLAHDISDIESAKVILMELSDKVGMTARKYNKKGHTVQINIKYSNFQSITRQRTITETYLVKEIYSAGIEMLEKNWNERLPVRL---LGISLSGFSKYNE--DEQISMFNMLEIDNEK------SSVRKIDKIEAAIDSIRKKYGDSIIK 390
>gi|116512975|ref|YP_811882.1| DNA polymerase IV [Lactococcus lactis subsp. cremoris SK11] >gi|123025143|sp|Q02WA3|DPO4_LACLS DNA polymerase IV (Pol IV) >gi|116108629|gb|ABJ73769.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Lactococcus lactis subsp. cremoris SK11] (364 aa)
Score = 346, Expect = 1.0e-30, Identities = 96/328 (29%), Positives = 167/328 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK--LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSI 331
           KI HIDMD+FFASVE+ + P  +  P+ +        G  V+++ +Y AR  G+ SAM+  +A  +CPQ   I  N  KYT +S ++       + NIE  SIDE YLDV+  +      I+ A L+++ I  +  L C+ G S+  FLAK+A++  KP G   +  D    ++  L + K  G+G +   +L  L      D+    +   + +K G++  +L     GI    +    +RK++G+ ++        + +K  LIK ++  ++  LK        + +K+RYSD  + TK  + V  +N      + +  +QI +   YD+ + + +
  S:    13 KIIHIDMDAFFASVEVRDNPSLKGKPVVIARNPLQTGGRGVVSTCSYEARAFGIHSAMSAKEAYDLCPQAIFISGNYEKYTKVSKQVREIFKRYTDNIEAASIDEAYLDVTENKIGAQSAIKIAKLIQHDIFVELGLTCSAGVSYNKFLAKIASDYEKPHGLTLIMPDEALEFLAKLPVEKFHGVGKATVPKLHALGFFTGGDLQKA-DPVDLAEKFGIYGWELFQKANGIHNSKVKNHRERKSVGKERTYGKLLYLPDDIKAELIK-ISKQVSESLKRHQLKGNIIILKLRYSDFTTLTKRKSMV--ENLDSPEDIAEAAQQIFEEIDYDESLGVRL 346
>gi|168490630|ref|ZP_02714773.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae CDC0288-04] >gi|183574896|gb|EDT95424.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae CDC0288-04] (353 aa)
Score = 346, Expect = 1.1e-30, Identities = 101/333 (30%), Positives = 173/333 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S   +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSKKERGVRLLGITLTG 352
>gi|187735823|ref|YP_001877935.1| DNA-directed DNA polymerase [Akkermansia muciniphila ATCC BAA-835] >gi|187425875|gb|ACD05154.1| DNA-directed DNA polymerase [Akkermansia muciniphila ATCC BAA-835] (359 aa)
Score = 346, Expect = 1.1e-30, Identities = 83/287 (28%), Positives = 154/287 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           + KI H+DMD+F+AS+E  + PEY   P+AVG      V+A+A+Y AR  GV+SAM  + A K+CP L       + Y ++S +I++     +  +E  S+DE +LDV+  +      ++ A  +K  I+++ +L  + G S+  FLAK+A++  KPDG  T+     + +I  L I    G+G +   ++  L++     +     D+L+R   K   + ++  R    G+   P+ P   RK++G  ++ R N +  +   + +  L +++   L    F   ++ +K+++ D
  S:     3 QRKIIHVDMDAFYASIEQRDHPEYRGKPIAVGRPEMRGVVAAASYEARRFGVRSAMPSMKALKLCPHLIFTRNRMDVYKAVSAQIHAIFHRYTDLVEPLSLDEAFLDVTENKPGIPLAVDIARRIKKEIRRELHLTASAGVSYNKFLAKIASDYRKPDGLFTIHPSRAEKFIAALPIEAFWGVGHATAERMRALSITNGAQLRARDKDFLVRHFGKTGAIFYNFAR----GVDDRPVEPSRMRKSVGCEETYRENVTRAEALEQRLPLLAEELAGRLARSGFRGNTLTLKVKFPD 293
>gi|73670232|ref|YP_306247.1| DNA polymerase IV [Methanosarcina barkeri str. Fusaro] >gi|72397394|gb|AAZ71667.1| DNA polymerase IV [Methanosarcina barkeri str. Fusaro] (367 aa)
Score = 346, Expect = 1.1e-30, Identities = 95/340 (27%), Positives = 173/340 (50%)
  Q:     6 FHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASL-VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQL 345
           FH D DSFFASVE+ ERPE + LP+ VG          V+++ +Y AR  G+ SAM I  A K+CP    +  N   Y  +S KI   L   +   +  S+DE YL V   +  N++E    +L +K+ +K++  + C+VG      +AK+A+   KPDG   ++ ++ + +++ L +SKI GIG      L  + L+ ++++AN  +  L+  K G    +++    G+    +      K++ R  +   + S+  +    +  L + ++S L     +FK+V + +R+ D  + T+S     + + I   +     + +S+F    ++  + I    + E D N+ L
  S:    17 FHADTDSFFASVEVRERPELKGLPVVVGSDPKGGSGRGVVSTCSYEARKYGIHSAMPISQAYKLCPDAVFLPVNMKLYAGVSTKIMELLKGFADRFQQVSVDEAYL-VPGPEITNFEEAALYALSIKDKVKEQEGITCSVGIGPNKLIAKVASGFQKPDGLTVVSPEDVRKFLFPLPVSKIPGIGDKTAETLKSMGLNRVEELANF-DVQLLSGKFGKMGFRMKQLANGLDFGEVREKESVKSISRHGTFAEDTSDPVKITGSLDLLAESVHSSLLKNKLLFKTVVLTVRFEDFSTYTRSKTISIWTSDI-FVIKRTAMQLLSEFIGKQKLRLVGIEVTKLRERDENQTL 363
>gi|170759086|ref|YP_001788136.1| DNA polymerase IV [Clostridium botulinum A3 str. Loch Maree] >gi|169406075|gb|ACA54486.1| DNA polymerase IV [Clostridium botulinum A3 str. Loch Maree] (349 aa)
Score = 346, Expect = 1.1e-30, Identities = 101/339 (29%), Positives = 193/339 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF---NFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M   I H+DMD+FFASVE  +  + +  P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +     +Y  +S+ I+  L  ++  IE  SIDE YLD++N + E+   I+ A  +K  +K +  L  +VG S+  FLAK+A+   KPDG   + +D   S +  L I+KI GIG     +L  + ++ ++D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++ ++ +E  K + + ++ +++ L  ++   K+V +KI+ S+  + T+S    +++  +++I  ++  D+ E I +F +  ++I L+++  N+ EN
  S:     1 MDRVIIHVDMDAFFASVEQMDNKKLKGKPVIVGGIGERGVVSTASYEARKYGVHSAMPVFIAKKRCPFGIYVPGRHERYKEVSNSIFKILYKITPIIEPVSIDEAYLDITNIKEES---IKVAEHIKKRVKDEMGLTLSVGISYNKFLAKLASEWNKPDGIKIIRQDMIPSILMPLPINKIHGIGKKSVEKLNNIGIYTVEDMHKLSRDFCI-EYFGKFGVEIYERIRGIDYREVKVSRERKSIGKEITLKKDITDKEEMKKYLLDFSNKVSTNLYKRNSGGKTVTVKIKTSNFQTHTRSKTVDDYIRDKDEI-YNIACDILEHI-NFKEPIRLIGLTVS--NLGEN 339
>gi|193782767|ref|NP_436520.4| DNA polymerase IV [Sinorhizobium meliloti 1021] >gi|193073223|gb|AAK65932.2| Nucleotidyltransferase/DNA polymerase [Sinorhizobium meliloti 1021] (369 aa)
Score = 346, Expect = 1.1e-30, Identities = 90/296 (30%), Positives = 158/296 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI----EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFV 299
           KI HIDMD+F+ASVE  + PE    P+AVG+     V+A+A+Y AR  GV SAM  V AK+ CP+L  +    + Y ++S +I +  +  +  +E  S+DE YLDV+    EN++ +    E A  ++  I+ + +L  + G S+  FLAKMA++  KPDG   +T  +   ++  L + K  G+GP+   ++  L +    D+ + ++   +++  G           GI    + PD  RK++G   + R +  + +     +K L D +    +      K++ +K++++D    T+S   V
  S:    18 KIIHIDMDAFYASVEQRDNPELRGKPVAVGYPEARGVVAAASYEARKFGVHSAMPSVTAKRKCPELIFVPHRFDVYRAVSRQIQAIFAEYTPLVEPLSLDEAYLDVT----ENFRGLKLATEIAEEIRGRIRAETHLTASAGVSYNKFLAKMASDQRKPDGLFVITPKHGPDFVQALPVKKFHGVGPATAEKMKRLGIETGADLKS-RDLAFLQQHFGKSGPYFYWIARGIDERKVKPDRIRKSIGAEDTFREDVHDLETARAGLKPLIDKVWHYCEASGIRGKTMTLKVKWADFTQITRSKTIV 317
>gi|22095624|sp|Q92XH8|DPO42_RHIME DNA polymerase IV 2 (Pol IV 2) (354 aa)
Score = 346, Expect = 1.1e-30, Identities = 90/296 (30%), Positives = 158/296 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI----EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFV 299
           KI HIDMD+F+ASVE  + PE    P+AVG+     V+A+A+Y AR  GV SAM  V AK+ CP+L  +    + Y ++S +I +  +  +  +E  S+DE YLDV+    EN++ +    E A  ++  I+ + +L  + G S+  FLAKMA++  KPDG   +T  +   ++  L + K  G+GP+   ++  L +    D+ + ++   +++  G           GI    + PD  RK++G   + R +  + +     +K L D +    +      K++ +K++++D    T+S   V
  S:     3 KIIHIDMDAFYASVEQRDNPELRGKPVAVGYPEARGVVAAASYEARKFGVHSAMPSVTAKRKCPELIFVPHRFDVYRAVSRQIQAIFAEYTPLVEPLSLDEAYLDVT----ENFRGLKLATEIAEEIRGRIRAETHLTASAGVSYNKFLAKMASDQRKPDGLFVITPKHGPDFVQALPVKKFHGVGPATAEKMKRLGIETGADLKS-RDLAFLQQHFGKSGPYFYWIARGIDERKVKPDRIRKSIGAEDTFREDVHDLETARAGLKPLIDKVWHYCEASGIRGKTMTLKVKWADFTQITRSKTIV 302
>gi|27375972|ref|NP_767501.1| DNA polymerase IV [Bradyrhizobium japonicum USDA 110] >gi|27349111|dbj|BAC46126.1| DNA-damage-inducible protein [Bradyrhizobium japonicum USDA 110] (366 aa)
Score = 346, Expect = 1.1e-30, Identities = 92/292 (31%), Positives = 160/292 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFAS----LVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + PE    P+AVG      V+A+A+Y AR  GV+SAM  V AK+ CP L  + P    Y ++S +I    +  +  IE  S+DE YLDV+    EN + I  A      ++  IK +  LN + G S+  FLAK+A++  KP+G   ++ +   +++  L + K  GIGP+ + ++  L +   +D+ N   +++     K G ++  +     G+   P+  +  RK++G   + + +  E+   +  +K L D +    +      ++V +KI+++D +  T+S
  S:    16 KIIHIDMDAFYASVEQRDNPELRGKPVAVGGSAERGVVAAASYEARKFGVRSAMPSVTAKRQCPDLIFVRPRFEVYKAISRQIREIFAEHTPIIEPLSLDEAYLDVT----ENLQGIPLARDVALRIREKIKAETGLNASAGISYNKFLAKLASDHRKPNGQFVISPEMGPAFVEALPVGKFHGIGPATSAKMNALGIFTGRDMRNQTLEFMNANFGKAGAYYYWISR---GVDERPVRANRIRKSIGAETTFQADLDEFDALVAALKPLVDKVWRHCEATGNRGRTVTLKIKFADFEIITRS 311
>gi|15642285|ref|NP_231918.1| DNA polymerase IV [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586202|ref|ZP_01675993.1| DNA-damage-inducible protein P [Vibrio cholerae 2740-80] >gi|121726782|ref|ZP_01680000.1| DNA-damage-inducible protein P [Vibrio cholerae V52] >gi|153221395|ref|ZP_01952373.1| DNA-damage-inducible protein P [Vibrio cholerae MAK 757] >gi|153819514|ref|ZP_01972181.1| DNA-damage-inducible protein P [Vibrio cholerae NCTC 8457] >gi|153821469|ref|ZP_01974136.1| DNA-damage-inducible protein P [Vibrio cholerae B33] >gi|194533236|ref|YP_002068654.1| DNA-damage-inducible protein P [Vibrio cholerae MO10] >gi|22095641|sp|Q9KPS5|DPO4_VIBCH DNA polymerase IV (Pol IV) >gi|9656851|gb|AAF95431.1| DNA-damage-inducible protein P [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121549614|gb|EAX59638.1| DNA-damage-inducible protein P [Vibrio cholerae 2740-80] >gi|121630816|gb|EAX63200.1| DNA-damage-inducible protein P [Vibrio cholerae V52] >gi|124119742|gb|EAY38485.1| DNA-damage-inducible protein P [Vibrio cholerae MAK 757] >gi|125619288|gb|EAZ47817.1| DNA-damage-inducible protein P [Vibrio cholerae MO10] >gi|126509941|gb|EAZ72535.1| DNA-damage-inducible protein P [Vibrio cholerae NCTC 8457] >gi|126520962|gb|EAZ78185.1| DNA-damage-inducible protein P [Vibrio cholerae B33] (360 aa)
Score = 346, Expect = 1.2e-30, Identities = 95/290 (32%), Positives = 155/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE-LTDDINSGLKY---QDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD FFA+VE+ + P Y ++ LAVG       VI++ NY AR  GV+SAM    A K+CPQL ++    + Y S+S +I +     +  IE  S+DE YLDVS +          A  ++  I Q+ NL  + G +   FLAK+A++L KPDG   +T D  +  +  L + KI G+G     +L +  L+   D+       L+  + G   + L     GI    +  + +RK++G   +  +N S +QE  ++I++ L  ++++ L     Q  + K   IK++++D    T
  S:     7 KIIHVDMDCFFAAVEMRDNPAYREIALAVGGHEKQRGVISTCNYQARKFGVRSAMPTAQALKLCPQLHVVPGRMSVYKSVSQQIQTIFQRYTSLIEPLSLDEAYLDVSESTAYQGSATLIAQAIRRDIWQELNLTASAGVAPIKFLAKVASDLNKPDGLYVVTPDKVQEMVDSLPLEKIPGVGKVALEKLHQAGLYVGADVRRADYRKLLH-QFGRLGASLWKKSHGIDEREVVTERERKSVGVEYTFSQNISTFQECWQVIEQKLYPELDARLSRAHPQRGIIKQ-GIKVKFADFQQTT 304
>gi|148556499|ref|YP_001264081.1| DNA-directed DNA polymerase [Sphingomonas wittichii RW1] >gi|148501689|gb|ABQ69943.1| DNA-directed DNA polymerase [Sphingomonas wittichii RW1] (380 aa)
Score = 346, Expect = 1.2e-30, Identities = 83/292 (28%), Positives = 152/292 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + P  +  P+AVG      V+A+A+Y AR  GV+SAM    A+++CP L  + P    Y  +S +I+   +  +  +E  S+DE YLDV+N         E A  ++  I+++  L  + G S+  F+AK+A++  KPDG   +  D   ++I    + +  G+GP    ++ +L +H   D+     ++L  ++ G       +    I    + PD  RK++G   +   +   +++    + E ++ +    +      ++++IK+RYSD  + T++
  S:    25 KIIHIDMDAFYASVEQRDDPALKGRPVAVGGTRERGVVAAASYEARKYGVRSAMASALARRLCPDLLFVRPRFEVYREVSRQIHLIFADYTDLVEPLSLDEAYLDVTNNHQGIATATEVARQIRARIREETGLTASAGVSYNKFIAKLASDHNKPDGLCVVRPDQGLAFIAMQPVGRFHGVGPVTATRMEKLGIHTGADLRRCSREFL-GQQFGKSGDYFYLAARAIDHRAVRPDRVRKSIGSENTFFHDLYSHEDLAAALLESSESVARHAERTGKAGRTISIKLRYSDFRTLTRA 320
>gi|148996863|ref|ZP_01824581.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP11-BS70] >gi|168576822|ref|ZP_02722672.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae MLV-016] >gi|194397431|ref|YP_002037138.1| DNA polymerase IV DinB [Streptococcus pneumoniae G54] >gi|73620959|sp|Q97SC7|DPO4_STRPN DNA polymerase IV (Pol IV) >gi|147757438|gb|EDK64477.1| DNA-damage inducible protein P [Streptococcus pneumoniae SP11-BS70] >gi|183577478|gb|EDT98006.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae MLV-016] >gi|194357098|gb|ACF55546.1| DNA polymerase IV DinB [Streptococcus pneumoniae G54] (353 aa)
Score = 346, Expect = 1.2e-30, Identities = 101/333 (30%), Positives = 173/333 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+    P+ +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY S+  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S   +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSKKERGVRLLGITMTG 352
>gi|119945086|ref|YP_942766.1| DNA polymerase IV [Psychromonas ingrahamii 37] >gi|119863690|gb|ABM03167.1| DNA-directed DNA polymerase [Psychromonas ingrahamii 37] (359 aa)
Score = 345, Expect = 1.6e-30, Identities = 97/287 (33%), Positives = 156/287 (54%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG--RSQSIRNYSEYQE---FL--KLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           + KI HIDMDSFFASVE+ + P Y  +PLAVG       VI+++NY AR  GV+SAM    A ++CP LT++      Y  +S +I +     +  IE  S+DE +LDV+     +      A  ++N I+++ NL  + G +   FLAK+A+++ KPDG   +  D  +S I  L + KI G+G    ++L     +   DI N  N Y + ++ G     L     GI    +  + +RK++G  R+ SI N + ++E   F+  KL  EL   +      +  + +   IK++++D
  S:     9 QRKIIHIDMDSFFASVEMRDEPSYRGIPLAVGGSELQRGVISTSNYEARKYGVRSAMATAHALRLCPHLTVVPGRIQVYKEISAQIRAIFERYTHLIEPLSLDEAFLDVTECCQLHGSATLIAEAIRNDIRRELNLTASAGVAPIKFLAKVASDMNKPDGQFVIPPDKVQSVIDTLPLEKIPGVGKVSLQKLNNAEFYACADIKN-SNYYELLRRFGRMGEALWNFSHGIDNREVVTERERKSVGVERTFSI-NITTFEECWLFIERKLFPELDKRLGHATPERSIIKQG--IKMKFAD 303
>gi|90418642|ref|ZP_01226553.1| DNA polymerase IV [Aurantimonas sp. SI85-9A1] >gi|90336722|gb|EAS50427.1| DNA polymerase IV [Aurantimonas sp. SI85-9A1] (399 aa)
Score = 345, Expect = 1.6e-30, Identities = 84/294 (28%), Positives = 155/294 (52%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + KI HIDMD+F+ASVE  + P     P+AVG      V+A+A+Y AR  GV+SAM  V A++ CP L  + P    Y ++S +I +  +  +  IE  S+DE YLDV+   ++     + A +++  I++   L  + G S+  FLAK+A++  KPDG   +T      ++ DL I +  G+GP+   ++    +H  +D+ +    +L     K G ++  +     GI   P+  +  RK++G   +   +   + E  + ++ + D +    +      ++V +K++++D    T++
  S:    44 QRKIIHIDMDAFYASVEQRDDPSLRGRPVAVGGSRERGVVAAASYEARVYGVRSAMPSVTARRRCPDLIFVKPRFEVYKAISAEIRAIFAEHTPIIEPLSLDEAYLDVTENLHDIPSATQIAEMIRQRIREVTGLTASAGVSYNKFLAKLASDYRKPDGIFVVTPAMGPGFVEDLPIGRFHGVGPATAAKMQRFGIHTGRDLHDKSLPFLQEHFGKTGPYYYSISR---GIDERPVRANRIRKSVGAENTFGADLFAFDEMREALQPILDKVWRYCETSTIRGRTVTLKVKFADFQQITRA 341
>gi|73747966|ref|YP_307205.1| DNA polymerase IV [Dehalococcoides sp. CBDB1] >gi|73659682|emb|CAI82289.1| DNA polymerase IV [Dehalococcoides sp. CBDB1] (390 aa)
Score = 344, Expect = 1.8e-30, Identities = 87/291 (29%), Positives = 152/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           ++ H+D+D+FF SVE A RPE +  P+ VG       V+A+A+Y AR  G+ S M ++ AK +CPQ   I  N   Y   S+K    LS  S  +E   +DE YL+V+  +  +    E AS ++  I  +  +N ++G + +   AK+AT  AKP+G   +      S++  L I+ + GIG    + L  L +  +  +A +   +L + ++G +   L    +GI   P+    + K++ R  +    +  Q FL+  +  L++ I + L+ +    + V IKIR++D  + T+
  S:     5 RVMHVDLDAFFVSVEQAVRPELKDKPVIVGGKPERRGVVAAASYEARKFGIHSGMPLITAKNLCPQAIFIEGNHQLYREYSEKFMLILSDFSPFLEPMGLDEAYLEVTGFESLHGSIAEMASKIRRRITAEMGINASIGIANSKVAAKIATERAKPNGQCEVPAGEEASFLAPLDIAVMPGIGKKTEQHLKSLGIDTLGKLAALPASFL-KSRLGAYAPYLSNAAMGIDNRPVEMPSEAKSISRETTFETDTRNQTFLEAKLSYLSEKITATLRKRGKQARVVQIKIRFADFTTLTR 300
>gi|126652133|ref|ZP_01724315.1| DNA polymerase IV [Bacillus sp. B14905] >gi|126591041|gb|EAZ85152.1| DNA polymerase IV [Bacillus sp. B14905] (411 aa)
Score = 344, Expect = 1.8e-30, Identities = 98/345 (28%), Positives = 188/345 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD--YKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT--KSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIME-NDNNEQLTIFD 349
           I HID++ F+ASVE    P  +  P+A+         ++ + +Y AR  GV + MN+ +A++ CP+L ++ PN  +Y + S   +  L   S+ ++  SIDE Y+ +   + +N   +E    ++  I  +  L C++G +   FLAKMA+ + KP G   L K +  S ++ L++ ++ GIG S   +L EL +  I ++A   ++Y +++K G++  +L+    G    P++P+  Y  K++G S ++  + ++  E  K++  L++ +   LK +     +V+I IR +  ++ T  KS N   F  +  +    +LF +  +    + V  L +T +N+ +  +  +QLT FD
  S:     7 ILHIDLNCFYASVEQIYDPSLKGKPIAIAGNPKERRGIVITCSYEARKSGVYTTMNVGEARRKCPELIVLPPNFERYRAASKSFFGLLKEYSEILQPVSIDEGYIQLPIIEGQN--VLEHVHGIQGRIWNELQLPCSIGIAPNKFLAKMASEMRKPMGITILRKRDVPSVLWPLNVKEMHGIGKSTAEKLKELGIQTIGELA-AADEYTLKQKFGINGLRLKQKANGEDDRPVDPEAIYDTKSVGNSTTLSHDTTDRDELYKIMTTLSEKVAERLKAKKLAGVTVSIIIRTASWETYTRSKSVNNAIFSKEDIVEQAWNLFNKNWN---EEPVRLLGVTISNVSDIKEMTQQLTFFD 357
>gi|85374810|ref|YP_458872.1| DNA polymerase IV [Erythrobacter litoralis HTCC2594] >gi|84787893|gb|ABC64075.1| putative DNA damage-inducible protein [Erythrobacter litoralis HTCC2594] (382 aa)
Score = 344, Expect = 2.0e-30, Identities = 91/312 (29%), Positives = 163/312 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQIPLHVVVDLFE 315
           KI H+DMD+FFASVE  + P+    P+AVG      V+A+A+Y AR  GVKSAM  V AK++CP L  +      Y   S +I    +  + ++E  S+DE YLDV++           A  ++ +I+++  L  + G S+  FLAK+A++  KPDG   +      +++  L I +  G+GP    ++  L +    D+A  K+   +R+  G     L     GI   PI  +  RK++G  ++  ++  E  E  + ++ +   +   ++      +++ +K++Y+D  + T++ +   +V+ Q++    V  DL E
  S:    25 KIIHVDMDAFFASVEQRDNPDLRGKPVAVGGSSGRGVVAAASYEARRFGVKSAMPSVTAKRLCPDLIFVKHRFEAYREASARIREIFNRYTPHVEPLSLDEAYLDVTDDLQAVGSATGTAQAIRKAIREETGLTASAGVSYNKFLAKLASDQNKPDGLCVIRPGEGAAFVQSLPIRRFHGVGPKGAEKMARLGIDTGADLAG-KDLAWLRQNFGSFGDYLYRAARGIDLRPIRTNRSRKSVGGERTFSQDQHEPDELRETLERIIAIVWERIERSKARGRTITLKMKYNDFRTITRAQSLPHYVSGQDEFA-SVARDLLE 342
>gi|148254691|ref|YP_001239276.1| DNA polymerase IV [Bradyrhizobium sp. BTAi1] >gi|146406864|gb|ABQ35370.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Bradyrhizobium sp. BTAi1] (354 aa)
Score = 344, Expect = 2.1e-30, Identities = 94/295 (31%), Positives = 159/295 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI----EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M  KI HIDMD+F+ASVE  + PE    P+AVG      V+A+A+Y AR  GV+SAM  V AK+ CP L  + P    Y ++S ++ +  +  +  IE  S+DE YLDV+    EN + I    + A  ++ +IK +  LN + G S+  FLAK+A++  KP+G   ++ +   +++  L + K  GIGP+   +L  L +    DI      +L ++  G   +       GI   P+  D  RK++G   + + + +E +     ++ L D +    +      ++V +K+++SD +  T+S
  S:     1 MIRKIIHIDMDAFYASVEQRDNPELRGKPVAVGGSRERGVVAAASYEARKFGVRSAMPSVTAKRQCPDLIFVKPRFEVYKAISLQVRAIFAEHTPLIEPLSLDEAYLDVT----ENLQGIPLARDIALRIRETIKTETGLNASAGISYNKFLAKLASDHRKPNGQYVISPEMGPAFVETLPVGKFHGIGPATAAKLTALGIRTGLDIRRQSLAFL-QQHFGKSGAYYYWISRGIDERPVRADRIRKSVGAETTFVTDLTELEPMTAELRPLIDKVWRHCESTGKSGRTVTLKVKFSDFEIITRS 299
>gi|145595751|ref|YP_001160048.1| DNA-directed DNA polymerase [Salinispora tropica CNB-440] >gi|145305088|gb|ABP55670.1| DNA-directed DNA polymerase [Salinispora tropica CNB-440] (419 aa)
Score = 343, Expect = 2.2e-30, Identities = 84/312 (26%), Positives = 166/312 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDP--INPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFE 315
           ++ H+DMD+FFA+VE+  RPE    P+ VG L    V++SA+Y AR  GV+SAM    A+ +CP    + P+   YT+ S ++      ++  +E  S+DE +LDV+  Q    +    A L++  +  +  L C+VG + + F+AK+ +  AKPDG L +       +++ L +  + G+G      L  L L  + ++A    D ++R+ +G + +   ++ L    DP  + P+   K++G   +   + ++ +E  + +  L + + + L+    + ++V +K+R +D  + ++S +       +P  V  ++F+
  S:    25 RVLHVDMDAFFAAVEVHRRPELRGRPVVVGGLGQRGVVSSASYPARRYGVRSAMPTARARALCPHAVFLPPDFTAYTTASRRVMQIFRDVTPLVEPLSLDEAFLDVAGAQRLFGRPSAIARLIRERVATEVGLTCSVGVASSKFVAKLGSTRAKPDGLLVVPTAQVLDFLHPLPVEALWGVGERSAETLRRLGLVTVGELAQAP-DGMLRRALG-NAAARHLHELAWGRDPRRVTPERGEKSVGAEVTFDVDVTDRREIRRALLGLAEKVGARLRRSGQVGRTVALKVRLADFRTVSRSRSL-----DVPTDVGREMFD 336
>gi|196189957|gb|EDX84921.1| ImpB/MucB/SamB family [Synechococcus sp. PCC 7335] (371 aa)
Score = 343, Expect = 2.3e-30, Identities = 86/292 (29%), Positives = 153/292 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+AS+E  + PE    P+AVG L      + +A+Y AR  G+ SAM    A   C  L  + P    Y ++S +I +     ++ +E  S+DE YLDVS  +      +  A  +++ I+    L  + G S   FLAK+A++L KPDG   ++ +  K++I  L I    G+GP+   ++  L +H   D+       L +   K+G ++ ++          P+NP+  RK++G  +S  R+ S+ ++    +  +  +++  L+       ++ +KI+Y + D+ T+S
  S:    22 KIIHIDMDAFYASIEQRDNPELRGKPVAVGGLPSQRGAVCAASYEARKYGIHSAMPSRSAITRCQHLIFVKPRFEHYRAVSAEIRAIFFDYTELVEPLSLDEAYLDVSVDKQGIGSAVAIAKQIRDRIRTDLQLTASAGVSINKFLAKIASDLNKPDGLSFISPEEAKTFIEQLRIEDFYGVGPATATKMKSLGIHTGADLKTWTQAELTQTFGKVGSYYYRVARAEDN---RPVNPNRIRKSIGAERSFFRDLSQIEDMETALANIATEVSQRLQKNKRQGHTLTLKIKYDNYDTITRS 318
>gi|193216571|ref|YP_001999813.1| Pol_IV_kappa DNA polymerase [Mycoplasma arthritidis 158L3-1] >gi|193001894|gb|ACF07109.1| Pol_IV_kappa DNA polymerase [Mycoplasma arthritidis 158L3-1] (416 aa)
Score = 343, Expect = 2.3e-30, Identities = 93/301 (30%), Positives = 164/301 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSS-LSKNIETGSIDEWYLDVSNTQYENWKEIEFASL---VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI--RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQI 305
           IFHIDMD+FF + E A  P  +  P+A+G +    +  S +Y  + LG++     +  K +CP +  + P+   Y+S S +I+ +L +  +  IE  SIDE YL+V  T   N ++I   +L   ++ +I  KF L C++G SFT FLAKM+TN AKP G L   K + + + YDL I +I G+G + T +L E  ++  +D+ N KN   +R   G  +  L + + G        + + K +  S S    N +++ E    + EL ++++   K  +    ++ + IR+++ + ++K      + N++
  S:     8 IFHIDMDAFFINCERAIDPRLDNQPVAIGKVHKRSIATSVSYELKKLGLRPGDPSLKVKHLCPNVIFVEPHYQLYSSYSKRIFDYLETHYTHTIEIYSIDECYLEV--TTILNNRKISAQALAFEIQKNILDKFQLPCSIGISFTKFLAKMSTNKAKPFGILETKKQDIEKHFYDLDIQEIFGVGKASTAKLKEYGINTYRDLVNEKNTQFLRSVFGKRFYSLILELKGDNLHDHVQNEEAKGISNSMSFIENNIADFNEISNCLYELAENVSERAKITNVEGSTITVMIRWANKNWSSKQKRIHFYTNEV 316
>gi|16804014|ref|NP_465499.1| hypothetical protein lmo1975 [Listeria monocytogenes EGD-e] >gi|22095619|sp|Q8Y5T0|DPO4_LISMO DNA polymerase IV (Pol IV) >gi|16411428|emb|CAD00053.1| lmo1975 [Listeria monocytogenes] (356 aa)
Score = 343, Expect = 2.5e-30, Identities = 99/333 (29%), Positives = 166/333 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV----KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNI 336
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V    + +I Q+  L  + G SF  F+AK+A++  KP G   +T +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +   N  + +   + + +    +   L       K+V +K+RYSD  + TK      + N             I  ++  D +  + +T  N+
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYQELGLTASAGVSFNKFIAKIASDFKKPAGITVVTPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDSRVLEQSLMQFAKKVEERLIKLQKHGKTVVLKLRYSDFTTITKRLTLNEYTNDASQIYQAAALLLIESYTGQDSIRLIGLTVTNL 343
>gi|149911085|ref|ZP_01899712.1| DNA polymerase IV [Moritella sp. PE36] >gi|149805835|gb|EDM65824.1| DNA polymerase IV [Moritella sp. PE36] (350 aa)
Score = 343, Expect = 2.6e-30, Identities = 90/285 (31%), Positives = 156/285 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRS----QSIRNYSE--------YQEFLKLIKELTDDI-----NSGLKYQDFMFKSVNIKIRYSD 288
           KI HIDMD++FA+VE+ + P Y+ +P+A+G +     VIA+ NY+AR  GV+SAM+   A ++CP LT++      Y  +S +I+   S  +  IE  S+DE YLDV++ +  +      A  ++  I+ +  L  + G +   FLAK+A+++ KP+G   +T    K+++ DL ++KI G+G    ++L  + L+   D+     + +I +  G     L     GI   P+  +  RK++G      + I    +        YQ  L+ +++ + D+        LK+ DF   S    I   D
  S:     3 KIIHIDMDAYFANVEVRDNPAYKNIPIAIGGMSDRRGVIATCNYIARQYGVRSAMSSYKAMQLCPDLTLVPSRMQVYKDVSAQIHEIFSRYTDLIEPLSLDEAYLDVTDCELFSGSATLIAEDIRKCIESELALTASAGVAPVKFLAKVASDINKPNGLFVITPSQVKAFVADLPLNKIPGVGKVTWQKLNRVGLYTCADVLKFPAEDII-ESFGKLGHSLLERCQGIDNRPVCNERHRKSVGVEITLPEDIVTLEQCMALFPNLYQTLLQRLQKASPDMRITKQGVKLKFNDFTLTSAEQSITTLD 308
>gi|168184461|ref|ZP_02619125.1| DNA polymerase IV [Clostridium botulinum Bf] >gi|182672433|gb|EDT84394.1| DNA polymerase IV [Clostridium botulinum Bf] (349 aa)
Score = 343, Expect = 2.8e-30, Identities = 101/339 (29%), Positives = 192/339 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS---FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M   I H+DMD+FFASVE  +  + +  P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +     +Y  +S+ I+  L  ++  IE  SIDE YLD++N + E    I+ A  +K  +K +  L  +VG S+  FLAK+A++  KPDG   + +D   S +  L I+KI GIG     +L  + ++ ++D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++ +  +E  K + + ++ +++ L  ++   K+V +KI+ S+  + T+S    +++  +++I  ++  D+ E I +F +  ++I L+++  N+ EN
  S:     1 MDRVIIHVDMDAFFASVEQMDNKKLKGKPIIVGGIGERGVVSTASYEARKYGVHSAMPVFIAKKRCPFGIYVPGRHERYKEVSNNIFKILYKVTPIIEPVSIDEAYLDITNIKEE---PIKVAEHIKKRVKNEMGLTLSVGISYNKFLAKLASDWNKPDGIKIIRQDMIPSILMPLPINKIHGIGKKSVEKLNNIGIYTVEDMHKLSRDFCI-EYFGKFGVEIYERIRGIDYREVKVSRERKSIGKEITLKKDITNKEEMKKYLLDFSNKVSTNLYKRNSGGKTVTVKIKTSNFQTHTRSKTVNDYIRDKDEI-YNIACDILEHI-NFKEPIRLIGLTVS--NLGEN 339
>gi|110638080|ref|YP_678289.1| DNA polymerase IV [Cytophaga hutchinsonii ATCC 33406] >gi|110280761|gb|ABG58947.1| DNA polymerase IV [Cytophaga hutchinsonii ATCC 33406] (385 aa)
Score = 343, Expect = 2.8e-30, Identities = 99/377 (26%), Positives = 196/377 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK--SFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKII 377
           M   I H+D+DSFF SVEL  RPE +  PL +G      V+AS +Y AR  G+ SAM+   AKK+CP+   +  +  +Y+  S  +   +   +   E  SIDE+YLD++      +  +++ + ++ +I ++  L  + G S    ++K+AT L+KP+G L +     K+++  L I KI  +G   T  L +  +  I  ++N      I K +G H   L     GI   P+ P  +RK++    +    S     L   + ++ +++   L+ ++F+   + +KI+YS+ +  T+  SF++ +  + + +  +  LF+ + +  K+ ++I + ++  N++    N Q+++F+   +  +  + ++ IR +  +   K+ I
  S:     1 MDRSIIHMDLDSFFVSVELLRRPELKGKPLIIGGSSERGVVASCSYEARKFGIHSAMSSQKAKKLCPEAIFVRGDMQEYSKYSKIVRQIIHDKAPVYEQASIDEFYLDITGMD-RFFGILKWTTELRETIIKESGLPISCGLSVNKVVSKIATGLSKPNGLLYVPAGTEKAFLAPLPIEKIPMVGKKTTEILHQAGIFDIGTLSNTPA-VQIEKLLGQHGQGLWKRANGIDLSPVEPYSERKSISTETTFGEDSTNVPMLHATLLQMVEELCFSLRKKNFLTGCLTVKIKYSNFEKETRQCSFSYTS-SDDVLMQKITGLFDALYNKRKHVRLIGVKLS--NLVH--GNYQISLFEDSEKNQNLYAAMDAIRTKFGQDAVKRAI 377
>gi|125625067|ref|YP_001033550.1| DNA polymerase IV [Lactococcus lactis subsp. cremoris MG1363] >gi|189027668|sp|A2RNH9|DPO4_LACLM DNA polymerase IV (Pol IV) >gi|124493875|emb|CAL98869.1| DNA polymerase IV [Lactococcus lactis subsp. cremoris MG1363] (364 aa)
Score = 342, Expect = 2.9e-30, Identities = 95/328 (28%), Positives = 166/328 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK--LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSI 331
           KI HIDMD+FFASVE+ + P  +  P+ +        G  V+++ +Y AR  G+ SAM+  +A  +CPQ   I  N  KYT +S ++       + NIE  SIDE YLDV+  +      I+ A L+++ I  +  L C+ G S+  FLAK+A++  KP G   +  D    ++  L + K  G+G +   +L  L      D+    +   + ++ G++  +L     GI    +    +RK++G+ ++        + +K  LIK ++  ++  LK        + +K+RYSD  + TK  + V  +N      + +   QI +   YD+ + + +
  S:    13 KIIHIDMDAFFASVEVRDNPSLKGKPVVIARNPLQTGGRGVVSTCSYEARAFGIHSAMSAKEAYDLCPQAIFISGNYEKYTKVSKQVREIFKRYTDNIEAASIDEAYLDVTENKIGAQSAIKIAKLIQHDIFVELGLTCSAGVSYNKFLAKIASDYEKPHGLTLIMPDEALEFLAKLPVEKFHGVGKATVPKLHALGFFTGGDLQKA-DPVDLAERFGIYGWELFQKANGIHNSKVKNHRERKSVGKERTYGKLLYLPDDIKAELIK-ISKQVSESLKRHQLKGNIIILKLRYSDFTTLTKRKSMV--ENLDSPEDIAEAARQIFEEIDYDESLGVRL 346
>gi|148380777|ref|YP_001255318.1| DNA polymerase IV [Clostridium botulinum A str. ATCC 3502] >gi|153932271|ref|YP_001385062.1| DNA polymerase IV [Clostridium botulinum A str. ATCC 19397] >gi|153934711|ref|YP_001388531.1| DNA polymerase IV [Clostridium botulinum A str. Hall] >gi|148290261|emb|CAL84381.1| DNA polymerase IV [Clostridium botulinum A str. ATCC 3502] >gi|152928315|gb|ABS33815.1| DNA polymerase IV [Clostridium botulinum A str. ATCC 19397] >gi|152930625|gb|ABS36124.1| DNA polymerase IV [Clostridium botulinum A str. Hall] (349 aa)
Score = 342, Expect = 3.1e-30, Identities = 101/339 (29%), Positives = 192/339 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS---FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M   I H+DMD+FFASVE  +  + +  P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +     +Y  +S+ I+  L  ++  IE  SIDE YLD++N + E    I+ A  +K  +K +  L  +VG S+  FLAK+A++  KPDG   + +D   S +  L I+KI GIG     +L  + ++ ++D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++ +  +E  K + + ++ +++ L  ++   K+V +KI+ S+  + T+S    +++  +++I  ++  D+ E I +F +  ++I L+++  N+ EN
  S:     1 MDRVIIHVDMDAFFASVEQMDNKKLKGKPVIVGGIGERGVVSTASYEARKYGVHSAMPVFIAKKRCPFGIYVPGRHERYKEVSNNIFKILYKVTPIIEPVSIDEAYLDITNIKEE---PIKVAEHIKKRVKNEMGLTLSVGISYNKFLAKLASDWNKPDGIKIIRQDMIPSILMPLPINKIHGIGKKSVEKLNNIGIYTVEDMHKLSRDFCI-EYFGKFGVEIYERIRGIDYREVKVSRERKSIGKEITLKKDITNKEEMKKYLLDFSNKVSTNLYKRNTGGKTVTVKIKTSNFQTHTRSKTVNDYIRDKDEI-YNIACDILEHI-NFKEPIRLIGLTVS--NLGEN 339
>gi|16801148|ref|NP_471416.1| hypothetical protein lin2082 [Listeria innocua Clip11262] >gi|22095622|sp|Q92A40|DPO4_LISIN DNA polymerase IV (Pol IV) >gi|16414583|emb|CAC97312.1| lin2082 [Listeria innocua] (356 aa)
Score = 342, Expect = 3.2e-30, Identities = 100/302 (33%), Positives = 162/302 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQ----KFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQI 305
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V   I+Q    +  L  + G SF  F+AK+A++  KP G   +  +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H  +L  +V G   + +NP   RK++G+  +     + N    Q  +K  K++ + +    K+     K+V +K+RYSD  + TK      + N  NQI
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYRELGLTASAGVSFNKFIAKIASDFKKPAGITVVAPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYQLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDNRILEQSLMKFAKKVEERLIKLQKHG----KTVVLKLRYSDFTTITKRLTLNEYTNDANQI 315
>gi|47096619|ref|ZP_00234207.1| DNA-damage-inducible protein P, putative [Listeria monocytogenes str. 1/2a F6854] >gi|153183460|ref|ZP_01934320.1| hypothetical protein LMOG_00178 [Listeria monocytogenes J0161] >gi|153191471|ref|ZP_01938691.1| hypothetical protein LMPG_00719 [Listeria monocytogenes J2818] >gi|47015004|gb|EAL05949.1| DNA-damage-inducible protein P, putative [Listeria monocytogenes str. 1/2a F6854] >gi|126943751|gb|EBA21468.1| hypothetical protein LMOG_00178 [Listeria monocytogenes J0161] >gi|127765250|gb|EBA25600.1| hypothetical protein LMPG_00719 [Listeria monocytogenes J2818] (356 aa)
Score = 342, Expect = 3.5e-30, Identities = 103/333 (30%), Positives = 171/333 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV----KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNI 336
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V    + +I Q+  L  + G SF  F+AK+A++  KP G   +T +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +   N  + +   + + +    +   L       K+V +K+RYSD  + TK      + N  NQI     + L E    ++  D +  + +T  N+
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYQELGLTASAGVSFNKFIAKIASDFKKPAGITVVTPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDSRVLEQSLMQFAKKVEERLIKLQKHGKTVVLKLRYSDFTTITKRLTLNEYTNDANQIYQAAALLLRES---YTGQDSIRLIGLTVTNL 343
>gi|168187738|ref|ZP_02622373.1| DNA polymerase IV [Clostridium botulinum C str. Eklund] >gi|169294384|gb|EDS76517.1| DNA polymerase IV [Clostridium botulinum C str. Eklund] (347 aa)
Score = 342, Expect = 3.5e-30, Identities = 105/348 (30%), Positives = 187/348 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKND--YLIRKKIGLH-WSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR--YSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIF 348
           M   I H+DMD+FFASVE+ ++P  +  P+ VG +    V+++ +Y AR  G++SAM +  AK +CP    +     +Y  +S K++  LS ++  IE  SIDE YLD++N    N    + A  +KN IK+   L  +VG S+  FLAK+A++  KPDG   +TKD     +  L I+K+ GIG    ++L  + +  +K +  +     Y    K GL  ++++R    GI    +    ++K++G+  ++ ++  +  E  K +     +I   L   +   K++ +KI+  Y +  + +KS +      Q    V   + + I +FS+  ++I  SI++   +++   EQLT+F
  S:     1 MDRVILHVDMDAFFASVEVMDKPSLKGKPVVVGGISERGVVSTCSYEARKYGIRSAMPVYKAKALCPSAVFLPTRHYRYKEISRKVFEILSKVTNKIEQVSIDEAYLDITNI---NMNPKDLAVNIKNMIKENMGLTISVGISYNKFLAKLASDWNKPDGLKIITKDMIPDILMPLSINKVHGIGRKSAKKLNNIGIFTVKQLYTLPKKLFYEYFGKFGLDIYNRIR----GIDNREVITVREQKSIGKETTLKKDTKDKDELKKFLWIFAINIEEKLTTSNVKGKTITLKIKTAYFENHTRSKSLDKYISSRQEIYKVACAILDSI-EFSEKIRLIGTSISS---LKDVEVEQLTLF 347
>gi|170755759|ref|YP_001782423.1| DNA polymerase IV [Clostridium botulinum B1 str. Okra] >gi|169120971|gb|ACA44807.1| DNA polymerase IV [Clostridium botulinum B1 str. Okra] (349 aa)
Score = 341, Expect = 3.8e-30, Identities = 101/339 (29%), Positives = 191/339 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS---FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M   I H+DMD+FFASVE  +  +    P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +     +Y  +S+ I+  L  ++  IE  SIDE YLD++N + E    I+ A  +K  +K +  L  +VG S+  FLAK+A++  KPDG   + +D   S +  L I+KI GIG     +L  + ++ ++D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++ +  +E  K + + ++ +++ L  ++   K+V +KI+ S+  + T+S    +++  +++I  ++  D+ E I +F +  ++I L+++  N+ EN
  S:     1 MDRVIIHVDMDAFFASVEQMDNKKLRGKPVIVGGIGERGVVSTASYEARKYGVHSAMPVFIAKKRCPFGIYVPGRHERYKEVSNNIFKILYKVTPIIEPVSIDEAYLDITNIKEE---PIKVAEHIKKKVKNEMGLTLSVGISYNKFLAKLASDWNKPDGIKIIRQDMIPSILMPLPINKIHGIGKKSVEKLNNIGIYTVEDMHKLSRDFCI-EYFGKFGVEIYERIRGIDYREVKVSRERKSIGKEITLKKDITNKEEMKKYLLDFSNKVSTNLYKRNSGGKTVTVKIKTSNFQTHTRSKTVNDYIRDKDEI-YNIACDILEHI-NFKEPIRLIGLTVS--NLGEN 339
>gi|153939133|ref|YP_001392095.1| DNA polymerase IV [Clostridium botulinum F str. Langeland] >gi|152935029|gb|ABS40527.1| DNA polymerase IV [Clostridium botulinum F str. Langeland] (349 aa)
Score = 341, Expect = 3.9e-30, Identities = 101/339 (29%), Positives = 191/339 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS---FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M   I H+DMD+FFASVE  +  +    P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +     +Y  +S+ I+  L  ++  IE  SIDE YLD++N + E    I+ A  +K  +K +  L  +VG S+  FLAK+A++  KPDG   + +D   S +  L I+KI GIG     +L  + ++ ++D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++ +  +E  K + + ++ +++ L  ++   K+V +KI+ S+  + T+S    +++  +++I  ++  D+ E I +F +  ++I L+++  N+ EN
  S:     1 MDRVIIHVDMDAFFASVEQMDNKKLRGKPVIVGGIGERGVVSTASYEARKYGVHSAMPVFIAKKRCPFGIYVPGRHERYKEVSNNIFKILYKVTPIIEPVSIDEAYLDITNIKEE---PIKVAEHIKKKVKNEMGLTLSVGISYNKFLAKLASDWNKPDGIKIIRQDMIPSILMPLPINKIHGIGKKSVEKLNNIGIYTVEDMHKLSRDFCI-EYFGKFGVEIYERIRGIDYREVKVSRERKSIGKEITLKKDITNKEEMKKYLLDFSNKVSANLYKRNSGGKTVTVKIKTSNFQTHTRSKTVNDYIRDKDEI-YNIACDILEHI-NFKEPIRLIGLTVS--NLGEN 339
>gi|147668662|ref|YP_001213480.1| DNA-directed DNA polymerase [Dehalococcoides sp. BAV1] >gi|146269610|gb|ABQ16602.1| DNA-directed DNA polymerase [Dehalococcoides sp. BAV1] (390 aa)
Score = 341, Expect = 3.9e-30, Identities = 86/291 (29%), Positives = 152/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           ++ H+D+D+FF SVE A RPE++  P+ VG       V+A+A+Y AR  G+ S M ++ AK +CPQ   I  N   Y   S+K    LS  S  +E   +DE YL+V+  +  +    + AS ++  I  +  +N ++G + +   AK+AT  AKP+G   +      S++  L I+ + GIG    + L  L +  +  +A +   +L +  +G +   L    +GI   P+    + K++ R  +    +  Q FL+  +  L++ I + L+ +    + V IKIR++D  + T+
  S:     5 RVMHVDLDAFFVSVEQAVRPEFKDKPVIVGGKPERRGVVAAASYEARKFGIHSGMPLITAKHLCPQAIFIEGNHQLYREYSEKFMLILSDFSPFLEPMGLDEAYLEVTGFESLHGSIAQMASKIRRRITAELGINASIGIANSKVAAKIATEQAKPNGQCEVPAGEEASFLAPLDIAVMPGIGKKTEQHLKSLGIDTLGKLAALPASFL-KSCLGTYAPYLSNAAMGIDNRPVEMPSEAKSISRETTFETDTRNQTFLEAKLSYLSEKITATLRKRGKQTRVVQIKIRFADFTTLTR 300
>gi|29377230|ref|NP_816384.1| DNA-damage-inducible protein P [Enterococcus faecalis V583] >gi|29344696|gb|AAO82454.1| DNA-damage-inducible protein P [Enterococcus faecalis V583] (372 aa)
Score = 341, Expect = 4.0e-30, Identities = 91/291 (31%), Positives = 147/291 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN-YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           KI HIDMD+FFASVE  + PE    PL +        G  V+ +ANY+AR  G+ SAM+   A ++CP       N  KY+ +S +I       +  IE  SIDE YLDV+  +  +   I+ A +++  I  +  L C+ G S+  FLAK+A++  KP G   +  +  + ++  L I    GIG     ++ EL +    D+       LIR    + +S  R  V GI   P+     RK++G+  +     +  ++    +++L   +   L+      K+V +K+RY+D  + TK
  S:    16 KIIHIDMDAFFASVEERDHPELVGHPLVIARHPSDTGGKGVVTTANYIARQYGIHSAMSAQKAYELCPSAIFKPGNYQKYSEISQEIREIFRRYTDVIEPVSIDEAYLDVTENKVNSKSAIKIAKMIQYDIWHELQLTCSAGVSYNKFLAKLASDFQKPKGLTVVLPEEAEDFLKALPIEDFHGIGKKTVPKMHELGIFTGADLYKQDEMTLIRLFGKMGYSLYR-KVRGIHDAPVQVTRDRKSVGKEHTYGTPLTTEEQVTAQLRQLAAGVERALQRVQKHGKTVVLKVRYTDYTTITK 314
>gi|162146654|ref|YP_001601113.1| putative DNA polymerase IV [Gluconacetobacter diazotrophicus PAl 5] >gi|187595399|ref|ZP_02981663.1| DNA-directed DNA polymerase [Gluconacetobacter diazotrophicus PAl 5] >gi|161785229|emb|CAP54775.1| putative DNA polymerase IV [Gluconacetobacter diazotrophicus PAl 5] >gi|187492234|gb|EDU30171.1| DNA-directed DNA polymerase [Gluconacetobacter diazotrophicus PAl 5] (381 aa)
Score = 341, Expect = 4.2e-30, Identities = 84/285 (29%), Positives = 151/285 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICD----PINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           +I H+DMD+F+ASVE  + P     PLAVG      V+A+A+Y AR  GV+SAM  V A++ CP L  + P  + Y ++S +I++  +  +  I+  S+DE YLDV++   +       A  ++ +I+ +  L  + G S+  FLAK+A++  KPDG   +T      ++  L +    GIGP+   ++  + +    D+     D L R     H+ K      GI       P+  D +RK++G  ++   +  ++ E L  +  + D +    + +  + ++V +K++Y+D
  S:    21 RIIHVDMDAFYASVEQRDDPALRGRPLAVGGSRQRGVVAAASYEARRYGVRSAMPSVTARRKCPDLIFVPPRFDVYRAVSAQIHAIFARYTGLIQPLSLDEAYLDVTDPLIDRPSATAIAQDIRAAIRAETGLTASAGVSYNKFLAKLASDYRKPDGLYVITPRMGPRFVESLPVEAFHGIGPATAARMRAMGIRTGLDLRAHDMDSLAR-----HFGKAAAFYYGIARGRDDRPVEADRRRKSVGTERTFEHDIHDWAEALSALDGMVDRVWGECRKRGLVARTVTVKVKYAD 309
>gi|46908202|ref|YP_014591.1| DNA-damage-inducible protein P, putative [Listeria monocytogenes str. 4b F2365] >gi|67460308|sp|Q71Y46|DPO4_LISMF DNA polymerase IV (Pol IV) >gi|46881472|gb|AAT04768.1| putative DNA-damage-inducible protein P [Listeria monocytogenes str. 4b F2365] (356 aa)
Score = 341, Expect = 4.2e-30, Identities = 95/300 (31%), Positives = 156/300 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV----KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN 303
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V    + +I Q+  L  + G SF  F+AK+A++  KP G   +T +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +   N  + +   + + +    +   L       K+V +K+RYSD  + TK      + N
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYQELGLTASAGVSFNKFIAKIASDFKKPAGITVVTPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDSRVLEQSLMQFAKKVEERLIKLQKHGKTVVLKLRYSDFTTITKRLTLNEYTN 310
>gi|116200590|ref|XP_001226107.1| hypothetical protein CHGG_10840 [Chaetomium globosum CBS 148.51] >gi|88175554|gb|EAQ83022.1| hypothetical protein CHGG_10840 [Chaetomium globosum CBS 148.51] (632 aa)
Score = 341, Expect = 4.2e-30, Identities = 87/285 (30%), Positives = 158/285 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV---KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDN--FKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINP--DYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           +   I HID D+F+A+VE  +RPE +KLP AVG  V+ + NYVAR  G +S M    AKK+CP+L ++  N +KY + + ++   L+      E+ SIDE YL++  T+Y    +++ A +V   ++ I +K ++  + G +    LAK+ +N+ KP+G   L +D     S++ DL   ++ GIG  L R+L  + +    DI   +  YL R      +  L    LG+    I P  DY+RK++G  ++ R+  +     + ++   +++ S ++  +   +++ +K++
  S:   122 LTQHIVHIDCDAFYAAVEQLDRPELKKLPFAVGGGVLTTCNYVARKFGCRSGMAGFVAKKLCPELILLPLNFDKYNAKAAEVREILAEYDPRFESASIDEAYLNI--TEYCAEHDMDPADVVSKLRSEIHEKTHITVSAGIAANARLAKICSNMNKPNGQFVLPRDRVAIMSFMRDLSCRQVNGIGRVLERELASVGIKTCGDIY-AQRQYLDRLFGQKAYEFLLHCHLGLGRTNIQPAEDYERKSVGTERTFRDLGDPALLREKLRRTAEELESDMRKAECKGRTLCLKVK 410
>gi|147674154|ref|YP_001217800.1| DNA polymerase IV [Vibrio cholerae O395] >gi|189044618|sp|A5F5Y1|DPO4_VIBC3 DNA polymerase IV (Pol IV) >gi|146316037|gb|ABQ20576.1| DNA-damage-inducible protein P [Vibrio cholerae O395] (360 aa)
Score = 341, Expect = 4.3e-30, Identities = 94/290 (32%), Positives = 155/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE-LTDDINSGLKY---QDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD FFA+VE+ + P Y ++ LAVG       VI++ NY AR  GV+SAM    A K+CPQL ++    + Y S+S +I +     +  IE  S+DE YLDVS +          A  ++  I Q+ NL  + G +   FLAK+A++L KP+G   +T D  +  +  L + KI G+G     +L +  L+   D+       L+  + G   + L     GI    +  + +RK++G   +  +N S +QE  ++I++ L  ++++ L     Q  + K   IK++++D    T
  S:     7 KIIHVDMDCFFAAVEMRDNPAYREIALAVGGHEKQRGVISTCNYQARKFGVRSAMPTAQALKLCPQLHVVPGRMSVYKSVSQQIQTIFQRYTSLIEPLSLDEAYLDVSESTAYQGSATLIAQAIRRDIWQELNLTASAGVAPIKFLAKVASDLNKPNGLYVVTPDKVQEMVDSLPLEKIPGVGKVALEKLHQAGLYVGADVRRADYRKLLH-QFGRLGASLWKKSHGIDEREVVTERERKSVGVEYTFSQNISTFQECWQVIEQKLYPELDARLSRAHPQRGIIKQ-GIKVKFADFQQTT 304
>gi|47093298|ref|ZP_00231068.1| DNA-damage-inducible protein P, putative [Listeria monocytogenes str. 4b H7858] >gi|153167823|ref|ZP_01927908.1| hypothetical protein LMHG_01259 [Listeria monocytogenes FSL N1-017] >gi|153202961|ref|ZP_01944399.1| hypothetical protein LMSG_01176 [Listeria monocytogenes HPB2262] >gi|47018318|gb|EAL09081.1| DNA-damage-inducible protein P, putative [Listeria monocytogenes str. 4b H7858] >gi|133726694|gb|EBA28392.1| hypothetical protein LMHG_01259 [Listeria monocytogenes FSL N1-017] >gi|133735031|gb|EBA36729.1| hypothetical protein LMSG_01176 [Listeria monocytogenes HPB2262] (356 aa)
Score = 341, Expect = 4.5e-30, Identities = 95/300 (31%), Positives = 156/300 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV----KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN 303
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V    + +I Q+  L  + G SF  F+AK+A++  KP G   +T +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +   N  + +   + + +    +   L       K+V +K+RYSD  + TK      + N
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYQELGLTASAGVSFNKFIAKIASDFKKPAGITVVTPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDSRVLEQSLMQFAKKVEERLIKLQKHGKTVVLKLRYSDFTTITKRLTLNEYTN 310
>gi|71904218|ref|YP_281021.1| DNA polymerase IV [Streptococcus pyogenes MGAS6180] >gi|123639299|sp|Q48RJ4|DPO4_STRPM DNA polymerase IV (Pol IV) >gi|71803313|gb|AAX72666.1| DNA polymerase IV [Streptococcus pyogenes MGAS6180] (364 aa)
Score = 341, Expect = 4.9e-30, Identities = 100/329 (30%), Positives = 172/329 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV+N +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYLDVTNNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGITMT 351
>gi|118578634|ref|YP_899884.1| DNA-directed DNA polymerase [Pelobacter propionicus DSM 2379] >gi|118501344|gb|ABK97826.1| DNA-directed DNA polymerase [Pelobacter propionicus DSM 2379] (410 aa)
Score = 340, Expect = 5.0e-30, Identities = 99/350 (28%), Positives = 183/350 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR---KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD----GDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVIN-LSITANNIMENDNNEQLTIFDSPTQK 354
           + H+DM+SFFASVE +  P+ +  P+ V       VI +A+Y AR  G+K+ M + +A+++C  + ++  +  KY   S +I   +   +  +E  SIDE ++DV+++          A L+K  I+ +F++ C++G +    LAK+A+ + KPDG   +  +N    +  + I ++ GIG  + R L  + ++   ++       L R K G+  S+L+   LGI   P+ P       K++G S ++ ++ S   E L+ + +L++ +    +      K+V++ IRY+D    G   T S   VN  ++I   VV     +I D  + +Q +  L +   N+      EQL +F+   +K
  S:     6 VMHLDMNSFFASVEQSANPDLKGKPVVVTGSQQRTVILTASYEARKFGIKTGMMLHEARRLCRDVIMVPADNRKYIHTSAQIMKMMLDYTPLVEVFSIDEAFMDVTHSMSLFTSAENIAYLLKARIRHQFDITCSIGIAPNKLLAKLASEMKKPDGLTVIAPENVSRVLETMPIKELCGIGKKMERHLNMMGIYTCGELGRCDEGRLTR-KFGIVGSRLKQMGLGIDNSPVIPAEDADAVKSVGHSMTLKKDISSRSEILRYLLQLSEMVGRRARRYGVAGKTVHLTIRYADFSTFGKQGTLS-QHVNQSDEIYQGVV-----KILDSIELEQPVRLLGVRITNLCY--QREQLPLFEDERRK 359
>gi|170017594|ref|YP_001728513.1| nucleotidyltransferase/DNA polymerase involved in DNA repair [Leuconostoc citreum KM20] >gi|169804451|gb|ACA83069.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Leuconostoc citreum KM20] (361 aa)
Score = 340, Expect = 5.0e-30, Identities = 92/345 (26%), Positives = 180/345 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQ-EFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL------HVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIF 348
           KI H+D+D+F+A VE+ + PE    PL +        G  V+A+ANYVAR LGV SAM+ V+A+++ P+   + PN  KY  +S  I+    + ++ IE  ++DE YLD++++          A+ +++ I ++  L  ++G S    LAK+ +   KP+G   +T DN  S++ +L I    G+G     +   L +     +  +  + L R   G     L     G+    +    +++++G+  + R +   + +  K  K+L +++ + LK +    +++NIKIR    ++ T++   +  +   PL           +FE++       +++ LSI+    +++   E++T+F
  S:    12 KILHVDIDAFYAQVEMRDNPELRNRPLIISRDPAETGGRGVVATANYVARALGVHSAMSAVEARQLAPEGVFLSPNFKKYRQVSKTIHHIFHTFTEKIEPVALDEAYLDMTDSHLSG---ASIAAQIRHQILKETGLTSSIGISHNKLLAKLGSEFNKPNGVTVITHDNMLSFLAELPIGDFRGVGAKTKAKFSALKVENGLQLRQLPKETL-RGLFGKMGENLYWQTRGVHFGEVQWQRQQQSVGKEATFRYFIHNEIDVHKAFKQLANEMIAALKVKQLTGRTLNIKIRDDAFNTITRA---ITRETPWPLSETLITQTAQSVFEEVIQTPFSVRLLGLSISN---LQSSTFEEMTLF 361
>gi|161484857|ref|NP_668289.2| DNA polymerase IV [Yersinia pestis KIM] (352 aa)
Score = 340, Expect = 5.1e-30, Identities = 88/243 (36%), Positives = 129/243 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI 246
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CPQLT++      Y   S  I    +  +  IE  S+DE YLDVS++          A  ++ SI  + NL  + G +   FLAK+A+ L KP+G   +T +  + ++ DL +SKI G+G    ++L  L L    DI       L+ K  G     L     GI    I+PD  RK++G  +++
  S:     3 KIIHVDMDCFFAAVEMRDDPRLRDIPLAIGGSKERRGVISTANYPARRYGVRSAMPTAMAFKLCPQLTLLPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVSDSLACGGSATLIAQEIRQSIASELNLTASAGIAPIKFLAKIASELNKPNGQYVITPNQIQPFLQDLPLSKIPGVGAVTAKRLQALGLVTCGDIQKYPLAELL-KHFGKFGRVLWERSHGIDEREISPDRLRKSVGVEKTL 249
>gi|166010983|ref|ZP_02231881.1| DNA polymerase IV [Yersinia pestis biovar Antiqua str. E1979001] >gi|167399408|ref|ZP_02304932.1| DNA polymerase IV [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|45435409|gb|AAS60968.1| DNA-damage-inducible protein P [Yersinia pestis biovar Microtus str. 91001] >gi|165989983|gb|EDR42284.1| DNA polymerase IV [Yersinia pestis biovar Antiqua str. E1979001] >gi|167051912|gb|EDR63320.1| DNA polymerase IV [Yersinia pestis biovar Antiqua str. UG05-0454] (356 aa)
Score = 340, Expect = 5.1e-30, Identities = 88/243 (36%), Positives = 129/243 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI 246
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CPQLT++      Y   S  I    +  +  IE  S+DE YLDVS++          A  ++ SI  + NL  + G +   FLAK+A+ L KP+G   +T +  + ++ DL +SKI G+G    ++L  L L    DI       L+ K  G     L     GI    I+PD  RK++G  +++
  S:     7 KIIHVDMDCFFAAVEMRDDPRLRDIPLAIGGSKERRGVISTANYPARRYGVRSAMPTAMAFKLCPQLTLLPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVSDSLACGGSATLIAQEIRQSIASELNLTASAGIAPIKFLAKIASELNKPNGQYVITPNQIQPFLQDLPLSKIPGVGAVTAKRLQALGLVTCGDIQKYPLAELL-KHFGKFGRVLWERSHGIDEREISPDRLRKSVGVEKTL 253
>gi|21957698|gb|AAM84540.1|AE013699_2 damage-inducible protein P; putative tRNA synthetase [Yersinia pestis KIM] (356 aa)
Score = 340, Expect = 5.1e-30, Identities = 88/243 (36%), Positives = 129/243 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI 246
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CPQLT++      Y   S  I    +  +  IE  S+DE YLDVS++          A  ++ SI  + NL  + G +   FLAK+A+ L KP+G   +T +  + ++ DL +SKI G+G    ++L  L L    DI       L+ K  G     L     GI    I+PD  RK++G  +++
  S:     7 KIIHVDMDCFFAAVEMRDDPRLRDIPLAIGGSKERRGVISTANYPARRYGVRSAMPTAMAFKLCPQLTLLPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVSDSLACGGSATLIAQEIRQSIASELNLTASAGIAPIKFLAKIASELNKPNGQYVITPNQIQPFLQDLPLSKIPGVGAVTAKRLQALGLVTCGDIQKYPLAELL-KHFGKFGRVLWERSHGIDEREISPDRLRKSVGVEKTL 253
>gi|88856607|ref|ZP_01131264.1| DNA polymerase IV [marine actinobacterium PHSC20C1] >gi|88814261|gb|EAR24126.1| DNA polymerase IV [marine actinobacterium PHSC20C1] (415 aa)
Score = 340, Expect = 5.1e-30, Identities = 88/291 (30%), Positives = 152/291 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGH----LVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDP--INPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H+DMD+FFASVEL +RPE    P+ VGH     V+ +A Y AR  GV SAM +  A + CP+  ++ P+  +Y   S K++     L+  +E   IDE +LDV+  +         A+L++  +  +  L C+VG + + ++AK+A+ L+KPDG L +  D    +++ L IS + G+G      L E     I DIA+     L R  +G     ++++ L    DP  +      K++G   +   +  +  E  + +  L+  +   L+    + ++V +K+R+ D  + T+S
  S:    23 ILHVDMDAFFASVELLDRPELIGKPVIVGHNSSRSVVTAATYEARKYGVNSAMPMALALRRCPKAIVLEPHFERYQYFSKKVFEICDDLTPKVERLGIDEAFLDVAGARAIYGSPKHVAALLRARVFAETGLVCSVGAAASKYVAKVASGLSKPDGLLVIPADKTTEFLHPLPISALWGVGGKTAEVLRERGFATIADIAHADRQTLTR-AVG-EAGAVKLHNLAWGNDPRDVVERPAEKSIGHETTFEVDILDADEIRRELLRLSGKVAVRLRSAGMVARTVVLKLRFEDFSTVTRS 318
>gi|16123390|ref|NP_406703.1| DNA polymerase IV [Yersinia pestis CO92] >gi|108808712|ref|YP_652628.1| DNA polymerase IV [Yersinia pestis Antiqua] >gi|108811029|ref|YP_646796.1| DNA polymerase IV [Yersinia pestis Nepal516] >gi|145600117|ref|YP_001164193.1| DNA polymerase IV [Yersinia pestis Pestoides F] >gi|149364926|ref|ZP_01886961.1| DNA-damage-inducible protein P [Yersinia pestis CA88-4125] >gi|161511436|ref|NP_992091.2| DNA polymerase IV [Yersinia pestis biovar Microtus str. 91001] >gi|162421814|ref|YP_001607653.1| DNA polymerase IV [Yersinia pestis Angola] >gi|165926575|ref|ZP_02222407.1| DNA polymerase IV [Yersinia pestis biovar Orientalis str. F1991016] >gi|165935841|ref|ZP_02224411.1| DNA polymerase IV [Yersinia pestis biovar Orientalis str. IP275] >gi|166212896|ref|ZP_02238931.1| DNA polymerase IV [Yersinia pestis biovar Antiqua str. B42003004] >gi|167421635|ref|ZP_02313388.1| DNA polymerase IV [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423673|ref|ZP_02315426.1| DNA polymerase IV [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167467178|ref|ZP_02331882.1| DNA polymerase IV [Yersinia pestis FV-1] >gi|123245611|sp|Q1C4D9|DPO4_YERPA DNA polymerase IV (Pol IV) >gi|123246681|sp|Q1CLD4|DPO4_YERPN DNA polymerase IV (Pol IV) >gi|189044621|sp|A4TPK8|DPO4_YERPP DNA polymerase IV (Pol IV) >gi|22095621|sp|Q8ZBZ9|DPO4_YERPE DNA polymerase IV (Pol IV) >gi|108774677|gb|ABG17196.1| DNA-damage-inducible protein P [Yersinia pestis Nepal516] >gi|108780625|gb|ABG14683.1| DNA-damage-inducible protein P [Yersinia pestis Antiqua] >gi|115348869|emb|CAL21825.1| DNA-damage-inducible protein P [Yersinia pestis CO92] >gi|145211813|gb|ABP41220.1| DNA-damage-inducible protein P [Yersinia pestis Pestoides F] >gi|149291339|gb|EDM41413.1| DNA-damage-inducible protein P [Yersinia pestis CA88-4125] >gi|162354629|gb|ABX88577.1| DNA polymerase IV [Yersinia pestis Angola] >gi|165915986|gb|EDR34593.1| DNA polymerase IV [Yersinia pestis biovar Orientalis str. IP275] >gi|165921503|gb|EDR38700.1| DNA polymerase IV [Yersinia pestis biovar Orientalis str. F1991016] >gi|166205683|gb|EDR50163.1| DNA polymerase IV [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960554|gb|EDR56575.1| DNA polymerase IV [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167057843|gb|EDR67589.1| DNA polymerase IV [Yersinia pestis biovar Mediaevalis str. K1973002] (352 aa)
Score = 340, Expect = 5.1e-30, Identities = 88/243 (36%), Positives = 129/243 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI 246
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CPQLT++      Y   S  I    +  +  IE  S+DE YLDVS++          A  ++ SI  + NL  + G +   FLAK+A+ L KP+G   +T +  + ++ DL +SKI G+G    ++L  L L    DI       L+ K  G     L     GI    I+PD  RK++G  +++
  S:     3 KIIHVDMDCFFAAVEMRDDPRLRDIPLAIGGSKERRGVISTANYPARRYGVRSAMPTAMAFKLCPQLTLLPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVSDSLACGGSATLIAQEIRQSIASELNLTASAGIAPIKFLAKIASELNKPNGQYVITPNQIQPFLQDLPLSKIPGVGAVTAKRLQALGLVTCGDIQKYPLAELL-KHFGKFGRVLWERSHGIDEREISPDRLRKSVGVEKTL 249
>gi|18310548|ref|NP_562482.1| DNA polymerase IV [Clostridium perfringens str. 13] >gi|22095617|sp|Q8XK37|DPO4_CLOPE DNA polymerase IV (Pol IV) >gi|18145229|dbj|BAB81272.1| DNA-damage-inducible protein P [Clostridium perfringens str. 13] (359 aa)
Score = 340, Expect = 5.8e-30, Identities = 113/346 (32%), Positives = 193/346 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF---QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN---DNNEQLTIFD 349
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I  L I K  G+G     +L  + +   +D+       LI     R KI   +++      GI    +NP   RK++G+  ++R +  + +E +++++++++ ++  L   +   K+V +K++++D    T+S    +F   Q +I +  V DL   I DF K  +V  L IT +++ EN   +  EQL+ FD
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGKPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNIVEPLSLDEAFVDVSKSKRCKGSATLIALEIKERIFKEVGLTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRKLPIGKFFGVGRVTKNKLNNIGVFKGEDLLGFSEKELIGILGDRGKILYEFAR------GIDNRQVNPYRIRKSIGKEITLREDIEDIEEMIEILEKISERVSESLCLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEQKEI-MECVKDLI-SIVDF-KNKKVRLLGITISSLEENIITEEREQLS-FD 358
>gi|94968575|ref|YP_590623.1| DNA-directed DNA polymerase [Acidobacteria bacterium Ellin345] >gi|94550625|gb|ABF40549.1| DNA-directed DNA polymerase [Acidobacteria bacterium Ellin345] (425 aa)
Score = 340, Expect = 6.0e-30, Identities = 87/291 (29%), Positives = 156/291 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHW-----SKLR-MNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           IFH+DMD+FF SVE    P  +   + VG       V+++A+Y AR  GV SAM +  A K+CP    +  +  +Y   S K +  L   S  +E  SIDE YLD++ T+  +   ++ A  +   +K +  LNC++G   +  +AK+ ++ AKP+G L +      S++  L + KI G+G    ++L E+ +  + D+A + +D  +R++ G  W      K R ++  G     +  D   K++    +    +  QE L+ +I  L++ +   ++  +   ++V IK+RYSD  + T++
  S:    18 IFHVDMDAFFVSVEELFDPSLKGKAVVVGGHRDERGVVSAASYAARKFGVHSAMPLRTAAKLCPDAIFVNGHPERYREYSGKAFEVLKKFSPKVEMASIDEAYLDMTGTERLHGPPLKAAHALHQFMKSETKLNCSIGIGTSRLIAKVCSDQAKPNGVLYIVPGQEASFLAPLSVRKIPGVGKVFEQKLNEIGIKKVGDLAKL-DDAFLRERFG-EWGLALAGKSRGLDAGGYFDRDVAVDEGPKSISHEHTFNTDTRDQEKLEAMIARLSEMVCRRVREHELHARTVQIKLRYSDFTTITRA 318
>gi|50914926|ref|YP_060898.1| DNA polymerase IV [Streptococcus pyogenes MGAS10394] >gi|73620812|sp|Q5XA48|DPO4_STRP6 DNA polymerase IV (Pol IV) >gi|50904000|gb|AAT87715.1| DNA polymerase IV [Streptococcus pyogenes MGAS10394] (364 aa)
Score = 340, Expect = 6.1e-30, Identities = 100/329 (30%), Positives = 172/329 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV+N +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYLDVTNNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|168179226|ref|ZP_02613890.1| DNA polymerase IV [Clostridium botulinum NCTC 2916] >gi|182669759|gb|EDT81735.1| DNA polymerase IV [Clostridium botulinum NCTC 2916] (349 aa)
Score = 340, Expect = 6.2e-30, Identities = 98/332 (29%), Positives = 188/332 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS---FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           M   I H+DMD+FFASVE  +  + +  P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +     +Y  +S+ I+  L  ++  IE  SIDE YLD++N + E    I+ A  +K  +K +  L  +VG S+  FLAK+A++  KPDG   + +D   S +  L I+KI GIG     +L  + ++ ++D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++ +  +E  K + + ++ +++ L  ++   K+V +KI+ S+  + T+S    +++  +++I  ++  D+ E I +F +  ++I L+++
  S:     1 MDRVIIHVDMDAFFASVEQMDNKKLKGKPVIVGGIGERGVVSTASYEARKYGVHSAMPVFIAKKRCPFGIYVPGRHERYKEVSNNIFKILYKVTPIIEPVSIDEAYLDITNIKEE---PIKVAEHIKKRVKNEMGLTLSVGISYNKFLAKLASDWNKPDGIKIIRQDMIPSILMPLPINKIHGIGKKSVEKLNNIGIYTVEDMHKLSRDFCI-EYFGKFGVEIYERIRGIDYREVKVSRERKSIGKEITLKKDITNKEEMKKYLLDFSNKVSTNLYKRNSGGKTVTVKIKTSNFQTHTRSKTVNDYIRDKDEI-YNIACDILEHI-NFKEPIRLIGLTVS 334
>gi|188025344|ref|ZP_02958315.2| hypothetical protein PROSTU_00018 [Providencia stuartii ATCC 25827] >gi|188023887|gb|EDU61927.1| hypothetical protein PROSTU_00018 [Providencia stuartii ATCC 25827] (359 aa)
Score = 339, Expect = 6.4e-30, Identities = 94/326 (28%), Positives = 165/326 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINL 329
           KI HIDMD F+A++E+ + P    +P+AVG       VI++ANY AR  GV SAM+   A ++CP L ++      Y   S  I+   S  +  IE  S DE YLDVS  ++ +      A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T      +++ L + KI G+G    ++L+++ L    D+ +     LI K +G     L     GI    +NPD  RK++G  +++  +   +++ L L+ +L +++   L     D       IK++++D    T+   +     Q     ++ L +Q+ +  + D+ + L
  S:    11 KIIHIDMDCFYAAIEMRDDPSLRNIPIAVGGSADRRGVISTANYEARRYGVHSAMSTAVALRLCPHLKVVPGRMALYKETSLHIHKIFSQYTDLIEPLSWDEAYLDVSECEHYHGSATLIAQAIRQQIFDELQLTASAGIAPIKFLAKIASDLNKPNGQYVITPQALPDFVWSLPLKKIPGVGKVTAQKLLDMGLETCGDVQSYDVVNLI-KVMGKFGQVLWERCHGIDERSVNPDRLRKSVGVERTLAEDIQHWEDCLPLLNQLYEELEVRLMKVKPDRRIARQGIKMKFNDFQQTTQEHAYPILDKQD----LISLAKQVWEHRRKDRGVRL 339
>gi|88773319|gb|EAR04586.1| DNA polymerase IV [Alteromonas macleodii 'Deep ecotype'] (357 aa)
Score = 339, Expect = 6.6e-30, Identities = 87/285 (30%), Positives = 156/285 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKY--QDFMFKSVNIKIRYSD 288
           KI H+DMD F+A+VE+ + P    +P+A+G       VI++ NY AR  GV+SAM    A K+CP LT++    + Y + S KI    +  +  IE  S+DE YLDV+N+++        A  ++  I+ +  L  + G +   F+AK+A++  KPDG   +T D   +++ D+ + KI G+G    ++L  + L+   D+     +  I+K++G   S L     GI    ++   +RK++G     S  I    E  +FL  L ++L + +++  K   +    ++  +K++++D
  S:     3 KIIHVDMDCFYAAVEMRDNPALRDIPIAIGGSADRRGVISTCNYPARKYGVRSAMATAYAVKLCPNLTLVKGRMDVYAAESQKIRKIFADYTDLIEPLSLDEAYLDVTNSEFCGGSATLIAEEIRARIQSELGLTASAGVAPCKFVAKVASDENKPDGICVITPDKLDAFVRDMPLKKIPGVGKVTMQKLQRMGLNTCNDVRQYPFER-IQKELGKFGSVLWERAHGIDERELSVSRERKSIGVERTLSDDIHTLDECIDFLPHLFEKLQERMDNHKKRTGKPVRIRTQGVKLKFND 298
>gi|146306757|ref|YP_001187222.1| DNA polymerase IV [Pseudomonas mendocina ymp] >gi|189027675|sp|A4XT24|DPO4_PSEMY DNA polymerase IV (Pol IV) >gi|145574958|gb|ABP84490.1| DNA-directed DNA polymerase [Pseudomonas mendocina ymp] (352 aa)
Score = 339, Expect = 6.8e-30, Identities = 87/292 (29%), Positives = 151/292 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           + KI HID D F+A++E+ + P     PLAVG       VIA+ NY AR  GV+SAM+   A K+CP L I+ P    Y S+S +I+      +  IE  S+DE YLDVS++ +        A  ++  + Q+ ++  + G +   FLAK+A++  KP+G   +T D    ++  L +SK+ G+G     +L  L +    D+ +     L+R + G    +L     GI    +  D +R++L    +  ++  + Q  L+ +  L +++N  L+  D  ++     +K+++ D    T
  S:     3 QRKIIHIDCDCFYAAIEMRDDPSLANRPLAVGGSADRRGVIATCNYEARAYGVRSAMSSRHALKLCPDLLIVKPRFEVYRSVSREIHGIFRQFTDLIEPLSLDEAYLDVSDSPHFAGSATRIAQEIRRRVAQELHITVSAGVAPNKFLAKIASDWRKPNGLFVITPDQVDEFVTALPVSKLHGVGKVTADKLTRLGIRTCLDLRDWNKLALVR-EFGSFGERLWRLAHGIDEREVKVDSRRQSLSVEHTYDQDLPDLQSCLEKLPALLEEMNGRLQRLDASYRPDKPFVKVKFHDFTQTT 301
>gi|169832906|ref|YP_001693961.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae Hungary19A-6] >gi|168995408|gb|ACA36020.1| DNA polymerase IV (Pol IV) [Streptococcus pneumoniae Hungary19A-6] (353 aa)
Score = 339, Expect = 6.8e-30, Identities = 99/333 (29%), Positives = 173/333 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELT---DDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQ---NQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           +  KI HIDMD+FFA+VE+ + P+     + +G          V+++ +Y AR  GV SAM+  +A + CPQ   I  N  KY ++  +I +     +  IE  SIDE YLDV+  +      ++ A L++  I Q+ +L  + G S+  FLAKMA++  KP G   +  +  + ++  + ISK  G+G     +L ++ +    D+  V    LI  + G     L     GI   P+  +  RK++G+ ++       +E +K  KELT   + +   L  Q+   K V +KIRY D  + TK  +        +QI   + + L+E++S+  +  +++ +++T 
  S:    10 LSRKIIHIDMDAFFAAVEIRDNPKLRGKSVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKAVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGISYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLEVPEVTLI-DRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILRAEEDIK--KELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQIS-QIALQLYEELSEKERGVRLLGITMTG 352
>gi|29349817|ref|NP_813320.1| DNA damage-inducible protein [Bacteroides thetaiotaomicron VPI-5482] >gi|29341728|gb|AAO79514.1| DNA damage-inducible protein [Bacteroides thetaiotaomicron VPI-5482] (353 aa)
Score = 339, Expect = 7.7e-30, Identities = 98/323 (30%), Positives = 173/323 (53%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQ----VINLSIT 332
           MD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV+SAM+   AK++CPQL  +    + Y S+S +I+      +  IE  S+DE +LDV+  +      ++ A  +K  I+++ NL  + G S+  FLAK+A++  KPDG  T+  D    +I  L I    G+GP   +++  L +H    +     + L     K+G L++   R    GI   P+     RK++G  +++ R+ S +   +  +  +  ++   L+ ++F   ++ +KI++ D    T+S      Q    L  ++ L +++    +Y+Q    +I LS++
  S:     1 MDAFYASVEQRDHPELRGKPLAVGHAEERGVVAAASYEARRYGVRSAMSSQKAKRLCPQLIFVSGRMDVYKSVSRQIHEIFHEYTDIIEPLSLDEAFLDVTENKKGISLAVDIAKEIKLRIREQLNLVASAGVSYNKFLAKIASDYRKPDGLCTIHPDQALDFIAGLPIESFWGVGPVTAKKMHLLGIHNGLQLRKCSLEMLTAHFGKVGALYYECSR----GIDERPVEAVRIRKSIGCERTLERDISVHSSVIIELYHVAVELIERLQRKEFKGNTLTLKIKFHDFSQITRS--ITQSQELYTLDRILPLAKELLKSVEYEQHPIRLIGLSVS 329
>gi|159039002|ref|YP_001538255.1| DNA-directed DNA polymerase [Salinispora arenicola CNS-205] >gi|157917837|gb|ABV99264.1| DNA-directed DNA polymerase [Salinispora arenicola CNS-205] (419 aa)
Score = 339, Expect = 7.9e-30, Identities = 84/312 (26%), Positives = 163/312 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSK-LRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFE 315
           ++ H+DMD+FFASVE+  RPE    P+ VG L    V++SA+Y AR  GV+SAM    A+ +CP    + P+   YT+ S  +      ++  +E  S+DE +LDV+  Q    +    A L++  +  +  L C+VG + + F+AK+ +  AKPDG L +       +++ L +  + G+G      L  L L  + ++A    D ++R+ +G   ++ LR    G     +  + + K++G   +   + ++ +E  + +  L + + + L+    + ++V +K+R +D  + ++S +       +P  V  ++F+
  S:    25 RVLHVDMDAFFASVEVRHRPELRGRPVVVGGLGPRGVVSSASYPARRYGVRSAMPTARARALCPHAVFLPPDFTAYTTASRTVMQIFQDVTPLVEPLSLDEAFLDVAGAQRLFGQPSAIARLIRERVATEVGLTCSVGVASSKFVAKLGSTRAKPDGMLVVPTARVLDFLHPLPVEALWGVGERSAETLRRLGLTTVGELAQAP-DGMLRRALGTAAARHLRELAWGKDPRRVTSEREDKSIGAEVTFDADVTDRREIRRALLGLAEKVGARLRRSGQVGRTVALKVRLADFRTVSRSRSL-----DVPTDVGREMFD 336
>gi|71911381|ref|YP_282931.1| DNA polymerase IV [Streptococcus pyogenes MGAS5005] >gi|71854163|gb|AAZ52186.1| DNA polymerase IV [Streptococcus pyogenes MGAS5005] (364 aa)
Score = 338, Expect = 8.5e-30, Identities = 99/329 (30%), Positives = 176/329 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQEFLKLIKELTDDIN---SGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV++ +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G    ++L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE   +  E++ ++    + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVKKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQE-TDIKAEISKNVKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|147677833|ref|YP_001212048.1| nucleotidyltransferase/DNA polymerase [Pelotomaculum thermopropionicum SI] >gi|189027673|sp|A5D243|DPO4_PELTS DNA polymerase IV (Pol IV) >gi|146273930|dbj|BAF59679.1| nucleotidyltransferase/DNA polymerase [Pelotomaculum thermopropionicum SI] (402 aa)
Score = 338, Expect = 8.9e-30, Identities = 103/367 (28%), Positives = 182/367 (49%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-------RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD--GDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQ 367
           M+  I   DM+SF+ASV  A  P  +  P+ VG      H ++ +A+  A+  GVK+ M + +A  +CPQ   + P  + Y + S +I   +   S  +E  SIDE ++DVS         +E A  +K  IK +  + C+VG      LAKMA  + KPDG   L   +    I+ L + ++ G+G  L ++L +LN+H I D+A      L ++K GL    L ++  GI   P++P     +L R +SI       R+Y  Y E   +I EL + +   ++   +  ++V++ ++ +D    S  ++ N+          V V L  Q   +  +  V  + ++   +++N   EQL +F    +     +  ++I+ +
  S:     1 MRCPILLADMNSFYASVHQAMEPRLKGKPVIVGGDPARRHGIVLAASVEAKACGVKTGMTVREAAALCPQGIFLKPRHSHYINFSARIIRIMKDFSPLVEPFSIDEAFMDVSGCGLLFGSSLEIAVKLKARIKNEVGVLCSVGVGPNKLLAKMAAGMQKPDGLTLLDFPDVPVKIWPLPVRELFGVGSRLEKRLRDLNIHTIGDLARYPLQVL-KQKFGLVGHILHLSASGIDYSPVDP----CSLERVRSIGHQITLPRDYWGYNEIKVVILELCEIVCRRVRLGGYAGRTVSLTLKDTDFLWLSRARTMNYPTASADEVYRVAVQLLHQ--HWPPWKPVRMVGVSLAGLVKN-RAEQLDLFGEAERARRLHAACDRIKDR 374
>gi|158320707|ref|YP_001513214.1| DNA-directed DNA polymerase [Alkaliphilus oremlandii OhILAs] >gi|189027656|sp|A8MGJ5|DPO4_ALKOO DNA polymerase IV (Pol IV) >gi|158140906|gb|ABW19218.1| DNA-directed DNA polymerase [Alkaliphilus oremlandii OhILAs] (398 aa)
Score = 338, Expect = 9.3e-30, Identities = 94/288 (32%), Positives = 159/288 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKND--YLIRKKIGLHWSKLRMNVLGIICDP---INPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           M   IF +DM++FF S E+    +   +P AV         ++ +ANY AR  GVK+AM + +A K+CP +T++ P+   Y   S ++ + LS  +  IE  SIDE +LD++ T+    K  + A L+   IK+   L C++G S   FL+KMA+++ KP G   L K + ++ ++ L I  + G+G     +L  L +  I D AN+K D  + I  K GL    L  +  GI   P   I+PD   K++GRS ++  +  + ++   ++  L +DI    +  +   ++VN+ ++ SD
  S:     1 MNPVIFLVDMNAFFISCEMTRNSKLIGIPAAVAGNPQNRTGIVLAANYEARRFGVKTAMTLNNALKLCPTMTVVPPDHRFYRQKSSEVMNLLSKYTPIIEQSSIDEAWLDMTGTENLFGKPADAAKLIMEDIKENLGLWCSIGISEGKFLSKMASDMKKPLGITELWKRDIQTKLWPLSIKSMHGVGAKTYEKLHSLGIETIGDFANLKKDDAHQILGKFGL---DLYHHAHGIDTTPVQVISPD-DMKSIGRSTTLPEDLVDIEQLKYILLTLCEDIGRSARKHNKRGRTVNLTLKSSD 296
>gi|89073173|ref|ZP_01159712.1| DNA polymerase IV [Photobacterium sp. SKA34] >gi|89051126|gb|EAR56583.1| DNA polymerase IV [Photobacterium sp. SKA34] (351 aa)
Score = 337, Expect = 1.2e-29, Identities = 95/295 (32%), Positives = 153/295 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLK---LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HID+DS++ASVE  + P    +PLAVG      V+++ +Y AR  GV+SAM    A ++CP LT++  N  KY S+S +I+      +  IE  S+DE YLDV+++          A  ++ SI  +  L  + G S   F++K+A+++ KP+G   +T D  +S+I DL + KI G+G     +L  L  +  +DI     + LI    G   + L     GI   P+  +  RK++G  ++  N  +S  Q  L    L  EL   +   L   D +   + +K++++D    T    F
  S:     5 KIIHIDLDSYYASVEARDNPSLRGIPLAVGGKNGRGVLSTCSYEARSFGVRSAMPTAKALQLCPNLTVVSGNMEKYRSVSKQIHEIFRRYTDIIEPLSLDEAYLDVTDSTLFQGSATLIAQDIRRSIAAELQLTASAGVSPLKFVSKVASDMNKPNGICVVTPDEVQSFIDDLDLGKINGVGKVTLEKLNTLGFYKGRDIKTSNRNALI-SHFGKFGNTLWDRCHGIDDRPVIVERVRKSVGVERTYLNDIHSLEQCILSIEPLFVELEKRLEKALA--DKLINKLGVKLKFNDFQQTTVEHKF 305
>gi|116873410|ref|YP_850191.1| DNA polymerase IV [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123463973|sp|A0AK80|DPO4_LISW6 DNA polymerase IV (Pol IV) >gi|116742288|emb|CAK21412.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (356 aa)
Score = 337, Expect = 1.4e-29, Identities = 102/333 (30%), Positives = 170/333 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQ----KFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNI 336
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V   I+Q    +  L  + G SF  F+AK+A++  KP G   +  +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +   N  + +   + + +    + + L       K+V +K+RYSD  + TK      + N  NQI     + L E    ++  D +  + +T  N+
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVARDIQQTIYHELGLTASAGVSFNKFIAKIASDFKKPAGMTVVAPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDSRILEQSLMQFAKKVEARLIKLQKHGKTVVLKLRYSDFTTITKRLTLNEYTNDANQIYQAAALLLRES---YTGQDSIRLIGLTVTNL 343
>gi|163786797|ref|ZP_02181245.1| hypothetical protein FBALC1_16467 [Flavobacteriales bacterium ALC-1] >gi|159878657|gb|EDP72713.1| hypothetical protein FBALC1_16467 [Flavobacteriales bacterium ALC-1] (369 aa)
Score = 337, Expect = 1.4e-29, Identities = 99/313 (31%), Positives = 166/313 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF--QNQIPLHVVVDLFEQ 316
           KI H+DMD+F+ASV   + PE +  P+AVG      VI++A+Y AR  GVKSAM+   A+K+CP+L  +  +  +Y+ +S +I       +  +E  S+DE YLDV+    EN   +  A+L+   I+Q+      L  + G S   F+AK+A++  KP+G  T+  ++   ++ DL I K  G+G     ++ +  +   KD+ +   DYL  K  G         V GI    + P+  RK+L   ++ R N S     L+ ++++ ++++  L       K++ +KI+YSD    T+S     +  +  I L    DL  Q
  S:     9 KIIHVDMDAFYASVAQMDNPELKGKPIAVGGGGKRGVISAASYEARKFGVKSAMSGRLAEKLCPELIFVRTDFERYSEISKRIRKIFYDYTDLVEPLSLDEAYLDVT----ENKIGLPSATLIAQKIRQRIFDEVGLTASAGISINKFVAKIASDYNKPNGQKTVNPEDVLQFLEDLDIRKFYGVGKVTAEKMYQKGIFTGKDLKSKSADYL-EKNFGKSGRSYYHIVRGIHNSKVKPNRIRKSLAAERTFRENLSSEIFMLEKLRQIAEEVSKRLDKSKVAGKTITLKIKYSDFTLQTRSKTLPYYVSEKAIVLETAKDLLYQ 327
>gi|116629089|ref|YP_814261.1| nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus gasseri ATCC 33323] >gi|116094671|gb|ABJ59823.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus gasseri ATCC 33323] (373 aa)
Score = 336, Expect = 1.4e-29, Identities = 92/293 (31%), Positives = 160/293 (54%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICP--QLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGL------HWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           K KI H+DMD+F+ASVE+ + P      + +G        H V+A+ANYVAR  G  SAM    A ++ P  +L II P+  KY ++S +I+  +  ++  +E+ ++DE YLDV+  +      +  A++++  I QK  L  + G S+  FLAKM +  AKP G   +  +    ++    I K  GIGP    +L E+ ++   D+  +  D LI+K  ++G       H   LR  V        + +  RK++G  ++  ++  +  E L  ++  + ++ + LK + F+   V +KIR ++  + TK
  S:    10 KRKIIHLDMDAFYASVEIRDNPALRNKAVLIGGDPKKNRGHGVVATANYVARQYGAHSAMPTAKAIRLIPAEKLVIIQPHFEKYRAVSAEIHRLMHKMTDRVESVALDEAYLDVTENKLHLADPVRIATILQEQIYQKVGLTSSFGVSYNKFLAKMGSEYAKPFGRTVIRPETALDFLAKQKIEKFPGIGPKTQERLAEMGVYTGADLIKIPTDVLIKKFNRMGYLIAQHAHGIDLRAVV-------TDSERNRKSIGIERTFNQSLFDENEALTRLRAYSGELENRLKKRHFLANCVVLKIRDANFKTITK 314
>gi|94499176|ref|ZP_01305714.1| DNA polymerase IV [Oceanobacter sp. RED65] >gi|94428808|gb|EAT13780.1| DNA polymerase IV [Oceanobacter sp. RED65] (366 aa)
Score = 336, Expect = 1.4e-29, Identities = 97/358 (27%), Positives = 179/358 (50%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLI-KELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTE 358
           M  ++ H+D D FFA+VE+ + P+Y  +PLA+G       VI++ NYVAR  GV+SAM    A K+CP L +I  +  KY  +S ++ S + S     E  SIDE Y+++S   +   K I  A  ++  ++ +  +  +VG +   +LAK+A++  KP+G   +       ++  L + KI G+GP    +L  + +H   D+  ++   L+ K+ G    KL     GI    ++   +RK+L   ++  N  E +E L+ + ++L     S ++      + V   +K++++D    T      N Q  + L   ++L +Q    ++  Q  ++ +         N  Q+ +FD  T ++  +
  S:     1 MPRQVLHVDCDCFFAAVEMRDSPQYRDIPLAIGGSSDRRGVISTCNYVARAYGVRSAMPSGQALKLCPDLMLIRGDMEKYRRVSREVMSIVESYGLAFEQVSIDEAYIEIS--PHSPGKII--AQQIRQQVEAEIGITVSVGIAPNKYLAKVASDWNKPNGQFVVEPQALNEFVRTLPVGKIPGVGPKSAEKLANMGIHSCADVQAIELADLL-KRFGQFGKKLYDRSRGIDDRTLSNGRERKSLSVERTFANDIESEEELQQVAQDLWLRFQSRIEANAIRLRDVTPFVKVKFADFQVTT----LANHQKTVDLDSFIELIQQ----ARRRQEKSIRLIGIGARLKQNLTQMELFDQATAELDID 353
>gi|187778600|ref|ZP_02995073.1| hypothetical protein CLOSPO_02195 [Clostridium sporogenes ATCC 15579] >gi|187772225|gb|EDU36027.1| hypothetical protein CLOSPO_02195 [Clostridium sporogenes ATCC 15579] (349 aa)
Score = 336, Expect = 1.5e-29, Identities = 94/295 (31%), Positives = 163/295 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M   I H+DMD+FFASVE  +  + +  P+ VG +    V+++A+Y AR  GV SAM +  AKK CP    +    N+Y  +S+ I+  L  ++  IE  SIDE YLD+S+ +    K I+ A  +KN +K +  L  +VG S+  FLAK+A++  KPDG   + KD     +  L I+KI GIG     +L  + +  + D+  +  D+ I +  G    ++   + GI    +    +RK++G+  ++ ++    +E  K + + ++ I++ L  ++   K+V +KI+ S+  + T+S
  S:     1 MDRVIMHVDMDAFFASVEQMDNKKLKGKPVIVGGIGERGVVSTASYEARKYGVHSAMPVFMAKKKCPFGIYVPGRHNRYREVSNNIFKILYKVTPIIEPVSIDEAYLDISHIKE---KPIKVAKYIKNRVKDEIGLTLSVGISYNKFLAKLASDWNKPDGIKIINKDMIPRILMPLPINKIHGIGKKSVEKLHNIGVFTVADMHKLSKDFCI-EYFGKFGVEIYDRIRGIDYREVKVSRERKSIGKEITLKKDIINKEEMKKYLLDFSNKISTNLYKRNSAGKTVTVKIKTSNFKTHTRS 296
>gi|94991144|ref|YP_599244.1| DNA polymerase IV [Streptococcus pyogenes MGAS10270] >gi|189044612|sp|Q1JF59|DPO4_STRPD DNA polymerase IV (Pol IV) >gi|94544652|gb|ABF34700.1| DNA polymerase IV [Streptococcus pyogenes MGAS10270] (364 aa)
Score = 336, Expect = 1.5e-29, Identities = 99/329 (30%), Positives = 172/329 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV++ +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|15675671|ref|NP_269845.1| DNA polymerase IV [Streptococcus pyogenes M1 GAS] >gi|22095631|sp|Q99Y66|DPO4_STRP1 DNA polymerase IV (Pol IV) >gi|13622885|gb|AAK34566.1| putative DNA-damage-inducible protein P [Streptococcus pyogenes M1 GAS] (364 aa)
Score = 336, Expect = 1.5e-29, Identities = 99/329 (30%), Positives = 176/329 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQEFLKLIKELTDDIN---SGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV++ +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G    ++L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE   +  E++ ++    + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVKKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKYDRIRKSIG---SERTYAKLLYQE-TDIKAEISKNVKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|153175202|ref|ZP_01930597.1| hypothetical protein LMIG_00619 [Listeria monocytogenes FSL N3-165] >gi|153196482|ref|ZP_01940852.1| hypothetical protein LMRG_01122 [Listeria monocytogenes 10403S] >gi|127633943|gb|EBA23335.1| hypothetical protein LMRG_01122 [Listeria monocytogenes 10403S] >gi|133729655|gb|EBA31353.1| hypothetical protein LMIG_00619 [Listeria monocytogenes FSL N3-165] (356 aa)
Score = 336, Expect = 1.7e-29, Identities = 94/300 (31%), Positives = 155/300 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV----KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN 303
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V    + +I Q+  L  + G SF  F+AK+A++  KP G   +  +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +   N  + +   + + +    +   L       K+V +K+RYSD  + TK      + N
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYQELGLTASAGVSFNKFIAKIASDFKKPAGITVVAPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETTFEFNVLDSRVLEQSLMQFAKKVEERLIKLQKHGKTVVLKLRYSDFTTITKRLTLNEYTN 310
>gi|19746777|ref|NP_607913.1| DNA polymerase IV [Streptococcus pyogenes MGAS8232] >gi|24211640|sp|Q8NZI1|DPO4_STRP8 DNA polymerase IV (Pol IV) >gi|19749010|gb|AAL98412.1| putative DNA-damage-inducible protein P [Streptococcus pyogenes MGAS8232] (364 aa)
Score = 336, Expect = 1.8e-29, Identities = 99/329 (30%), Positives = 172/329 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV++ +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDLVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|51595246|ref|YP_069437.1| DNA polymerase IV [Yersinia pseudotuberculosis IP 32953] >gi|153950157|ref|YP_001402117.1| DNA polymerase IV [Yersinia pseudotuberculosis IP 31758] >gi|170025513|ref|YP_001722018.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII] >gi|186894264|ref|YP_001871376.1| DNA-repair protein [Yersinia pseudotuberculosis PB1/+] >gi|81640247|sp|Q66DZ7|DPO4_YERPS DNA polymerase IV (Pol IV) >gi|189044620|sp|A7FLI9|DPO4_YERP3 DNA polymerase IV (Pol IV) >gi|51588528|emb|CAH20136.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Yersinia pseudotuberculosis IP 32953] >gi|152961652|gb|ABS49113.1| DNA polymerase IV [Yersinia pseudotuberculosis IP 31758] >gi|169752047|gb|ACA69565.1| DNA-directed DNA polymerase [Yersinia pseudotuberculosis YPIII] >gi|186697290|gb|ACC87919.1| UMUC domain protein DNA-repair protein [Yersinia pseudotuberculosis PB1/+] (352 aa)
Score = 336, Expect = 1.8e-29, Identities = 87/243 (35%), Positives = 129/243 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI 246
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CPQLT++      Y   S  I    +  +  IE  S+DE YLDVS++          A  ++ SI  + NL  + G +   FLAK+A+ L KP+G   +T +  + ++ DL +SKI G+G    ++L  L L    +I       L+ K  G     L     GI    I+PD  RK++G  +++
  S:     3 KIIHVDMDCFFAAVEMRDDPRLRDIPLAIGGSKERRGVISTANYPARRYGVRSAMPTAMAFKLCPQLTLLPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVSDSLACGGSATLIAQEIRQSIASELNLTASAGIAPIKFLAKIASELNKPNGQYVITPNQIQPFLQDLPLSKIPGVGAVTAKRLQALGLVTCGEIQKYPLAELL-KHFGKFGRVLWERSHGIDEREISPDRLRKSVGVEKTL 249
>gi|149177333|ref|ZP_01855938.1| DNA-damage-inducible protein P [Planctomyces maris DSM 8797] >gi|148843858|gb|EDL58216.1| DNA-damage-inducible protein P [Planctomyces maris DSM 8797] (388 aa)
Score = 336, Expect = 1.8e-29, Identities = 97/359 (27%), Positives = 188/359 (52%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ--YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLI-KELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF---VNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQV 368
           MD+F+AS+E  + PE +  P+ VG       V+++ANY AR  GV SAM +  A+++CPQ        + Y  +S  +       +  +E  S+DE +LDVS +Q  + N +EI  A+ +K  ++    L  +VG +   FLAK+A++  KPDG + +  D  + ++  L +S++ GIG   T++   L +  I  +  ++   L     + GLH   L     G+    + P+ + K++ R  +  +     E L++I  +L +D++  L+      K++ +KIRY D  + T+S       +   +I    ++ L +++ +     ++I + +T     ++ +  Q ++FD   Q+    S+L++++ Q+
  S:     1 MDAFYASIEERDHPELQGQPIIVGGRAEHRGVVSAANYPARKFGVHSAMPMKTARQLCPQAHFFPVRMSDYAEVSQSLQKIFRKYTPLVEPLSLDEAFLDVSGSQLLFGNGREI--AASIKQEVRHSLQLIASVGVAPNKFLAKIASDADKPDGLVVVEPDKIQEFLDPLPVSRVWGIGKMATQRFNRLGIQTISQVRVLEPKILTELFGEQGLHLWNLSQ---GLDERAVIPERQAKSISRETTFSSDVNDLEILRIILMDLVEDVSRRLRKNKLRGKTIQLKIRYDDFSTFTRSITVSQPTDLTREIEQSALLMLDQKLPERPLSIRLIGVGVTG---FQSGSQHQKSLFDEEDQQ--KFSRLDQVKDQI 362
>gi|150004450|ref|YP_001299194.1| DNA damage-inducible protein [Bacteroides vulgatus ATCC 8482] >gi|149932874|gb|ABR39572.1| DNA damage-inducible protein [Bacteroides vulgatus ATCC 8482] (351 aa)
Score = 335, Expect = 1.9e-29, Identities = 91/286 (31%), Positives = 155/286 (54%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           MD+F+ASVE  + PE    PLAVGH     V+A+A+Y AR  GV SAM+   AK++CP+L  +    N Y ++S +I+    + +  IE  S+DE +LDV+  +      I+ A  +K  I+++  L  + G S+  FLAK+A++  KPDG  T+  D    +I  L I    G+GP   +++  L +H    +     + L R+  K G L++   R    GI   P+ P   RK++G   ++ ++ S +   +  +  +  ++   LK  +F   ++ +KI++ D +  T+S
  S:     1 MDAFYASVEQRDNPELCGKPLAVGHAEERGVVAAASYEARRYGVHSAMSSQKAKRLCPELIFVPGRMNVYKAVSRQIHDIFHTYTDIIEPLSLDEAFLDVTENKAGFSLAIDIAKDIKKRIRKELGLIASAGVSYNKFLAKIASDYRKPDGLCTIHPDQALDFIAHLPIESFWGVGPVTAQKMHALGIHNGTQLQACTLEMLTRQFGKAGNLYYDFAR----GIDLRPVEPIRIRKSVGCEHTLEKDISLHSSAIIELYHVVTELLERLKRTNFSGNTLTLKIKFHDFNQITRS 290
>gi|28871135|ref|NP_793754.1| DNA polymerase IV [Pseudomonas syringae pv. tomato str. DC3000] >gi|38257466|sp|Q87Y22|DPO4_PSESM DNA polymerase IV (Pol IV) >gi|28854385|gb|AAO57449.1| DNA polymerase IV [Pseudomonas syringae pv. tomato str. DC3000] (353 aa)
Score = 335, Expect = 1.9e-29, Identities = 78/239 (32%), Positives = 129/239 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           + KI HID D F+A++E+ + PE    PLAVG       VIA+ NY AR  GV+SAM+   A K+CP LTI+ P    Y   S +I+S     +  IE  S+DE +LDVS+T + +      A  ++  +  + ++  + G +   FLAK+A++  KP+G   +T D  + ++  L ++K+ G+G     +L  L +    D+ +     L+R + G    +L     GI   P+  D +R+++
  S:     3 QRKIIHIDCDCFYAAIEMRDEPELAGKPLAVGGSAERRGVIATCNYEARAYGVRSAMSSRHALKLCPDLTIVKPRMEAYKEASREIHSIFRDYTDLIEPLSLDEAFLDVSDTHHFSGSATRIAQDIRRRVSNQLHITVSAGVAPNKFLAKIASDWKKPNGLFVITPDQVEDFVASLPVTKLHGVGKVTADKLGRLGIVDCADLRSRSKLALVR-EFGSFGERLWSLAHGIDDRPVQNDSRRQSV 245
>gi|56965584|ref|YP_177318.1| DNA polymerase IV [Bacillus clausii KSM-K16] >gi|56911830|dbj|BAD66357.1| DNA polymerase IV DinB [Bacillus clausii KSM-K16] (414 aa)
Score = 335, Expect = 1.9e-29, Identities = 101/347 (29%), Positives = 183/347 (52%)
  Q:     3 NKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMAT-NLAK--PDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPIN--PDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFD 349
           N IF +DM+SF+AS+E A  P+Y+  PL V         VI +A  +A+  GV++A  + +A++ CP L ++ P+  +Y  +S +I   L + +  +E  SIDE ++DV+ +Q       E A  VK +I  +F +   VG      LAK+A  N AK   +G   L KD+    ++ L I K+ G+G  ++  L  + +  I  +A   +   I+K+ G+H   L M+  G    P+      +RK  G   ++ R+Y + ++   ++ EL +++ + L+   +M  +V++ +  +D     + F+    + F+  I + V       +  F     +  LSI  +N +++D N QL++FD
  S:     5 NVIFLVDMESFYASIEHAANPQYDGRPLVVSGDVNRRSGVILAACPLAKAKGVRNAERLFEAQQKCPDLVVVKPHMQRYVDISLQISKILGTFTDLVEPYSIDEQFMDVTGSQKLFGPPYEIAEKVKQAIMDRFGVKARVGIGENKVLAKLACDNFAKKSSEGIYWLRKDSLDLDLWCLPIEKLFGVGRKMSVHLRNMGIRTIGQLAQT-DGARIKKRFGVHGQVLWMSANGEDYSPVTRAAHARRKGYGNGMTLPRDYVKKEDICVVLLELCEEVCARLRQDGWMGSTVSLSVNGADF-VEKRGFHRQYTIPFETNITMEVYEAACALLERFWDGYPIRRLSIGVSN-LQSDQNWQLSLFD 363
>gi|72161500|ref|YP_289157.1| DNA-directed DNA polymerase [Thermobifida fusca YX] >gi|71915232|gb|AAZ55134.1| DNA-directed DNA polymerase [Thermobifida fusca YX] (424 aa)
Score = 335, Expect = 2.0e-29, Identities = 83/291 (28%), Positives = 152/291 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYE-NWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHW-SKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I HIDMD+FFASVE    P+  + P+ VG      V+ASANY AR  G+ SAM +  A ++CP   +  P+   Y  +S  +   L S++  +E  S+DE +LDV+          +  A L++  ++ +  L C+VG + T F+AK+A+   KPDG L +   +  ++++ L +  + G+G    + L  + L  + D+A    D L R ++G    ++L     G    P+ P+   K++   ++   +  + +   + +  L++ +   L+      ++V +K+R +D  + T+S
  S:    36 ILHIDMDAFFASVEELRHPDVVRRPVLVGGTGPRGVVASANYQARRYGIHSAMPMSRALRLCPHAVVFPPDHETYRRVSAGVMDLLRSITPQVEQLSVDEAFLDVAGADRRLGGGPLHIAQLIRARMRAEQGLTCSVGIAATKFVAKLASTRCKPDGLLVVPTRHVTAFLHPLPVGALWGVGERTEQALRRMGLRTVGDVARTPPDTL-RHELGQALGNQLAELAWGYDPRPVTPETADKSVSTEETFPTDIHDPERIRRELLRLSEKVARRLRASGQAGRTVGVKLRRADFSTVTRS 332
>gi|54308027|ref|YP_129047.1| DNA polymerase IV [Photobacterium profundum SS9] >gi|46912453|emb|CAG19245.1| putative DNA-damage-inducible protein P [Photobacterium profundum SS9] (358 aa)
Score = 335, Expect = 2.0e-29, Identities = 85/293 (29%), Positives = 155/293 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQD--FMFKSVNIKIRYSDGDSAT 293
           ++ KI H+DMD F+A+VE+ + P  + +P+A+G       VI++ NY+AR  GV+SAM    A K+CP LT++    + Y  +S  I +     +  IE  S+DE YLDV+  +         A  ++ +I+ + NL  + G +   F+AK+A++L KP+G   +T +    ++ +L + KI G+G    ++L E  L   +D+    + +L+ ++ G     L     GI    +  +  RK++G   +   N  EY E  ++I++L  ++   LK +          +K++++D    T
  S:     7 VQRKIIHVDMDCFYAAVEMRDNPALKNIPIAIGGRSEQRGVISTCNYLARKYGVRSAMPSGQAMKLCPHLTLVPGRMSVYKEVSQHIRAIFQRYTDKIEPLSLDEAYLDVTECEMFYGSATLIAQDIRRAIQDELNLTASAGIAPVKFIAKVASDLNKPNGQYVVTPNEVADFVANLKLEKIPGVGKVTIQKLHEKGLFVGRDV-QAYDQHLLLQQFGKLGQSLWSRAQGIDNREVVVERLRKSVGVETTFSHNIREYDECWQVIEKLYPELERRLKKERPALNISKQGVKVKFADFQQTT 306
>gi|24213203|ref|NP_710684.1| DNA damage-inducible protein [Leptospira interrogans serovar Lai str. 56601] >gi|73919255|sp|Q8F8Q2|DPO4_LEPIN DNA polymerase IV (Pol IV) >gi|24193922|gb|AAN47702.1|AE011236_11 DNA damage-inducible protein [Leptospira interrogans serovar Lai str. 56601] (364 aa)
Score = 335, Expect = 2.0e-29, Identities = 93/313 (29%), Positives = 166/313 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN--FQNQIPLHVVVDLFEQ 316
           KI H+DMD+F+ASVE  + PEY+  PL VG       V+++A+Y AR  GV+SAM    A ++ PQ   ++P    Y  +S +I       +  +E  S+DE YLDV+  +      +  A  ++  I ++  L  + G   + F++K+A+   KP+G   +  D+  S+I  L +S   G+G    R++ EL ++  KD+     D L++   K+G+++ K+     G     +    +RK+LG   +  R+  +Y + LK +K++   +   L+ +DF  K++ +KI++ D    T+S       F+        ++LFE+
  S:     7 KIIHVDMDAFYASVEQRDFPEYKGKPLIVGGPPNSRSVVSAASYEARKFGVRSAMPCSKAAQLAPQAIFVFPRFEVYKEVSKQIREIFLEYTDLVEMLSLDEGYLDVTFNKKNIPYAVTIAKEIRTEIFKRTELTASAGVGNSKFISKLASEKNKPNGLTVVLPDDVISFIDPLPVSSFHGVGKVTARKMKELGIYTGKDLRTKSIDELVQHFGKMGIYYYKISR---GEDERMVQSSRERKSLGAESTFDRDKLDYDDLLKQLKDVAVVVERRLEKKDFAGKTLTLKIKFYDFSLKTRSKTLSEPIFKADELYSTAIELFEE 326
>gi|157149712|ref|YP_001449567.1| DNA polymerase IV [Streptococcus gordonii str. Challis substr. CH1] >gi|189044609|sp|A8AUV7|DPO4_STRGC DNA polymerase IV (Pol IV) >gi|157074506|gb|ABV09189.1| DNA-damage-inducible protein P [Streptococcus gordonii str. Challis substr. CH1] (354 aa)
Score = 335, Expect = 2.1e-29, Identities = 94/330 (28%), Positives = 171/330 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT--KSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           KI HIDMD+FFA+VE+ + P+ +  P+ +G          V+++ NY AR  GV SAM+  +A + CPQ   I  N  KY ++  +I       +  IE  SIDE YLDV+  +      ++ A L+++ I  +  L  + G S+  FLAK+A++  KP G   +  +  ++++  + I+K  G+G     +L E+ ++   D+  +    LI  K G     L     GI   P+  +  RK++G+ ++     YSE ++  K +  L   + + L   D   +++ +KIRY+D  + T  KS N      +       ++++ + +  +  +++ L++T 
  S:    13 KIIHIDMDAFFAAVEVRDNPKLKGHPVIIGSDPRLTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQGIFISGNYEKYQAVGLQIREIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIAKLIQHDIWNELQLTASAGVSYNKFLAKIASDYEKPHGLTVILPEEAEAFLAPMDIAKFHGVGNKSVEKLHEMGVYTGADLLKIPEMTLI-DKFGRFGFDLYRKARGISNSPVKSNRIRKSIGKERTYAKLLYSE-EDIKKELTLLAQKVENSLIKHDKKGRTIVLKIRYADFSTLTKRKSLNLATRDKKQIERTAHEIYDSLEEQPRGIRLLGLTVTG 352
>gi|73668106|ref|YP_304121.1| DNA polymerase IV [Methanosarcina barkeri str. Fusaro] >gi|72395268|gb|AAZ69541.1| DNA polymerase IV [Methanosarcina barkeri str. Fusaro] (365 aa)
Score = 335, Expect = 2.3e-29, Identities = 93/295 (31%), Positives = 156/295 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL--------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETG------SIDEWYLDVSNTQYENWK-EIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M+  I H+DMDSF+A++E  E PE +   + V  L         +++ NY AR  G+K+ M+   AKK+ P+   +   K+ YTS+SD++   L S +   E G      SIDE +L+++     ++    E  + +KN +K K  L C+VG      +AKMA+++ KPDG   ++ D F+S+++ L +SK+ GIG     +L E+ +  IKD+A      LI          L+    GI   P+      + +GR  ++  +  +     +L+  L  D+ S L  ++  F++V I +  S     TKS
  S:     1 MQRIILHVDMDSFYAAIEERENPELQGKAVVVCMLSGRSELSGAVSTCNYTARESGIKAGMSCSKAKKLNPEAVFLPVRKDFYTSVSDRVMEILRSYADAREIGEAFEQISIDEAFLEITEKTGGDFNLAFEIGTQIKNEVKDKEKLTCSVGVGPNKLIAKMASSVQKPDGITVISPDKFESFLWPLKVSKLWGIGNVTAGKLQEMGIVTIKDLAEHDVIDLISTFGKTRGVWLKQAASGIDDSPLKEKDGSEQIGRIATLPEDTLDVNLISQLLDRLAGDVISKLDSRELSFRTVTITVINSKFRMYTKS 311
>gi|139473158|ref|YP_001127873.1| DNA polymerase IV [Streptococcus pyogenes str. Manfredo] >gi|189044614|sp|A2RCQ1|DPO4_STRPG DNA polymerase IV (Pol IV) >gi|134271404|emb|CAM29624.1| DNA polymerase IV [Streptococcus pyogenes str. Manfredo] (364 aa)
Score = 335, Expect = 2.4e-29, Identities = 99/329 (30%), Positives = 172/329 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV++ +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDLVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|90410930|ref|ZP_01218944.1| DNA polymerase IV [Photobacterium profundum 3TCK] >gi|90328143|gb|EAS44454.1| DNA polymerase IV [Photobacterium profundum 3TCK] (358 aa)
Score = 335, Expect = 2.4e-29, Identities = 85/292 (29%), Positives = 155/292 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQD--FMFKSVNIKIRYSDGDSAT 293
           + KI H+DMD F+A+VE+ + P  + +P+A+G       VI++ NY+AR  GV+SAM    A K+CP LT++    + Y  +S  I +     +  IE  S+DE YLDV+  +         A  ++ +I+ + NL  + G +   F+AK+A++L KP+G   +T +    ++ +L + KI G+G    ++L E  L   +D+    + +L+ ++ G     L     GI    +  +  RK++G   +  +N  EY E  ++I++L  ++   LK +          +K++++D    T
  S:     8 QRKIIHVDMDCFYAAVEMRDNPALKNIPIAIGGRSEQRGVISTCNYLARKYGVRSAMPSGQAMKLCPHLTLVPGRMSVYKEVSQHIRAIFQRYTDKIEPLSLDEAYLDVTECEMFYGSATLIAQDIRRAIQDELNLTASAGIAPVKFIAKVASDLNKPNGQYVVTPNEVADFVANLKLEKIPGVGKVTIQKLHEKGLFVGRDV-QAYDQHLLLQQFGKLGQSLWSRAQGIDNREVVVERLRKSVGVETTFSQNIREYGECWQVIEKLYPELERRLKKERPALNISKQGVKVKFADFQQTT 306
>gi|21228978|ref|NP_634900.1| DNA polymerase IV [Methanosarcina mazei Go1] >gi|24211645|sp|Q8PT42|DPO42_METMA DNA polymerase IV 2 (Pol IV 2) >gi|20907518|gb|AAM32572.1| DNA polymerase IV [Methanosarcina mazei Go1] (369 aa)
Score = 335, Expect = 2.4e-29, Identities = 80/291 (27%), Positives = 161/291 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASL-VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKE----------LTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           +FH+DMDSFFASVE+ ERPE + LP+ VG          V+++ +Y AR  G+ SAM I  A + CP    +  N   Y  +S  +   L   ++  +  S+DE YL +  +   N++E    +L +K+ ++++  + C+VG      ++K+A+   KPDG   +  ++ + +++ L +S+I G+G      L ++ ++ ++++AN  +  ++ +K+G    +L+    G+       D++   L   +S+++ S +  F +   +          L + ++  L    F+FK++ + +R+ D  + T+S
  S:    17 VFHVDMDSFFASVEVRERPELKNLPVIVGSDPKGGSGRGVVSTCSYEARKYGIHSAMPISQAYRFCPDAVFLPVNMKLYAGVSAGVMEILRGFAEKFQQVSVDEAYL-IPGSGVRNFEEAALYALRIKDEVQRQQKITCSVGVGPNKLVSKIASGFQKPDGLTVVRPEDVRDFLFPLPVSRIPGVGEKTEETLKKMGINRVEELANC-DVQMLSEKLGKMGFRLKQLANGL-------DFEE--LVEKESVKSISRHGTFAEDTDDPVKVSGSLDLLIESVHGSLMKHSFLFKTITLTVRFEDFSTYTRS 315
>gi|150019053|ref|YP_001311307.1| DNA-directed DNA polymerase [Clostridium beijerinckii NCIMB 8052] >gi|149905518|gb|ABR36351.1| DNA-directed DNA polymerase [Clostridium beijerinckii NCIMB 8052] (348 aa)
Score = 334, Expect = 2.4e-29, Identities = 86/295 (29%), Positives = 167/295 (56%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M N I H+DMD+FFASVE  + P+ +  P+ VG +    V+++ +Y AR  GV SAM +  A++ CP    +     KY  +S +I+   + ++  +E  SIDE +LD+S  + ++   IE A  +KN + ++  L  ++G S+  FLAK+A+   KP+G   + K+     ++ L ISK+ G+G     +L  + ++YI+++  +  ++ I + +G +  ++   + GI    +    +RK++G+ ++++ +    +E  + IKE + +I   L  ++   K+V +K +  D ++ T+S
  S:     1 MDNVILHVDMDAFFASVEQRDNPDIKGKPVIVGGISERGVVSTCSYEARKYGVHSAMPMFMAREKCPNGIFVSGRYGKYAKVSQEIFEIFNEVTPLVEPVSIDEGFLDLSQGKIKD--GIEAARYIKNRVFKEVGLTLSIGISYNKFLAKLASEWNKPNGIKEIRKEMIPDILFPLPISKVHGLGKVSVAKLNNMGIYYIEELYKMPKEFYI-EYLGKNGIEIYDRIRGIDGRKVELIRERKSIGKERTLKFDTKNKEELREYIKEFSFEIEEILNRKNVSGKTVTLKFKTKDFENHTRS 297
>gi|119962523|ref|YP_947459.1| putative DNA polymerase IV [Arthrobacter aurescens TC1] >gi|119949382|gb|ABM08293.1| putative DNA polymerase IV [Arthrobacter aurescens TC1] (384 aa)
Score = 334, Expect = 2.5e-29, Identities = 84/286 (29%), Positives = 144/286 (50%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           MD+FF SVEL  RPE    P+ VG      V+ SA+Y AR  GVKSAM +  A + CP   II P   +Y  +S ++    +S++  +E  S+DE +LDV          ++   L++  +  +  +  +VG + T F+AK+A+   KPDG L +  ++   Y++ L +  + G+G      L  L +  + D+A      L +K +G     +    +GI   P+ P    K++G  ++    +  Q  L + +  L+      L+    + ++V +K+RYSD  + T+S
  S:     1 MDAFFVSVELRTRPELRGKPVIVGFPAERSVVLSASYEARATGVKSAMPMSIAMRRCPSAVIINPRHTEYYEVSGRLMEIFASITDLVEPLSVDEAFLDVGGAIRRLGSPMDIGHLIRRRVHSELGITASVGIASTKFVAKIASTRCKPDGILQIDAEDSVPYLHSLPVGALWGVGGKTAEVLSRLGIRTVADVAATPLASL-KKVLGASGEHVHRLSMGIDPRPVTPTRLEKSIGAEETFSVDTADQALLHRELLRLSHRTAIRLRSSGMLARTVALKLRYSDFSTVTRS 290
>gi|39995154|ref|NP_951105.1| ImpB/MucB/SamB family protein [Geobacter sulfurreducens PCA] >gi|39981916|gb|AAR33378.1| ImpB/MucB/SamB family protein [Geobacter sulfurreducens PCA] (413 aa)
Score = 334, Expect = 2.7e-29, Identities = 85/287 (29%), Positives = 151/287 (52%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAV---GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGI---ICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           +  I HIDM++FFASVE    P  +  P+AV   G  V+ +A+Y AR  GVK+ MN  +A + CP L ++  +  KYT  S +I       +  +ET SIDE +LDV+ +          A  +K  I+ +F L C++G +    LAK+A+++ KPDG   +  +     +  + I  + GIG    +QL  L +    ++     + ++R+  G+   +L +   GI      P+    + K++G S ++ R+ +  ++ LK + +L++ +    +      K+V++ IRY+D
  S:     8 QRTILHIDMNAFFASVEQQANPSLQGKPIAVVGSGRTVVTTASYEARAFGVKTGMNKWEALQACPHLILVVGDNRKYTHTSTQINRIFRDFTPEVETFSIDEAFLDVTGSLALFGSAETIACRIKALIRHRFGLTCSIGIAPNKLLAKLASDMKKPDGLTIIRPEEVTRLMEIIPIQDLCGIGVKTRKQLNSLGIQTCGELGRFPVE-ILRRTFGVIGDRLHLMGKGIDDSPVVPVEEAEEVKSVGHSMTLDRDLTARRDILKYLLQLSEMVGRRARRYGVAGKTVHLTIRYAD 300
>gi|45658878|ref|YP_002964.1| DNA polymerase IV [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|73919254|sp|Q72MY7|DPO4_LEPIC DNA polymerase IV (Pol IV) >gi|45602123|gb|AAS71601.1| DNA polymerase IV [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (364 aa)
Score = 334, Expect = 2.8e-29, Identities = 93/313 (29%), Positives = 166/313 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN--FQNQIPLHVVVDLFEQ 316
           KI H+DMD+F+ASVE  + PEY+  PL VG       V+++A+Y AR  GV+SAM    A ++ PQ   ++P    Y  +S +I       +  +E  S+DE YLDV+  +      +  A  ++  I ++  L  + G   + F++K+A+   KP+G   +  D+  S+I  L +S   G+G    R++ EL ++  KD+     D L++   K+G+++ K+     G     +    +RK+LG   +  R+  +Y + LK +K++   +   L+ +DF  K++ +KI++ D    T+S       F+        ++LFE+
  S:     7 KIIHVDMDAFYASVEQRDFPEYKGKPLIVGGPPNSRSVVSAASYEARKFGVRSAMPCSKAAQLAPQAIFVFPRFEVYKEVSKQIREIFLEYTDLVEMLSLDEGYLDVTFNKKNIPFAVTIAKEIRTEIFKRTELTASAGVGNSKFISKLASEKNKPNGLTVVLPDDVISFIDPLPVSSFHGVGKVTARKMKELGIYTGKDLRTKSIDELVQHFGKMGIYYYKISR---GEDERMVQSSRERKSLGAESTFDRDKLDYDDLLKQLKDVAVVVERRLEKKDFAGKTLTLKIKFYDFSLKTRSKTLSEPIFKADELYSTAIELFEE 326
>gi|150391906|ref|YP_001321955.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF] >gi|149951768|gb|ABR50296.1| DNA-directed DNA polymerase [Alkaliphilus metalliredigens QYMF] (367 aa)
Score = 334, Expect = 2.9e-29, Identities = 92/360 (25%), Positives = 191/360 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF-QNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESK 360
           M ++I H+DMD+FFA+VE  ++PE +   + VG      ++ + +Y AR  G+ SAM I  AK+ CP    +     +Y  +S +++  L  ++  +E  SIDE +LD+S+ + + +   + A  +K  + QK  L  +VG S+  FLAK+A++  KPDG   +TK+     +  L + K+ GIG     +L ++ +  I+D+ ++    LI   +G    ++   + G+    +  D + K++GR  ++ R+  + +E  K +     +++  LK + F  +++ IK++ +   + +K      + +++  ++ +     + +   +Y ++I L+++  + +     EQLT +D+  + +   SK
  S:     1 MDHRIIHVDMDAFFAAVEQQDQPELKGKAVIVGGSSNRGIVCTCSYEARKFGIHSAMPIFMAKQRCPHGIYLPVRHERYREVSRQVFDILYEVTDLVEPLSIDEAFLDISDCEEKTY---DIAKYIKEQVNQKTGLTISVGISYNKFLAKLASDWNKPDGIKIITKEMVPDILKPLPVHKVFGIGRKSGSKLNQIGIETIEDLLSLSEQNLI-DLLGKSGVEIYHRIRGVDQRMVEIDRQIKSIGRETTLTRDTMDKEELKKYLFIFAQEVSQSLKRRGFFARTITIKMKDAHFKAHSKGKTIEKYIRDEKEIYEIASEALEENGIEEYIRLIGLTVSNFSTVP---IEQLTFYDTVDKTLENASK 359
>gi|58039310|ref|YP_191274.1| DNA polymerase IV [Gluconobacter oxydans 621H] >gi|58001724|gb|AAW60618.1| DNA polymerase IV, damage-inducible protein P [Gluconobacter oxydans 621H] (356 aa)
Score = 333, Expect = 3.2e-29, Identities = 86/294 (29%), Positives = 155/294 (52%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + +I HIDMD+F+ASV+  + P     PLAVG      V+A+A+Y AR  GV+SAM  V AK++CP+L  +    + Y S+S +I+   S  +  I+  S+DE YLD+++           A  ++  I  +  L  + G S+  FLAK+A++  KPDG   +T      ++  L +    GIGP++ R++  L +    D+     + L R   K    ++   R    GI   P+  + +RK+LG  Q+ +R+ +   +  + + ++   +    + +    ++V +K++Y+D    T++
  S:     3 QRRIVHIDMDAFYASVKQRDDPSLRGRPLAVGRGEARGVVAAASYEARRFGVRSAMPSVTAKRLCPELLFVPARFDVYRSVSAQIHDIFSRYTPLIQPLSLDEAYLDLTDHLGAYGSATLVADRIRADIHAETGLTASAGVSYNRFLAKLASDYRKPDGLFVITPAMGPEFVAALPVDAFHGIGPAMARKMRALGIETGADLRERDIETLTRHFGKAATFYYGISR----GIDHRPVVVNRERKSLGTEQTYLRDLTSEADAHQALTQIAATLWGSAQRRQLQARTVTLKVKYADFRQITRA 300
>gi|146298645|ref|YP_001193236.1| DNA-directed DNA polymerase [Flavobacterium johnsoniae UW101] >gi|146153063|gb|ABQ03917.1| DNA-directed DNA polymerase [Flavobacterium johnsoniae UW101] (360 aa)
Score = 333, Expect = 3.3e-29, Identities = 92/292 (31%), Positives = 151/292 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + P     PLAVG      V+A+A+Y AR  GV+SA++ V AKK CP++  + P  ++Y  +S KI+      +  +E  S+DE YLDV+  +  N      A  ++  I  +  L  + G S   F+AK+A+++ KP+G  T+  D    ++ +L I K  G+G   T ++ +L +    D+ +   ++L  K  G   +     V GI    + P    K++    +   N S     L+ ++ +   +   LK  +   K+V +KI+YSD    T+S
  S:     9 KIIHIDMDAFYASVEQMDNPALRGKPLAVGGSENRGVVAAASYEARKFGVRSAISGVLAKKYCPEIIFVRPRFDRYKEISSKIHKIFHEYTDLVEPLSLDEAYLDVTQNKKGNPSASLLAQEIRTRIFNEVGLTASAGISVNKFVAKIASDINKPNGQKTVNPDEIIPFLEELPIRKFYGVGKVTTEKMYQLGIFTGSDLKSKSLEFL-EKHFGKSGAFYYSVVRGIHNSEVKPHRITKSVAAEHTFDVNLSSEIFMLEQLERIAVSLEKRLKRHNVSGKTVTLKIKYSDFTQQTRS 304
>gi|24372697|ref|NP_716739.1| DNA polymerase IV [Shewanella oneidensis MR-1] >gi|81589360|sp|Q8EHU9|DPO4_SHEON DNA polymerase IV (Pol IV) >gi|24346755|gb|AAN54184.1|AE015556_1 DNA-damage-inducible protein P [Shewanella oneidensis MR-1] (357 aa)
Score = 333, Expect = 3.4e-29, Identities = 93/290 (32%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD +FA+VE+ + PEY   PLAVG       VI++ NY AR  GV+SAM    A+K+CP L ++      Y  +S +I +  S  ++ IE  S+DE YLDVS+ +         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +  D    +I  L + +I G+G     +L  L L+   D+       LI  + G   + L     GI    ++   +RK++G     +Q I    + Q+ +  LI+EL+  ++   K  D       +K+++SD    T
  S:     3 KIIHVDMDCYFAAVEMRDFPEYRGKPLAVGGSRERRGVISTCNYEARRFGVRSAMATAYAQKLCPDLILVPGRMQVYKDVSSQIRAIFSRYTELIEPLSLDEAYLDVSDCKLHKGSATLIAEAIRRDILAETGLTASAGVAPVKFLAKVASDLNKPNGQYVIPPDKVPEFIRTLSLRQIPGVGKVTAEKLSSLGLNTCGDVQTYPKQELI-TRFGKFGAVLIERAQGIDDRGLSVSRERKSVGVETTLAQDIYTLEQCQQVMPGLIQELSTRLSRSAK--DRQIHKQVVKLKFSDFKQTT 299
>gi|110803706|ref|YP_698855.1| DNA polymerase IV [Clostridium perfringens SM101] >gi|123047351|sp|Q0SSQ2|DPO4_CLOPS DNA polymerase IV (Pol IV) >gi|110684207|gb|ABG87577.1| DNA polymerase IV [Clostridium perfringens SM101] (359 aa)
Score = 333, Expect = 3.5e-29, Identities = 98/330 (29%), Positives = 180/330 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-----RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF--QNQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           KI HIDMD+F+AS+E  + P+Y+  PL VG       V+A+ +Y AR  G+ SAM  + A K+CP+   I P    Y  +S ++ + L+  S  +E  S+DE ++DVS ++         A  +K  I ++  L  + G SF  FLAKMA++  KPDG   +T++N K +I  L I K  G+G     +L  + +   +D+       LI     R KI   +++      GI    +NP   RK++G+  ++R +  + +E ++++ ++ + ++  L   +   K+V +K++++D    T+S    +F  + +  +  V DL   +   +K  +++ ++I++
  S:     6 KIIHIDMDAFYASIEQRDNPKYKGKPLIVGGDPNRRGVVATCSYEARKYGIHSAMPSLTAYKLCPKAIFIRPRMEVYKKVSRQVMNILNEYSNLVEPLSLDEAFVDVSKSKRCKGSATLIALEIKERIFKEVGLTASAGVSFNKFLAKMASDFRKPDGITVITEENSKDFIRKLPIGKFFGVGRVTKNKLNNIGVFKGEDLLGFSEKELIGILGDRGKILYEFAR------GIDNRQVNPYRIRKSIGKEITLREDIEDIEEMIEILDKIAERVSESLCLLNKKGKTVTLKVKFNDFKHITRSITLEHFLKEKKEIMECVKDLISIVDFKNKKVRLLGITISS 342
>gi|94995023|ref|YP_603121.1| DNA polymerase IV [Streptococcus pyogenes MGAS10750] >gi|189044613|sp|Q1J509|DPO4_STRPF DNA polymerase IV (Pol IV) >gi|94548531|gb|ABF38577.1| DNA polymerase IV [Streptococcus pyogenes MGAS10750] (364 aa)
Score = 333, Expect = 3.5e-29, Identities = 97/329 (29%), Positives = 171/329 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE Y+DV+N +      ++ A L+++ + ++  L C+ G S+  FL K+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSCKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYVDVTNNKLGIKSAVKIAKLIQHDMWKEVGLTCSAGVSYNKFLGKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|116618680|ref|YP_819051.1| nucleotidyltransferase/DNA polymerase for DNA repair [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097527|gb|ABJ62678.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (361 aa)
Score = 333, Expect = 3.5e-29, Identities = 83/292 (28%), Positives = 157/292 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           +I H+D+D+F+A +E+ + PE   LPL +        G  V+A+ANY AR LGV SAM+  +AK++ P    + P+  KY  +S +I+      +  IE  + DE YLD++++          A+ +++ I ++  L  ++G S+   LAK+A+   KP+G   +TKDN   ++  L IS   G+G     +   L +     +  +  + L R + G     L     G+    +    +R+++G+ ++   + + ++ + L  K+L  +I   +K +  + +++NIKIR S+ ++ T+S
  S:    12 RIIHVDLDAFYAQIEMRDHPELRDLPLIISRDPIESNGRGVVATANYAARKLGVHSAMSAAEAKRLAPDAFFMRPDFQKYKMISQQIHHIFHQYTDKIEPIAFDEAYLDLTDSVLTG---ATLAAKIRHQILKETQLTSSIGVSYNKLLAKLASEFNKPNGVTVITKDNALDFLARLPISSFRGVGKKTQEKFAMLGVENGAQLRMIPQETL-RAQFGKMGEHLFWQARGVHFGEVQWHRQRQSVGKEETFDQFVQTRDEVNLEFKKLAVEIVKIMKNKKLVGRTLNIKIRDSEFNTITRS 308
>gi|119471218|ref|ZP_01613721.1| DNA polymerase IV [Alteromonadales bacterium TW-7] >gi|119445684|gb|EAW26967.1| DNA polymerase IV [Alteromonadales bacterium TW-7] (352 aa)
Score = 332, Expect = 4.5e-29, Identities = 102/313 (32%), Positives = 164/313 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQEFL--KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQ 316
           KI H+DMD+F+ SVE+ + PE    P+AVG       V++++NY+AR  GVKSAM    A + CP L ++      Y S+S +I       +  IE  S+DE YLDVS+ +         A  + +SI ++ NL  + G S   FLAK+A++L KP+G   +   +  S+I ++ + KI G+G     +L+  NL + +D+     +YL  K  K+G L W +      G    P+    +RK++G     S+ I + S   + L  KL+ EL       L   D     + +K+++SD    TK F+       I   ++V+ F +
  S:     3 KIIHVDMDAFYVSVEIRDNPELANKPVAVGGSRSSRGVLSTSNYIARQYGVKSAMPTSVALRKCPDLILVPGRMEVYKSVSSQIREIFERYTDIIEPLSLDEAYLDVSDCKLFGGSATLIAQDICHSIHKELNLTASAGVSPIKFLAKVASDLNKPNGVYVIPPKDVDSFIDNMELKKIPGVGKVTNEKLLLNNLKFGRDVKASSLEYLTSKYGKLGRLLWERCS----GSDDRPVIVSRERKSVGVERTFSEDILDLSILDDILKNKLLPELQKRAEKHL--VDRGISKIGVKVKFSDFHQTTKEFSTDKIDMAILSELLVEAFAR 323
>gi|42518567|ref|NP_964497.1| DNA polymerase IV [Lactobacillus johnsonii NCC 533] >gi|41582852|gb|AAS08463.1| DNA polymerase IV [Lactobacillus johnsonii NCC 533] (373 aa)
Score = 332, Expect = 4.8e-29, Identities = 87/291 (29%), Positives = 160/291 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICP--QLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLR--MNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           KI HIDMD+F+ASVE+ + P      + +G        H V+A+ANY+AR  G  SAM    A ++ P  +L II PN  KY ++S +I+  +  ++  +E+ ++DE YLDV+  +      +  A+L++  I Q+  L  + G S+  FLAKM +  AKP G   +  +  + ++    I    GIGP    +L E+ ++   D+  +  D LI+K  ++G   ++    +++  ++ D    +  RK++G  ++  +N  +    L  ++  + ++   LK + F+   V +K+R ++  + TK
  S:    12 KIIHIDMDAFYASVEMRDNPSIRNKAVLIGGDPKKNKGHGVVATANYIARSYGAHSAMPTAKAVRLIPAEKLVIIQPNFEKYRAVSAEIHQLMHKITDRVESVALDEAYLDVTENKLNLTDPVRIAALLQERIYQRIGLTSSFGVSYNKFLAKMGSEYAKPFGRTVIKPEGARDFLAKQPIKNFPGIGPKTQEKLAEMEVYTGADLRKIPTDILIKKFNRMGYLMAQHAHGIDLRDVVTD---SERNRKSIGIERTFNQNLFDENTALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTITK 314
>gi|21911131|ref|NP_665399.1| DNA polymerase IV [Streptococcus pyogenes MGAS315] >gi|28895184|ref|NP_801534.1| DNA polymerase IV [Streptococcus pyogenes SSI-1] >gi|25452928|sp|Q8K5Y2|DPO4_STRP3 DNA polymerase IV (Pol IV) >gi|21905342|gb|AAM80202.1| putative DNA-damage-inducible protein P [Streptococcus pyogenes MGAS315] >gi|28810429|dbj|BAC63367.1| putative DNA-damage-inducible protein P [Streptococcus pyogenes SSI-1] (365 aa)
Score = 332, Expect = 5.1e-29, Identities = 92/291 (31%), Positives = 155/291 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           KI HIDMD+FFA+VE  + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ D+I       +  +E  SIDE YLDV++ +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK
  S:    13 KIIHIDMDAFFAAVEERDNPALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFKRYTDVVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVVALLQDHKKLGKTIVLKVRYADFITLTK 311
>gi|167941561|ref|ZP_02528636.1| DNA polymerase IV (Pol IV) [Ureaplasma urealyticum serovar 8] >gi|167959945|ref|ZP_02547014.1| DNA polymerase IV (Pol IV) [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972861|ref|ZP_02555138.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167973718|ref|ZP_02555995.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975817|ref|ZP_02558094.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167987905|ref|ZP_02569576.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195867806|ref|ZP_03079806.1| ImpB/MucB/SamB family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209227|gb|EDU06270.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019187|gb|EDU57227.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998288|gb|EDU67385.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659881|gb|EDX53261.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660503|gb|EDX53760.1| ImpB/MucB/SamB family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (360 aa)
Score = 331, Expect = 6.5e-29, Identities = 103/345 (29%), Positives = 191/345 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT--QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS--FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINL-SITANNIMENDN-NEQLTIFD 349
           I H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVKSAM I  AK++CP L I+    + Y + S+  +  ++     +E  SIDE ++D +N+  +Y N   +  A+ ++N +K K NL+ +VG SF   +AKMAT L KP G   + ++   + I++L ISKI  IG   +++L  +N+  IK++    N       +G  +  L  ++ G+       D   K++  S++   + +++ E    + EL  ++ + LK  + M  +++I I+Y +  +  K    ++     Q     + +LF+++      D+++ L  ++ N ++  ++  +QL +FD
  S:     9 IMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKSAMPIFLAKELCPNLIILPCEHDIYQTYSNHFFQIVNKYCNKVEITSIDECFIDATNSIKKYHNNVRL-LAAKIQNEVKNKLNLSISVGISFNKTIAKMATELNKPFGISIIDENKITNLIHELDISKIPFIGEIKSQELYAINIFKIKELIASNNKQKASLVLGSMYQNLVNDLKGLNEIKTIEDDIYKSISHSKTFNEDLNDFYEISNELNELISNVVNRLKKHNLMTNNISINIKYPNFQTKVKQKRLDYYTDDYQTIFLAIKNLFKKVYK----DELVRLIGVSLNKLVPKESVKKQLFLFD 360
>gi|34762668|ref|ZP_00143660.1| DNA polymerase IV [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887689|gb|EAA24766.1| DNA polymerase IV [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (350 aa)
Score = 330, Expect = 7.2e-29, Identities = 102/339 (30%), Positives = 175/339 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDG-FLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEN 339
           M+  I H DMD+F+AS+E+   P+ +  P+ VG  ++ +A+Y AR  G+ SAM + DAK +CP+L +I  +K +Y  +S++I++ +  ++  +E  + DE Y+D+++      K   FA   K  IK+  NL C+VG  F    AK+A+++ KP G F+   ++ F  YI D  I  I G+G      L   N+ Y+KD+     DYL++K        L  +V GI  D +    +  ++G  ++ +       E ++    L +     L   +   +S+ IKIRY+   + TKS   + F  +    +   + E I+ F K D+V  L +   +I +N
  S:     1 MEKIIMHYDMDAFYASIEINRNPKLKNKPIVVGENIVTTASYEARKYGIHSAMKVSDAKLLCPRLIVIPVDKTEYIRISNEIHNLIFKITNKVEFVATDEGYIDLTDVIKPENKN-SFAIKFKQRIKELTNLTCSVGIGFNKLSAKIASDINKPFGFFIFENEEEFIKYISDKKIKIIPGVGKKFFEILKNDNIFYVKDVFKYSLDYLMKKYGKSRGENLYCSVRGIDYDEVEYQREIHSIGNEETFLIPLQNNSEIIREFHSLFNYTFERLIKNNVFTQSITIKIRYTSFKTYTKS-KKLKFSTRSKDFLYNKMLELINSFEKEDEVRLLGVYFGDIKKN 339
>gi|52840797|ref|YP_094596.1| DNA-damage inducible protein P [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52627908|gb|AAU26649.1| DNA-damage inducible protein P [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (355 aa)
Score = 330, Expect = 8.1e-29, Identities = 79/242 (32%), Positives = 129/242 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           KI HIDMD F+A++E+ + PE    P+AVG       VIA+ NY AR  G++SAM    A K+C +L +     + Y   S  I S L+  +  IE  S+DE YLDV+ +          A  ++  I Q   L  + G +    LAK+A++  KP+G + +  ++  +++ DL + K+ G+GP +  +L  LN+    D+     +YL+ +K G    +L     GI   P+NP+  RK++   ++
  S:     6 KIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIATCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLIEPLSLDEAYLDVTESTQCQGSATWIAEEIRARIYQARQLTASAGIAPNKSLAKIASDWHKPNGQMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLRALNIKTCADLQRYSIEYLL-QKFGTMGQRLYELARGIDNRPVNPERIRKSISVEET 251
>gi|196229012|ref|ZP_03127878.1| DNA-directed DNA polymerase [Chthoniobacter flavus Ellin428] >gi|196227293|gb|EDY21797.1| DNA-directed DNA polymerase [Chthoniobacter flavus Ellin428] (359 aa)
Score = 330, Expect = 8.3e-29, Identities = 93/296 (31%), Positives = 150/296 (50%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVS---------NTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFK-SYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           M   IFH+DMD+F+ASVE  + PEY   PL VG       V+ +A+Y AR   V+SAM    A K+CP    + P  + Y + S  I   L  ++  IE  S+DE YLD+S         +T  E    +  A  +K  I  + +L  ++G +   FLAK+ ++  KPDG LTL ++  K +++  L +  I G+GP     L       I D+     D  +   +G     L+   +G    P++   +RK++    +    ++ +  L+  +KEL  D+   L   +    +V +K+RYSD  + T+  
  S:     1 MPRVIFHVDMDAFYASVEQRDHPEYRGKPLIVGSPPTQRGVVCAASYEARKFKVRSAMPSRTAGKLCPHGIFVRPRMDVYRAESGAIMEILRGVTSVIEKVSVDEAYLDLSALFQDHTDPDTALE--AAVPVAQEIKRRIAHERSLTASIGVASNKFLAKLGSDFQKPDG-LTLIREREKVAFLKPLSVRSIHGVGPVTAEALETHGFKVIGDLQAASGD--LSGVVGSFAESLKARAMGDDERPVDTSDERKSISAENTFLEDTDDRPTLREALKELATDVAHSLAKHEMGALTVQVKVRYSDFTTLTRQL 307
>gi|148360791|ref|YP_001251998.1| DNA-damage inducible protein P [Legionella pneumophila str. Corby] >gi|148282564|gb|ABQ56652.1| DNA-damage inducible protein P [Legionella pneumophila str. Corby] (355 aa)
Score = 330, Expect = 8.3e-29, Identities = 79/242 (32%), Positives = 129/242 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           KI HIDMD F+A++E+ + PE    P+AVG       VIA+ NY AR  G++SAM    A K+C +L +     + Y   S  I S L+  +  IE  S+DE YLDV+ +          A  ++  I Q   L  + G +    LAK+A++  KP+G + +  ++  +++ DL + K+ G+GP +  +L  LN+    D+     +YL+ +K G    +L     GI   P+NP+  RK++   ++
  S:     6 KIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIATCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLIEPLSLDEAYLDVTESTQCQGSATWIAEEIRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNGQMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLGALNIKTCADLQRYSVEYLL-QKFGTMGQRLYELARGIDNRPVNPERIRKSISVEET 251
>gi|168338299|ref|ZP_02694914.1| DNA polymerase IV (Pol IV) [Ureaplasma urealyticum serovar 10] >gi|168362932|ref|ZP_02696106.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903025|gb|EDT49314.1| DNA polymerase family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (360 aa)
Score = 330, Expect = 8.6e-29, Identities = 103/345 (29%), Positives = 191/345 (55%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT--QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS--FNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINL-SITANNIMENDN-NEQLTIFD 349
           I H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVKSAM I  AK++CP L I+    + Y + S+  +  ++     +E  SIDE ++D +N+  +Y N   +  A+ ++N +K K NL+ +VG SF   +AKMAT L KP G   + ++   + I++L ISKI  IG   +++L  +N+  IK++    N       +G  +  L  ++ G+       D   K++  S++   + +++ E    + EL  ++ + LK  + M  +++I I+Y +  +  K    ++     Q     + +LF+++      D+++ L  ++ N ++  ++  +QL +FD
  S:     9 IMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKSAMPIFLAKELCPNLIILPCEHDIYQTYSNHFFQIVNKYCNKVEITSIDECFIDATNSIKKYHNNVRL-LAAKIQNEVKNKLNLSISVGISFNKTIAKMATELNKPFGISIIDENKITNLIHELDISKIPFIGEIKSQELYAINIFKIKELIASNNKQKASLVLGSMYQNLVNDLKGLNEIKTIEDDIYKSISHSKTFNEDLNDFYEISNELNELISNVVNRLKKHNLMTNNISINIKYPNFQTKVKQKRLDYYTDDYQTIFLAIKNLFKKVYK----DELVRLIGVSLNKLVPKESVKKQLFLFD 360
>gi|149277809|ref|ZP_01883949.1| putative DNA polymerase [Pedobacter sp. BAL39] >gi|149231497|gb|EDM36876.1| putative DNA polymerase [Pedobacter sp. BAL39] (365 aa)
Score = 330, Expect = 8.8e-29, Identities = 92/297 (30%), Positives = 154/297 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDD-------INSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           + KI HIDMDSF+ASVE  + P  +   +AVG        V+A+A+Y AR  GV SAM    A ++CP L  +YP    Y  +S  I       +  I+  S+DE YLDV+  +      I+ A  +K +IK + NL  + G S   F+AK+A+++ KPDG   +     + +I  L + K  G+G     ++    LH   D+  +    L+    K G  + K+   V GI   P+  + + K++G   +      + E L+L+ E+ ++       + + ++      +++ IKI++SD    T+S +F
  S:     9 QRKIIHIDMDSFYASVEQRDNPSLKGKAIAVGGSPEGRGGVVATASYEARKFGVHSAMPSKRALQLCPHLIFVYPRFAAYKEVSRHIREIFRRYTDLIQPLSLDEAYLDVTEDKLGIGSAIDIAMEIKQAIKDELNLTASAGVSINKFVAKVASDMDKPDGLTFIGPSKIERFIEQLPVEKFHGVGKVTAEKMKIRGLHKGADLKKLTEGELVHLFGKSGHFFYKI---VRGIDHRPVQANQETKSIGAEDT------FSEDLELLTEMNEELCKIAGTVCNRMEQHRLYGRTLTIKIKFSDFKQITRSRSF 311
>gi|146310425|ref|YP_001175499.1| DNA polymerase IV [Enterobacter sp. 638] >gi|189027666|sp|A4W6W8|DPO4_ENT38 DNA polymerase IV (Pol IV) >gi|145317301|gb|ABP59448.1| DNA-directed DNA polymerase [Enterobacter sp. 638] (352 aa)
Score = 330, Expect = 9.2e-29, Identities = 93/291 (31%), Positives = 158/291 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDY-LIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFL--KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP L ++    + Y   S +I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  + NL  + G +   FLAK+A++L KP+G   +T D    ++  L +SKI G+G     +L  L L   +D+   K+D  ++ K+ G     L     GI    IN +  RK++G  ++    I ++S+ +  +  +L  EL   + + +K  D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDVPIAIGGSRVKRGVISTANYPARKFGVRSAMPTAMALKLCPHLILLPGRFDAYKEASVRIQEIFSRYTSLIEPLSLDEAYLDVTDSLHCHGSATLMAQEIRQTISDELNLTASAGIAPVKFLAKIASDLNKPNGQYVITPDEVPHFLKTLPLSKIPGVGKVSAAKLENLGLRTCEDVQ--KSDLAMLLKRFGKFGRVLWERSQGIDERSINNERLRKSVGVERTLADDIHDWSDCETIITEQLYPELERRL-AKVK-PDLLIARQGVKLKFNDFQQTTQ 301
>gi|125717216|ref|YP_001034349.1| DNA polymerase IV [Streptococcus sanguinis SK36] >gi|189044616|sp|A3CKU4|DPO4_STRSV DNA polymerase IV (Pol IV) >gi|125497133|gb|ABN43799.1| DNA-damage-inducible protein P, putative [Streptococcus sanguinis SK36] (354 aa)
Score = 329, Expect = 9.5e-29, Identities = 95/330 (28%), Positives = 168/330 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT--KSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITA 333
           KI HIDMD+FFASVE  + P+ +  P+ +G          V+++ NY AR  GV SAM+  +A + CPQ   I  N  KY ++  +I       +  IE  SIDE YLDV+  +      ++ A L+++ I  +  L  + G S+  FLAK+A++  KP G   +  +  +  +  + I+K  G+G     +L E+ ++   D+  +    LI  K G     L     GI   P+  +  RK++G+ ++     YSE ++  K +  L   + + L   D   +++ +KIRY+D  + T  KS N      +       ++++ + +  +  +++ L++T 
  S:    13 KIIHIDMDAFFASVEERDNPKLKGHPVIIGSDPRLTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQGIFISGNYEKYQAVGLQIREIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIAKLIQHDIWNELQLTASAGVSYNKFLAKIASDYEKPHGLTVILPEEAEVSLAPMDIAKFHGVGKKSVEKLHEMGVYTGADLLKIPEMTLI-DKFGRFGFDLYRKARGISNSPVKSNRIRKSIGKERTYAKLLYSE-EDIKKELTLLAQKVENSLTKHDKKGRTIVLKIRYADFSTLTKRKSLNLATQDKEQIERTAHEIYDSLEEQPRGIRLLGLTVTG 352
>gi|116333836|ref|YP_795363.1| nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus brevis ATCC 367] >gi|116099183|gb|ABJ64332.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus brevis ATCC 367] (371 aa)
Score = 329, Expect = 9.5e-29, Identities = 100/349 (28%), Positives = 185/349 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHW-SKLRMNVLGIICDPINPDY---------KRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF---NFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNI-MENDNNEQLTIFDS 350
           + KI H+DMD+F+AS+E  + P +++ PL +        G  V+A+ANY AR LGV SAMN  +A K+ PQ     PN   Y  +SD+I+      +  IE  + DE YLDV+  ++     ++ A  ++  I +K +L C+ G S++ FLAK A++  KP G   +  ++   ++  L I +  G+G     ++ EL   Y++              IG  W S + +  L + C   + +          +RK++G+ ++    +    E +  L+ + E+   + + ++ +    K++ +K+R S   + TK +   +F+    Q    + +DL++ ++   + +QV  L IT   +  +   N +L +FDS
  S:     8 QRKIIHVDMDAFYASIEERDHPAFKQHPLIIAQDPRKTGGRGVVATANYAARQLGVHSAMNANEALKLAPQAIFQPPNFPLYRQISDQIHEIFHEYTDKIEPVAFDEAYLDVTENKHHLHSAVQVAHEIQVEIFEKTHLTCSTGISYSKFLAKEASDFRKPVGVSVILPEDAHDFLMALPIERFRGVGKKTVPKMHELGNSYLEPTC----------IIGQSWPSFMSLVNLAMFCISGSEELTSGRLPYQRERKSIGKERTYGPPLTTLGEVENQLQRLAEM---VAATVQEKQRHGKTLVLKLRTSAFKTLTKRYTQADFIANDAQTYYDLALDLYQSVA--GENEQVRLLGITITGLAAQTFENVRLPLFDS 367
>gi|189218631|ref|YP_001939272.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Methylokorus infernorum V4] >gi|189185489|gb|ACD82674.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Methylacidiphilum infernorum V4] (365 aa)
Score = 329, Expect = 9.9e-29, Identities = 92/293 (31%), Positives = 156/293 (53%)
  Q:     6 FHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDV-SNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRS----QSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           F +D+D+F+ SVE    PEY ++P+AV      G  VI +A+Y AR  GVKS M I  A   CP + ++  + + Y   S+ +YS L   S+ IE  SIDE  L V S+   E       A+ ++ +I  K  L  ++G      +AKMA +LAKP G   +     K+++  L + KI G+GP+  +    + +  I D++ V ++  +R+K G   +       GI   P+  +   ++L R     + I+N+S  Q   +++  L+ D+   L+ +  + K+V +K+RYSD  +  + F+ 
  S:    28 FFVDLDAFYVSVERLRHPEYREMPMAVYTGSLNGRGVIMTASYEARKYGVKSGMPIRQALYHCPGIMLVAAHPSLYEEYSNSVYSLLKRFSERIERVSIDENCLVVPSSIDPET-----TATAIQAAIGAKIGLPSSIGVGSNKLIAKMACDLAKPQGIRVIPPGYEKAFLAPLPVEKIPGVGPATLKIFHAMGIVTIDDLSKV-DEQTLREKFGKRGAYFYNAAQGIDKSPLQLERTPRSLSREITFDRDIKNFSILQ---RVLVSLSRDLADSLRKEKLVAKTVFLKLRYSDFSTNLRQFSL 322
>gi|54293545|ref|YP_125960.1| hypothetical protein lpl0597 [Legionella pneumophila str. Lens] >gi|53753377|emb|CAH14830.1| hypothetical protein [Legionella pneumophila str. Lens] (355 aa)
Score = 329, Expect = 1.0e-28, Identities = 79/242 (32%), Positives = 129/242 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           KI HIDMD F+A++E+ + PE    P+AVG       VIA+ NY AR  G++SAM    A K+C +L +     + Y   S  I S L+  +  IE  S+DE YLDV+ +          A  ++  I Q   L  + G +    LAK+A++  KP+G + +  ++  +++ DL + K+ G+GP +  +L  LN+    D+     +YL+ +K G    +L     GI   P+NP+  RK++   ++
  S:     6 KIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKHRGVIATCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLIEPLSLDEAYLDVTESTQCQGSATWIAEEIRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNGQMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLGALNIKTCADLQRYSIEYLL-QKFGTMGQRLYELARGIDNRPVNPERIRKSISVEET 251
>gi|89092521|ref|ZP_01165474.1| DNA polymerase IV [Oceanospirillum sp. MED92] >gi|89083033|gb|EAR62252.1| DNA polymerase IV [Oceanospirillum sp. MED92] (355 aa)
Score = 329, Expect = 1.0e-28, Identities = 76/240 (31%), Positives = 127/240 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           M+ KI H D D FFA+VE+ + P    +P+AVG       VI++ NY+AR  GV+SAM    A K+CPQL ++  N  KY  +S ++ +     +  IE  S+DE +LDV++++  +      A  ++  ++ +  +  + G +   FLAK+A++  KPDG   +T D  + ++  L ++KI G+G     +L    +   KDI       LI ++ G    +L     GI   P+     RK++
  S:     4 MERKIIHCDCDCFFAAVEMRDDPSLASIPIAVGGRSDRRGVISTCNYLAREYGVRSAMATAQAIKLCPQLKVLSGNMQKYKDVSAQVMAIFKEYTDLIEPLSLDEAFLDVTHSECCSGSATLIAQEIRQRVRDEVGITVSAGVAPNKFLAKIASDWNKPDGIWVITPDQVEEFVLQLGVNKISGVGDKTAEKLKSFGIETCKDIREKSRIELI-ERFGKFGQRLYELSWGIDQRPVRSSRVRKSI 247
>gi|20092821|ref|NP_618896.1| DNA-damage-inducible protein P [Methanosarcina acetivorans C2A] >gi|22095612|sp|Q8TIW3|DPO4_METAC DNA polymerase IV (Pol IV) >gi|19918122|gb|AAM07376.1| DNA-damage-inducible protein P [Methanosarcina acetivorans C2A] (366 aa)
Score = 329, Expect = 1.1e-28, Identities = 90/295 (30%), Positives = 159/295 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLV--------IASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETG------SIDEWYLDVSNTQYENWK-EIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEF-LKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M+  I H+DMD F+A++E  E+PE     + V  L         +++ NY+AR  G++S M    AKK+ P+   +   K  YTS+SD+I   L S +   E G      S+DE +L+++     ++    E    +K  IK+K NL C++G      +AKMA++  KPDG   ++ +N +++++ L +SK+ GIG    ++L E+++  +KD+A      LI        + L+    GI   P+      + +GR  ++   +  QE  L L+++L  D+   L  ++  F+ V + +  S+  + TKS
  S:     2 MQRVIIHVDMDYFYAAIEEREKPELLGKAVVVCMLSGRSELSGSVSTCNYIAREFGIRSGMPCSRAKKLNPEAVFLPVRKEFYTSVSDRIMEILRSYADPGENGDSFEQISVDEAFLEITYRAGGDFNLAFELGMQIKKEIKEKENLTCSIGIGPNKLIAKMASSAKKPDGITVVSPENQEAFLWPLKVSKLWGIGDVTAKKLQEMDIVTVKDLAEHDVIELISTFGKSRGTWLKQAASGIDDSPLKEREGSEQIGRIATLPEDTLDQELILSLLEKLAGDVIEKLDSRELSFRVVTVTVINSNFRTYTKS 312
>gi|168808518|ref|ZP_02829577.1| DNA polymerase IV (Pol IV) [Ureaplasma urealyticum serovar 2] (360 aa)
Score = 329, Expect = 1.1e-28, Identities = 93/290 (32%), Positives = 163/290 (56%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT--QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           I H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVKSAM I  AK++CP L I+    + Y + S+  +  ++     +E  SIDE ++D +N+  +Y N   +  A+ ++N +K K NL+ +VG SF   +AKMAT L KP G   + ++   + I++L ISKI  IG   +++L  +N+  IK++    N       +G  +  L  ++ G+       D   K++  S++   + +++ E    + EL  ++ + LK  + M  +++I I+Y +  +  K
  S:     9 IMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKSAMPIFLAKELCPNLIILPCEHDIYQTYSNHFFQIVNKYCNKVEITSIDECFIDATNSIKKYHNNVRL-LAAKIQNEVKNKLNLSISVGISFNKTIAKMATELNKPFGISIIDENKITNLIHELDISKIPFIGEIKSQELYAINIFKIKELIASNNKQKASLVLGSMYQNLVNDLKGLNEIKTIEDDIYKSISHSKTFNEDLNDFYEISNELNELISNVVNRLKKHNLMTNNISINIKYPNFQTKVK 305
>gi|90579859|ref|ZP_01235667.1| DNA polymerase IV [Vibrio angustum S14] >gi|90438744|gb|EAS63927.1| DNA polymerase IV [Vibrio angustum S14] (362 aa)
Score = 328, Expect = 1.2e-28, Identities = 80/293 (27%), Positives = 159/293 (54%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV----GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSAT 293
           ++ KI H+DMD F+A+VE+ + P    +P+A+       V+++ NY+AR  G+ SAM    A K+CP LT++      Y  +S +I +     +  IE  S+DE YLDVS+ +  +      A  ++ +I+ +  L  + G +   F+AK+A++L KP+G   +T ++  +++ +L + KI G+G    ++L E  L+  +D+ N  + +L+ ++ G     L     GI    +  + +RK++G  ++  +N S + +  +++ +L  ++   L+    +       IK++++D    T
  S:    12 VQRKIIHVDMDCFYAAVEMRDAPALRDVPIAISGRSARGVVSTCNYLARKYGIHSAMPTAHALKLCPHLTLVPSRMQVYRDVSLQIRAIFERYTDKIEPLSLDEAYLDVSDCEMLHGSATLIAQDIRRAIESELQLTASAGVAPVKFIAKVASDLNKPNGQYVVTPEDVDNFVAELKLEKIPGVGKVTIQKLHEKGLYVGRDVQNY-DRHLLLQQFGKFGQSLWSRAHGIDEREVIVERQRKSVGVERTFSQNISTFDQCWQVVDQLYPELEQRLRKVRPELDIAKQGIKLKFADFQQTT 310
>gi|54296583|ref|YP_122952.1| hypothetical protein lpp0614 [Legionella pneumophila str. Paris] >gi|53750368|emb|CAH11762.1| hypothetical protein [Legionella pneumophila str. Paris] (355 aa)
Score = 328, Expect = 1.2e-28, Identities = 78/242 (32%), Positives = 129/242 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           KI HIDMD F+A++E+ + PE    P+AVG       VIA+ NY AR  G++SAM    A K+C +L +     + Y   S  I S L+  +  +E  S+DE YLDV+ +          A  ++  I Q   L  + G +    LAK+A++  KP+G + +  ++  +++ DL + K+ G+GP +  +L  LN+    D+     +YL+ +K G    +L     GI   P+NP+  RK++   ++
  S:     6 KIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIATCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLVEPLSLDEAYLDVTESTQCQGSATWIAEEIRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNGQMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLGALNIKTCADLQRYSVEYLL-QKFGTMGQRLYELARGIDNRPVNPERIRKSISVEET 251
>gi|71281288|ref|YP_267789.1| DNA polymerase IV [Colwellia psychrerythraea 34H] >gi|71147028|gb|AAZ27501.1| DNA polymerase IV [Colwellia psychrerythraea 34H] (352 aa)
Score = 328, Expect = 1.3e-28, Identities = 84/258 (32%), Positives = 138/258 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVK--NDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLI 259
           + KI HIDMD F+A++E+ + PEY+ +PLAVG      V+ ++NY AR  GV+SAM  + AK++CP L I++   + Y   S  I    S  +  IE  S+DE YLDV++           A  ++  I  + NL  + G +   FLAK+A++  KP+G   +T D   +++  L + KI GIGP   +   +LN H     A+V+  N   ++  +G   + L +   G+    +    +RK+L    ++ +    Q+  KL+
  S:     4 QKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGP---KTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLV 264
>gi|29653632|ref|NP_819324.1| DNA-damage-inducible protein P [Coxiella burnetii RSA 493] >gi|161831206|ref|YP_001596230.1| ImpB/MucB/SamB family protein [Coxiella burnetii RSA 331] >gi|164686019|ref|ZP_01946909.2| ImpB/MucB/SamB family protein [Coxiella burnetii 'MSU Goat Q177'] >gi|165919789|ref|ZP_02219532.1| ImpB/MucB/SamB family protein [Coxiella burnetii RSA 334] >gi|29540894|gb|AAO89838.1| DNA-damage-inducible protein P [Coxiella burnetii RSA 493] >gi|161763073|gb|ABX78715.1| ImpB/MucB/SamB family protein [Coxiella burnetii RSA 331] >gi|164601562|gb|EAX32467.2| ImpB/MucB/SamB family protein [Coxiella burnetii 'MSU Goat Q177'] >gi|165916872|gb|EDR35476.1| ImpB/MucB/SamB family protein [Coxiella burnetii RSA 334] (357 aa)
Score = 328, Expect = 1.4e-28, Identities = 93/313 (29%), Positives = 162/313 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQ-EFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD-----GDSATKSFNFVNFQNQIPLHVVVDLFEQ 316
           KI H+DMD F+ ++E+ + P+  + P+AVG       VI +ANY+ARG GV+SA++   AKK+CP L I+  N  KY ++  +I       +  +E  S+DE YLDVS+ +         A  ++  I ++ +L  + G +    LAK+A+   KP+G   +       ++  L I KI G+G    +++  +N+H   D+  +  + L  K  G     L     GI    + P+  RK++      SQ I   SE + E   L  +L   +   LK+ D   +   +KI+++D      ++ T++ +   F+     H++  +FE+
  S:    11 KIIHVDMDCFYVAIEMRDNPKLREKPVAVGGAAHSRGVICTANYIARGYGVQSAISSSYAKKLCPSLIILPVNMEKYRAIGHQIRGLFQEYTHLVEPLSLDEAYLDVSDCKIHQGSATRIAQEIREQIVKRHSLTASAGVASNKLLAKVASAWNKPNGIKVILPSKADDFVKTLPIEKIHGVGKITAQKMKAMNIHTCSDLQALSREAL-SKSFGSFGVTLYELCRGIDPRSVEPNRIRKSVSVEHTFSQDIATLSECEIELANLFNDLKQRL---LKHTDRCIRKQFVKIKFNDFKITKAETITQTISLDLFK-----HLLYQIFER 329
>gi|109896789|ref|YP_660044.1| DNA-directed DNA polymerase [Pseudoalteromonas atlantica T6c] >gi|123065074|sp|Q15YP8|DPO4_PSEA6 DNA polymerase IV (Pol IV) >gi|109699070|gb|ABG38990.1| DNA-directed DNA polymerase [Pseudoalteromonas atlantica T6c] (356 aa)
Score = 328, Expect = 1.4e-28, Identities = 85/290 (29%), Positives = 160/290 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQD--FMFKSVNIKIRYSDGDSAT 293
           KI HIDMD ++A+VE+ + P+Y  +PLA+G       VI++ NYVAR  GV+SAM    A+K+CP L ++      Y+ +S +I       +  IE  S+DE YLDV++++  +      A  ++ +I ++  L  + G +   F+AK+A++  KP+G   +T D   +++  L + KI G+G    ++L  + L   +D+ +   D  ++   K G + W +      GI    ++   KRK++G  +++ ++ +  +E L +++ L   + S L+        +S  +K++++D    T
  S:     3 KIIHIDMDCYYAAVEMRDNPQYRDIPLAIGGSADRRGVISTCNYVARKYGVRSAMATAYARKLCPDLVLVPGRMALYSEISQQIRKIFLRYTDKIEPLSLDEAYLDVTDSELFSGSATLIAQDIRRAIFEETQLTASAGVAPCKFVAKIASDENKPNGICVITPDTQDAFVKTLALGKIPGVGKVTLQKLNNMGLFTCQDVRDYPLDAFVKAFGKFGPVIWDRSH----GIDERELSVSRKRKSVGVERTLAQDITTDEECLAMLESLYPKLLSRLEAASPKLAIQSQGVKLKFNDFQQTT 299
>gi|77412153|ref|ZP_00788476.1| DNA-damage-inducible protein P [Streptococcus agalactiae CJB111] >gi|77161813|gb|EAO72801.1| DNA-damage-inducible protein P [Streptococcus agalactiae CJB111] (364 aa)
Score = 328, Expect = 1.4e-28, Identities = 94/316 (29%), Positives = 159/316 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISD 319
           KI HIDMD+FFASVE  + P  +  P+ +G          V+++ NY AR  GV SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A +++  I    +L C+ G S+  FLAK+A++  KP G   +  D  + ++  L I K  G+G     +L  L ++  +D+ ++    LI    G     L     GI   P+ PD  RK++G  ++     Y+E     ++ K +   + S L+    + K++ +K+RY+D ++ TK      +    QI   V   +F+ + +
  S:    13 KIIHIDMDAFFASVEERDNPSLKGKPVIIGSDPRKTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQAIFISGNYQKYRQVGMEVRDIFKKYTDLVEPMSIDEAYLDVTENKMGIKSAVKLAKMIQYDIWNDVHLTCSAGISYNKFLAKLASDFEKPKGLTLILPDQAQDFLKPLPIEKFHGVGKRSVEKLHALGIYTGEDLLSLSEISLI-DMFGRFGYDLYRKARGINASPVKPDRVRKSIGSEKTYGKLLYNEADIKAEISKNVQRVVAS-LEKNKKVGKTIVLKVRYADFETLTKRMTLEEYTQDFQIIDQVAKAIFDTLEE 338
>gi|67525831|ref|XP_660977.1| hypothetical protein AN3373.2 [Aspergillus nidulans FGSC A4] >gi|40744161|gb|EAA63341.1| hypothetical protein AN3373.2 [Aspergillus nidulans FGSC A4] (609 aa)
Score = 328, Expect = 1.4e-28, Identities = 89/292 (30%), Positives = 158/292 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI---EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTL--TKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINP--DYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           + H+D D+FFA+VE  +RPE + +P+AVG  V+ + NY AR  G +S M    AKK+CPQL  +  N  KYT+ + +I + L+      E+ SIDE YL++  T Y   K++   E  S ++  I +K  ++ + G +    +AK+ +N  KP+G   +   K+    ++ DL + KI G+G    R+L  + +    DI   +  YL +   +  LH+  L    LG+    I P   Y+RK++G  ++    S+ +EF + +     ++   L    FM +++ +K++ +  +  T+ +
  S:   112 VVHVDCDAFFAAVEELDRPELKTVPMAVGKGVLTTCNYEARKFGCRSGMASFVAKKLCPQLICLPQNYEKYTAKAQEIRAILAQYDPQFESASIDEAYLNI--TAYCREKQLDPDEAVSRMRAEILEKTKISVSAGIAANAKIAKICSNRNKPNGQFRVPNEKNAIMEFMRDLPMRKINGVGRVFERELDSIGIKTCGDIFP-QRAYLAKLFGEKALHF--LAQCYLGVGRTKIQPAESYERKSVGTERTFHEISKREEFREKLWSCAQELEKDLSRTQFMGRTLVLKVKLATFEVLTRQY 407
>gi|160893602|ref|ZP_02074386.1| hypothetical protein CLOL250_01156 [Clostridium sp. L2-50] >gi|156864587|gb|EDO58018.1| hypothetical protein CLOL250_01156 [Clostridium sp. L2-50] (426 aa)
Score = 328, Expect = 1.5e-28, Identities = 107/382 (28%), Positives = 204/382 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKN---KYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ--YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDY---LIRKKIGLHWSKLRMNVLGIICDPI-NPDY--KRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVV---------DLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSS 382
           M   I H DM+ F+ASVE+   PE +   +AV       H ++ + +  A+  G+K+ M   +AK++CP L ++ P      KY++M+ +IY   + L   +E   +DE +LDV+ +Q  Y + KEI  A  ++  +K +  L  ++G SF    AK+ +++ KPD   ++ +  +K  ++ L +S+++  G S T++L ++ ++ I D+A + +DY   L+ K   + WS       G+   P+   D+    K++G   +   +    +E  K+I EL  DI   L+      + V I IR       ++      +Q Q+ L  +V         +LF++  D+   + V ++++ A N++     EQ+ +F  P  ++  E KL    +++ +   K+ I YP++
  S:    15 MNRTILHSDMNCFYASVEMMLNPELQGKAVAVCGSTENRHGIVLAKSEKAKQAGIKTGMVNWEAKRLCPDLILVPPQYEQYLKYSNMAREIYQEYTDL---VEPYGMDECFLDVTASQVLYGSGKEI--ADQIRCRMKNELGLTVSIGISFNKIFAKLGSDMKKPDAITSIEESEWKQKVWPLRVSELLFCGRSTTKKLEQVGIYTIGDLAEMDHDYVNQLLGKNGLMLWSYAN----GLDDSPVMEKDFVSPMKSVGHGITCTADLKTEEEVWKVILELCQDIGHRLRIHGLKAQGVQIAIR-------SQELFIRQYQGQLSLPTIVPLEIAKLARELFQRNYDWK--EPVRSVTVRAINLVSAKEPEQICLFSDPI-RLEKEEKLFLAIEEIRRRFGKRAI-YPAA 403
>gi|42521969|ref|NP_967349.1| DNA polymerase IV [Bdellovibrio bacteriovorus HD100] >gi|39574499|emb|CAE78003.1| DNA polymerase IV [Bdellovibrio bacteriovorus HD100] (356 aa)
Score = 327, Expect = 1.6e-28, Identities = 91/290 (31%), Positives = 154/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVL-----GIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGL---KYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD F+A+VE+  RPE +  PL +G       V+ +A+Y AR  GV+SAM    A ++CPQL +I P+ + Y + S K+   +   +  IE  S+DE YLDV++ +         A  ++  I  + NL  + G +   FLAK+A++  KP+G   +   + ++++ DL + KI G+G    +++ +L L    DI      Y + +    HW   R   L     GI    +  +++RK+L   ++  ++    Q+ LK +  L +D    +   +Y D   K + IK+++ D    T
  S:     3 KIIHIDMDCFYAAVEVKYRPELKGKPLGIGGPPNTRSVLCTASYEARKFGVRSAMPSSQAVRLCPQLVLIPPHFDLYKAESRKVREIMERFTNKIEPLSLDEAYLDVTDCEQFGGSATLIAQEIRRLIFTELNLTASAGVAPNKFLAKIASDWKKPNGQFVVRPQDVETFVKDLPVEKIFGVGKVTAQKMHDLGLRTCGDI----QKYTVLELS--HWFGSRAAELYDFSRGIDHREVITEWERKSLTVEETYNKDLPTLQDCLKTLPSLYEDFVRRMDRGQYHD-RIKGLVIKLKFFDFKQTT 299
>gi|88705924|ref|ZP_01103633.1| DNA polymerase IV [gamma proteobacterium KT 71] >gi|88699995|gb|EAQ97105.1| DNA polymerase IV [Congregibacter litoralis KT71] (410 aa)
Score = 327, Expect = 1.6e-28, Identities = 84/292 (28%), Positives = 147/292 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI H+DMD+F+ASVE  + P     PLAVG      V+A+A+Y AR  GVKSAM  V A++ CPQL  + P    Y ++S +++   +  +  IE  S+DE YLDV+            A  ++  I+++  L  + G S+  F+AK+A++  KPDG   +  +   +++  L   +  G+GP    ++  L +    DI      +L  +  G     L     G     +  D +RK++G  ++  +     E L+  ++ + D +   +   +   ++V IK++Y+D    T++
  S:    48 KIIHVDMDAFYASVEQRDDPALRGKPLAVGGSAKRGVVAAASYEARKFGVKSAMPGVTARRRCPQLLFVKPRFEVYRAVSQQLHGIFARYTHIIEPLSLDEAYLDVTADLAGLGSATAIAEAIRGDIRRELRLTASAGVSYNKFIAKVASDQNKPDGVFVVRPEEGAAFVATLPARRFFGVGPKTAERMSSLGIQTGADIRAQTLGFL-EQHFGKSAHYLYRASRGEDYRAVKADRERKSIGGERTYSDDLSTDEALRDALEHIIDIVWERIHRNNARGRTVTIKVKYADFQQITRA 343
>gi|83647018|ref|YP_435453.1| DNA polymerase IV [Hahella chejuensis KCTC 2396] >gi|83635061|gb|ABC31028.1| DNA polymerase IV [Hahella chejuensis KCTC 2396] (356 aa)
Score = 327, Expect = 1.6e-28, Identities = 81/237 (34%), Positives = 122/237 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           KI HID DSF+ASVE+ + P    LP+AVG       VIA+ NY AR  GV+SAM+   A  +CP L  + P    Y S+S  I++     +  IE  S+DE YLDVS  +         A  ++  ++Q   L  + G +   FLAK+A++  KPDG   +   + K +I  L + KI G+G     ++  L +    D+  +  D L R   G +  +L     G+   P+  ++ RK+L
  S:     3 KIIHIDADSFYASVEIRDNPSLRHLPVAVGGSPDKRGVIATCNYNARAFGVRSAMSSAKAVLLCPDLVFVRPRFEVYRSVSKDIHTIFRDYTDLIEPLSLDEAYLDVSECKACKGSATLIAEEIRARVRQDLRLTVSAGVAPNKFLAKIASDWNKPDGIFVIRPQDVKDFIPQLPVRKINGVGKVTAAKMEALGITTCGDLQRLSKDDLER-HFGSYGERLYNLSRGVDNRPVQTEWVRKSL 243
>gi|22537865|ref|NP_688716.1| DNA polymerase IV [Streptococcus agalactiae 2603V/R] >gi|25011810|ref|NP_736205.1| DNA polymerase IV [Streptococcus agalactiae NEM316] >gi|76787674|ref|YP_330334.1| DNA polymerase IV [Streptococcus agalactiae A909] >gi|76798415|ref|ZP_00780656.1| DNA polymerase IV (Pol IV) [Streptococcus agalactiae 18RS21] >gi|77405963|ref|ZP_00783042.1| DNA-damage-inducible protein P [Streptococcus agalactiae H36B] >gi|77413674|ref|ZP_00789858.1| DNA-damage-inducible protein P [Streptococcus agalactiae 515] >gi|81588478|sp|Q8DXW9|DPO4_STRA5 DNA polymerase IV (Pol IV) >gi|81588721|sp|Q8E3I8|DPO4_STRA3 DNA polymerase IV (Pol IV) >gi|123601318|sp|Q3JZG9|DPO4_STRA1 DNA polymerase IV (Pol IV) >gi|22534761|gb|AAN00589.1|AE014270_7 DNA-damage-inducible protein P [Streptococcus agalactiae 2603V/R] >gi|24413351|emb|CAD47430.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562731|gb|ABA45315.1| DNA polymerase IV [Streptococcus agalactiae A909] >gi|76586247|gb|EAO62764.1| DNA polymerase IV (Pol IV) [Streptococcus agalactiae 18RS21] >gi|77160274|gb|EAO71401.1| DNA-damage-inducible protein P [Streptococcus agalactiae 515] >gi|77175415|gb|EAO78205.1| DNA-damage-inducible protein P [Streptococcus agalactiae H36B] (364 aa)
Score = 327, Expect = 1.7e-28, Identities = 97/338 (28%), Positives = 171/338 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDN 341
           KI HIDMD+FFASVE  + P  +  P+ +G          V+++ NY AR  GV SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A +++  I    +L C+ G S+  FLAK+A++  KP G   +  D  + ++  L I K  G+G     +L  L ++  +D+ ++    LI    G     L     GI   P+ PD  RK++G  ++     Y+E     ++ K +   + S L+    + K++ +K+RY+D ++ TK      +    QI   V   +F+ + +     +++ +++T    +EN++
  S:    13 KIIHIDMDAFFASVEERDNPSLKGKPVIIGSDPRKTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQAIFISGNYQKYRQVGMEVRDIFKKYTDLVEPMSIDEAYLDVTENKMGIKSAVKLAKMIQYDIWNDVHLTCSAGISYNKFLAKLASDFEKPKGLTLILPDQAQDFLKPLPIEKFHGVGKRSVEKLHALGVYTGEDLLSLSEISLI-DMFGRFGYDLYRKARGINASPVKPDRVRKSIGSEKTYGKLLYNEADIKAEISKNVQRVVAS-LEKNKKVGKTIVLKVRYADFETLTKRMTLEEYTQDFQIIDQVAKAIFDTLEESVFGIRLLGVTVTT---LENEH 357
>gi|95931101|ref|ZP_01313827.1| DNA-directed DNA polymerase [Desulfuromonas acetoxidans DSM 684] >gi|95132846|gb|EAT14519.1| DNA-directed DNA polymerase [Desulfuromonas acetoxidans DSM 684] (380 aa)
Score = 327, Expect = 1.8e-28, Identities = 89/295 (30%), Positives = 147/295 (49%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           + KI HIDMD+F+ASVE  + PE    P+ VG       V+A+ +Y AR  G+ SAM    A ++CPQ   + P    Y  +S +I +     +  IE  S+DE +LD++ +  +       A  +   I ++  L  + G S+  FLAK+A++  KP G   +T D    +I  L I +  G+G    ++++ L +    D+       LIR   K G  + ++     GI   P+    +RK++G     S+ IRN     + L ++  L + I   L +      ++ +KI++SD    T SF
  S:     4 QRKIIHIDMDAFYASVEQRDHPELRGKPVIVGGPPDSRGVVATCSYEARKFGIHSAMASSRAYRLCPQALFVRPRMEVYRQVSSQIRAIFEHYTDLIEPLSLDEAFLDLTMSDRQPNSATWIAREILERIHRETELTASAGVSYNKFLAKVASDCHKPAGLTVITPDQASDFIAQLPIRRFFGVGKVTEKKMLRLGITCGADLLKYPETELIRLFGKQGRFFYRI---ARGIDERPVVAHRQRKSIGNETTLSEDIRNRD---QMLTILSALAEKIEGRLAHYQTSAYTITLKIKFSDFQQVTLSF 303
>gi|42561082|ref|NP_975533.1| DNA polymerase IV [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492579|emb|CAE77175.1| DNA polymerase IV [Mycoplasma mycoides subsp. mycoides SC str. PG1] (402 aa)
Score = 327, Expect = 1.9e-28, Identities = 125/373 (33%), Positives = 199/373 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFL-SSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKN--DYLIRKKIGLHWSKLRMNVLGIICDPIN---PDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYS-DGDSATKSFNFVNFQNQIPLHVVVDLFEQISD------FSKYDQVINLSI----TANNIMENDNNEQLTIFDSP---TQKISTESKLEKIRKQVNKTLNKKII 377
           I HIDMD+FFAS    + PE +  P+ + +     +I++A+Y AR   +K+AM +  AKK+ PQ+  + P+     ++S +I+ F+ ++ +  IE  SIDE YLDVS+   +N   +  A  ++  I  +FNL C++G  F  F AKM+T+L KP+G    T  NFK  I+ + I+K+ G G S  + L    +  IKD+A + +   Y +  K GL    L+   LG+  D IN    DYK  +   + +   Y +Y E   +I  L+  I+  L     + K++ IKIRY  D     K  +  +   QI L    + FE+I +      +S YDQ   + +     +  I +N N  QL I +       +I    K+E +   +NK   K +I
  S:     6 IIHIDMDAFFASCMQLKHPELKNKPIVISNSFDKSIISTASYEARKYNIKAAMPLFKAKKLYPQIISVKPDMIFINNISYQIWDFIKNNYTNKIEVASIDEAYLDVSDL-VKNTSVLILAKNIQKDIYDQFNLTCSIGIGFNRFSAKMSTSLDKPNGITLTTTSNFKDNIWPISINKMYGFGQSAAKLLNNTKIKTIKDLALLSDVEVYQLLNKKGL---ALKNEALGLGSDYINYLSNDYKSISKETTLNTPIY-QYDEIETIILNLSKFISYKLHKNQLLCKTIEIKIRYKIDEKLFDKQKHLTSRHKQITLKNYTNDFEKIYNSALDCFYSLYDQNKGILLIGVGVSKLIHKNQNWVQLDIENQTKVDKNQIDNALKIENMIFDINKKFKKPVI 397
>gi|23466117|ref|NP_696720.1| DNA-damage-inducible protein P [Bifidobacterium longum NCC2705] >gi|23326851|gb|AAN25356.1| DNA-damage-inducible protein P [Bifidobacterium longum NCC2705] (448 aa)
Score = 327, Expect = 1.9e-28, Identities = 78/292 (26%), Positives = 155/292 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKI-YSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSK-LRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           + HIDMD+F+AS+E+A  P  +  P+ +G     V+++A+Y AR  G+ SAM    A ++CP    +  +   Y  MS +I +    +++   E  S+DE Y+DVS    E  +     + ++  + ++F++ C+VG +    ++KMA+  AKPDG L +       ++  + +  I GIGPSL ++L    +H + ++A +    L R       ++ L     G+    I    + K++G  +++  +  + +    L++   D++ S L+ +  + +++ +K+R++D    T+SF
  S:    47 VLHIDMDAFYASLEVARNPGLKGKPVIIGTGPRAVVSAASYEARKYGINSAMPAARAHRLCPNGIFLPVDMAYYRMMSHRIMHEVFLTVTDRFEQVSVDEGYMDVSAALLEWGRPSAIGAWIRAQVAERFHVTCSVGIACNKLVSKMASTNAKPDGMLLIPAARSAEFVQMMPLRGIPGIGPSLEKRLNAWGVHSVAELAQLDEAALTRATGSPAAARGLWAASHGLDSREITTVREEKSIGSEETLAEDTRDMRVVCGLLRSACDEVTSTLRRKGLVARTLTVKLRFADLSYQTRSF 344
>gi|46190130|ref|ZP_00121858.2| COG0389: Nucleotidyltransferase/DNA polymerase involved in DNA repair [Bifidobacterium longum DJO10A] >gi|189440548|ref|YP_001955629.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Bifidobacterium longum DJO10A] >gi|189428983|gb|ACD99131.1| Nucleotidyltransferase/DNA polymerase for DNA repair [Bifidobacterium longum DJO10A] (424 aa)
Score = 327, Expect = 1.9e-28, Identities = 78/292 (26%), Positives = 155/292 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKI-YSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSK-LRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           + HIDMD+F+AS+E+A  P  +  P+ +G     V+++A+Y AR  G+ SAM    A ++CP    +  +   Y  MS +I +    +++   E  S+DE Y+DVS    E  +     + ++  + ++F++ C+VG +    ++KMA+  AKPDG L +       ++  + +  I GIGPSL ++L    +H + ++A +    L R       ++ L     G+    I    + K++G  +++  +  + +    L++   D++ S L+ +  + +++ +K+R++D    T+SF
  S:    23 VLHIDMDAFYASLEVARNPGLKGKPVIIGTGPRAVVSAASYEARKYGINSAMPAARAHRLCPNGIFLPVDMAYYRMMSHRIMHEVFLTVTDRFEQVSVDEGYMDVSAALLEWGRPSAIGAWIRAQVAERFHVTCSVGIACNKLVSKMASTNAKPDGMLLIPAARSAEFVQMMPLRGIPGIGPSLEKRLNAWGVHSVAELAQLDEAALTRATGSPAAARGLWAASHGLDSREITTVREEKSIGSEETLAEDTRDMRVVCGLLRSACDEVTSTLRRKGLVARTLTVKLRFADLSYQTRSF 320
>gi|195977472|ref|YP_002122716.1| DNA polymerase IV DinB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974177|gb|ACG61703.1| DNA polymerase IV DinB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (367 aa)
Score = 326, Expect = 2.2e-28, Identities = 95/330 (28%), Positives = 166/330 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSITA 333
           KI HIDMD+FFA+VE  + PE +  P+ +G          V+++ NY AR  G+ SAM+  +A + CPQ   I  +  KY  +   I       +  +E  SIDE YLDV++ +      ++ A L++  I    +L C+ G S+  FLAK+A++  KP G   +  D+   ++  L I K  G+G     +L E+ ++  +D+  V    LI  + G    +L     GI   P+ P+  RK++    S R Y++  YQE      I +    +   L+    + + + +K+RY+D  + TK  +         L      +LF+ + +  +  +++ +++T 
  S:    13 KIIHIDMDAFFAAVEERDNPELKGKPVVIGKDPRESGGRGVVSTCNYEARRFGIHSAMSSKEAYERCPQAIFISGDHAKYRRIGYDIREIFRRYTDQVEPVSIDEAYLDVTSNKLGIKSALKIARLIQYDIWNSLHLTCSAGVSYNKFLAKLASDFEKPHGLTLVLPDDALPFLEKLPIEKFHGVGKRTVERLHEMGIYTGQDLLRVPEMTLI-DQFGRFGYELYRKARGISHSPVKPNRIRKSI---SSERTYAKLLYQEADIKAEISKNASRVADLLEANKKLGRIIVLKVRYADFTTLTKRVSLPELTRDARLIDQTARELFDSLEEHKEGIRLLGVTMTG 352
>gi|28378874|ref|NP_785766.1| DNA-damage-inducible protein P [Lactobacillus plantarum WCFS1] >gi|38257504|sp|Q88V07|DPO4_LACPL DNA polymerase IV (Pol IV) >gi|28271711|emb|CAD64617.1| DNA-damage-inducible protein P [Lactobacillus plantarum WCFS1] (366 aa)
Score = 326, Expect = 2.2e-28, Identities = 93/316 (29%), Positives = 162/316 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL--------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISD 319
           KI H+DMD+F+AS+E  E P Y+  PL + H         V+ +ANYVAR  GV SAM    A ++CP      PN   Y  +S +I+      ++ IE  + DE YLDV+  +      +E A  ++  I  + +L C+ G S+  F+AK+A++  KP G   +   + + ++    I K  G+G     ++ +L +   +D+   +++  + K+ G     L   V G    P+    +RK++G+ ++    +++ +E    LK I +L   + + ++      K++ +K+RY D  + TK   F  F   IP      LFEQ ++
  S:     6 KIIHVDMDAFYASIEEREHPAYKTQPLVIAHDPRQTGGRGVVTTANYVARQFGVHSAMPAAKALELCPTAVFKTPNFPLYREVSAQIHRIFHEYTEMIEPIAFDEAYLDVTTNKKHIHSAVELAHRLQQEIWHQTHLTCSTGISYNKFIAKLASDYRKPAGVTIVLPQDAEPFLLREPIEKFRGVGKKTVPKMHDLGIKTGQDLY-AQSELDLIKQFGKLGYILYRRVRGSDDRPVEYLRERKSIGKERTFGPFLQSTTEVNTHLKAIAKL---VAASMQSHQRHGKTLVLKLRYGDFVTITKRRTFGEF---IPNDAA--LFEQYAE 324
>gi|163754636|ref|ZP_02161758.1| putative DNA polymerase [Kordia algicida OT-1] >gi|161325577|gb|EDP96904.1| putative DNA polymerase [Kordia algicida OT-1] (370 aa)
Score = 326, Expect = 2.5e-28, Identities = 94/298 (31%), Positives = 157/298 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVL-GIICDPINPDYKRKNLGRSQSIRNYSEYQEF-LKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF 301
           KI H+DMD+F+ASVE  + PE +  PLAVG      V+++A+Y AR  GV+SAM+   AKK CP+L  + P  ++Y  +S +I       +  +E  S+DE YLDV+  +  N      A  ++  I +   L  + G S   F+AK+A++  KP+G  T+  +    ++  L I K  G+G     ++ +L +   KD+     D+L     K G    K   NV+ GI    + P+   K++G  ++  +    + F L+ ++ + +++   LK      K+V +KI+YSD  + T+S     F
  S:     9 KIIHVDMDAFYASVEQLDNPELKGKPLAVGGGAKRGVVSAASYEARKFGVRSAMSGFLAKKRCPELIFVRPRFDRYKEISTQIRKIFYEYTDLVEPLSLDEAYLDVTKNKKGNPSASLIAEEIRAKILKDVGLTASAGISINKFIAKVASDYNKPNGQKTVPPEEVLDFLEALDIRKFYGVGKVTAERMYQLGIFTGKDLKTKDVDFLTEHFGKSG----KFYFNVVRGIHLSEVKPNRIAKSVGAERTFSDNLTSEIFMLEKLENIANELEKRLKKYAISGKTVTLKIKYSDFTTQTRSKTIAYF 310
>gi|157369207|ref|YP_001477196.1| DNA polymerase IV [Serratia proteamaculans 568] >gi|189027680|sp|A8GAC8|DPO4_SERP5 DNA polymerase IV (Pol IV) >gi|157320971|gb|ABV40068.1| DNA-directed DNA polymerase [Serratia proteamaculans 568] (353 aa)
Score = 326, Expect = 2.5e-28, Identities = 90/272 (33%), Positives = 149/272 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSE---------YQEFLKLIKELTDDINSG-----LKYQDF 275
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV SAM+   A K+CP L ++      Y   S  I    +  +  IE  S+DE YLDV++    N      A  ++ +I  + NL  + G +   FLAK+A+ L KP+G   +T     +++  L +SKI G+G    ++L E+ L    D+       L+++  K G + W + +    GI    ++P+  RK++G     ++ I ++ +         Y E    ++++  D++       LK+QDF
  S:     3 KIIHVDMDCFFAAVEMRDDPSLRDIPLAIGGSADRRGVISTANYPARRYGVHSAMSTAMALKLCPHLKLLPGRMAAYKEASQHIREIFARYTPLIEPLSLDEAYLDVTDCSQCNGSATLIAEQIRQTISDELNLTASAGIAPIKFLAKIASELNKPNGQYVITPAQVPAFLQQLPLSKIPGVGKVTAKRLEEVGLITCADVQQYDLAALLKRFGKFGRVLWERCQ----GIDLREVSPERLRKSVGVERTLAEDIHDWEDCEALIVDKLYPELELRLRKVKPDLHIARQGVKLKFQDF 296
>gi|171779234|ref|ZP_02920205.1| hypothetical protein STRINF_01082 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282290|gb|EDT47717.1| hypothetical protein STRINF_01082 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (364 aa)
Score = 326, Expect = 2.6e-28, Identities = 97/313 (30%), Positives = 156/313 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEY----QEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL-----HVVVDLFEQ 316
           KI HIDMD+FFASVE  + P+ +  P+ +G          V+++ NY AR  GV SAM+  +A + CPQ   I  N  KY  +  +I   L   +  +E  SIDE YLDV+  +      I+ A +++  I Q+  L C+ G S+  FLAK+A++  KP G   +  ++ + ++  L I K  G+G     +L ++ +    D+  +    LI    G     L     GI   P+ P+  RK++G   S R YS+      +    I + T  +   L   + + + V +K+RY+D  + TK        N   +     H + D  E+
  S:    14 KIIHIDMDAFFASVEERDNPDLKGKPVIIGSDPRKTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQAIFISGNYQKYREIGMQIREILRRYTDLVEPMSIDEAYLDVTENKRGTKSAIKIAKMIQYDIWQEVRLTCSAGVSYNKFLAKLASDYDKPKGLTLVLPEDAQDFLKKLPIEKFHGVGKKSVEKLHQMGVFTGADLLEIPEMTLI-DHFGRFGYDLYRKARGISNSPVRPNRIRKSIG---SERTYSKLLYKDADIKSEISKNTRRVVDSLMRNNKVGRIVVLKVRYADFSTLTKRKTLDEVTNDFEVIDQSAHAIFDSLEE 339
>gi|55823560|ref|YP_142001.1| DNA polymerase IV [Streptococcus thermophilus CNRZ1066] >gi|81559009|sp|Q5LYC2|DPO4_STRT1 DNA polymerase IV (Pol IV) >gi|55739545|gb|AAV63186.1| DNA polymerase IV, damage-inducible [Streptococcus thermophilus CNRZ1066] (367 aa)
Score = 325, Expect = 2.9e-28, Identities = 97/346 (28%), Positives = 171/346 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL--------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFD 349
           KI HIDMD+FFA VE+ + P  +  P+ +G+         V+++ NY AR  GV SAM+  +A + CP    I  N + Y  +  +I       +  +E  SIDE YLDV+  +      ++ A L++  I Q+ +L C+ G S+  F+AK+A++  KP G   +  +  + ++  L I K  G+G     +L +++++   D+  +    LI  + G     L     GI   P+ P+  RK++G  ++     YSE     +L K       S  K +  + + + IK+RYSD  + TK                +   +F+Q+ + S   +++ +++T    +E+    QL + D
  S:    13 KIIHIDMDAFFAQVEMRDDPSLKDKPVIIGNDPRKTGGRGVVSTCNYEARKYGVHSAMSSKEAYERCPNAVFISGNYSHYREVGMQIREIFKCYTDLVEPMSIDEAYLDVTTNKLGIKSAVKVAKLIQYDIWQELHLTCSAGVSYNKFIAKLASDFQKPAGLTVVLPEEAQDFLEKLPIEKFHGVGKKSVERLHDMDIYTGADLLKISEITLI-DRFGRFGFDLFRKARGISNSPVKPNRVRKSIGSERTYGKLLYSEDDIKAELTKNAKQVAESAQKAKK-VGRIIVIKVRYSDFSTLTKRMTLDKSTQDFDTIDRISHSIFDQLEENSSGVRLLGVTLTG---LEDQEGRQLDLDD 365
>gi|119502995|ref|ZP_01625080.1| DNA polymerase IV [marine gamma proteobacterium HTCC2080] >gi|119461341|gb|EAW42431.1| DNA polymerase IV [marine gamma proteobacterium HTCC2080] (356 aa)
Score = 324, Expect = 3.5e-28, Identities = 90/290 (31%), Positives = 144/290 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSE-YQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HID D F+A++E+ + P     P AVG       V+ + NY AR  GV SAM    A ++CP L +   N  KY  +S +++      +  IE  S+DE YLDVS++   +      A  ++  IK + N+  + G S   FLAK+A++  KPDG   +T D   ++   L +  I G+GP    +L  +      D+ N +   L +++ G     L     G    P+N    RK+L      +Q ++N    + +   L+ EL   I+ G K    + K+  +KI++SD  + T
  S:     3 KIIHIDADCFYAAIEMRDDPSLIDRPFAVGGSAEGRGVLTTCNYPAREFGVHSAMPTSQAYRLCPDLVVAPVNIPKYREVSVQMHEIFEQFTDVIEPLSLDEAYLDVSDSTLFDGSASRIAEAIREQIKTEINITVSAGVSINKFLAKVASDWNKPDGQKVVTPDEVDAFTAALEVRAIPGVGPVTAEKLKRMGFQKCTDLRNAEARVL-KRRFGSFAQTLIERAHGRDNRPVNTSRIRKSLSVEHTYTQDLKNGQPCFDKLPGLLDELRGRIDKG-KLAPRIQKAY-VKIKFSDFSTTT 299
>gi|91792543|ref|YP_562194.1| DNA polymerase IV [Shewanella denitrificans OS217] >gi|123356988|sp|Q12Q05|DPO4_SHEDO DNA polymerase IV (Pol IV) >gi|91714545|gb|ABE54471.1| DNA-directed DNA polymerase [Shewanella denitrificans OS217] (358 aa)
Score = 324, Expect = 3.6e-28, Identities = 97/290 (33%), Positives = 154/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PE++  PLAVG       VI++ NY AR  GV+SAM+   A ++CP L ++    + Y S+S +I S  +  +  IE  S+DE YLDV+++ +        A  ++  I +   L  + G +   FLAK+A++L KP+G   +T +   +++ DL + KI G+G     +L  L L   +D+     D LI    G     L     GI    ++ D  RK++G     +Q I +  +  + L  LI+EL        K Q  + K V +K+++SD    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEFKGKPLAVGGRSDRRGVISTCNYEARKFGVRSAMSSHKALQLCPDLVLVPGRMDVYKSVSAQIRSVFARYTDIIEPLSLDEAYLDVTDSPHCKGSATLMAKAIREEIFELTGLTASAGIAPIKFLAKIASDLNKPNGQYLITPERIPAFVKDLPLIKIPGVGKVTAAKLEALGLLNCQDVQQYPKDKLIH-AFGKFGVVLIDRAHGIDPRALSMDRLRKSVGVETTLAQDIYSLEQCHQILPGLIQELGSRCAKSAK-QRQIHKQV-VKLKFSDFKQTT 299
>gi|194432752|ref|ZP_03065037.1| DNA polymerase IV [Shigella dysenteriae 1012] >gi|194419014|gb|EDX35098.1| DNA polymerase IV [Shigella dysenteriae 1012] (350 aa)
Score = 324, Expect = 3.7e-28, Identities = 88/291 (30%), Positives = 152/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L E+ L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     2 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQAIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEEMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 299
>gi|94989203|ref|YP_597304.1| DNA polymerase IV [Streptococcus pyogenes MGAS9429] >gi|94993090|ref|YP_601189.1| DNA polymerase IV [Streptococcus pyogenes MGAS2096] >gi|189044610|sp|Q1JA16|DPO4_STRPB DNA polymerase IV (Pol IV) >gi|189044611|sp|Q1JK63|DPO4_STRPC DNA polymerase IV (Pol IV) >gi|94542711|gb|ABF32760.1| DNA polymerase IV [Streptococcus pyogenes MGAS9429] >gi|94546598|gb|ABF36645.1| DNA polymerase IV [Streptococcus pyogenes MGAS2096] (364 aa)
Score = 324, Expect = 3.7e-28, Identities = 98/329 (29%), Positives = 171/329 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE--YQE--FLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN---QIPLHVVVDLFEQISDFSKYDQVINLSIT 332
           KI HIDMD+FFA+VE  +    +  P+ +G          V+++ NY AR  G+ SAM+  +A + CP+   I  N  KY ++ ++I       +  +E  SIDE YLDV+N +      ++ A L+++ I ++  L C+ G S+  FLAK+A++  KP G   + K++   ++  L I K  G+G     +L ++ ++  +D+  V    LI    G     L     GI   P+  D  RK++G   S R Y++  YQE      I +    + + L+    + K++ +K+RY+D  + TK            QI   V  D+F+ +S+     +++ +++T
  S:    13 KIIHIDMDAFFAAVEERDNLALKGKPVVIGKDPRETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGEQIRRIFKRYTDVVEPMSIDEAYLDVTNNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAKLASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEMTLI-DHFGRFGFDLYRKARGISNSPVKSDRIRKSIG---SERTYAKLLYQETDIKAEISKNAKRVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIE-QVAGDIFDSLSENPAGIRLLGVTMT 351
>gi|188159269|ref|ZP_02512425.2| DNA polymerase IV [Mycoplasma mycoides subsp. mycoides LC str. GM12] (407 aa)
Score = 324, Expect = 3.8e-28, Identities = 125/373 (33%), Positives = 199/373 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFL-SSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKN--DYLIRKKIGLHWSKLRMNVLGIICDPIN---PDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYS-DGDSATKSFNFVNFQNQIPLHVVVDLFEQISD------FSKYDQVINLSI----TANNIMENDNNEQLTIFDSP---TQKISTESKLEKIRKQVNKTLNKKII 377
           I HIDMD+FFAS    + PE +  P+ + +     +I++A+Y AR   +K+AM +  AKK+ PQ+  + P+     ++S +I+ F+ ++ +  IE  SIDE YLDVS+   +N   +  A  ++  I  +FNL C++G  F  F AKM+T+L KP+G    T  NFK  I+ + I+K+ G G S  + L    +  IKD+A + +   Y +  K GL    L+   LG+  D IN    DYK  +   + +   Y +Y E   +I  L+  I+  L     + K++ IKIRY  D     K  +  +   QI L    + FE+I +      +S YDQ   + +     +  I +N N  QL I +       +I    K+E +   +NK   K +I
  S:     6 IIHIDMDAFFASCMQLKHPELKNKPIVISNSFDKSIISTASYEARKYNIKAAMPLFKAKKLYPQIISVKPDMIFINNISYQIWEFIKNNYTNKIEVASIDEAYLDVSDL-VKNTNVLILAKNIQKDIYDQFNLTCSIGIGFNRFSAKMSTSLHKPNGITLTTTSNFKDNIWPISINKMYGFGQSAAKLLNNTKIKTIKDLALLSDVEVYQLLNKKGL---ALKSEALGLGSDYINYLSNDYKSISKETTLNTPIY-QYDEIETIILNLSKFISYKLHKNQLLCKTIEIKIRYKIDEKLFDKQKHLESRHKQITLKNHTNDFEKIYNSALDCFYSLYDQNKGILLIGVGVSKLIHKNQNWVQLDIENQTKVDKNQIDNALKIENMIFDINKKFKKPVI 397
>gi|183601930|ref|ZP_02963299.1| DNA-damage-inducible protein P [Bifidobacterium animalis subsp. lactis HN019] >gi|183218815|gb|EDT89457.1| DNA-damage-inducible protein P [Bifidobacterium animalis subsp. lactis HN019] (438 aa)
Score = 324, Expect = 3.9e-28, Identities = 82/294 (27%), Positives = 155/294 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIY-SFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR----KKIGLHWSKLRMNVLGIICDP--INPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           I HIDMD+FFAS+E+A  PE+   P+ VG     V+++A+Y AR  G+ SAM    A ++CP    +  + + Y+++S +I+ +    ++  IE  S+DE Y+DVS            A  ++  + ++F + C+VG +    +AKMA+  AKP+G L +  D    ++  + +  I G+GP+  ++L    ++ +  +A    + LI+    K    H  +    +     DP  +      K++G+ ++   + ++      LIK+  D + S L+ +  M +++ +K+R+ D   +TK    
  S:    23 ILHIDMDAFFASLEIARHPEFRGKPVIVGTGNRAVVSAASYEARKYGINSAMPAARAHQLCPNGIFLPVDHHYYSAVSHEIFHTVFREVTDRIEQVSVDECYMDVSGALLAWHSPTRIAQWLRAQVAERFGITCSVGIAGNKLVAKMASTNAKPNGMLLIPLDKHAQFVQLMPLRGIPGLGPAQEKRLNAWGINSVSQLARCSVEELIQATGSKAAATHLWEASHGI-----DPCTLTLHAPEKSIGQERTFDTDCNDLATASTLIKQCCDKVASILRAKGLMARTLTVKLRFPDLAYSTKQMQL 322
>gi|71733882|ref|YP_275925.1| DNA polymerase IV [Pseudomonas syringae pv. phaseolicola 1448A] >gi|123635454|sp|Q48FB2|DPO4_PSE14 DNA polymerase IV (Pol IV) >gi|71554435|gb|AAZ33646.1| DNA polymerase IV [Pseudomonas syringae pv. phaseolicola 1448A] (353 aa)
Score = 324, Expect = 3.9e-28, Identities = 76/239 (31%), Positives = 127/239 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           + KI HID D F+A++E+ + PE    PLAVG       VIA+ NY AR  GV+SAM+   A K+CP LTI+ P    Y   S +I++     +  IE  S+DE +LDVS+  + +      A  ++  +  + ++  + G +   FLAK+A++  KP+G   +T D  + ++  L ++K+ G+G     +L  L +    D+       L+R + G    +L     GI   P+  D +R+++
  S:     3 QRKIIHIDCDCFYAAIEMRDEPELAGKPLAVGGSAERRGVIATCNYEARAYGVRSAMSSRHALKLCPDLTIVKPRMEAYKEASREIHTIFRDYTDLIEPLSLDEAFLDVSDAGHFSGSATRIAQDIRRRVSNQLHITVSAGVAPNKFLAKIASDWKKPNGLFVITPDQVEDFVASLPVTKLHGVGKVTADKLGRLGIVDCADLRGRSKLALVR-EFGSFGERLWSLAHGIDDRPVQNDSRRQSV 245
>gi|114046491|ref|YP_737041.1| DNA polymerase IV [Shewanella sp. MR-7] >gi|122944881|sp|Q0HY21|DPO4_SHESR DNA polymerase IV (Pol IV) >gi|113887933|gb|ABI41984.1| DNA-directed DNA polymerase [Shewanella sp. MR-7] (359 aa)
Score = 324, Expect = 4.4e-28, Identities = 95/290 (32%), Positives = 150/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S +I +  S  ++ IE  S+DE YLDVS+ +         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +  D    ++  L + KI G+G     +L  L L+   D+       LI  + G   + L     GI    I+   +RK++G     +Q I    + Q+ +  LI+EL+  +    K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSRVQRGVISTCNYEARKFGVRSAMATGYALKLCPDLILVPGRMQVYKEVSQQIRAIFSRYTELIEPLSLDEAYLDVSDCKLFKGSATLIAEAIRRDILAETGLTASAGVAPIKFLAKVASDLNKPNGQCVIPPDEVPEFVKSLSLRKIPGVGKVTAEKLSSLGLNTCADVQAYPKQELI-ARFGKFGAVLVERAHGIDDRGISVSRERKSVGVETTLAQDIYTLEQCQQVMPGLIQELSSRLGRSAKGRQ-IHKQV-VKLKFNDFKQTT 299
>gi|69938548|ref|ZP_00633005.1| DNA-directed DNA polymerase [Paracoccus denitrificans PD1222] >gi|119383484|ref|YP_914540.1| DNA-directed DNA polymerase [Paracoccus denitrificans PD1222] >gi|119373251|gb|ABL68844.1| DNA-directed DNA polymerase [Paracoccus denitrificans PD1222] (363 aa)
Score = 324, Expect = 4.5e-28, Identities = 98/346 (28%), Positives = 177/346 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL---VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRS----QSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF---VNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNE---QLTIFD 349
           +I H+DMD+F+ASVE  + P     P+AVG +   V+A+A+Y AR  GV+SAM  + A ++CP L  + P  + Y ++S ++ +  +  +  +E  S+DE YLD+++           A  ++  I++   L  + G S+  FLAK+A++  KPDG   +  +    ++  L I +  GIGP+   ++    +    D+A    D+L     K    +W+  R    GI    + PD  RK++G      + +R+ +   E L +   L D +           ++V +K++Y D    T++ +    V  ++++ L +  +L   +  F+    V  L IT + + E   +E   QL +FD
  S:    11 RIVHVDMDAFYASVEQRDDPALRGKPVAVGGIQRGVVAAASYEARRYGVRSAMPSMRAMRLCPDLIFVKPRFDVYRAVSQQVRAIFAEYTPLVEPLSLDEAYLDLTD-HLNGSTATRIAKEIRARIREATGLTASAGVSYNKFLAKLASDQRKPDGLFVIPPEAGAEFVQGLPIGRFHGIGPATAARMEAHGILTGADLARQSLDFLTARFGKSGAYYWNISR----GIDTREVKPDRIRKSIGAENTYFEDLRDIAAAHEALAV---LADKVWRHTTTAALRGRTVTLKVKYGDFRQITRARSLPRAVESRDEM-LEMACELLAPV--FADPHGVRLLGITLSGLEEARQDEPPRQLGLFD 361
>gi|183985375|ref|YP_001853666.1| nucleotidyltransferase/DNA polymerase DinP [Mycobacterium marinum M] >gi|183178701|gb|ACC43811.1| nucleotidyltransferase/DNA polymerase DinP [Mycobacterium marinum M] (399 aa)
Score = 323, Expect = 4.8e-28, Identities = 79/291 (27%), Positives = 151/291 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL---IRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI---RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+DSF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++AM    A+++CPQ  ++ P    Y   SD ++      +  +E  S+DE +LDV+  +  +   ++ A+ ++  ++ +  L  TVG + T FLAK+A+  AKPDG L +  ++  ++++ L + ++ G+G     +L    L  + D+A +    L   +   +G     L  N   I    ++   +R+++G  +++    N     E   ++  L D I   ++      ++V +++R+ D   AT+S
  S:     9 ILHADLDSFYASVEQRDDPSLRGRPVIVGGGVVLAASYEAKAYGVRTAMGGTQARRLCPQAVVVPPRMRAYMRASDAVFEVFRDCTPLVEPLSVDEAFLDVAGLRRVSGTPVQIAARLREDVRGRVGLPITVGVARTKFLAKVASQEAKPDGLLLVPPEDELAFLHPLPVRRLWGVGAKTAAKLQSHGLCTVADVAELSESALSSMLGAAMGRQLYALSRN---IDRRRVSTGVRRRSVGAQRALGRAGNALSPAELDAVVVTLIDRITGRMRAAGRTGRTVVLRLRFDDFSRATRS 302
>gi|153011002|ref|YP_001372216.1| DNA polymerase IV [Ochrobactrum anthropi ATCC 49188] >gi|151562890|gb|ABS16387.1| DNA-directed DNA polymerase [Ochrobactrum anthropi ATCC 49188] (453 aa)
Score = 323, Expect = 5.0e-28, Identities = 95/366 (25%), Positives = 189/366 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ--YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN-YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF---VNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDS-PTQKISTESKLEKIRKQ 367
           K  + HID D+F+ASVE  + PE    PL +G     V+++A Y+AR  GV+SAM +  A + CP   ++ PN  KY  +  ++   +  L+  +E  SIDE +LD+S T+  ++    I  AS  K  ++ +  ++ ++G S+  FLAK+A+++ KP GF  + +    +++ D  +S I G+G +   +L    +  I  +  ++   L+ K  G    +L     G     + PD+  K++    +  N  S+  + + +++ L + ++  LK  +   ++V +K++  D  S T++          ++I  H  + L E+  D +++     L I  + +  +D  +   + D+  T++   E+ ++K+R +
  S:    54 KLSLAHIDCDAFYASVEKRDNPELRDKPLIIGGGKRGVVSTACYLARIHGVRSAMPMFKALEACPDAVVVKPNMEKYVRVGREVRQMMRDLTPLVEPLSIDEAFLDLSGTERLHKAPPAIVLASFAKR-VEDEIGISASIGLSYCKFLAKVASDIEKPRGFSVIGEAEALTFLRDRSVSTIWGVGKAFAAKLESDGIRSIGQLQTMEEGALV-KAYGTMGQRLYRLSRGQDSRKVEPDHDMKSVSAETTFNNDLSDANDLVPVLRALAEKVSRRLKASEIAGRTVVLKLKTHDFKSRTRNRQLSDPTQLADRIFRH-GLQLLEKELDGTRFRL---LGIGVSELSSSDRADPPDLVDTQATKRAVAENAIDKLRNK 423
>gi|157147182|ref|YP_001454501.1| DNA polymerase IV [Citrobacter koseri ATCC BAA-895] >gi|189027658|sp|A8AKQ2|DPO4_CITK8 DNA polymerase IV (Pol IV) >gi|157084387|gb|ABV14065.1| hypothetical protein CKO_02960 [Citrobacter koseri ATCC BAA-895] (351 aa)
Score = 323, Expect = 5.7e-28, Identities = 86/285 (30%), Positives = 147/285 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSD 288
           KI H+DMD F+A+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++      Y   S  I    S  +  IE  S+DE YLDV+++ Y +      A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L + KI G+G     +L  + L   +D+       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ E   +I+ L  ++   L     D +     +K++++D
  S:     3 KIIHVDMDCFYAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFEAYKEASQHIREIFSRYTSRIEPLSLDEAYLDVTDSTYCHGSATLIAQEIRQTIFNELQLTASAGIAPVKFLAKIASDLNKPNGQYVITPADVPEFLKTLPLGKIPGVGKVSAARLETMGLRTCEDVQKYDLAMLL-KRFGKFGRVLWERSQGIDERDVNNERLRKSIGVERTLAEDIHEWAECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFND 294
>gi|90406943|ref|ZP_01215134.1| DNA polymerase IV [Psychromonas sp. CNPT3] >gi|90311985|gb|EAS40079.1| DNA polymerase IV [Psychromonas sp. CNPT3] (361 aa)
Score = 322, Expect = 6.1e-28, Identities = 94/319 (29%), Positives = 160/319 (50%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVL----GIICDPINPDYKRKNLGRSQSIR-----NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDF 320
           + KI HIDMD F+A+VE+ + P+Y  + LA+G       V+++ NY+AR  GV SAM    AK++CP L II    + YT +S +I       +  +E  S+DE +LDVS+ +         A  ++ +I  +  L  + G +   FLAK+A++  KP+G   +T      ++  L + KI G+G    ++L +  L    D+ N     L+     L + KL  N+L    GI    +  + +RK+L    + R       +  ++     KEL   + + LK  + +   V +K+++ D       F   N + +   H+ + L E I D+
  S:     7 QRKIIHIDMDCFYAAVEMRDHPQYRDIALAIGGRVDRRSVLSTCNYLARQFGVHSAMPSFKAKQLCPDLVIIAGRMDVYTQVSKQIREIFYRYTDIVEPLSLDEAFLDVSDCKLFKGSATYIAMDIRRAIFDELQLTASAGVAPVKFLAKIASDENKPNGLCVITPQQVPEFVKTLALKKIPGVGRVAQQKLAQRGLFSCADVQNYPPQELL-----LEFGKLGQNLLNYCHGIDARTVISNRQRKSLAVEHTFRYDIGPKAARNEKLPLFYKELNLRLEAILK--EHIITKVGVKVKFMD-------FTTKNIERKAS-HISLSLLEDILDY 324
>gi|184201139|ref|YP_001855346.1| DNA polymerase IV [Kocuria rhizophila DC2201] >gi|183581369|dbj|BAG29840.1| DNA polymerase IV [Kocuria rhizophila DC2201] (412 aa)
Score = 322, Expect = 6.7e-28, Identities = 93/360 (25%), Positives = 178/360 (49%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANV---KNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQ----ISDFSKYDQVINL-SITANNIMENDNNEQLTIFDSPTQKISTESKLEKI 364
           I H+DMD F+  VEL + P++   P+ V       V+ SA+Y AR  GV SAM +  A+  CP   ++ P++  Y   S  +     S++  +E  S+DE ++DVS         +E A  ++ +I+Q+  L  +VG +    +AK+A+   KPDG L +  ++ ++++  L + ++ G+G   +  L    L  + DIA     +   L+    G H  +L    LG    P+ P  + K+LG  ++ + + SE  E  +++  L  +  + L+        V +K+RY+D  + ++S    +     P+    DL+ +    +    +  Q + L  I A  ++  D+  QL++     +  + E  ++++
  S:    17 ILHVDMDMFYVGVELLDAPQHRGRPVIVAGSGPRSVVLSASYEARRFGVHSAMPVSQARARCPSAVLLEPHREAYAHYSRIVMDIFRSVTDRVEQLSVDEAFVDVSGAIRRCGPPVEIARGLRRTIQQRTGLTASVGVAENKTVAKIASAHCKPDGLLVVAPEHTRAFLARLPVDRLWGVGRRTSETLRAAGLATVGDIAGTPLPRLHALVGVASGSHLQQL---ALGHDPRPVTPTREEKSLGAERTFQTDLSETAELKRVLLGLCHETAARLRRHGLRAGRVGLKLRYADFTTISRSRTLGH-----PVTSAHDLYTEAAGLLDALGRRPQAVRLVGIRAEKLVGADHALQLSLDGRDAEWGAAEEAMDRV 381
>gi|146317857|ref|YP_001197569.1| DNA polymerase IV [Streptococcus suis 05ZYH33] >gi|145688663|gb|ABP89169.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Streptococcus suis 05ZYH33] (337 aa)
Score = 322, Expect = 7.2e-28, Identities = 89/323 (27%), Positives = 163/323 (50%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSIT 332
           MD+FFA++E+ + P  +  P+ +G          V+++ NY AR  G+ SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A L++  I  + +L  + G S+  FLAK+A+++ KP G   +  ++    +  L + K  G+G     +L E+ ++  +D+ +V    LI  + G     L     GI   P+  D  RK+ G+ ++ R   Y E ++ LK +  L   + + LK      +++ +K+RY D  + TK  +   + +Q       V  L E+I    K  +++ +++T
  S:     1 MDAFFAAIEVRDSPALKGKPVIIGADPRLSGGRGVVSTCNYEARAFGIHSAMSSKEAYERCPQAIFISGNYEKYQEVGRQVREIFHRYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKFLAKIASDMEKPHGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLDVPEMVLI-DRFGRFGFDLYRKARGISNSPVKVDRVRKSSGKERTYRKLLYRE-EDVLKELISLCQRVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIEEIGKIEKGIRLLGVTVT 333
>gi|118725594|ref|ZP_01574233.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10] >gi|118665069|gb|EAV71692.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10] (399 aa)
Score = 322, Expect = 7.5e-28, Identities = 103/374 (27%), Positives = 192/374 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQI-PLHVVVDLFEQISDFSKYD-------QVINLSITANNIMENDN-NEQLTIFDSPTQKISTESKLEKIRKQVNKTLNK 374
           M   +F +DM++FF S E++   E    P AV         +I +ANY AR  GVK+ M I  A K+CP++ ++ P+   Y   S ++   L   S  IE  SIDE +LD++ T+      ++ A  + ++I  +  L C++G S    LAK+A+ + KP G   L   + ++ ++ L ++ + GIG     +L  + +  I ++AN  +  LI K +G    +L+    GI    + P    + K++GRS ++  + +E +E      E+ +++    +  +   +++ I I+YSD       F  +  Q  I P ++  D++E      K +       ++I +SI+     EN+  + Q+++FD      ++  K EK+ K ++   +K
  S:     1 MDRVVFLVDMNAFFISCEMSRNSEIVGKPAAVAGNPRTRTGIILAANYEARKFGVKTTMVIHQALKLCPEMLLVPPDHRFYEKKSIEVMEILKRFSPVIEQNSIDEAWLDMTGTETLFGSPMDAAHQIMDAINDELGLWCSIGISENKLLAKIASEIKKPMGITELWLKDVQTKLWPLKVTDLYGIGRQTGMKLNNIGIETIGELANYNSQSLI-KYLGRQGLELQRMANGIDTSQVTPHVSGEMKSIGRSNTLAEDITEIEEVRTTFIEMCEEVGYEARKNNKKARTIQITIKYSD-------FKTITRQTSIEPTYLTKDIYETGFSLLKKNWNSLMPVRLIGISISG---FENEGLSGQMSLFDEADLCDNSSRKEEKLEKAIDSIRSK 381
>gi|66044645|ref|YP_234486.1| DNA polymerase IV [Pseudomonas syringae pv. syringae B728a] >gi|75502962|sp|Q4ZWM4|DPO4_PSEU2 DNA polymerase IV (Pol IV) >gi|63255352|gb|AAY36448.1| DNA-directed DNA polymerase [Pseudomonas syringae pv. syringae B728a] (354 aa)
Score = 322, Expect = 7.5e-28, Identities = 75/239 (31%), Positives = 128/239 (53%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           + KI HID D F+A++E+ + P+    PLAVG       VIA+ NY AR  GV+SAM+   A K+CP LTI+ P  + Y   S +I++     +  IE  S+DE +LDVS   + +      A  ++  +  + ++  + G +   FLAK+A++  KP+G   +T D  + ++  L ++K+ G+G     +L  L +    D+ +     L+R + G    +L     GI   P+  D +R+++
  S:     3 QRKIIHIDCDCFYAAIEMRDEPDLAGKPLAVGGSAERRGVIATCNYEARAYGVRSAMSSRHALKLCPDLTIVKPRMDAYKEASREIHTIFRDYTDLIEPLSLDEAFLDVSEAGHFSGSATRIAQDIRRRVSNQLHITVSAGVAPNKFLAKIASDWKKPNGLFVITPDQVEEFVASLPVTKLHGVGKVTADKLGRLGIVDCADLRSRSKLALVR-EFGSFGERLWSLAHGIDDRPVQNDSRRQSV 245
>gi|167212685|ref|ZP_02282992.1| hypothetical protein LmonL_17760 [Listeria monocytogenes LO28] (286 aa)
Score = 322, Expect = 7.8e-28, Identities = 83/242 (34%), Positives = 133/242 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLV----KNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           KI HIDMD+F+ASVE  + PE+   PL +G       V+A+ +Y AR  GV SAM    A K+CP    I+ N   Y  +S++I    S  +  IE  S+DE YLDV+    EN K ++ A++V    + +I Q+  L  + G SF  F+AK+A++  KP G   +T +  ++++  + ++K  G+G     +L  L +    D+       LIR ++  H   L  +V G   + +NP   RK++G+  +
  S:     6 KIIHIDMDAFYASVEQRDHPEFRGKPLIIGGDPNKRGVVATCSYEARKFGVHSAMPTRQAAKLCPNGIFIHGNMAHYVEVSNQIREIFSRYTDIIEPLSLDEAYLDVT----ENKKGMKSATMVAREIQQTIYQELGLTASAGVSFNKFIAKIASDFKKPAGITVVTPEEAEAFLEQIPVTKFYGVGKVTAEKLHRLGIETGADLKKWSEWDLIR-ELHKHGYHLYRHVRGRSNNIVNPHRDRKSVGKETT 251
>gi|114567185|ref|YP_754339.1| DNA-directed DNA polymerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338120|gb|ABI68968.1| DNA-directed DNA polymerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (419 aa)
Score = 321, Expect = 8.1e-28, Identities = 101/384 (26%), Positives = 198/384 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVL-GIICDPI---NPDYKRKNLGRS-QSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQI--PLHVVVDLFEQI-----SDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRS 384
           M+  I H D+++F+ASVE   RPE     +AV       H ++ + NY+A+  G+++   I  A++ CP+L ++ PN   Y   S    S  +S +  +E   +DE +LDV+ + +     IE A  ++  IK +  ++ +VG S+    AK+ +++ KPD    ++KDNFK   + L  S ++ +G +  R+     +  I DIA  ++D L+ K     W ++  +   G    P+     +   K++G S  + R+    ++ L +I  L++ + + L+   F  ++V+I +R        K+      Q ++  P ++  D+ E+      S +S    + ++ +   +++  D++EQL++F    ++I    K EKI   ++ TL  +  H+   R+
  S:     1 MERVILHSDLNNFYASVECLHRPEIRNKAVAVCGDPAARHGIVLAKNYLAKESGIQTGEVIWQAQQKCPELVVVPPNYPLYLKFSRLARSIYASYTDQVEAFGLDEAWLDVTGSIHIFGSGIEMADEIRERIKLELGVSASVGVSYNKIFAKLGSDMKKPDATTIISKDNFKQTAWPLPASDLLYVGRATCRKFARWGISTIGDIA--ESDPLVLKARLGKWGEVLWSFANGYDRSPVVAMGEESIIKSVGNSITTPRDLENNEDVLLIIYALSESVAARLREHGFKCRTVHIHVR-------DKNLFTFGVQGKLLRPGNISNDIAEKAMALFRSHYSWAHPIRSIGVRGCDLIAADSHEQLSLFTDEEKRI----KQEKIEATLD-TLRCRFGHFSVQRA 388
>gi|113969291|ref|YP_733084.1| DNA polymerase IV [Shewanella sp. MR-4] >gi|123029894|sp|Q0HLP0|DPO4_SHESM DNA polymerase IV (Pol IV) >gi|113883975|gb|ABI38027.1| DNA-directed DNA polymerase [Shewanella sp. MR-4] (359 aa)
Score = 321, Expect = 8.4e-28, Identities = 95/290 (32%), Positives = 150/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S +I +  S  ++ IE  S+DE YLDVS+ +         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +  D    ++  L + KI G+G     +L  L L+   D+       LI  + G   + L     GI    I+   +RK++G     +Q I    + Q+ +  LI+EL+  +    K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSRVQRGVISTCNYEARKFGVRSAMATGYALKLCPNLILVPGRMQVYKEVSQQIRAIFSRYTELIEPLSLDEAYLDVSDCKLFKGSATLIAEAIRRDILAETGLTASAGVAPIKFLAKVASDLNKPNGQCVIPPDEVPEFVKSLSLRKIPGVGKVTAEKLSSLGLNTCADVQAYPKQELI-ARFGKFGAVLVERAHGIDERGISVSRERKSVGVETTLAQDIYTLEQCQQVMPGLIQELSSRLVRSAKGRQ-IHKQV-VKLKFNDFKQTT 299
>gi|168307750|ref|ZP_02690425.1| DNA polymerase family protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902874|gb|EDT49163.1| DNA polymerase family protein [Ureaplasma parvum serovar 1 str. ATCC 27813] (360 aa)
Score = 321, Expect = 8.7e-28, Identities = 104/345 (30%), Positives = 187/345 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEF-ASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINL-SITANNIMENDN-NEQLTIFD 349
           I H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVK+AM I  AK++CP L I+    N Y S S   +  ++  +  IE  SIDE ++D ++   +    I   A+ ++  IK K NL+ ++G S+   +AKMAT L KP G   + ++   + IY+L+I+KI  IG   +++L  +N+  IK++   +N   I   +G  +  L  ++ G+    I  +   K +  S++   + +++ E    + +L   + + LK  + M  +++I I+Y    +  K      + +  Q     + +LF+ +      D+ I L  I+ N +++ +N  +QL +FD
  S:     9 IMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKAAMPIFLAKELCPNLIILPSEHNIYQSYSKHFFQIINKYANKIEITSIDECFIDATDLVKKYHNNIRLLATKIQKEIKNKLNLSISIGISYNKTIAKMATELNKPSGISIIDENKIINLIYELNINKIPYIGEIKSQELYAINIFKIKELIATENKQKISLVLGSIYQNLVNDLKGLSEIKIIDEDIYKTISHSKTFNEDLNDFYEISNEMNDLILTVTNRLKKCNLMTNNISIYIKYPSFKTKIKQKQLTYYTDDYQTIFLAIKNLFKIMYK----DETIRLIGISLNKLVKKENVKKQLFLFD 360
>gi|77408795|ref|ZP_00785524.1| DNA-damage-inducible protein P [Streptococcus agalactiae COH1] >gi|77172576|gb|EAO75716.1| DNA-damage-inducible protein P [Streptococcus agalactiae COH1] (364 aa)
Score = 321, Expect = 9.8e-28, Identities = 93/316 (29%), Positives = 159/316 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISD 319
           KI HIDMD+FFASVE  + P  +  P+ +G          V+++ NY AR  GV SAM+  +A + CPQ   I  N  KY  +  ++       +  +E  SIDE YLDV+  +      ++ A +++  I    +L C+ G S+  FLAK+A++  KP G   +  D  + ++  L I K  G+G     +L  L ++  +D+ ++    LI    G     L     GI   P+ P+  RK++G  ++     Y+E     ++ K +   + S L+    + K++ +K+RY+D ++ TK      +    QI   V   +F+ + +
  S:    13 KIIHIDMDAFFASVEERDNPSLKGKPVIIGSDPRKTGGRGVVSTCNYEARKFGVHSAMSSKEAYERCPQAIFISGNYQKYRQVGMEVRDIFKKYTDLVEPMSIDEAYLDVTENKMGIKSAVKLAKMIQYDIWNDVHLTCSAGISYNKFLAKLASDFEKPKGLTFILPDQAQDFLKPLPIEKFHGVGKRSVEKLHALGVYTGEDLLSLSEISLI-DMFGRFGYDLYRKARGINASPVKPNRVRKSIGSEKTYGKLLYNEADIKAEISKNVQRVVAS-LEKNKKVGKTIVLKVRYADFETLTKRMTLEEYTQDFQIIDQVAKAIFDTLEE 338
>gi|54024639|ref|YP_118881.1| DNA polymerase IV [Nocardia farcinica IFM 10152] >gi|54016147|dbj|BAD57517.1| putative DNA polymerase IV family protein [Nocardia farcinica IFM 10152] (433 aa)
Score = 321, Expect = 9.9e-28, Identities = 83/291 (28%), Positives = 155/291 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDP--INPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+DSF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++ MN   A ++CPQ  ++ P  + Y + S  ++      +  +E  SIDE +LDV+  +    + IE A  ++  ++ +  L  +VG + T FLAK+A+ +AKPDG   +  +    +++ L + ++ G+G    R L E  +  I  +A +    L R  +G   ++  ++ L +  DP  +    +R++LG  +++ R +   +E    +  L D +   L+  D + ++V +++R+ D   AT+S
  S:    44 ILHADLDSFYASVEQRDDPSLRGRPVIVGGGVVLAASYEAKAFGVRTPMNGARALRLCPQAVVVPPRMSAYAAASKAVFEVFRDTTPVVEGISIDEAFLDVAGLRRIAGEPIEIARRLRARVRDEVGLPISVGIARTKFLAKVASAVAKPDGLRLVEPERELEFLHPLPVERLWGVGDVTARTLHEHGITRIAQLAELGESGL-RGFLGPAAAR-HLSALAMARDPRRVETGRRRRSLGAQRALGRRHRTPEEVAAYLHGLVDRLGRRLRAADRLCRTVVLRMRFDDFTRATRS 335
>gi|113461074|ref|YP_719142.1| DNA polymerase IV [Haemophilus somnus 129PT] >gi|112823117|gb|ABI25206.1| DNA-damage-inducible protein P, DNA polymerase IV (Pol IV) [Haemophilus somnus 129PT] (353 aa)
Score = 321, Expect = 1.0e-27, Identities = 85/262 (32%), Positives = 141/262 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKEL 262
           M  KI HIDMD F+AS+E+ ++PE    P+AVG L     V+++ NYVAR  G+ SAM    A K+CP L ++  N   Y  +S +I       +  IE  S+DE YLDV++ Q  +      A  ++  I Q+  L  + G +   FLAK+A++  KP+G   +  +   ++I  L + KI G+G   T++L ++ L    DI       LI +  KIG    ++     GI   P+    + K++G  +++ +N  + ++ +++I  L
  S:     1 MPRKIIHIDMDCFYASIEIRDKPELYDRPVAVGGLANQRGVLSTCNYVARQFGLHSAMPTSQALKLCPDLVLLAVNMPLYKQVSQQIQHIFLRYTDLIEPLSLDEAYLDVTDCQKCSGSATWIAEEIRQIITQETGLTASAGIAPLKFLAKIASDQNKPNGQFVIKPEEVATFIRQLPLKKIPGVGKVTTQRLQQMGLETCSDIQQFDYHVLIDRFGKIG---HRIWQFSQGIDERPVQSHREPKSIGLERTLMKNILQVEQGIEVINSL 267
>gi|145300090|ref|YP_001142931.1| DNA polymerase IV [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852862|gb|ABO91183.1| DNA polymerase IV [Aeromonas salmonicida subsp. salmonicida A449] (361 aa)
Score = 320, Expect = 1.0e-27, Identities = 88/290 (30%), Positives = 145/290 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG-----RSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD F+A+VE+ + P    +PLA+G       VI++ NYVAR  GV+SAM    AKK+CP   +I      Y   S ++ +     ++ +E  S+DE YLDV+++          A+ ++ +I  +  L  + G +   FLAK+A+   KPDG   +  +    ++  L ++K+ GIG     +L  L L+  +D   + +D LI  + G     L   + G    P+     RK +G      S  +   + +Q   +LI EL     +G   +  M +   IK++++D    T
  S:    14 KIIHIDMDCFYAAVEMRDNPALRDVPLAIGGSSDRRGVISTCNYVARRFGVRSAMPSGLAKKLCPPFVLIPGRMAVYKETSRQLRAIFLRYTELVEPLSLDEAYLDVTDSNCCGGSATLMAAEIRQAIVTELGLTASAGVAPNKFLAKLASEQRKPDGLFVIRPEEVDEFVRQLPLAKLPGIGRKTAERLESLGLYSCEDARVLSSDELI-ARFGKLGEMLTGRIWGRDDQPVQAQRIRKTIGVETTLASDVLDEAACWQVLSQLIPELERRFAAGYAREQLMGQG--IKLKFADFQQTT 310
>gi|77457422|ref|YP_346927.1| DNA polymerase IV [Pseudomonas fluorescens PfO-1] >gi|123605726|sp|Q3KH18|DPO4_PSEPF DNA polymerase IV (Pol IV) >gi|77381425|gb|ABA72938.1| DNA-directed DNA polymerase [Pseudomonas fluorescens PfO-1] (353 aa)
Score = 320, Expect = 1.1e-27, Identities = 67/193 (34%), Positives = 111/193 (57%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLH 194
           + KI H+D D F+A++E+ + P     PLAVG       VIA+ NY AR  GV+SAM+   A K+CP LTI+ P  + Y   S +I++  S  +  IE  S+DE YLDVS++ +        A  ++  +  + ++  + G +   FLAK+A++  KP+G   +T D  + ++  L +SK+ G+G     +L +L ++
  S:     3 QRKIIHVDCDCFYAAIEMRDDPSLAGKPLAVGGSADRRGVIATCNYEARAYGVRSAMSSGHALKLCPDLTIVKPRMDAYREASKEIHTIFSDYTDLIEPLSLDEAYLDVSDSAHFGGSATRIAQDIRRRVSNQLHITVSAGVAPNKFLAKIASDWRKPNGLFVITPDQVEEFVSGLPVSKLHGVGKVTADKLGKLGIN 200
>gi|171680875|ref|XP_001905382.1| unnamed protein product [Podospora anserina] >gi|27764332|emb|CAD60612.1| unnamed protein product [Podospora anserina] >gi|170940065|emb|CAP65292.1| unnamed protein product [Podospora anserina] (641 aa)
Score = 320, Expect = 1.1e-27, Identities = 83/285 (29%), Positives = 152/285 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQY---ENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDN--FKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLH-WSKLRMNVLGIICDPINP--DYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           +   I HID D+F+A+VE  +RPE   LP AVG  V+ + NYVAR  G +S M    AKK+CP+L ++  N +KY + + ++   L+      E+ SIDE YL++  TQY         +  S ++  I +K ++  + G +    LAK+ +N+ KP+G   L +D      ++ +L   ++ GIG  L R+L  + +    DI   +    I K  G   ++ L    LG+    I P  +Y+RK++G  ++ R+     +  + ++ + +++   ++  +   +++ IK++
  S:   128 LTQHIVHIDCDAFYAAVEQLDRPELADLPFAVGGGVLTTCNYVARRFGCRSGMAGFVAKKLCPELILLPLNFDKYNAKAAEVREILADYDPRFESASIDEAYLNI--TQYCIDHGMDAADVVSQMRREIHEKTHITVSAGIAANARLAKICSNMNKPNGQYVLPRDRVVIMEFMRNLSCRQVNGIGRVLERELGTIGISTCGDIYTQRQ--FIEKLFGEKTYNFLLRCYLGLGRTSIQPAEEYERKSVGTERTFRDMDNPTQLREQLRRIAEELEKDMRRAECKGRTLCIKVK 416
>gi|57233660|ref|YP_180766.1| DNA polymerase IV, putative [Dehalococcoides ethenogenes 195] >gi|57224108|gb|AAW39165.1| DNA polymerase IV, putative [Dehalococcoides ethenogenes 195] (390 aa)
Score = 320, Expect = 1.1e-27, Identities = 101/364 (27%), Positives = 179/364 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT--KSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQ 367
           ++ H+D+D+FF SVE + RPE +  P+ VG       V+A+A+Y AR  G+ S M ++ AK +CPQ   I  N   Y   S+K    LS  S  +E   +DE YL+V+  +  +    E A  ++  I  + ++N ++G + +  +AK+AT  AKP+G   +      +++  L IS + GIG      L  L ++ +  +A +   +L +  +G +   L     GI   P+    + K++ R  +    +    FL+  +  L++ I + L+ +    + V IKIR++D  + T  K  N     NQ      + L   I D S    V  L +  ++    +  +QL I  +  +    ++ L+KIR++
  S:     5 RVMHVDLDAFFVSVEQSLRPELKSKPVIVGGKPERRGVVAAASYEARKFGIHSGMPLLSAKHLCPQAVFIEGNHRLYREYSEKFMQILSDFSPFLEPMGLDEAYLEVTGFESLHGSIGEMALKIRRRITAELSINASIGIANSKVVAKIATERAKPNGQCEVPAGEEAAFLAPLDISIMPGIGKKTEYHLKSLGINTLGRLAGIPATFL-KIHLGTYAPYLLNAAAGIDNRPVEMPAEAKSISRETTFETDTRNHTFLEAKLGYLSEKIAATLRKRGKQARVVQIKIRFADFTTLTRQKHLNHPCSGNQEIFQTALKLMNGILD-SDRRSVRLLGVGISDFCGPE--KQLEIDPARARLEKLDASLDKIRQK 372
>gi|145221714|ref|YP_001132392.1| DNA polymerase IV [Mycobacterium gilvum PYR-GCK] >gi|145214200|gb|ABP43604.1| DNA-directed DNA polymerase [Mycobacterium gilvum PYR-GCK] (413 aa)
Score = 320, Expect = 1.1e-27, Identities = 82/291 (28%), Positives = 148/291 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKN---DYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR-------------KNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+DSF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++AM    A+ +CPQ  ++ P    Y+  S  ++      +  +E  S+DE +LDVS  +  +   ++ A+ ++  ++ +  L  TVG + T FLAK+A+  AKPDG L +  D   ++++ L + ++ G+G     +L    +  + D+A +       L+   +G     L  NV          D +R             + LGR+ S     +      ++  L D I   ++  D   ++V +++R++D   AT+S
  S:    18 ILHADLDSFYASVEQRDDPSLRGRPVLVGGGVVLAASYEAKAFGVRTAMGGRQARALCPQAIVVAPRMRAYSDASAAVFEVFRDTTPVVEPVSVDEAFLDVSGLRRVSGTPVQIATRLRERVRDEVGLPITVGIARTKFLAKVASQEAKPDGLLLVPPDRELAFLHPLPVRRLWGVGAKTADKLRAHGIETVADVAELSETTLSSLVGGAMGRQLFALAHNV----------DRRRVVTGQRRRSVGAQRALGRAGSAMTVDQVD---AVVVNLIDRITRRMRAADRTGRTVVLRLRFADFSRATRS 311
>gi|192812577|ref|ZP_03041245.1| DNA-directed DNA polymerase [Geobacillus sp. Y412MC10] >gi|192798984|gb|EDV75496.1| DNA-directed DNA polymerase [Geobacillus sp. Y412MC10] (443 aa)
Score = 320, Expect = 1.1e-27, Identities = 97/367 (26%), Positives = 195/367 (53%)
  Q:     5 IFHIDMDSFFASVELAERPE-YEKLPLAV-GHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKR-KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFS----KYDQVIN-LSITANNIMENDNNE-QLTIFDSPTQ--KISTESKLEKIRKQVNKT 371
           I H+DM++F+ SV  AE PE Y     AV G +     VI + +Y AR LG+++ MN+  A +I P L II P+ + Y   S+   +   + +  +E  SIDE YLD++ ++ +    ++ A  ++  I+++ +L C+VG +    LAKMA+++ KP+G   L   +    +++   +++ GIG     +L +LN+  I  +A   ++ L+    G+  S ++    GI   P+  + ++ K++G + ++ ++ +  +E  +++  L+D +   L+ Q  +   + I +R  D  + T+S +       IP     D++ +  +      K D+ +  L +T   +   + +  QL +FD   Q  K S    ++++R +  ++
  S:    15 ILHVDMNAFYCSVHEAEEPELYRGKATAVAGSIELRKGVIVTCSYAARSLGIRTGMNVRQALRIYPDLMIIQPDFHLYRKYSNAFMNIAYAYTPQLEATSIDECYLDITGSK-QFGTPLDIAREIQERIREELSLPCSVGIAPNKLLAKMASDMKKPNGLSVLRIRDVPQVLWNKPCAELFGIGSKTADKLRKLNIQTIGQLA-AADESLLTSTFGVMGSWMKRAASGIDHAPVVAEREQSKSIGHTTTLPQDVTSAEEARRVLLNLSDQVARRLRRQGLVTSGIQITLRTPDMKTITRSRHLA-----IPTENTEDIYREACELYNRHWKQDKPLRLLGVTLQQLTAKEESAIQLDLFDYEKQPKKESLTRVMDELRNKFGES 391
>gi|168281605|ref|ZP_02689272.1| DNA polymerase IV (Pol IV) [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|170762215|ref|YP_001752523.1| DNA polymerase IV (Pol IV) [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189044617|sp|B1AJ79|DPO4_UREP2 DNA polymerase IV (Pol IV) >gi|22095642|sp|Q9PQ53|DPO4_UREPA DNA polymerase IV (Pol IV) >gi|168827792|gb|ACA33054.1| DNA polymerase IV (Pol IV) [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675916|gb|EDT87821.1| DNA polymerase IV (Pol IV) [Ureaplasma parvum serovar 14 str. ATCC 33697] (360 aa)
Score = 320, Expect = 1.1e-27, Identities = 104/345 (30%), Positives = 187/345 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEF-ASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINL-SITANNIMENDN-NEQLTIFD 349
           I H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVK+AM I  AK++CP L I+    N Y S S   +  ++  +  IE  SIDE ++D ++   +    I   A+ ++  IK K NL+ ++G S+   +AKMAT L KP G   + ++   + IY+L+I+KI  IG   +++L  +N+  IK++   +N   I   +G  +  L  ++ G+    I  +   K +  S++   + +++ E    + +L   + + LK  + M  +++I I+Y    +  K      + +  Q     + +LF+ +      D+ I L  I+ N +++ +N  +QL +FD
  S:     9 IMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKAAMPIFLAKELCPNLIILPSEHNIYQSYSKHFFQIINKYTNKIEITSIDECFIDATDLVKKYHNNIRLLATKIQKEIKNKLNLSISIGISYNKTIAKMATELNKPSGISIIDENKIINLIYELNINKIPYIGEIKSQELYAINIFKIKELIATENKQKISLVLGSIYQNLVNDLKGLSKIKIIDEDIYKTISHSKTFNEDLNDFYEISNEMNDLILTVTNRLKKCNLMTNNISIYIKYPSFKTKIKQKQLTYYTDDYQTIFLAIKNLFKIMYK----DETIRLIGISLNKLVKKENVKKQLFLFD 360
>gi|87200669|ref|YP_497926.1| DNA polymerase IV [Novosphingobium aromaticivorans DSM 12444] >gi|87136350|gb|ABD27092.1| DNA-directed DNA polymerase [Novosphingobium aromaticivorans DSM 12444] (378 aa)
Score = 320, Expect = 1.2e-27, Identities = 83/292 (28%), Positives = 147/292 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           K+ H+DMD+FFASVE  + P+    P+AVG      V+A+A+Y AR  GV+SAM    A  +CP L    P  + Y S+S +I +     + ++E  S+DE YLDV++           A L++  IK    L  + G S+  FLAK+A++  KPDG   +       ++  L + +  GIGP    ++  L +    D+   ++   +R+  G     L   V GI    +  D  RK++G  ++  R+ S      + ++ + + +   ++      ++V +K++++D    T++
  S:    19 KVIHVDMDAFFASVEQRDNPDLRGKPVAVGGSSGRGVVAAASYEARKFGVRSAMPSARAIVLCPDLIFCRPRFDVYRSVSQQIRAIFLDYTPHVEPLSLDEAYLDVTDDVRGIGSATRIAELIRRRIKADTGLTASAGVSYNKFLAKIASDQNKPDGMCVIRPGEGAQFVASLPVRRFHGIGPRGAEKMAALGIETGADL-RARDLPFLRQHFGSLADYLYRAVRGIDLRQVKADRPRKSVGAERTFERDISSGPALRETLERILEIVWDRIERSGASGRTVTLKMKFNDFTPITRA 314
>gi|187733383|ref|YP_001879027.1| DNA polymerase IV [Shigella boydii CDC 3083-94] >gi|187430375|gb|ACD09649.1| DNA polymerase IV [Shigella boydii CDC 3083-94] (354 aa)
Score = 320, Expect = 1.2e-27, Identities = 86/293 (29%), Positives = 154/293 (52%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           K KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     4 KVKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 303
>gi|116619978|ref|YP_822134.1| DNA-directed DNA polymerase [Solibacter usitatus Ellin6076] >gi|116223140|gb|ABJ81849.1| DNA-directed DNA polymerase [Solibacter usitatus Ellin6076] (414 aa)
Score = 320, Expect = 1.2e-27, Identities = 81/290 (27%), Positives = 155/290 (53%)
  Q:     6 FHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWS-KLR-MNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           FH+DMD+FF SVE    P  +  P+ VG       V+++A+Y AR  GV SAM +  A K+CPQ   +  + ++Y   S +++  L S S  +E  S+DE YLD++ T+      +  A L+   +K    LNC++G + +  +AK+ ++ AKP+G + +      +++  L + KI G+G    + L  L +  + D+A + + +L  +  K G+  + K R ++  G     I  +   K++    +   + ++  +    +  L++ +   L+ Q    +++ +K+RYSD  + T++
  S:     5 FHVDMDAFFVSVEELFDPSLKGKPVVVGGQSNERGVVSAASYAARKFGVHSAMPLRTAYKLCPQAIFVDGHPDRYREYSHRVHEVLESFSPLVEMASVDEAYLDITGTERLYGPPLRAAHLLHERMKAATKLNCSIGIAASRLVAKITSDQAKPNGIMWILAGREAAFLAPLDVRKIPGVGKVTEKNLHLLGIRKVGDLARLDDAFLEERFGKWGMALAGKSRGLDAGGWFDTEIGEEQGPKSISHEHTFNEDTADLGQIESTLARLSEMVGRRLREQALEARTLQLKLRYSDFSTITRA 304
>gi|167971561|ref|ZP_02553838.1| DNA polymerase family protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700924|gb|EDU19206.1| DNA polymerase family protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (360 aa)
Score = 320, Expect = 1.2e-27, Identities = 104/345 (30%), Positives = 186/345 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEF-ASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINL-SITANNIMENDN-NEQLTIFD 349
           I H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVK+AM I  AK++CP L I+    N Y S S   +  ++  +  IE  SIDE ++D +    +    I   A+ ++  IK K NL+ ++G S+   +AKMAT L KP G   + ++   + IY+L+I+KI  IG   +++L  +N+  IK++   +N   I   +G  +  L  ++ G+    I  +   K +  S++   + +++ E    + +L   + + LK  + M  +++I I+Y    +  K      + +  Q     + +LF+ +      D+ I L  I+ N +++ +N  +QL +FD
  S:     9 IMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKAAMPIFLAKELCPNLIILPSEHNIYQSYSKHFFQIINKYANKIEITSIDECFIDATGLVKKYHNNIRLLATKIQKEIKNKLNLSISIGISYNKTIAKMATELNKPSGISIIDENKIINLIYELNINKIPYIGEIKSQELYAINIFKIKELIATENKQKISLVLGSIYQNLVNDLKGLSEIKIIDEDIYKTISHSKTFNEDLNDFYEISNEMNDLILTVTNRLKKCNLMTNNISIYIKYPSFKTKIKQKQLTYYTDDYQTIFLAIKNLFKIMYK----DETIRLIGISLNKLVKKENVKKQLFLFD 360
>gi|19704534|ref|NP_604096.1| DNA polymerase IV [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|24211649|sp|Q8REB0|DPO4_FUSNN DNA polymerase IV (Pol IV) >gi|19714816|gb|AAL95395.1| DNA polymerase IV [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (350 aa)
Score = 320, Expect = 1.3e-27, Identities = 106/340 (31%), Positives = 183/340 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT-QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDG-FLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKY-------QDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMEND 340
           M+  I H DMD+F+AS+E+   P+ +  PL VG  ++ +A+Y AR   + SAM + DAK +CP+L ++  +K +Y  +S++I++ +  ++  +E  + DE Y+D+++  + EN K   F    K  IK+  NL C+VG  F    AK+A+++ KP G F+   ++ F  +I D  I  I G+G      L    + Y+KDI     DYL++K        L  +V GI  D +  +Y+R+      SI N   +   L+   E+  + NS  +Y        +   +S+ IK+RY+   + TKS   + F  +    +  ++FE I+ F K D+V  L +   +I +++
  S:     1 MERIIMHYDMDAFYASIEINRNPKLKNKPLVVGENIVTTASYEARKYDIHSAMKVSDAKLLCPKLIVLPVDKTEYIRISNEIHNLILKITNKVEFVATDEGYIDLTDVIKPENKK--AFVIKFKQRIKELTNLTCSVGIGFNKLSAKIASDINKPFGFFIFENEEEFIKHISDKKIKIIPGVGKKFFEILKNDKIFYVKDIFKYPLDYLVKKYGKSRGENLYCSVRGIDFDEV--EYQRE----IYSIGNEETFLIPLQNNSEIIREFNSLFEYTFERLLKNNVFTQSITIKMRYTSFKTYTKS-KKLKFSTRSKDFLYNEMFELINSFEKEDEVRLLGVYFGDIKKSN 340
>gi|37680765|ref|NP_935374.1| DNA polymerase IV [Vibrio vulnificus YJ016] >gi|37199514|dbj|BAC95345.1| DNA-damage-inducible protein P [Vibrio vulnificus YJ016] (358 aa)
Score = 320, Expect = 1.3e-27, Identities = 84/258 (32%), Positives = 139/258 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDY-LIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI HIDMD F+A+VE+ + P +   PLAVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S  I S  S  +  IE  S+DE YLDV+++   +      A  ++  I  +  L  + G +   FLAK+A+++ KP+G   +  +  +S I  L + KI G+G     +L +  L+  +D+ N  +DY  + K+ G   + L     GI    +  + +RK++G  ++  +N   Y++  ++I+E
  S:    11 KIIHIDMDCFYAAVEMRDNPNFRSRPLAVGGHEKQRGVISTCNYEARKFGVRSAMPTAQALKLCPSLLVVPGRMQVYKEVSTHIRSIFSRYTHLIEPLSLDEAYLDVTDSTQCHGSATLIAEAIRRDIWNELQLTASAGVAPIKFLAKVASDMNKPNGQFVIPPEQVQSVIDTLPLQKIPGVGKVSLEKLNQAGLYVCQDVKN--SDYRQLLKQFGRLGASLWQRSHGIDEREVIVERERKSVGVERTFTQNIVTYEQCWQVIEE 273
>gi|156935265|ref|YP_001439181.1| DNA polymerase IV [Enterobacter sakazakii ATCC BAA-894] >gi|189027667|sp|A7MEN4|DPO4_ENTS8 DNA polymerase IV (Pol IV) >gi|156533519|gb|ABU78345.1| hypothetical protein ESA_03117 [Enterobacter sakazakii ATCC BAA-894] (351 aa)
Score = 320, Expect = 1.3e-27, Identities = 88/285 (30%), Positives = 147/285 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSD 288
           KI H+DMD FFA+VE+ + P    +PLA+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  I    S  +  IE  S+DE YLDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L   +D+       L+ K+ G     L     GI    I+ D +RK++G  +++  +  E+ E   +++ L  ++   L     D       +K++++D
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPLAIGGSRERRGVISTANYPARKYGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASAHIREIFSRYTSLIEPLSLDEAYLDVTHSPHCYGSATLMAKEIRQTIFDELQLTASAGIAPIKFLAKIASDLNKPNGQYVITPEEVPGFLRTLPLGKIPGVGKVTAAKLESLGLRTCEDVQKSDLAALL-KRFGKFGRVLWERSQGIDDREISSDRQRKSVGVERTLAEDIHEWAECEAIVELLYPELERRLAAVQPDLRIARQGVKLKFND 294
>gi|15799936|ref|NP_285948.1| DNA polymerase IV [Escherichia coli O157:H7 EDL933] >gi|15829512|ref|NP_308285.1| DNA polymerase IV [Escherichia coli O157:H7 str. Sakai] >gi|168763472|ref|ZP_02788479.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4501] >gi|22095615|sp|Q8X7Q1|DPO4_ECO57 DNA polymerase IV (Pol IV) >gi|12513002|gb|AAG54556.1|AE005201_9 damage-inducible protein P; putative tRNA synthetase [Escherichia coli O157:H7 EDL933] >gi|13359715|dbj|BAB33681.1| damage-inducible protein DinP [Escherichia coli O157:H7 str. Sakai] >gi|189366404|gb|EDU84820.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4501] (351 aa)
Score = 320, Expect = 1.3e-27, Identities = 87/291 (29%), Positives = 151/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVTPVKFLAKIASDMNKPNGQFVITPAEVSAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|133919925|emb|CAM12485.1| hypothetical protein [uncultured bacterium] (418 aa)
Score = 319, Expect = 1.4e-27, Identities = 98/377 (25%), Positives = 187/377 (49%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLH----WSKLRMNVLGIIC--DPINPDYKRKNLGRS-QSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF-VNFQNQIPLHVVVDLFEQISDFSKYDQVI-NLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKII 377
           M   I H DM++F+ASVE    P  +K P+AV       H ++ + NY A+   VK+   +  AK+ C  L ++ P+  +Y   S    S     +  +E   +DE +LD+S T+       + A+ ++ ++K +  L  +VG SF    AK+ +++ KPD    + KD FK  I+ L  + ++G+G +  R L    +  I D+AN   ++L R+++G +    W+    N L ++   D ++P    K++G    ++ +  + ++   +  ELT DI   L+      + V I IR  D    T+ +   +    Q P+ +    F+       ++  I ++++ A N++  D   Q+ +F    ++   E ++EK  +++ +   K  I
  S:     8 MLRSILHCDMNNFYASVECMLDPALKKYPIAVCGSVEERHGIVLAKNYKAKAFDVKTGDAVWQAKQKCKDLVVVPPHYEEYIKYSKLARSVYERYTDQVEPYGMDECWLDISGTESLFGSPEKVANEIRETMKFELGLTISVGVSFNKIFAKLGSDMKKPDAVTVIPKDTFKEKIWGLPAADLLGVGRATQRVLDSYCIRTIGDLANNDPEFL-RRRLGKNGVVLWNYANGNDLSLVAKKDFVSP---IKSVGHGITTVADLEKPEQVWPVFLELTQDIGHKLRVHGLSAEGVAIHIR--DNTLNTRQWQTKIALPTQSPMIIAKTAFQLFEKRYGWNNPIRSVTVQAINLIPQDTPRQIDMFMDAAKQDKLE-RMEKCVEEIRRRFGKDSI 392
>gi|55821632|ref|YP_140074.1| DNA polymerase IV [Streptococcus thermophilus LMG 18311] >gi|81560203|sp|Q5M2Y5|DPO4_STRT2 DNA polymerase IV (Pol IV) >gi|55737617|gb|AAV61259.1| DNA polymerase IV, damage-inducible [Streptococcus thermophilus LMG 18311] (367 aa)
Score = 319, Expect = 1.4e-27, Identities = 95/344 (27%), Positives = 171/344 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL--------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTI 347
           KI HIDMD+FFA VE+ + P  +  P+ +G+         V+++ NY AR  GV SAM+  +A + CP    I  N + Y  +  +I       +  +E  SIDE YLDV+  +      ++ A L++  I Q+ +L C+ G S+  F+AK+A++  KP G   +  +  + ++  L I+K  G+G     +L +++++   D+  +    LI  + G     L     GI   P+ P+  RK++G  ++     Y+E     +L K       S  K +  + + + IK+RYSD  + TK                +   +F+Q+ + S   +++ +++T    +E+    QL +
  S:    13 KIIHIDMDAFFAQVEMRDDPSLKDKPVIIGNDPRKTGGRGVVSTCNYEARKYGVHSAMSSKEAYERCPNAVFISGNYSHYREVGMQIREIFKCYTDLVEPMSIDEAYLDVTTNKLGIKSAVKVAKLIQYDIWQELHLTCSAGVSYNKFIAKLASDFQKPAGLTVVLPEEAQEFLKKLPIAKFHGVGKKSVERLHDMDIYTGADLLKISEITLI-DRFGRFGFDLFRKARGISNSPVKPNRVRKSIGSERTYGKLLYNEDDIKAELTKNAKRVAESAQKAKK-VGRIIVIKVRYSDFSTLTKRMTLDKSTQDFDTIDRISHSIFDQLEENSSGVRLLGVTLTG---LEDQEGRQLDL 363
>gi|168707994|ref|ZP_02740271.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4045] >gi|168717322|ref|ZP_02749599.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4206] >gi|168737541|ref|ZP_02769818.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4115] >gi|168750214|ref|ZP_02775236.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4113] >gi|168757259|ref|ZP_02782266.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4401] >gi|168770029|ref|ZP_02795036.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4486] >gi|168776129|ref|ZP_02801136.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4196] >gi|168782992|ref|ZP_02807999.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4076] >gi|168789704|ref|ZP_02814711.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC869] >gi|168792639|ref|ZP_02817646.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4042] >gi|168800331|ref|ZP_02825338.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC508] >gi|195938634|ref|ZP_03084016.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4024] >gi|187768454|gb|EDU32298.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4196] >gi|188015590|gb|EDU53712.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4113] >gi|188999602|gb|EDU68588.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4076] >gi|189355747|gb|EDU74166.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4401] >gi|189361061|gb|EDU79480.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC4486] >gi|189370777|gb|EDU89193.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC869] >gi|189377361|gb|EDU95777.1| DNA polymerase IV [Escherichia coli O157:H7 str. EC508] (351 aa)
Score = 319, Expect = 1.4e-27, Identities = 87/291 (29%), Positives = 151/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVSAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|93006387|ref|YP_580824.1| DNA-directed DNA polymerase [Psychrobacter cryohalolentis K5] >gi|92394065|gb|ABE75340.1| DNA-directed DNA polymerase [Psychrobacter cryohalolentis K5] (371 aa)
Score = 319, Expect = 1.4e-27, Identities = 88/292 (30%), Positives = 151/292 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + PE    PL VG       V+A+A+Y  R  GV+SAM+  +A+K CP++  + P  + Y ++S +I   +  L+ ++E  S+DE YLDV+            A+ ++  I  +  LN + G SF   LAK+A+++ KP+G   +T  +  ++I  L I +  GIG +  ++L  + +    D+       L+ +  K G  +  +     G     +  +   K++G   + R N ++  E    I E   D  S L  +  +  ++ +K++YSD    T+S
  S:    21 KIIHIDMDAFYASVEQRDFPELRGKPLVVGGDPNGRGVVAAASYEVRKFGVRSAMSCYEARKRCPEVIFVPPRFDVYRAVSVEIRRIMHILTPHVEPLSLDEAYLDVTGLSVHQGSATLMANWLRAQILGQTGLNASAGVSFNKMLAKIASDINKPNGTAVITPADADAFISALPIERFHGIGKATAKRLHAMGVSNGADLRRTPAAILVNEFGKRGQFYHDI---AHGRDERAVKSERTHKSVGSETTFRENLTDDNELKIQIYEQNADAFSQLHKKQLIAYTITLKVKYSDFTQVTRS 317
>gi|152997785|ref|YP_001342620.1| DNA-directed DNA polymerase [Marinomonas sp. MWYL1] >gi|189027670|sp|A6W1V6|DPO4_MARMS DNA polymerase IV (Pol IV) >gi|150838709|gb|ABR72685.1| DNA-directed DNA polymerase [Marinomonas sp. MWYL1] (352 aa)
Score = 319, Expect = 1.6e-27, Identities = 88/317 (27%), Positives = 163/317 (51%)
  Q:     1 MKN-KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDY-LIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDF--MFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQI 317
           M+N KI HID D F+A++E+ + P    +P+A+G       V+++ANY AR  GV+SAM    AK++CP L +I  N NKY   S+++++     +  IE  S+DE YLDV+N+          A  +++ I ++  +  + G +   F+AK+A++  KPDG   +T +    ++ ++ +  I GIG     +L  L +    D+  +  D+ +++K  G    +L    LGI   P+    +RK++    +  ++  + +E   ++  L  D+   +  +DF        +K+++ D       F     +  I   +  D+F Q+
  S:     1 MQNRKIIHIDADCFYAAIEMRDDPNLRDIPMAIGGPASGRSVLSTANYAARVYGVRSAMPTSVAKRLCPALLVIPGNMNKYRLASEQMHAIFREFTDIIEPLSLDEAYLDVTNSSSFQGSATRIAEEIRSRILKEVGITVSAGVATNKFIAKVASDWDKPDGLTVVTPEKQFEFVSNVPVKFISGIGRVAQEKLASLGVFKCSDLQAL--DFSVLQKSFGSMSFRLSQFALGIDDRPVTVSRERKSISVEHTFSKDLLDLKECQAVLPILLTDLKKRMSGRDFESQLSKYYLKVKFDD-------FKQTTIEQPIKAKLSDDVFSQL 318
>gi|117919398|ref|YP_868590.1| DNA polymerase IV [Shewanella sp. ANA-3] >gi|189027688|sp|A0KTR5|DPO4_SHESA DNA polymerase IV (Pol IV) >gi|117611730|gb|ABK47184.1| UMUC domain protein DNA-repair protein [Shewanella sp. ANA-3] (359 aa)
Score = 319, Expect = 1.6e-27, Identities = 94/290 (32%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S +I +     ++ IE  S+DE YLDVS+ +         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +  D    ++  L + KI G+G     +L  L L+   D+       LI  + G   + L     GI    I+   +RK++G     +Q I    + Q+ +  LI+EL+  +    K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSRVQRGVISTCNYEARKFGVRSAMATGYALKLCPDLILVPGRMQVYKEVSQQIRAIFCRYTELIEPLSLDEAYLDVSDCKLFKGSATLIAEAIRRDILAETGLTASAGVAPIKFLAKVASDLNKPNGQCVIPPDEVAEFVKSLSLRKIPGVGKVTAEKLSSLGLNTCADVQAYPKQELI-ARFGKFGTVLVERAHGIDERGISVSRERKSVGVETTLAQDIYTLEQCQQVMPGLIQELSSRLGRSAKGRQ-IHKQV-VKLKFNDFKQTT 299
>gi|118463437|ref|YP_879466.1| DNA polymerase IV [Mycobacterium avium 104] >gi|118164724|gb|ABK65621.1| DNA polymerase IV 2 [Mycobacterium avium 104] (400 aa)
Score = 319, Expect = 1.6e-27, Identities = 79/291 (27%), Positives = 147/291 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL---IRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI---RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+DSF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++AM    A+++CP   ++ P  + YT  SD ++      +  +E  S+DE +LDV   +  +   +  A  ++  ++ +  L  TVG + T FLAK+A+  AKPDG L +  D   +++  L + ++ G+G     +L    +  + D+A +    L   +   +G     L  N   I    ++   +R+++G  +++    N     E   ++  L D I   ++      ++V +++R+ D   AT+S
  S:     9 ILHADLDSFYASVEQRDDPTLRGRPVIVGGGVVLAASYEAKAYGVRTAMGGAQARRLCPHAVVVPPRMHAYTRASDAVFRVFRECTPLVEALSVDEAFLDVGGLRRVSGTPVAIAQRLRADVRDRVGLPITVGIARTKFLAKVASQQAKPDGLLLVPPDQELAFLRPLPVRRLWGVGAVTAEKLRAHGIATVADVAELSESTLGSMVGAAMGRQLYALSRN---IDRRRVSTGVRRRSVGAQRALGRAGNTMSDSEIDAVVVNLIDRITGRMRAAGRTGRTVVLRLRFDDFTRATRS 302
>gi|26246277|ref|NP_752316.1| DNA polymerase IV [Escherichia coli CFT073] >gi|29427651|sp|P59477|DPO4_ECOL6 DNA polymerase IV (Pol IV) >gi|26106675|gb|AAN78860.1|AE016756_43 DNA polymerase IV [Escherichia coli CFT073] (351 aa)
Score = 318, Expect = 1.8e-27, Identities = 87/291 (29%), Positives = 151/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|161594047|ref|NP_904033.2| DNA polymerase IV [Chromobacterium violaceum ATCC 12472] (379 aa)
Score = 318, Expect = 1.8e-27, Identities = 83/292 (28%), Positives = 147/292 (50%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGL-KYQDFMFKSVNIKIRYSDGDSAT 293
           + KI H+D D F+A++E+ + P    +PLAVG       V+A+ NY+AR  GV SAM+   A ++CP+L I+ P+  +Y   S +I +     ++ IE  S+DE YLDV+   +E       A  ++  I+ +  +  + G +   FLAK+A++  KPDG   +   +  +++  L + KI G+G     +L  L +    D+       L R   G    +L     G    P++ D  RK +   ++  ++  +    L  + EL D + + L +     FK +++K+++ D    T
  S:     5 QRKIIHVDCDCFYAAIEMRDDPSLRDVPLAVGGRPETRGVVATCNYIARRYGVHSAMSSARALRLCPELLIVPPDMARYRLASQQIMAIYQRYTEVIEPLSLDEAYLDVTGQPHERGSATLMAEAIRRQIRDEVGITASAGIAPNKFLAKVASDWNKPDGQYLIRPRDIDAFVAVLPVEKIHGVGRVTAERLHRLGIRSCGDLRRWSPADLFR-HFGSFGERLLALAHGRDERPVSTDRSRKTISVEETYAQDLPDLASCLSKLPELVDRLQARLARSGSPAFKGLSVKLKFDDFSQTT 302
>gi|34105668|gb|AAQ62022.1| DNA-damage-inducible protein P [Chromobacterium violaceum ATCC 12472] (496 aa)
Score = 318, Expect = 1.8e-27, Identities = 83/292 (28%), Positives = 147/292 (50%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGL-KYQDFMFKSVNIKIRYSDGDSAT 293
           + KI H+D D F+A++E+ + P    +PLAVG       V+A+ NY+AR  GV SAM+   A ++CP+L I+ P+  +Y   S +I +     ++ IE  S+DE YLDV+   +E       A  ++  I+ +  +  + G +   FLAK+A++  KPDG   +   +  +++  L + KI G+G     +L  L +    D+       L R   G    +L     G    P++ D  RK +   ++  ++  +    L  + EL D + + L +     FK +++K+++ D    T
  S:   122 QRKIIHVDCDCFYAAIEMRDDPSLRDVPLAVGGRPETRGVVATCNYIARRYGVHSAMSSARALRLCPELLIVPPDMARYRLASQQIMAIYQRYTEVIEPLSLDEAYLDVTGQPHERGSATLMAEAIRRQIRDEVGITASAGIAPNKFLAKVASDWNKPDGQYLIRPRDIDAFVAVLPVEKIHGVGRVTAERLHRLGIRSCGDLRRWSPADLFR-HFGSFGERLLALAHGRDERPVSTDRSRKTISVEETYAQDLPDLASCLSKLPELVDRLQARLARSGSPAFKGLSVKLKFDDFSQTT 419
>gi|40062939|gb|AAR37809.1| DNA polymerase IV [uncultured marine bacterium 443] (356 aa)
Score = 318, Expect = 1.8e-27, Identities = 67/210 (31%), Positives = 114/210 (54%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK 210
           M  KI HID D F+A++E+ + P    +P+AVG       V+ +ANY AR  GV+SAM+   A ++CP LT++ P  NKY   S  + +     +  IE  S+DE YLDV+ +   +      A  ++  ++ + ++  + G S   F+AK+A++  KP+G   +T +    ++  L + KI G+G    +++    L    DI + +   LIR+
  S:     1 MPRKIIHIDADCFYAAIEMRDDPSLRGIPMAVGGSADRRGVLTTANYDARRYGVRSAMSTAHAMRLCPHLTVVPPQFNKYRDASRAMRTIFEEYTDMIEPLSLDEAYLDVTESSGAHVTATRMAKEIRAKVEDELDITVSAGVSVNKFIAKVASDWQKPNGLTVVTPEQVDLFVKALPVQKIPGVGAVTAQKMHRYGLKTCSDIRDWELHELIRR 215
>gi|157159715|ref|YP_001457033.1| DNA polymerase IV [Escherichia coli HS] >gi|193068712|ref|ZP_03049673.1| DNA polymerase IV [Escherichia coli E110019] >gi|189027663|sp|A7ZWJ6|DPO4_ECOHS DNA polymerase IV (Pol IV) >gi|157065395|gb|ABV04650.1| DNA polymerase IV [Escherichia coli HS] >gi|192958075|gb|EDV88517.1| DNA polymerase IV [Escherichia coli E110019] (351 aa)
Score = 318, Expect = 1.8e-27, Identities = 87/291 (29%), Positives = 151/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|116628345|ref|YP_820964.1| DNA polymerase IV [Streptococcus thermophilus LMD-9] >gi|122267060|sp|Q03J54|DPO4_STRTD DNA polymerase IV (Pol IV) >gi|116101622|gb|ABJ66768.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Streptococcus thermophilus LMD-9] (367 aa)
Score = 318, Expect = 1.9e-27, Identities = 95/346 (27%), Positives = 172/346 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL--------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFD 349
           KI HIDMD+FFA VE+ + P  +  P+ +G+         V+++ NY A+  GV SAM+  +A + CP    I  N + Y  +  +I       +  +E  SIDE YLDV+  +      ++ A L++  I Q+ +L C+ G S+  F+AK+A++  KP G   +  +  + ++  L I+K  G+G     +L +++++   D+  +    LI  + G     L     GI   P+ P+  RK++G  ++     Y+E     +L K       S  K +  + + + IK+RYSD  + TK                +   +F+Q+ + S   +++ +++T    +E+    QL + D
  S:    13 KIIHIDMDAFFAQVEMRDDPSLKDKPVIIGNDPRKTGGRGVVSTCNYEAKKYGVHSAMSSKEAYERCPNAVFISGNYSHYREVGMQIREIFKCYTDLVEPMSIDEAYLDVTTNKLGIKSAVKVAKLIQYDIWQELHLTCSAGVSYNKFIAKLASDFQKPAGLTVVLPEEAQEFLKKLPIAKFHGVGKKSVERLHDMDIYTGADLLKISEITLI-DRFGRFGFDLFRKARGISNSPVKPNRVRKSIGSERTYGKLLYNEDDIKAELTKNAKRVAESAQKAKK-VGRIIVIKVRYSDFSTLTKRMTLDKSTQDFDTIDRISHSIFDQLEENSSGVRLLGVTLTG---LEDQEGRQLDLDD 365
>gi|89210838|ref|ZP_01189222.1| UMUC-like DNA-repair protein [Halothermothrix orenii H 168] >gi|89159579|gb|EAR79243.1| UMUC-like DNA-repair protein [Halothermothrix orenii H 168] (385 aa)
Score = 318, Expect = 1.9e-27, Identities = 97/367 (26%), Positives = 192/367 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIP--LHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQ 367
           M+  I H+DMD+FFASVE  + PE+ + P+ VG +      V+++A+Y AR  GVKSAM++V+A+++CP+   +    ++Y  +S+KI+   ++ +  +E  SIDE +LD++         +E    +KN IK++  L  ++G S+  FLAK+A+ + KPDGF  +  +N    +  L + ++ GIG    + L+   +  +  + ++    L +  +G    +L     GI    + P    K++   ++   +  +  E +  +  +++ +   L+       +V IK+RY++  + T+      + +         + L ++ +  SK  ++  L I   N+ +N N  QL++F    +K    S ++KI+ +
  S:     1 MELDIMHVDMDAFFASVEQLDNPEFRRKPVIVGGIDLENRGVVSTASYEARKYGVKSAMSVVEARRLCPEGIFVKGRHSRYREISEKIFRIFNTYTPLVEKVSIDEAFLDLTGCHRLFGSSVEIGKKIKNKIKEQLGLTASIGLSYNKFLAKLASGMDKPDGFFIIDDNNVDKILNKLCVGEVWGIGKKTEQLLLSKGIKTVGMLRHLSKSDL-KGILGKQGLQLYYLARGIDDRHVEPGSDIKSISHEETFSDDLIDPDEVMSHLMNMSERVARRLRKNCLKGSTVFIKVRYNNRVTLTRRTTIKEYVDDTDSIYRTGLLLIKKHNLLSKPIRL--LGIGMANLTDN-NGIQLSLFTDRVRKKRLTSTIDKIKDR 372
>gi|16128217|ref|NP_414766.1| DNA polymerase IV [Escherichia coli str. K-12 substr. MG1655] >gi|74310874|ref|YP_309293.1| DNA polymerase IV [Shigella sonnei Ss046] >gi|89107104|ref|AP_000884.1| DNA polymerase IV [Escherichia coli W3110] >gi|170021341|ref|YP_001726295.1| DNA-directed DNA polymerase [Escherichia coli ATCC 8739] >gi|170079858|ref|YP_001729178.1| DNA polymerase IV [Escherichia coli str. K12 substr. DH10B] >gi|188492262|ref|ZP_02999532.1| DNA polymerase IV [Escherichia coli 53638] >gi|194438229|ref|ZP_03070321.1| DNA polymerase IV [Escherichia coli 101-1] >gi|2501652|sp|Q47155|DPO4_ECOLI DNA polymerase IV (Pol IV) >gi|123617967|sp|Q3Z5A4|DPO4_SHISS DNA polymerase IV (Pol IV) >gi|189027665|sp|B1J100|DPO4_ECOLC DNA polymerase IV (Pol IV) >gi|984587|dbj|BAA07593.1| DinP [Escherichia coli W3110] >gi|1552799|gb|AAB08651.1| DinP [Escherichia coli] >gi|1786425|gb|AAC73335.1| DNA polymerase IV [Escherichia coli str. K-12 substr. MG1655] >gi|4902967|dbj|BAA77901.1| DNA polymerase IV [Escherichia coli W3110] >gi|73854351|gb|AAZ87058.1| damage-inducible protein P [Shigella sonnei Ss046] >gi|169756269|gb|ACA78968.1| DNA-directed DNA polymerase [Escherichia coli ATCC 8739] >gi|169887693|gb|ACB01400.1| DNA polymerase IV [Escherichia coli str. K12 substr. DH10B] >gi|188487461|gb|EDU62564.1| DNA polymerase IV [Escherichia coli 53638] >gi|194422893|gb|EDX38888.1| DNA polymerase IV [Escherichia coli 101-1] (351 aa)
Score = 318, Expect = 1.9e-27, Identities = 85/291 (29%), Positives = 153/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|13358000|ref|NP_078274.1| hypothetical protein UU437 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|6899428|gb|AAF30849.1|AE002140_8 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (351 aa)
Score = 318, Expect = 1.9e-27, Identities = 103/343 (30%), Positives = 186/343 (54%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEF-ASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN--QIPLHVVVDLFEQISDFSKYDQVINL-SITANNIMENDN-NEQLTIFD 349
           H+D+D+F+A+V     PEY+  P+AVG L     +I+S NY+AR  GVK+AM I  AK++CP L I+    N Y S S   +  ++  +  IE  SIDE ++D ++   +    I   A+ ++  IK K NL+ ++G S+   +AKMAT L KP G   + ++   + IY+L+I+KI  IG   +++L  +N+  IK++   +N   I   +G  +  L  ++ G+    I  +   K +  S++   + +++ E    + +L   + + LK  + M  +++I I+Y    +  K      + +  Q     + +LF+ +      D+ I L  I+ N +++ +N  +QL +FD
  S:     2 HLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKAAMPIFLAKELCPNLIILPSEHNIYQSYSKHFFQIINKYTNKIEITSIDECFIDATDLVKKYHNNIRLLATKIQKEIKNKLNLSISIGISYNKTIAKMATELNKPSGISIIDENKIINLIYELNINKIPYIGEIKSQELYAINIFKIKELIATENKQKISLVLGSIYQNLVNDLKGLSKIKIIDEDIYKTISHSKTFNEDLNDFYEISNEMNDLILTVTNRLKKCNLMTNNISIYIKYPSFKTKIKQKQLTYYTDDYQTIFLAIKNLFKIMYK----DETIRLIGISLNKLVKKENVKKQLFLFD 351
>gi|157156229|ref|YP_001461421.1| DNA polymerase IV [Escherichia coli E24377A] >gi|191165703|ref|ZP_03027542.1| DNA polymerase IV [Escherichia coli B7A] >gi|193063270|ref|ZP_03044361.1| DNA polymerase IV [Escherichia coli E22] >gi|194427631|ref|ZP_03060179.1| DNA polymerase IV [Escherichia coli B171] >gi|189027662|sp|A7ZHZ2|DPO4_ECO24 DNA polymerase IV (Pol IV) >gi|157078259|gb|ABV17967.1| DNA polymerase IV [Escherichia coli E24377A] >gi|190904210|gb|EDV63920.1| DNA polymerase IV [Escherichia coli B7A] >gi|192931178|gb|EDV83781.1| DNA polymerase IV [Escherichia coli E22] >gi|194414401|gb|EDX30675.1| DNA polymerase IV [Escherichia coli B171] (351 aa)
Score = 318, Expect = 2.0e-27, Identities = 85/291 (29%), Positives = 153/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|82775832|ref|YP_402179.1| DNA polymerase IV [Shigella dysenteriae Sd197] >gi|123563306|sp|Q32J17|DPO4_SHIDS DNA polymerase IV (Pol IV) >gi|81239980|gb|ABB60690.1| damage-inducible protein P [Shigella dysenteriae Sd197] (351 aa)
Score = 318, Expect = 2.0e-27, Identities = 87/291 (29%), Positives = 151/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAIGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|114562139|ref|YP_749652.1| DNA polymerase IV [Shewanella frigidimarina NCIMB 400] >gi|122300543|sp|Q086K1|DPO4_SHEFN DNA polymerase IV (Pol IV) >gi|114333432|gb|ABI70814.1| DNA-directed DNA polymerase [Shewanella frigidimarina NCIMB 400] (359 aa)
Score = 318, Expect = 2.1e-27, Identities = 90/290 (31%), Positives = 150/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PE    P+AVG       VI++ +Y AR  GV+SAM+   A ++CPQL ++      Y S+S +I       +  +E  S+DE YLDV++           A  +++ I +   L  + G +   FLAK+A++L KP+G   +T +    ++ DL +SKI G+G   +++L ++ L    D+       LI +  G     L     GI    I+P   RK++G     ++ I    +  + L +LI+EL+  +    K  D       +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPELRGKPIAVGGRSDRRGVISTCSYEARKFGVRSAMSSYHALQLCPQLILVPGRMEVYKSVSLQIREIFHRYTDLVEPLSLDEAYLDVTDCDAHQGSATLIAKTIRDEIFEVTGLTASAGIAPIKFLAKIASDLNKPNGQYVITPNQIADFVKDLPLSKIPGVGKVTSKKLADIGLTTCYDVQQYPKVQLI-EAFGKFGHVLAERAQGIDSRQISPHRVRKSVGVETTLAKDIFTLEQCHQVLPQLIQELSTRVRRSAK--DRQIHKQVVKLKFNDFKQTT 299
>gi|91209319|ref|YP_539305.1| DNA polymerase IV [Escherichia coli UTI89] >gi|110640467|ref|YP_668195.1| DNA polymerase IV [Escherichia coli 536] >gi|117622533|ref|YP_851446.1| DNA polymerase IV [Escherichia coli APEC O1] >gi|191171433|ref|ZP_03032982.1| DNA polymerase IV [Escherichia coli F11] >gi|122424895|sp|Q1RFU0|DPO4_ECOUT DNA polymerase IV (Pol IV) >gi|122958567|sp|Q0TL85|DPO4_ECOL5 DNA polymerase IV (Pol IV) >gi|189027664|sp|A1A7U2|DPO4_ECOK1 DNA polymerase IV (Pol IV) >gi|91070893|gb|ABE05774.1| damage-inducible protein P; DNA polymerase IV [Escherichia coli UTI89] >gi|110342059|gb|ABG68296.1| DNA-damage-inducible protein P (DinP) [Escherichia coli 536] >gi|115511657|gb|ABI99731.1| DNA polymerase IV [Escherichia coli APEC O1] >gi|190908367|gb|EDV67957.1| DNA polymerase IV [Escherichia coli F11] (351 aa)
Score = 318, Expect = 2.3e-27, Identities = 85/291 (29%), Positives = 153/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|170679693|ref|YP_001742392.1| DNA polymerase IV [Escherichia coli SMS-3-5] >gi|170517411|gb|ACB15589.1| DNA polymerase IV [Escherichia coli SMS-3-5] (351 aa)
Score = 317, Expect = 2.3e-27, Identities = 85/291 (29%), Positives = 153/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAKEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|118442868|ref|YP_878523.1| ImpB/MucB/SamB family protein [Clostridium novyi NT] >gi|118133324|gb|ABK60368.1| ImpB/MucB/SamB family [Clostridium novyi NT] (265 aa)
Score = 317, Expect = 2.3e-27, Identities = 72/195 (36%), Positives = 113/195 (57%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDI 199
           I H+DMD+FFASVE  + P  +  P+ VG +    V+++ +Y AR  G++SAM +  AK +CP    +     +Y  +S K++  LS+++  IE  SIDE YLD++N    N    + A  +KN IK+   L  +VG S+  FLAK+A++  KPDG   +TKD     +  L I+K+ GIG     +L  + +  +K +
  S:     9 ILHVDMDAFFASVEAMDNPSLKGKPVVVGGISERGVVSTCSYEARKYGIRSAMPVYKAKYLCPSAIFLPTRHYRYREVSRKVFKILSTVTDKIEQVSIDEAYLDITNI---NMNPKDVAVNIKNMIKENMGLTISVGISYNKFLAKLASDWNKPDGLKIITKDMIPEILMPLSINKVHGIGTKSAEKLNNIGIFTVKQL 204
>gi|170717651|ref|YP_001784729.1| DNA-directed DNA polymerase [Haemophilus somnus 2336] >gi|168825780|gb|ACA31151.1| DNA-directed DNA polymerase [Haemophilus somnus 2336] (354 aa)
Score = 317, Expect = 2.3e-27, Identities = 85/262 (32%), Positives = 140/262 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKEL 262
           M  KI HIDMD F+AS+E+ ++PE    P+AVG L     V+++ NYVAR  G+ SAM    A K+CP L ++  N   Y  +S +I       +  IE  S+DE YLDV++ Q  +      A  ++  I Q+  L  + G +   FLAK+A++  KP+G   +  +    +I  L + KI G+G   T++L ++ L    DI       LI +  KIG    ++     GI   P+    + K++G  +++ +N  + ++ +++I  L
  S:     2 MPRKIIHIDMDCFYASIEIRDKPELYDRPVAVGGLANQRGVLSTCNYVARQFGLHSAMPTSQALKLCPDLVLLAVNMPLYKQVSQQIQHIFLRYTDLIEPLSLDEAYLDVTDCQKCSGSATWIAEEIRQIITQETGLTASAGIAPLKFLAKIASDQNKPNGQFVIKPEEVAMFIRQLPLKKIPGVGKVTTQRLQQMGLETCSDIQQFDYHVLIDRFGKIG---HRIWQFSQGIDERPVQSHREPKSIGLERTLMKNILQVEQGIEVINSL 268
>gi|167645987|ref|YP_001683650.1| DNA-directed DNA polymerase [Caulobacter sp. K31] >gi|167348417|gb|ABZ71152.1| DNA-directed DNA polymerase [Caulobacter sp. K31] (373 aa)
Score = 317, Expect = 2.4e-27, Identities = 86/292 (29%), Positives = 149/292 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + P     PLAVGH     V+A+A+Y AR  GV+SAM    A   CPQL  + P    Y ++S +I++  +  +  IE  S+DE YLDV+  +       + A  ++  I +   L  + G S+  FLAK+A++  KP+G   +     ++++  L I +  G+G     ++  L++H  +D+      +L ++  G           G     +NPD  RK+ G   +  +++   +     +  + DD+ +  +      ++V +KI+++D   AT+S
  S:     6 KIIHIDMDAFYASVEQRDDPSLRGRPLAVGHGARRGVVAAASYEARKFGVRSAMPSTTALAKCPQLIFVPPRFEVYKAVSRQIHAIFADYTDLIEPLSLDEAYLDVTANRRGLATATDTALEIRARILETTGLTASAGISYNKFLAKLASDQRKPNGQFVVPPGKGEAFVQTLPIGRFYGVGAVTEAKMKSLDIHTGEDLHRQSLAFL-QQHFGKSGPWYYAIARGEDHRRVNPDRVRKSSGSETTFDQDHIAPEPIEAGVLAMADDVWAWCQKTGARARTVTVKIKWADFQQATRS 301
>gi|24111721|ref|NP_706231.1| DNA polymerase IV [Shigella flexneri 2a str. 301] >gi|30061848|ref|NP_836019.1| DNA polymerase IV [Shigella flexneri 2a str. 2457T] >gi|81723732|sp|Q83M86|DPO4_SHIFL DNA polymerase IV (Pol IV) >gi|24050502|gb|AAN41938.1| damage-inducible protein P [Shigella flexneri 2a str. 301] >gi|30040092|gb|AAP15825.1| damage-inducible protein P [Shigella flexneri 2a str. 2457T] (351 aa)
Score = 317, Expect = 2.5e-27, Identities = 87/291 (29%), Positives = 150/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L + KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLEKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|110833520|ref|YP_692379.1| DNA polymerase IV [Alcanivorax borkumensis SK2] >gi|110646631|emb|CAL16107.1| DNA polymerase IV [Alcanivorax borkumensis SK2] (371 aa)
Score = 317, Expect = 2.6e-27, Identities = 91/278 (32%), Positives = 147/278 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNT-QYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHW----SKLRMNVLGIICDPINPDYKRKNLGRSQSIRN--------YSEYQEFLKLIKE---------LTDDINSGLKYQDFMFKSVN 281
           KI H+D D F+A+VE+ + P     P+AVG       VIA+ NY AR  GV SAM    A + CP+L I+ PN +KY  +S +I+      +  IE  S+DE YLDVS + Q+EN      A  ++  ++++  +  + G     FLAK+A++  KPDG   +     ++++  L + KI G+G     ++  LNL    D+       L R ++G H+     +L     G    PI    +RK++   ++             E +  L+ +KE         L   + + +KYQDF+  S +
  S:    11 KIIHVDCDCFYAAVEMRDDPALRGRPVAVGGDPHRRGVIATCNYPARQFGVHSAMASSQALRRCPELVIVPPNFDKYRKVSTQIHDIFRRYTSLIEPLSLDEAYLDVSTSEQFEN-SATRIAQALRLDVRREVGITVSAGVGPNKFLAKVASDWRKPDGLFVIPPAQVEAFVTALPVGKISGVGRVTGERMKGLNLKTCGDLQQ-----LSRLELGQHFGSFGERLYHLCRGEDSRPIQTGRRRKSVSVERTYEKDQPTLTDWLRELEGLLEKLKERFAKLDQHYLISGLTAKVKYQDFISMSCD 309
>gi|161501818|ref|NP_760709.2| DNA polymerase IV [Vibrio vulnificus CMCP6] >gi|33301083|sp|Q8DBI7|DPO4_VIBVU DNA polymerase IV (Pol IV) >gi|71151855|sp|Q7MID6|DPO4_VIBVY DNA polymerase IV (Pol IV) (354 aa)
Score = 317, Expect = 2.6e-27, Identities = 84/258 (32%), Positives = 139/258 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDY-LIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI HIDMD F+A+VE+ + P +   PLAVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S  I S  S  +  IE  S+DE YLDV+++   +      A  ++  I  +  L  + G +   FLAK+A+++ KP+G   +  +  +S I  L + KI G+G     +L +  L+  +D+ N  +DY  + K+ G   + L     GI    +  + +RK++G  ++  +N   Y++  ++I+E
  S:     7 KIIHIDMDCFYAAVEMRDNPNFRSRPLAVGGHEKQRGVISTCNYEARKFGVRSAMPTAQALKLCPSLLVVPGRMQVYKEVSTHIRSIFSRYTHLIEPLSLDEAYLDVTDSTQCHGSATLIAEAIRRDIWNELQLTASAGVAPIKFLAKVASDMNKPNGQFVIPPEQVQSVIDTLPLQKIPGVGKVSLEKLNQAGLYVCQDVKN--SDYRQLLKQFGRLGASLWQRSHGIDEREVIVERERKSVGVERTFTQNIVTYEQCWQVIEE 269
>gi|28210190|ref|NP_781134.1| putative DNA polymerase IV [Clostridium tetani E88] >gi|28202626|gb|AAO35071.1| putative DNA polymerase IV [Clostridium tetani E88] (352 aa)
Score = 317, Expect = 2.7e-27, Identities = 90/304 (29%), Positives = 158/304 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           M   I HID+D+FFASVE  + P+    P+ VG      V+A+A+Y AR  GV SAM +  A++ CP    +    ++Y  +S  I+     ++  +E  SIDE YLD++N   E    +E    +K  I ++  L  ++G S+  FLAK+A++  KP+G   + KD   + +  L I+K+ G+G     ++  + +  I+D+  +  D  I    K GL   ++   + G     +    +RK++G   ++R +  + +E  K +   +  I+ GLK      K+V +KI+    ++ TKS    ++ N+
  S:     1 MDRIIMHIDLDAFFASVEQRDNPKLRGKPVIVGGTSGRGVVATASYEARKYGVHSAMPVFMAREKCPNGIYVPSRHDRYREVSKNIFKIFYEITPIVEPVSIDEAYLDITNCGRE---PLEIVKYIKKEIWKREGLTASMGISYNKFLAKLASDWNKPNGVKIIKKDMIPNILLPLPINKVHGMGKKSVEKMNNIGIFKIEDMYKLPLDLFIEYFGKFGL---EIYERIRGFDNREVQVGRERKSIGNETTLRKDTKDTEEIKKYLYTFSKSISEGLKKNHMWGKTVTVKIKNYKFETTTKSKTLKDYINE 305
>gi|114331606|ref|YP_747828.1| DNA-directed DNA polymerase [Nitrosomonas eutropha C91] >gi|114308620|gb|ABI59863.1| DNA-directed DNA polymerase [Nitrosomonas eutropha C91] (385 aa)
Score = 317, Expect = 2.8e-27, Identities = 91/294 (30%), Positives = 159/294 (54%)
  Q:     1 MKNK-IFHIDMDSFFASVELAERPEYEKLPLAVG-------------------------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWS-KLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKL---IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           MKN+ I H+DMD+F+ASVEL   PE   LP+ +G                           V+ ++ Y AR  G+ SAM I+ A K+ P   ++  + + Y   S    + +++++ +IE   IDE Y+D+S    E       A  +K ++ +   L+C++G +    LAK+ ++L KP+G   LT  +    I+ L + KI GIGP    +L +L +H I ++AN +   L++   G  ++ +L    LG    P+    + K++ R  +  R+    Q+  KL      L   I   L ++ ++ +++ IK+RY D  + T+
  S:     3 MKNRRIAHLDMDAFYASVELLRYPELRGLPVVIGGRSVHQPIMQQNGTCLYAKLREYSGRGVVTTSTYEARAYGIFSAMGIMQAAKLAPDAILLPADFDTYHHYSRLFKNAVANIAPHIEDRGIDEIYIDLSKHPDET---TPLALRIKQAVHETTGLSCSIGVAPNKLLAKICSDLEKPNGLTILTHADIPHRIWPLPVHKINGIGPKTQAKLADLGIHKIGELANAEPG-LLQIHFGQRYALQLHHAALGNDNRPVVTSSEPKSISRETTFERDLHARQDREKLSAIFTGLCTHIAEDLHHKGYVGRTIGIKLRYEDFQTVTR 323
>gi|164687201|ref|ZP_02211229.1| hypothetical protein CLOBAR_00842 [Clostridium bartlettii DSM 16795] >gi|164603625|gb|EDQ97090.1| hypothetical protein CLOBAR_00842 [Clostridium bartlettii DSM 16795] (368 aa)
Score = 317, Expect = 2.8e-27, Identities = 98/346 (28%), Positives = 187/346 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIEL---NLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYS-EYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHV-----VVDLFEQISDFSKYDQVINLSITANNIME-NDNNEQLTIFD 349
           KI HIDMD+F+ASVE  + PE    P+ VG       V+A+ +Y AR  G+ SAM    A+K CP    + P  + Y  +S++I       +  +E  S+DE +LDV+N +         A  +K  I  +  L+ + G S+  FLAK+A++  KP+GF  +   + + ++  L I K  GIG   ++ L  L   N + ++ ++    + + + +   +++  R    GI   P+ P  +RK++G   ++  NY  + +E + ++ EL  D+++ + Y + + K+V +K+++ D    T+S   ++ ++ I  H      + +LF  I   +   Q+  + +T +N+++ N+    +T+F+
  S:     6 KIIHIDMDAFYASVEQRDNPELRGKPVIVGGDPHSRGVVATCSYEARAYGIHSAMPAKIAQKRCPYAIFVRPRFDVYREVSEQIRDIFHRYTDLVEPLSLDEAFLDVTNPKIPIKYATTIAKFIKRDILIETGLSASAGVSYNKFLAKLASDYQKPNGFTVIMPGDAQQFLDKLPIEKFFGIGKVTSKTLKTLGIKNGYDLRQMSLYDLEKIFKSRGYFYYNFAR----GIDNRPVEPYRERKSVGSETTLDHNYRLDEKEIVDILDELCLDVSNRITYLNKLGKTVTLKMKFEDFTQITRS---LSLEHGISSHEDIRTNIYNLFRNIPQNNL--QIRLVGVTLSNLIDINETCHNITLFE 358
>gi|154150165|ref|YP_001403783.1| DNA-directed DNA polymerase [Candidatus Methanoregula boonei 6A8] >gi|153998717|gb|ABS55140.1| DNA-directed DNA polymerase [Candidatus Methanoregula boonei 6A8] (365 aa)
Score = 317, Expect = 2.8e-27, Identities = 83/299 (27%), Positives = 156/299 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG--------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ-YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE-YQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQN 303
           + H DMD F+A+VE+ + PE     + VG          V+++A+Y AR  GV+SAM I  A ++CP    + P+  +Y ++S +I          ++  SIDE +LD+S  + ++  +++  A  +K +I+ +  + C++G + +  +AK+A+   KPDG   +T D+ + ++  L I KI GIG     Q+  L +  I ++A      L+    G     LR   LG     +      K++ +  +  N +E  +E    ++ L  ++   +  +   FK+V I++RY+   S TK+ + +++ N
  S:    13 VLHADMDCFYAAVEMHDHPEIAGKAVVVGADPQGGAGRGVVSTASYEARAFGVRSAMPISQAYRLCPGAVYLRPDMARYAAVSAEIMGIFKETGYRVQQVSIDEAFLDISPVRSFDTARDL--AVRLKQTIRDRVGITCSLGVAPSKIVAKIASGHQKPDGMTVVTPDSARDFLAPLPIRKIPGIGGKTGAQIEALGITTIGNLATCDIQVLV-GAFGRSAGLLREAALGHDNSEVVERDGVKSISKETTFANDTEDPKEIAATMELLVREVAQAIADEALQFKTVTIRVRYAGFVSKTKARSLLHYHN 318
>gi|149114686|ref|ZP_01841437.1| DNA-directed DNA polymerase [Shewanella baltica OS223] >gi|146865558|gb|EDK50865.1| DNA-directed DNA polymerase [Shewanella baltica OS223] (358 aa)
Score = 317, Expect = 2.8e-27, Identities = 94/290 (32%), Positives = 150/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ +Y AR  GV+SAM    A K+CP L ++      Y  +S +I    S  ++ IE  S+DE YLDVS  Q         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L+   D+       L+  + G     L     GI    I+ D +RK++G     ++ I +  + Q+ +  LI+EL   ++   K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSSDRRGVISTCSYEARKFGVRSAMATAYAFKLCPDLILVPGRMQVYKEVSLQIREIFSRYTQLIEPLSLDEAYLDVSECQQYKGSATLIAQAIRRDILAETGLTASAGIAPVKFLAKVASDLNKPNGQYVITPETLPDFVKTLSLRKIPGVGKVTAEKLSSLGLNTCGDVQAYSKPELL-ARFGKFGGVLIERSQGIDERGISADRERKSVGVETTLAKDIYSLEQCQQVMPGLIQELALRLSRSAKERK-IHKQV-VKLKFNDFKQTT 299
>gi|153001936|ref|YP_001367617.1| DNA polymerase IV [Shewanella baltica OS185] >gi|189027683|sp|A6WRW5|DPO4_SHEB8 DNA polymerase IV (Pol IV) >gi|151366554|gb|ABS09554.1| DNA-directed DNA polymerase [Shewanella baltica OS185] (358 aa)
Score = 317, Expect = 2.8e-27, Identities = 94/290 (32%), Positives = 150/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ +Y AR  GV+SAM    A K+CP L ++      Y  +S +I    S  ++ IE  S+DE YLDVS  Q         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L+   D+       L+  + G     L     GI    I+ D +RK++G     ++ I +  + Q+ +  LI+EL   ++   K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSSDRRGVISTCSYEARKFGVRSAMATAYAFKLCPDLILVPGRMQVYKDVSLQIREIFSRYTQLIEPLSLDEAYLDVSECQQYKGSATLIAQAIRRDILAETGLTASAGIAPVKFLAKVASDLNKPNGQYVITPETLPEFVKTLSLRKIPGVGKVTAEKLSSLGLNTCGDVQAYSKPELL-ARFGKFGGVLIERSQGIDERGISADRERKSVGVETTLAKDIYSLEQCQQVMPGLIQELALRLSRSAKERK-IHKQV-VKLKFNDFKQTT 299
>gi|170723173|ref|YP_001750861.1| DNA-directed DNA polymerase [Pseudomonas putida W619] >gi|169761176|gb|ACA74492.1| DNA-directed DNA polymerase [Pseudomonas putida W619] (354 aa)
Score = 317, Expect = 2.9e-27, Identities = 81/290 (27%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI HID D F+A++E+ + P     P+AVG       VIA+ NY AR  GV+SAM+   A K+CP L I+ P    Y   S +I+      ++ IE  S+DE YLDVS++Q+        A  ++  + +  ++  + G +   FLAK+A++  KP+G   +T D  ++++  L ++++ G+G     +L  L +    D+ +     L+R + G    +L     GI    ++ D +R+++    +   +  +    L+ + EL + +N  +   D  ++     +K+++ D    T
  S:     5 KIIHIDCDCFYAAIEMRDDPRLAGRPMAVGGSPDHRGVIATCNYEARAYGVRSAMSSRHALKLCPDLLIVKPRFEAYREASREIHGIFRDYTELIEPLSLDEAYLDVSDSQWFAGSATRIAEDIRRRVARALHITVSAGVAPNKFLAKIASDWRKPNGLFVITPDQVEAFVAALPVARLHGVGKVTADKLARLGIDTCLDMRDWSRLALVR-EFGSFGERLWGLARGIDDRAVHNDSRRQSVSVENTYDTDLPDLASCLERLPELLNSLNERIARMDSSYRPDKPFVKVKFHDFSQTT 301
>gi|170789092|gb|EDT30136.1| DNA polymerase IV (Pol IV) [Oligotropha carboxidovorans OM5] (435 aa)
Score = 317, Expect = 2.9e-27, Identities = 98/379 (25%), Positives = 188/379 (49%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ-YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRN-YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFV---NFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHY---PSSRSN 385
           HID D+F+A+V   +RPE    P+ +G     V+A+A Y+AR  GV+SAM +  A  +CP   +I P+  +Y  +  ++   + +L+  +E  SIDE +LD+S T+        +  +   N ++++  +  +VG S   FLAKMA++L KP GF  L+  + ++ + D  +  I G+GP++  +L +     I D+       LIR   G    +L     GI    +  D   K +    +  N   E+    +++ +L++ ++  LK  D    ++ +K++ +D    T+S + V      N+I   +  D+  + +D + + ++I + ++A       ++E         +    E  ++ +RK+       + I Y   P+S S+
  S:    47 HIDCDAFYATVAKHDRPEIADKPVIIGGGKRGVVAAACYIARTYGVRSAMPMYKALDLCPSAIVIRPDMARYVQVGREVRQAMRALTPLVEPISIDEAFLDLSGTERLHGMIPAKVLARFANQVEREIGITASVGLSANKFLAKMASDLDKPRGFAVLSPSDGQALMTDKPVGFIHGVGPAMQDKLRDHGFRLIGDLQRADEIDLIR-AFGGEGRRLWRLARGIDDRKVVADRGAKMISSETTFENDLREFTPLERILWDLSETVSRRLKTGDLAGSTITLKLKSADFRQRTRSQSIVAPTQLANRI-FAIARDMLARETDGTAF-RLIGVGVSALRSASGSDDEDFL----NARSAHAERAMDDVRKRFGDNAVVRGIAYTPRPASPSS 429
>gi|158316869|ref|YP_001509377.1| DNA-directed DNA polymerase [Frankia sp. EAN1pec] >gi|158112274|gb|ABW14471.1| DNA-directed DNA polymerase [Frankia sp. EAN1pec] (420 aa)
Score = 317, Expect = 2.9e-27, Identities = 77/293 (26%), Positives = 150/293 (51%)
  Q:     3 NKIFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           ++I H+DMD+F+AS+ + + PE    P+ VG     V+ SA Y AR  GV+SAM +  A+ +CP   ++  +  +Y  +S  I      ++  +   S+DE +LDV   +      ++ A  ++  I  + +L C+VG + + F+AK+A+   KPDG L +  D   ++++ L  + + G+GP   + L  L +  I DIA    D L R         L     G     + PD    ++G  ++   + ++ +   + +  L+  + + L+ +    ++++IK+R++D  + T++
  S:    20 SRILHVDMDAFYASIAVRDAPELRGRPVIVGGGSRGVVLSATYEARAFGVRSAMPMARARGLCPTAVVVPADHGRYREVSRAIMDVFRDVTPLVAPISLDEAFLDVGGGRRLFGTPVDIARAIRGRIATEQDLTCSVGVAPSMFVAKIASARCKPDGLLVVPPDEVLAFLHPLPTAALWGVGPRTEQALTRLGIRTIGDIARTPADTLRRALGAGAGGHLHALAHGRDDRRVEPDGVDVSVGAEETFSADLADPERLARELLRLSGRVAARLRARGQAGRNISIKVRHADFSTVTRA 316
>gi|146283325|ref|YP_001173478.1| DNA polymerase IV [Pseudomonas stutzeri A1501] >gi|145571530|gb|ABP80636.1| DNA-damage-inducible protein P [Pseudomonas stutzeri A1501] (360 aa)
Score = 316, Expect = 3.0e-27, Identities = 82/290 (28%), Positives = 145/290 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI HID D F+A++E+ + P   + P+AVG       VIA+ NY AR  GV+SAM    A K+CP L I+ P    Y   S +I+    + ++ IE  S+DE YLDVS  ++        A  ++  + Q+  +  + G +   FLAK+A+   KPDG   +T    + ++  L + ++ G+G     +L  L +    D+       L+R + G    +L     GI   P+  + +R+++   Q+  R+  +    L+ + EL   +++ +   D  ++     +K+++ D    T
  S:    14 KIIHIDCDCFYAAIEMRDDPSLARRPIAVGGAADRRGVIATCNYEARAYGVRSAMASGHALKLCPDLLILRPRMEAYREASREIHEIFRTYTEQIEPLSLDEAYLDVSACEHFAGSATRIAEDIRRRVWQQLRITVSAGVAPNKFLAKIASEWNKPDGLFVVTPAQVEEFVKALEVKRLHGVGRVTAEKLGRLGIRTCSDLREWGRLSLVR-EFGAFGERLWGLAWGIDERPVQVESRRQSVSVEQTYDRDLPDLAACLERLPELLQQLSTRMARLDSGYRPGKPFVKLKFHDFTQTT 310
>gi|67158856|ref|ZP_00419674.1| DNA-directed DNA polymerase [Azotobacter vinelandii AvOP] >gi|67084525|gb|EAM04008.1| DNA-directed DNA polymerase [Azotobacter vinelandii AvOP] (353 aa)
Score = 316, Expect = 3.1e-27, Identities = 84/290 (28%), Positives = 148/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI H+D D F+A++E+ + P     PLAVG       VIA+ NY AR  GV SAM    A K+CP+L I+ P    Y  +S +I   L   S+ +E  S+DE YLDVS + + +      A  V+  + Q+  +  + G +   FLAK+A++  KPDG   +     ++++ +L +S++ G+G     +L  L +    ++       L+R + G    +L +   GI   P+  D +R++L   ++  R+  +    L+ +  L + ++  L   D  ++     +K+++ D    T
  S:     5 KIIHVDCDCFYAAIEMRDDPRLAGRPLAVGGAPDRRGVIATCNYEARAYGVHSAMPARQALKLCPELLIVRPRFEAYKVVSREIQRILRDYSELVEPLSLDEAYLDVSASPHFSGSATRIAQDVRRRVWQELRITVSAGVAPNKFLAKIASDWRKPDGLFVIPPAEVEAFVAELPVSRLHGVGKVTAERLARLGVRTCAELRQWSRLALMR-EFGSFGERLALLARGIDERPVTVDSRRQSLSVERTYERDLPDLAACLEQLPPLLEALDGRLARLDGGYRPDKPFVKVKFHDFTQTT 301
>gi|168227058|ref|ZP_02652289.1| hypothetical protein Sententeric_14870 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (351 aa)
Score = 316, Expect = 3.4e-27, Identities = 85/291 (29%), Positives = 150/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S ++    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRRVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|13471787|ref|NP_103354.1| DNA polymerase IV [Mesorhizobium loti MAFF303099] >gi|22095627|sp|Q98JM5|DPO42_RHILO DNA polymerase IV 2 (Pol IV 2) >gi|14022531|dbj|BAB49140.1| DNA damage inducible protein P [Mesorhizobium loti MAFF303099] (415 aa)
Score = 316, Expect = 3.5e-27, Identities = 79/294 (26%), Positives = 153/294 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--------KKIGLHWSKLRMNVLGIICDPINPDYKRK--NLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           I H D+D+F+ASVE    P     P+AVG  V+ +A+Y AR  GV+  M    A+++CPQL  +  N + Y  + D     L   +  +E  SIDE + DV+   +   +  + A+ +++ ++ +  L  ++G + T  LAK+A+ +AKPDG + +       +++DL +S + G+GP+   +L E+ +  I ++A   +  L R        K   L W++          DP   + +R+  + G   ++ +  +  +  +  +  L D + S L+ +    ++V +++R++D  + T+S   
  S:     7 ILHADLDAFYASVEQLLDPSLRGKPIAVGGGVVLAASYEARAFGVRGGMPGRKARELCPQLIFVGGNFSHYQRLGDAAIKVLDDFTPVVERISIDEAFADVAGCTHLFGQPRDIATAIRHRVRAELGLPISIGVARTKHLAKIASQVAKPDGLVVVDPGTELDFLHDLPVSLMWGVGPATKSRLAEIGIQTIGELARTHSGALTRLLGPAAGEKLAALAWNR----------DPRKLETRRRAHSAGAQSALGQKPAVARVIVPTLLHLADRVASRLRAKARPGRTVTVRVRFADLSAVTRSITL 301
>gi|59889801|emb|CAH19157.1| Damage inducible protein P [Escherichia coli] (351 aa)
Score = 316, Expect = 3.7e-27, Identities = 85/291 (29%), Positives = 152/291 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKFCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 300
>gi|87122841|ref|ZP_01078712.1| DNA-damage-inducible protein P [Marinomonas sp. MED121] >gi|86161893|gb|EAQ63187.1| DNA-damage-inducible protein P [Marinomonas sp. MED121] (348 aa)
Score = 315, Expect = 3.9e-27, Identities = 95/287 (33%), Positives = 153/287 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWS-KLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDI-NSG-----------LKYQDFMFKSVNIKIRYSDGD 290
           KI HID D FFA+VE+ + P++  +PLA+G       VIA+ANY AR  GV+SAM+   A  +CP LT+I  N  KY   S ++++     +  IE  S+DE YLDV++    +      A  ++  I Q   +  + G +   FLAK+A++  KP+G   +     +++I  + +  I G+G     +L  LN+    D+  V  DYL+  +    W+ +L+    GI   P+    +RK++      +  + + +E +  L  L+ EL   I N G           LK+ D  F+   I+  Y  GD
  S:     3 KIIHIDADCFFAAVEMRDNPDFNDVPLAIGGPASSRGVIATANYAAREYGVRSAMSSAKAVILCPHLTLIRGNMEKYRLASRQMHAIFQEYTLKIEPLSLDEAYLDVTDCTQCHGSATLIAEEIRQRIYQTVGITVSAGIAVNKFLAKVASDWNKPNGQFVVEPAKQEAFIRSIPVKCIHGVGKVAQEKLSRLNVKTCFDLQKV--DYLVLSQYFGSWAYRLQQLSNGIDNRPVQSCSERKSISVETTYATDLESLTECEAKLPSLLLELKRRIKNKGTALHLGKYYLKLKFSD--FQQTTIETAYVAGD 308
>gi|165976465|ref|YP_001652058.1| DNA polymerase IV [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876566|gb|ABY69614.1| nucleotidyltransferase/DNA polymerase involved in DNA repair [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (356 aa)
Score = 315, Expect = 4.0e-27, Identities = 88/292 (30%), Positives = 151/292 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFL-KLIKELTDDINSGLKYQDFM-FKSVNIKIRYSDGDSAT 293
           + KI HIDMD F+A++E+ E P     P+AVG       V+ + NY AR  G+ SAM    A K CP L ++  N   Y ++S++I+      +  +E  S+DE YLDV++ +  +      A  ++++I  + +L  + G +   FLAK+ ++  KP+G   ++ +N  ++IYDL + KI G+G     +L +L LH   DI +  +   I K  G    +L      I    I  +  RK+L    +    I + +E ++ + +L K+L   +      +    FK + IK+++ D    T
  S:     4 QRKIIHIDMDCFYAAIEMRENPALIGKPVAVGGSVEGRGVLTTCNYEARKFGLHSAMPTAQALKRCPNLILVPVNMPLYKAVSEQIHQIFRRYTDIVEPLSLDEAYLDVTDCRQCSGSATWIAQEIRDAIWNELHLTASAGIAPLKFLAKIVSDQNKPNGQFVISPENMTAFIYDLPLKKIPGVGKVTNEKLAQLGLHTCGDIQH-SDKAFIYKTFGKFGQRLWEFSHAIDNRKIEANRPRKSLAVENTLPTDIWHLAEAEQIVDELFKKLVFRLQRNWGERSLQEFKKLAIKLKFGDFTQTT 305
>gi|126173180|ref|YP_001049329.1| DNA-directed DNA polymerase [Shewanella baltica OS155] >gi|189027682|sp|A3D147|DPO4_SHEB5 DNA polymerase IV (Pol IV) >gi|125996385|gb|ABN60460.1| DNA-directed DNA polymerase [Shewanella baltica OS155] (358 aa)
Score = 315, Expect = 4.4e-27, Identities = 93/290 (32%), Positives = 150/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ +Y AR  GV+SAM    A K+CP L ++      Y  +S +I    S  ++ +E  S+DE YLDVS  Q         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L+   D+       L+  + G     L     GI    I+ D +RK++G     ++ I +  + Q+ +  LI+EL   ++   K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSSDRRGVISTCSYEARKFGVRSAMATAYAFKLCPDLILVPGRMQVYKDVSLQIREIFSRYTQLVEPLSLDEAYLDVSECQQYKGSATLIAQAIRRDILAETGLTASAGIAPVKFLAKVASDLNKPNGQYVITPETLPEFVKTLSLRKIPGVGKVTAEKLSSLGLNTCGDVQAYSKPELL-ARFGKFGGVLIERSQGIDERGISADRERKSVGVETTLAKDIYSLEQCQQVMPGLIQELALRLSRSAKERK-IHKQV-VKLKFNDFKQTT 299
>gi|114707393|ref|ZP_01440290.1| DNA polymerase IV [Fulvimarina pelagi HTCC2506] >gi|114537274|gb|EAU40401.1| DNA polymerase IV [Fulvimarina pelagi HTCC2506] (434 aa)
Score = 315, Expect = 4.6e-27, Identities = 81/282 (28%), Positives = 149/282 (52%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ--YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           H+D D+F+AS+E  + P   + P+ VG     V+ +A Y+AR  GV+SAM +  A K+CP+ T+I PN  KY  +  +I   +  L+  ++  SIDE ++D+  T+  +     +    L    I+ +  ++ ++G S   FLAKMA++L KP GF  + +   + Y+    IS I G+G ++  +L    L  I  + ++ +   IR+   +GL  SKL     GI    + PD + K++    +   +     + + +++ L + ++  LK  D     + ++++ SD
  S:    46 HLDCDAFYASIEKRDDPSLAQKPVIVGGGTRGVVTTACYIARIRGVRSAMPMFKALKLCPEATVIRPNMEKYAGVGREIRQMMRDLTPLVQPVSIDEAFMDLKGTERLHGEPSSVTLTRLAAR-IEYEIGVSVSIGLSHNKFLAKMASDLEKPRGFSVIGRAETRDYLRAKPISAIWGVGDAMAAKLKADGLTMISQLQDMDDTDFIRRYGAMGLRLSKLAH---GIDDRSVEPDGEAKSISAETTFNCDLHRADDLVPVLRRLCEKVSGRLKATDLAATGITLRLKTSD 331
>gi|83316461|gb|ABC02404.1| DinB [Bacillus weihenstephanensis] (276 aa)
Score = 314, Expect = 5.1e-27, Identities = 72/257 (28%), Positives = 146/257 (56%)
  Q:    44 ARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN 300
           AR  G+++ M + +AK++CPQL + +PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+   ++++ GIG     +L ++++H I+ +A   ++++IR KIG H   L+    G+    ++P+   + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N
  S:     2 AREYGIRTTMPLWEAKRLCPQLVVRHPNFTLYREASFQMFQILSRFTEQIQPFSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEIIWPRSVAEMHGIGEKTAEKLKDIHIHTIEQLAK-GDEHIIRAKIGKHGVDLQKRAKGMDDREVDPNQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN 259
>gi|154509052|ref|ZP_02044694.1| hypothetical protein ACTODO_01569 [Actinomyces odontolyticus ATCC 17982] >gi|153798686|gb|EDN81106.1| hypothetical protein ACTODO_01569 [Actinomyces odontolyticus ATCC 17982] (447 aa)
Score = 314, Expect = 5.2e-27, Identities = 91/295 (30%), Positives = 153/295 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGL----HWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFV 299
           I H+DMDSFFA VE+ E P     P+ VG      V+ SA Y AR LGV++ M    A+ +CP    I  N   Y   S ++ + L++++  +E  SIDE +LDVS  +       + A L++  I++   L  ++G + T  +AK+A++ AKPDG L + +     +++ L +  + G+G      L    +  I D+AN     L  K +G+    H   L     GI   P+ P    K++G  ++    +R+ ++ +EF   I   + D    L+    +  +V+IK+R +D  + T+S + V
  S:    23 ILHVDMDSFFAQVEMREDPSLVGRPIIVGGTSGRGVVTSATYEARALGVRAGMPTSRARALCPGAAFIPGNHGLYQRYSRQVMAILATVTPVLEQVSIDEAFLDVSGARRRLGSPTQIARLIRARIREAVGLPASIGIAATKSVAKIASSHAKPDGLLLIPQAATVDFLHGLPVGALWGVGGKTAAILDREGIDTIGDLANAPLTRLT-KLLGVASAHHLHDLSW---GIDPRPVAPTRAEKSVGMERTFEEDVRSRADIEEF---ILAASHDCARRLRAGGVVGWTVDIKMRGTDFHTITRSVSLV 322
>gi|152979117|ref|YP_001344746.1| DNA polymerase IV [Actinobacillus succinogenes 130Z] >gi|150840840|gb|ABR74811.1| DNA-directed DNA polymerase [Actinobacillus succinogenes 130Z] (357 aa)
Score = 314, Expect = 5.3e-27, Identities = 90/347 (25%), Positives = 179/347 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQD-----FMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIF 348
           + KI HIDMD F+A+VE+ E P     P+AVG       V+ + NY  R  G +SAM    A K+CP L ++      Y  +S +I+      +  IE  S+DE YLDV+++          A  ++ +I  + +L  + G +   FLAK+A++  KP+G   +  +N   ++  L + KI G+G   +  L+E+ L+  +D+ +     L+ +  KIG    ++     GI    + P  +RK++G  +++ +N    ++ + +++EL  ++   +           ++ + +K+++ D    T   + V FQ +    ++  ++++    S   +++ L +T   I E + +EQ++++
  S:     6 QRKIIHIDMDCFYAAVEMREAPSLVGKPVAVGGHSRQRGVLTTCNYEVRKFGCRSAMPTAQAVKLCPDLIVLPVRMTLYKQVSQQIHQIFHRYTDIIEPLSLDEAYLDVTDSGKCCGSATWIAQEIRQAIFDELHLTASAGIAPLKFLAKIASDQNKPNGQFVINPENVTEFVRTLPLRKIPGVGKVTSEHLLEMGLYTCEDVQHAGLSVLLNRFGKIG---KRIWDFSHGIDEREVQPHRERKSVGVERTLSQNIFTLEQGMAVLEELCSELKRRILRAKPDISLSRYRKMGVKLKFDDFQVTTLEKSAVEFQQETFATLLSQIWQRAEGRSV--RLVGLHVT---IPEEEKSEQMSLW 357
>gi|160876658|ref|YP_001555974.1| DNA polymerase IV [Shewanella baltica OS195] >gi|189027684|sp|A9L0T3|DPO4_SHEB9 DNA polymerase IV (Pol IV) >gi|160862180|gb|ABX50714.1| DNA-directed DNA polymerase [Shewanella baltica OS195] (358 aa)
Score = 314, Expect = 5.5e-27, Identities = 94/290 (32%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ +Y AR  GV+SAM    A K+CP L ++      Y  +S +I    S  +  IE  S+DE YLDVS  Q         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L+   D+       L+  + G     L     GI    I+ D +RK++G     ++ I +  + Q+ +  LI+EL   ++   K +  + K V +K++++D    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSSDRRGVISTCSYEARKFGVRSAMATAYAFKLCPDLILVPGRMQVYKEVSLQIREIFSRYTPLIEPLSLDEAYLDVSECQQYKGSATLIAQAIRRDILAETGLTASAGIAPVKFLAKVASDLNKPNGQYVITPETLPDFVKTLSLRKIPGVGKVTAEKLSSLGLNTCGDVQAYSKPELL-ARFGKFGGVLIERSQGIDERGISADRERKSVGVETTLAKDIYSLEQCQQVMPGLIQELALRLSRSAKERK-IHKQV-VKLKFNDFKQTT 299
>gi|119775659|ref|YP_928399.1| DNA polymerase IV [Shewanella amazonensis SB2B] >gi|189027681|sp|A1S8M3|DPO4_SHEAM DNA polymerase IV (Pol IV) >gi|119768159|gb|ABM00730.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B] (355 aa)
Score = 314, Expect = 5.6e-27, Identities = 73/204 (35%), Positives = 109/204 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL 207
           KI HIDMD +FA+VE+ + P+Y   PLAVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y ++S +I    S  +  IE  S+DE YLDVS+           A  +++ I ++  L  + G S   F+AK+A++L KP+G   ++ D    ++  L + KI G+G     +L  L L    D+  V    L
  S:     3 KIIHIDMDCYFAAVEMRDFPQYRGKPLAVGGSSDRRGVISTCNYEARAFGVRSAMASAYALKLCPNLILVPGRMEVYKAVSQQIREIFSRYTSLIEPLSLDEAYLDVSDCSLYQGSATRIAEAIRSDIFKETGLTASAGVSPIKFVAKVASDLNKPNGQYVVSPDTLMHFVRALSLGKIPGVGKVTEEKLNALGLKTCADVQQVPQTLL 211
>gi|124007421|ref|ZP_01692127.1| DNA polymerase IV 2 [Microscilla marina ATCC 23134] >gi|123987077|gb|EAY26826.1| DNA polymerase IV 2 [Microscilla marina ATCC 23134] (325 aa)
Score = 314, Expect = 5.7e-27, Identities = 92/318 (28%), Positives = 168/318 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQI---SDFS 321
           KI HIDMD+F+ASVE  + P+Y+  PLAVG      V+A+A+Y AR  GV SAM+   A + CP +  + P  + Y  +S +I       +  +E  S+DE YLDV+    +N   +  A+++   IKQK      L  + G S   FLAK+A+++ KP+G   ++ +    ++  L I K  GIG    +++ +L +    D+       L+R+  K+G ++  +     GI    +NP   RK++    +   + +  +E    + +L +++   ++      +++ +K++Y +    T+S       N + L  ++ L++++    DFS
  S:     3 KIIHIDMDAFYASVEQRDHPQYQGKPLAVGGSRERGVVAAASYEARKFGVYSAMSSRLAYQKCPHIIFVRPRFDVYKEVSQQIREIFHEYTDLVEPLSLDEAYLDVT----KNKVGMPSATIIAREIKQKIFDATQLTASAGISVNKFLAKVASDMDKPNGLTLISPEEAADFVAKLPIKKFHGIGKVTAKKMQQLGIFTGADLRRWDKAKLVRQFGKVGNYYFNIAQ---GIDQRSVNPHRIRKSISTENTFDHDLASLEEMETALHQLAEELMRRMEKTKSFGQTITLKVKYDNFQQITRSKTLAYPINTLDL--IIRLYQELIRGCDFS 325
>gi|83316477|gb|ABC02413.1| DinB [Bacillus weihenstephanensis] (276 aa)
Score = 314, Expect = 5.7e-27, Identities = 72/257 (28%), Positives = 146/257 (56%)
  Q:    44 ARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN 300
           AR  G+++ M + +AK++CPQL + +PN   Y   S +++  LS  ++ I+  SIDE YLD+++  Y     +E A +++ ++  +  L C++G +   FLAK A+++ KP G   L K +    I+   ++++ GIG     +L ++++H I+ +A   ++++IR KIG H   L+    G+    ++P+   + K++G S +  ++  E +E L +++ L+  ++  L+ +  +  ++ I I+Y D  + T+S    N
  S:     2 AREYGIRTTMPLWEAKRLCPQLVVRHPNFTLYREASFQMFQILSRFTEKIQPFSIDEGYLDITDC-YALGSPLEIAKMIQQALLTELQLPCSIGIAPNLFLAKTASDMKKPLGITVLRKRDIPEIIWPRSVAEMHGIGEKTAEKLKDIHIHTIEQLAK-GDEHIIRAKIGKHGVDLQKRAKGMDDREVDPNQMGQHKSVGNSMTFSKDMDEEKELLDMLERLSKSVSKRLQKRTLVSYNIQIMIKYHDRRTVTRSKQLKN 259
>gi|145612599|ref|XP_367313.2| hypothetical protein MGG_07238 [Magnaporthe grisea 70-15] >gi|145019736|gb|EDK03964.1| hypothetical protein MGG_07238 [Magnaporthe grisea 70-15] (626 aa)
Score = 314, Expect = 5.8e-27, Identities = 95/317 (29%), Positives = 157/317 (49%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQY---ENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDN--FKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINP--DYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFS 321
           I H+D D+F+A+VE  +RPE   LP AVG  V+ + NYVAR  G +S M    AKK+CP L  I PN  KYT+ + ++   L+      E+ SIDE YL++  TQY    N +  E    ++  +    N+  + G +    LAK+  N+ KP+G   L  +      ++ D+   K+ GIG  L R+L  + +    DI   +  YL +      +  L    LG+    I P  +Y+RK++G   +  + SE  +  K ++   +++   +K  +   +++ IKI         K   F  +  Q+ L   + L E + ++S
  S:   112 IVHVDCDAFYAAVEQLDRPELVDLPFAVGGGVLTTCNYVARTFGCRSGMAGFVAKKLCPNLVFIKPNFEKYTAKAQEVRKVLAKYDPRFESASIDEAYLNI--TQYCADNNLEPGEAVEQMRREVHLSTNITVSSGVAANAKLAKICGNINKPNGQYVLPSERPAIIEFMRDMPCRKVNGIGRVLERELQAVGVSTCGDIYP-QRKYLTQLFGEKAFKFLVDCYLGLGRTNIQPAEEYERKSVGTESTFNSISEPGDLRKKLRHTAEELEKDMKRAEVKGRTLVIKI---------KLHTFEVYTRQVILPRSIHLAEDLYNYS 423
>gi|21226988|ref|NP_632910.1| DNA polymerase IV [Methanosarcina mazei Go1] >gi|24211647|sp|Q8PYH6|DPO41_METMA DNA polymerase IV 1 (Pol IV 1) >gi|20905304|gb|AAM30582.1| DNA polymerase IV [Methanosarcina mazei Go1] (365 aa)
Score = 314, Expect = 6.4e-27, Identities = 89/295 (30%), Positives = 156/295 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLV--------IASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSK-----NIETGSIDEWYLDVSNTQYENWK-EIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M+  + HIDMD FFA++E  E PE  +  + V  L         +++ NYVAR  G++S M    AKK+ P+   +   K+ YTS+SD+I   L S +      + E  S+DE +L+ S     +++   E    +K  IK+K NL C++G      ++KMA++  KPDG   ++  + +++++ L++SK+ GIG     +L E+ +  +KD+A      LI        + L+    GI   P+      + +GR  ++   S  ++ +  LI+ L  D+   L  ++  F+ V + +  S+    TKS
  S:     2 MQRVVLHIDMDYFFAAIEERENPELREKAVVVCMLSGRSELSGSVSTCNYVAREFGIRSGMPCSRAKKLNPEAVFLPVRKDFYTSVSDRIMEILRSYADPGNGDSFEQISVDEAFLESSERTGGDFRLAFEVGMQIKKEIKEKENLTCSIGIGPNKLISKMASSAKKPDGITVVSPQDLEAFLWPLNVSKLWGIGSVTAGKLQEMGIVTVKDLAERDVIELISIFGKSRGTWLKQAASGIDDSPLKERDGSEQIGRIATLPEDSLDKKLISSLIERLAGDVIEKLDSRELSFRIVTVTVINSNFRMYTKS 311
>gi|196193888|gb|EDX88847.1| ImpB/MucB/SamB family [Alcanivorax sp. DG881] (371 aa)
Score = 314, Expect = 6.4e-27, Identities = 85/285 (29%), Positives = 147/285 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHW----SKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQ----EFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSD 288
           KI H+D D F+A+VE+ + P     P+AVG       VIA+ NY AR  GV SAM    A + CP+L I+ PN +KY  +S +I+      +  IE  S+DE +LDVS ++  +      A  ++  ++++  +  + G +   FLAK+A++  KPDG   +     + ++  L ++KI G+G     ++  LNL    D+       L R ++G H+     +L     G    PI    +RK++      R Y + Q    ++L+ ++ L + +        Q ++   +  K++Y D
  S:    11 KIIHVDCDCFYAAVEMRDDPSLRGRPVAVGGDPHRRGVIATCNYPARQFGVHSAMASSQALRRCPELVIVPPNFDKYRKVSAQIHDIFRRYTSLIEPLSLDEAFLDVSASEQFDNSATRIAQALRQDVRREVGITVSAGVAPNKFLAKVASDWRKPDGLFVIPPAQVEEFVAALPVNKISGVGRVTGERMAGLNLKTCGDLQQ-----LSRLELGQHFGSFGERLYHLCRGEDSRPIQTGRRRKSVSVE---RTYDKDQLTLTDWLRELEGLIEKLKERFAKLDQHYLISGLTAKVKYQD 302
>gi|126698476|ref|YP_001087373.1| DNA polymerase IV [Clostridium difficile 630] >gi|123174445|sp|Q18A91|DPO4_CLOD6 DNA polymerase IV (Pol IV) >gi|115249913|emb|CAJ67732.1| DNA polymerase IV [Clostridium difficile 630] (365 aa)
Score = 314, Expect = 6.4e-27, Identities = 91/301 (30%), Positives = 158/301 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIA--NVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEY--QEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           KI HIDMD+F+AS+E  +  + +  P+ VG       V+A+ +Y AR  G+ SAM    A   CP    + P  + Y S+S+KI       +  +E  S+DE YLDV+  +      IE A  +K  I ++  L  + G S+  FLAK+A++L KP+G   +T++N + ++  L ++K  G+G   +  L  L +    D+   N+     I KK G    K      GI   P+ P+  RK++G   ++ +  +   +E   ++ EL +++   LK  +   K++ +KI+Y D    T+S +  ++ ++
  S:     6 KIIHIDMDAFYASIEQRDNKKLKGRPVIVGGNPQSRGVVATCSYEARKFGIHSAMPSAVAYNRCPYAVFVRPRFDVYKSVSEKIRDIFYRYTDLVEPLSLDEAYLDVTKNKKNIDSSIEIAKQIKKDIFREVGLTSSAGVSYNKFLAKIASDLRKPNGLTVITEENAQDFLDKLPVNKFFGVGKVTSNTLKNLGIKTGYDLRCLNLFELENIFKKRGYELYKF---ARGIDDRPVEPNRVRKSVGAETTLSHNLDIDEEETRNILDELCEEVCHRLKNSEKFGKTLTLKIKYEDFTKITRSLSLEHYIDE 312
>gi|182414989|ref|YP_001820055.1| DNA-directed DNA polymerase [Opitutus terrae PB90-1] >gi|177842203|gb|ACB76455.1| DNA-directed DNA polymerase [Opitutus terrae PB90-1] (392 aa)
Score = 314, Expect = 6.6e-27, Identities = 78/284 (27%), Positives = 152/284 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASL-VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANV--KNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYK-RKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           I H+D D+FF S ELA +PE      AVG     +I+SA+Y AR  GV + M    A K+CP L ++      Y+ +S +++    +L+  ++  SIDE YLD+    ++   EIE A   +++ I+Q+  +  + G +    +A++A+ L KP GF+ +       ++  L I K+ G+GP    +L+    H IK + ++  + +  +    G  W ++R   LGI   P+  +++  K+  + ++   + + + E  +++K + D++   ++      +++ +K+RY D
  S:     6 IVHLDADAFFVSCELALKPELRGTKCAVGGRERGIISSASYEARACGVYTPMPTTRALKVCPDLIMLPHTGGLYSRVSRQMFELCETLTPLVQRNSIDEGYLDLGPCGFKTSAEIEQAVHGLQHKIEQQLQITASFGLAVNKLVAQIASKLRKPKGFVVVPSGTEAEFLAPLPIGKLPGVGPKTEERLV--GRHGIKLVRDLLARGEAELEAIFGDGWREMRDGALGIDDRPVETEHEDAKSYSQQETFDEDIASFAEIERVVKRMIDELLPKIREDGKRVRTMTVKVRYPD 295
>gi|152967157|ref|YP_001362941.1| DNA-directed DNA polymerase [Kineococcus radiotolerans SRS30216] >gi|151361674|gb|ABS04677.1| DNA-directed DNA polymerase [Kineococcus radiotolerans SRS30216] (407 aa)
Score = 314, Expect = 6.6e-27, Identities = 68/205 (33%), Positives = 111/205 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR 209
           + H DMD+F+ASVEL  RP+    P+ VG     V+ SA Y AR  GV +AM +  A+++CP  T++ P+   Y  +S  +     S++  +E  S+DE +LDVS             + +++ I  +  + C+VG + T F+AK+A+  AKPDG L +      ++++ L +S + G+G      L  L L  + DIA+     L+R
  S:    25 VLHADMDAFYASVELLRRPDLVGTPVIVGGGNRGVVLSATYEARRHGVHAAMPMARARRLCPGATVLTPHHEDYARISAGVMEVFRSITPLVEPLSLDEAFLDVSGAVRRLGSPARIGAALRDRIADEQGITCSVGVASTKFVAKLASGAAKPDGLLVVPHAQTVAFLHALPVSALWGVGERTEETLARLGLRTVADIAHTPVTTLVR 232
>gi|167770442|ref|ZP_02442495.1| hypothetical protein ANACOL_01787 [Anaerotruncus colihominis DSM 17241] >gi|167667037|gb|EDS11167.1| hypothetical protein ANACOL_01787 [Anaerotruncus colihominis DSM 17241] (390 aa)
Score = 313, Expect = 6.7e-27, Identities = 102/362 (28%), Positives = 194/362 (53%)
  Q:    10 MDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKE-------LTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPL--HVVVDLF----EQISDFSKYDQVIN-LSITANNIMENDNNEQLTIFDSPT---QKISTESKLEKIRKQVNKT 371
           M++F+ASVE    PE    P+AV         +I + N +A+  GVK+A  I  A++ CP L ++ P+ + Y + S K  +     +  +E  S+DE YLDV+ ++      ++ A  ++ ++K +  L  +VG SF    AKM ++  KPD    +T+DN++  +Y L +  ++ +G +    L  L +  I D+A + ++  ++ + G H   L     G+  DP+    ++  +   +S+ N   Y+  L+ +++       L + + S L+      + V + I+    D + K+   ++ Q Q+P   H+  DLF    E +S   +  + I  LS+TA N+ +    EQL++F++P    ++ + ES L+ IR++  K+
  S:     1 MNAFYASVEALYHPETAGKPMAVCGDAESRRGIILAKNELAKQRGVKTAEPIWQARRKCPDLLLLPPHHDLYRAYSKKANAIYERYTDLVEAASVDESYLDVTGSRNLFGDGVQIADAIRAAVKAELGLTVSVGVSFCKVFAKMGSDYKKPDATTAVTRDNYRDILYPLPVRDLLHVGGATAAALSGLGVKTIGDLAAL-DEQTLKARFGKHGLVLYTYAHGLDSDPVKAAGEQDEI---KSVGNSLTYKRDLRTLEDIRIGLMPLAESVASRLRAHGLRCRGVQVAIK----DPSLKT---IDRQMQMPYATHLAKDLFDASMELVSRSWEVGRPIRLLSVTAINLTDAGAEEQLSLFEAPRDTGRQEALESSLDSIRERFGKS 374
>gi|168819096|ref|ZP_02831096.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (351 aa)
Score = 313, Expect = 6.7e-27, Identities = 85/292 (29%), Positives = 150/292 (51%)
  Q:     3 NKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           +KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     2 HKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|182679061|ref|YP_001833207.1| DNA-directed DNA polymerase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634944|gb|ACB95718.1| DNA-directed DNA polymerase [Beijerinckia indica subsp. indica ATCC 9039] (373 aa)
Score = 313, Expect = 7.2e-27, Identities = 81/294 (27%), Positives = 146/294 (49%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASA----NYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + KI HIDMD+F+ASVE  + P     P+AVG           +Y AR  GV SAM  V A + CP L  + P  + Y ++S +I +  +  +  IE  S+DE YLDV++         E A  ++  I  +  L  + G S+  FLAK+A++  KP+G   +T      ++  L +SK  GIGP+   ++ +L +   +D+   +    +++  G   +       G+   P+ PD +RK++G   +   +   ++     +  + + +    +  +   ++V +K++Y+D    T+S
  S:    15 QRKIIHIDMDAFYASVEQRDDPGLRGRPVAVGSARARGVVAAASYEARKFGVHSAMPSVTALRKCPDLIFVPPRFDIYKAVSRRIRAIFAEHTALIEPLSLDEAYLDVTSNLRNVASATEIAEQIRARILAETGLTASAGVSYNKFLAKLASDHNKPNGLFVITPKMGPGFVEALPVSKFHGIGPATAAKMEKLAIATGRDL-KARPLAFLQQHFGKAGTYYYWIARGVDERPVRPDRERKSIGAENTFAIDLYTFEAAYAALTPIMEKVWRSREMMNLRARTVTLKVKYADFQQITRS 312
>gi|190150365|ref|YP_001968890.1| DNA polymerase IV [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915496|gb|ACE61748.1| DNA polymerase IV [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (372 aa)
Score = 313, Expect = 7.4e-27, Identities = 88/292 (30%), Positives = 151/292 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFL-KLIKELTDDINSGLKYQDFM-FKSVNIKIRYSDGDSAT 293
           + KI HIDMD F+A++E+ E P     P+AVG       V+ + NY AR  G+ SAM    A K CP L ++  N   Y ++S++I+      +  +E  S+DE YLDV++ +  +      A  ++++I  + +L  + G +   FLAK+ ++  KP+G   ++ +N  ++IYDL + KI G+G     +L +L LH   DI +  +   I K  G    +L      I    I  +  RK+L    +    I + +E ++ + +L K+L   +      +    FK + IK+++ D    T
  S:    20 QRKIIHIDMDCFYAAIEMRENPALIGKPVAVGGSVEGRGVLTTCNYEARKFGLHSAMPTAQALKRCPNLILVPVNMPLYKAVSEQIHQIFRRYTDIVEPLSLDEAYLDVTDCRQCSGSATWIAQEIRDAIWNELHLTASAGIAPLKFLAKIVSDQNKPNGQFVISPENMTAFIYDLPLKKIPGVGKVTNEKLAQLGLHTCGDIQH-SDKAFIYKTFGKFGQRLWEFSHAIDNRKIEANRPRKSLAVENTLPTDIWHLAEAEQIVDELFKKLVFRLQRNWGERSLQEFKKLAIKLKFGDFTQTT 321
>gi|146341432|ref|YP_001206480.1| DNA polymerase IV [Bradyrhizobium sp. ORS278] >gi|146194238|emb|CAL78260.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Bradyrhizobium sp. ORS278] (432 aa)
Score = 313, Expect = 7.4e-27, Identities = 83/289 (28%), Positives = 150/289 (51%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ-YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           HID D+F+A+VE  + PE    P+ +G     V+++A Y+AR  GV+SAM +  A ++CP   +I P+  KY  +  ++   + +L+  +E  SIDE +LD+S T+        +  +     ++Q   +  +VG S   FLAK+A++L KP GF  L +D  +  + D  +  I G+GP+  ++L +     I D+       L+ K+ G    +L     G+    +  D   K +    +    IR+Y+  +   KL+  L++ +++ LK       ++ +K++ SD    T+S
  S:    52 HIDCDAFYATVEKRDNPEVADRPVIIGGGKRGVVSAACYIARTYGVRSAMPMFKALELCPSAVVIRPDMAKYVRVGREVRQAMQALTPLVEPLSIDEAFLDLSGTERVHGMIPAKVLARFAREVEQIIGITVSVGLSCNKFLAKIASDLDKPRGFAALDQDEARDMLADKPVGFIFGVGPASQQRLAQHGFRLISDLQRADEIELM-KQFGGEGRRLWRLARGLDDRKVVADRGAKTISSETTFDTDIRDYATLE---KLLWRLSEKVSARLKASQLAGSTITLKLKTSDFRQRTRS 344
>gi|196155572|ref|YP_002125061.1| DNA polymerase IV [Alteromonas macleodii 'Deep ecotype'] >gi|196111351|gb|ACG65067.1| DNA polymerase IV [Alteromonas macleodii 'Deep ecotype'] (349 aa)
Score = 313, Expect = 7.5e-27, Identities = 83/279 (29%), Positives = 151/279 (54%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKY--QDFMFKSVNIKIRYSD 288
           MD F+A+VE+ + P    +P+A+G       VI++ NY AR  GV+SAM    A K+CP LT++    + Y + S KI    +  +  IE  S+DE YLDV+N+++        A  ++  I+ +  L  + G +   F+AK+A++  KPDG   +T D   +++ D+ + KI G+G    ++L  + L+   D+     +  I+K++G   S L     GI    ++   +RK++G     S  I    E  +FL  L ++L + +++  K   +    ++  +K++++D
  S:     1 MDCFYAAVEMRDNPALRDIPIAIGGSADRRGVISTCNYPARKYGVRSAMATAYAVKLCPNLTLVKGRMDVYAAESQKIRKIFADYTDLIEPLSLDEAYLDVTNSEFCGGSATLIAEEIRARIQSELGLTASAGVAPCKFVAKVASDENKPDGICVITPDKLDAFVRDMPLKKIPGVGKVTMQKLQRMGLNTCNDVRQYPFER-IQKELGKFGSVLWERAHGIDERELSVSRERKSIGVERTLSDDIHTLDECIDFLPHLFEKLQERMDNHKKRTGKPVRIRTQGVKLKFND 290
>gi|161504583|ref|YP_001571695.1| DNA polymerase IV [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189027678|sp|A9MNS1|DPO4_SALAR DNA polymerase IV (Pol IV) >gi|160865930|gb|ABX22553.1| hypothetical protein SARI_02697 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (351 aa)
Score = 313, Expect = 7.8e-27, Identities = 86/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV++T +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRECRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDTPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPDFLKTLPLAKIPGVGKVSAAKLESMGLITCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIERLYPELERRLATVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|168221861|ref|ZP_02647093.1| hypothetical protein Senterenterica_15801 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168232268|ref|ZP_02657326.1| hypothetical protein Sententerica_14893 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168238581|ref|ZP_02663639.1| hypothetical protein Senteenterica_20514 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194468929|ref|ZP_03074913.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735550|ref|YP_002113339.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194455293|gb|EDX44132.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711052|gb|ACF90273.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (351 aa)
Score = 313, Expect = 7.9e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|16759308|ref|NP_454925.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16763696|ref|NP_459311.1| DNA polymerase IV [Salmonella typhimurium LT2] >gi|29142919|ref|NP_806261.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|161615517|ref|YP_001589482.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167544265|ref|ZP_02339837.1| hypothetical protein Sentent_13364 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167553101|ref|ZP_02346851.1| hypothetical protein Sentente_21623 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167993331|ref|ZP_02574426.1| hypothetical protein Sententer_01000023_0100017880 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|189027679|sp|A9MY13|DPO4_SALPB DNA polymerase IV (Pol IV) >gi|54036996|sp|P63990|DPO4_SALTI DNA polymerase IV (Pol IV) >gi|54040957|sp|P63989|DPO4_SALTY DNA polymerase IV (Pol IV) >gi|25300621|pir||AG0542 hypothetical protein DinP (DNA damage-inducible protein) STY0358 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16418815|gb|AAL19270.1| DNA polymerase IV [Salmonella typhimurium LT2] >gi|16501599|emb|CAD08783.1| hypothetical protein DinP (DNA damage-inducible protein) [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138551|gb|AAO70121.1| hypothetical protein DinP [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|161364881|gb|ABX68649.1| hypothetical protein SPAB_03289 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (351 aa)
Score = 313, Expect = 7.9e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|168465387|ref|ZP_02699269.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195631947|gb|EDX50467.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Newport str. SL317] (351 aa)
Score = 313, Expect = 7.9e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|194442660|ref|YP_002039555.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194401323|gb|ACF61545.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Newport str. SL254] (351 aa)
Score = 313, Expect = 7.9e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|167559843|ref|ZP_02352848.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168476158|ref|ZP_02705181.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (351 aa)
Score = 313, Expect = 7.9e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|120600020|ref|YP_964594.1| DNA polymerase IV [Shewanella sp. W3-18-1] >gi|124545776|ref|ZP_01704951.1| UMUC-like DNA-repair protein [Shewanella putrefaciens 200] >gi|189044604|sp|A1RMZ5|DPO4_SHESW DNA polymerase IV (Pol IV) >gi|120560113|gb|ABM26040.1| DNA-directed DNA polymerase [Shewanella sp. W3-18-1] >gi|124510752|gb|EAY54820.1| UMUC-like DNA-repair protein [Shewanella putrefaciens 200] (358 aa)
Score = 313, Expect = 8.1e-27, Identities = 94/290 (32%), Positives = 145/290 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ +Y AR  GV+SAM    A K+CP L ++      Y  +S  I    S  +  IE  S+DE YLDVS  Q         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L+   D+       L+  + G   + L     GI    I+ D +RK++G     ++ I    + Q+ +  LI+EL   ++   K  D       +K+++SD    T
  S:     3 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSRERRGVISTCSYEARKFGVRSAMATSYAFKLCPNLILVPGRMQVYKEVSLHIREIFSRYTPLIEPLSLDEAYLDVSECQQYKGSATLIAEAIRRDILAETGLTASAGIAPVKFLAKVASDLNKPNGQYVITPEMLPEFVKTLSLRKIPGVGKVTAEKLTSLGLNTCGDVQVYSKQELL-SRFGKLGAVLIERAHGIDGRGISIDRERKSVGVETTLAKDIYTLEQCQQVMPGLIQELALRLSRSAK--DRKIHKQVVKLKFSDFKQTT 299
>gi|146292055|ref|YP_001182479.1| DNA polymerase IV [Shewanella putrefaciens CN-32] >gi|145563745|gb|ABP74680.1| DNA-directed DNA polymerase [Shewanella putrefaciens CN-32] (379 aa)
Score = 313, Expect = 8.1e-27, Identities = 94/290 (32%), Positives = 145/290 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD +FA+VE+ + PEY   PLAVG       VI++ +Y AR  GV+SAM    A K+CP L ++      Y  +S  I    S  +  IE  S+DE YLDVS  Q         A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T +    ++  L + KI G+G     +L  L L+   D+       L+  + G   + L     GI    I+ D +RK++G     ++ I    + Q+ +  LI+EL   ++   K  D       +K+++SD    T
  S:    24 KIIHIDMDCYFAAVEMRDFPEYRGKPLAVGGSRERRGVISTCSYEARKFGVRSAMATSYAFKLCPNLILVPGRMQVYKEVSLHIREIFSRYTPLIEPLSLDEAYLDVSECQQYKGSATLIAEAIRRDILAETGLTASAGIAPVKFLAKVASDLNKPNGQYVITPEMLPEFVKTLSLRKIPGVGKVTAEKLTSLGLNTCGDVQVYSKQELL-SRFGKLGAVLIERAHGIDGRGISIDRERKSVGVETTLAKDIYTLEQCQQVMPGLIQELALRLSRSAK--DRKIHKQVVKLKFSDFKQTT 320
>gi|41406276|ref|NP_959112.1| DNA polymerase IV [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41394624|gb|AAS02495.1| hypothetical protein MAP_0178c [Mycobacterium avium subsp. paratuberculosis K-10] (400 aa)
Score = 313, Expect = 8.3e-27, Identities = 77/291 (26%), Positives = 147/291 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL---IRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI---RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+DSF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++AM    A+++CP   ++ P  + Y+  SD ++      +  +E  S+DE +LDV   +  +   +  A  ++  ++ +  L  TVG + T FLAK+A+  AKPDG L +  D   +++  L + ++ G+G     +L    +  + D+A +    L   +   +G     L  N   I    ++   +R+++G  +++    N     E   ++  L D +   ++      ++V +++R+ D   AT+S
  S:     9 ILHADLDSFYASVEQRDDPTLRGRPVIVGGGVVLAASYEAKAYGVRTAMGGAQARRLCPHAVVVPPRMHAYSRASDAVFRVFRECTPLVEPLSVDEAFLDVGGLRRVSGTPVAIAQRLRADVRDRVGLPITVGIARTKFLAKVASQQAKPDGLLLVPPDQELAFLRPLPVRRLWGVGAVTAEKLRAHGIATVADVAELSESTLGSMVGAAMGRQLYALSRN---IDRRRVSTGVRRRSVGAQRALGRAGNTMSDSEIDAVVVNLIDRVTGRMRAAGRTGRTVVLRLRFDDFTRATRS 302
>gi|26987938|ref|NP_743363.1| DNA polymerase IV [Pseudomonas putida KT2440] >gi|38257491|sp|Q88NK4|DPO4_PSEPK DNA polymerase IV (Pol IV) >gi|24982649|gb|AAN66827.1|AE016311_7 DNA-damage-inducible protein P [Pseudomonas putida KT2440] (354 aa)
Score = 313, Expect = 8.6e-27, Identities = 84/290 (28%), Positives = 155/290 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGP----SLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI H+D D F+A++E+ + P     P+AVG       VIA+ NY AR  GV+SAM+   A K+CP L I+ P    Y   S +I++     ++ IE  S+DE YLDVS++Q+ +      A  ++  + +  ++  + G +   FLAK+A++  KP+G   +T +  ++++  L ++++ G+G      LTR  IE  LH +++ + +    L+R + G    +L     GI    ++ D +R+++    +   +  +    L  + EL D +N  +   D  ++     +K+++ D    T
  S:     5 KIIHVDCDCFYAAIEMRDDPRLAGRPMAVGGSPDHRGVIATCNYEARAYGVRSAMSSRHALKLCPDLLIVKPRFEAYREASREIHTIFRDYTELIEPLSLDEAYLDVSDSQWYSGSATRIAEDIRRRVARTLHITVSAGVAPNKFLAKIASDWRKPNGLFVITPNEVETFVAALPVARLHGVGKVTADKLTRLGIETCLH-LREWSRLA---LVR-EFGSFGERLWGLARGIDERAVHNDSRRQSVSVENTYDTDLPDLASCLARLPELLDSLNERIARMDSSYRPDKPFVKVKFHDFSQTT 301
>gi|88801750|ref|ZP_01117278.1| DNA polymerase IV [Polaribacter irgensii 23-P] >gi|88782408|gb|EAR13585.1| DNA polymerase IV [Polaribacter irgensii 23-P] (360 aa)
Score = 313, Expect = 8.6e-27, Identities = 86/298 (28%), Positives = 156/298 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNF 301
           KI H+DMD+F+ASV   + PE     +AVG      V+++A+Y AR  GVKSAM+   AK+ CP L  +  +  +Y  +S +I +     +  +E  S+DE YLDV+  +  N      A  ++  I  +  L  + G S   F+AK+A+++ KP+G  T+  +    ++  L ++K  G+G   T ++  L +    D+     + L++   K G H+  +   V GI    + P+  RK++   ++   N S     ++ ++++ +++   +K  D   K++ +KI+YSD    T+S    +F
  S:     9 KIIHVDMDAFYASVAQLDNPELIGKAIAVGGSAERGVVSAASYEARKFGVKSAMSSFLAKQKCPHLIFVKTDFERYKEISQRIRAIFYEYTDLVEPLSLDEAYLDVTENKKGNLSASLIAVEIRKRIYDEIGLRASAGISINKFIAKVASDINKPNGQKTINPEEVIEFLAALPVNKFYGVGKVTTAKMYNLGIFTGNDLKKKPLEELMKLFGKSGAHYYHI---VRGIHNSAVKPNRIRKSIAAERTFSENISSEIFMIERLEQIAEELERRMKKTDTKGKTITLKIKYSDFTQQTRSKTMPHF 310
>gi|167644442|ref|YP_001682105.1| DNA-directed DNA polymerase [Caulobacter sp. K31] >gi|167346872|gb|ABZ69607.1| DNA-directed DNA polymerase [Caulobacter sp. K31] (375 aa)
Score = 312, Expect = 8.8e-27, Identities = 87/292 (29%), Positives = 146/292 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + P     PLAVGH     V+A+A+Y AR  GV+SAM    A   CPQL  + P    Y ++S +I+   +  +  IE  S+DE YLDV+  +       E A  ++  I +   L  + G S+  FLAK+A++  KP+G   +     ++++  L I +  G+G     ++  L +H  +D+      +L ++  G           G     +NPD  RK+ G   +  +++   +     +  + DD+ +         ++V +KI+++D   AT+S
  S:     8 KIIHIDMDAFYASVEQRDDPSLRGRPLAVGHGAQRGVVAAASYEARKFGVRSAMPSTTALAKCPQLVFVPPRFEVYKAVSRQIHEIFADYTDLIEPLSLDEAYLDVTANRRGLETASETAKEIRARILETTGLTASAGVSYNKFLAKLASDQRKPNGQFVVPPGKGEAFVQTLPIGRFHGVGAVTEAKMKRLGVHTGEDLHRQSLAFL-QQHFGRSGPWYYAIARGEDDRRVNPDRVRKSSGSETTFDQDHIAPEPIEAGVLAMADDVWAWCAKTGDRARTVTVKIKWADFQQATRS 303
>gi|83814230|ref|YP_445661.1| putative DNA polymerase IV [Salinibacter ruber DSM 13855] >gi|83755624|gb|ABC43737.1| putative DNA polymerase IV [Salinibacter ruber DSM 13855] (373 aa)
Score = 312, Expect = 8.8e-27, Identities = 85/291 (29%), Positives = 144/291 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPE-YEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           +I H+DMD+F+A +E  + P+ Y   P+AVG      V+ +A+Y AR  GV SA   V+A + CP L  + P  + Y   S +I   L   +  +E  S+DE YLDV+  +         A  ++  I ++  L  + G     F+AK+A++L KPDG   +  D    +I  L I K  GIGP    ++ EL +    D+       LI    K G H+  L    +G    P+ PD  RK++G  ++   + +  +  L  +  + + +   L+  +   ++V +K++  D   +T+
  S:    20 RIVHVDMDAFYAQIEQRDFPDRYAGKPIAVGGDPPRGVVQTASYEARPYGVHSAQPAVEADRKCPDLIFVSPRMDVYQEESKRIRKILRRYTDLVEPLSLDEAYLDVTEPKTGRPSGTLIARRLRAEIYEETGLTASAGVGPGKFVAKVASDLDKPDGLTVVRPDEQMEFIAQLPIEKFHGIGPVTAAKMQELGIQTGADLQETPERTLIHHFGKRGRHFKTL---AVGTDDRPVQPDRDRKSVGAERTFPEDIARAETMLDRLSPIAERVAQRLRQANRKGRTVTLKLKSHDHQVSTR 315
>gi|168261272|ref|ZP_02683245.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (351 aa)
Score = 312, Expect = 9.0e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQRCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|194449490|ref|YP_002044297.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194407794|gb|ACF68013.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (351 aa)
Score = 312, Expect = 9.1e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENIGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|168240052|ref|ZP_02664984.1| hypothetical protein Senterienterica_00325 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] (351 aa)
Score = 312, Expect = 9.1e-27, Identities = 85/291 (29%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPDFLKTLPLAKIPGVGKVSAAKLENIGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|83855983|ref|ZP_00949512.1| DNA polymerase IV [Croceibacter atlanticus HTCC2559] >gi|83849783|gb|EAP87651.1| DNA polymerase IV [Croceibacter atlanticus HTCC2559] (368 aa)
Score = 312, Expect = 9.1e-27, Identities = 88/294 (29%), Positives = 151/294 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVI----ASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + KI H+DMD+F+ASVE  + P+    P+AVG        ++A+Y AR  GV+SAM+   A+++CP+L  +  N  +Y   S +I       +  +E  S+DE YLDV+  +  N      A  ++  IK K  LN + G S   F+AK+A+++ KP+G  T+  +    ++  L I K  GIG     ++    +    D+ +   +YL  +  G   +     V GI    + P   RK+LG  ++   N +     ++ ++ + ++I   L+  +   K+V +KI+YSD    T+S
  S:     7 ERKIIHVDMDAFYASVEQLDNPDLRGKPIAVGGGGKRGVVSAASYEARVFGVRSAMSGAQAQRLCPELIFVKTNFTRYKECSQQIREIFYEYTDKVEPLSLDEAYLDVTENKKGNPSATLIAKEIREKIKAKTGLNASAGISINKFIAKVASDINKPNGQKTINPEEVIPFLETLDIRKFYGIGKVTAEKMYLHGIFTGNDLKSKSLEYL-EEHFGKSGTYYYHIVRGIHNSEVKPHRTRKSLGAERTFSENITSELFMMERLEHIAEEIERRLEKSNVAGKTVTLKIKYSDFTLQTRS 304
>gi|15674011|ref|NP_268186.1| DNA polymerase IV [Lactococcus lactis subsp. lactis Il1403] >gi|22095634|sp|Q9CE21|DPO4_LACLA DNA polymerase IV (Pol IV) >gi|12725077|gb|AAK06127.1|AE006432_9 DNA-damage-inducible protein P [Lactococcus lactis subsp. lactis Il1403] (363 aa)
Score = 312, Expect = 9.5e-27, Identities = 84/291 (28%), Positives = 149/291 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAV--------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           KI HIDMD+FFASVE+ + P  +  P+ +        G  V+++ +Y AR  G+ SA +  +A  +CPQ   I  N  KYT +S ++       + +IE  SIDE YLDV+  +      I+ A L+++ I  +  L C+ G S+  FLAK+A++  KP G   +  +    ++  L + K  G+G +   +L  L      D+    +   + ++ G++  +L     GI    +    +RK++G+ ++        + +K  + +++  ++  LK        V +K+RYSD  + TK
  S:    13 KIIHIDMDAFFASVEVRDNPSLKVKPVVIARNPLQTGGRGVVSTCSYEARAFGIHSA-SAKEAYDLCPQAIFISGNYEKYTKVSKQVREIFKRYTDDIEAASIDEAYLDVTENKIGAQSAIKIAKLIQHDIFVELGLTCSAGVSYNKFLAKIASDYEKPHGLTLIMPEEALEFLAKLPVEKFHGVGKATVPKLHALGFFNGGDLQKA-DPVDLAERFGVYGWELYQKANGIHNSKVKNYRERKSVGKERTYGKLLYLPDDIKAELSKISGKVSDSLKSHQLKGSIVILKLRYSDFTTLTK 310
>gi|90424802|ref|YP_533172.1| DNA polymerase IV [Rhodopseudomonas palustris BisB18] >gi|90106816|gb|ABD88853.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris BisB18] (432 aa)
Score = 312, Expect = 9.6e-27, Identities = 79/289 (27%), Positives = 150/289 (51%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ-YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           HID D+F+A+VE  + P     P+ +G     V+++A Y+AR  GV+SAM +  A  +CP   ++ P+  KY  +  ++   + +L+  +E  SIDE +LD+S T+        +  +     ++++  +  +VG S   FLAK+A++L KP GF  L +D+ ++ + D  +  I G+GP+  ++LI      I D+       L+ K+ G    +L     GI    + PD   K++    +   +  +     K++  L++ ++S LK  D    ++ +K++ +D    T++
  S:    49 HIDCDAFYATVEKRDDPAIADRPVIIGGGKRGVVSAACYIARTFGVRSAMPMFKALALCPDAAVVRPDMAKYVRVGREVRQAMLALTPLVEPLSIDEAFLDLSGTERLHGMIAAKVLARFAAKVEREIGITVSVGLSCNKFLAKIASDLDKPRGFAVLDQDDARAMLTDRPVGFIFGVGPATEQRLIARGYRLIGDLQRAAEADLM-KQFGAEGQRLWRLARGIDDRKVVPDRGAKSISNETTFETDIRDLATLEKVLWRLSEKVSSRLKSADLAGSTITLKLKTADFRQRTRA 341
>gi|73662205|ref|YP_300986.1| putative nucleotidyltransferase DNA polymerase involved in DNA repair [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82592826|sp|Q49YT9|DPO4_STAS1 DNA polymerase IV (Pol IV) >gi|72494720|dbj|BAE18041.1| putative nucleotidyltransferase DNA polymerase involved in DNA repair [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (356 aa)
Score = 312, Expect = 9.9e-27, Identities = 97/348 (27%), Positives = 173/348 (49%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVIN-------LSITANNIMENDNNEQLTIFD 349
           + +I H+DMD FFA VE+ + P+ +  P+ VG       V+++A+Y AR  GV SAM    A K+CP    + P    Y + S+KI +   S ++ +E  S+DE YLD+++    +      A  ++  I +   L  + G S+  FLAK+A+ + KP+G   +   N    +  L I    G+G +  +++ +  ++  +D+ N     LIR   G     L     GI  +P+ P   RK++G  ++   + ++ +E L+ I EL++     L       K+V +KI+    +S +K  +  +     P+    D++    D   Y ++ N       + +T  N +E    E +TI+D
  S:     3 ERRIIHVDMDYFFAQVEMRDNPKLKGKPVIVGGKASGRGVVSTASYEARQYGVHSAMPTAQAHKLCPNGYYVTPRFEAYKTASEKIMNIFKSYTEVVEPLSLDEAYLDITHLVRPDLPASRIAQYIRRDIYEATMLTSSAGVSYNKFLAKLASGMNKPNGLTVIDYRNVHDILMGLDIGDFPGVGKASKQKMHQEAIYTGQDLYNQSERDLIR-LFGKRGHGLYNKARGIDHNPVKPTRIRKSVGTERTFATDMNDDEEILQKIWELSNKTAERLAKLQKSGKTVTVKIKTFKFESLSKQRSLRD-----PVRSETDIYNIAYDL--YTELKNPETPIRLVGVTVGN-LEKATYENMTIYD 354
>gi|159528146|ref|YP_001542709.1| DNA-damage inducible protein P [Fluoribacter dumoffii] >gi|159157991|dbj|BAF92680.1| DNA-damage inducible protein P [Fluoribacter dumoffii] (379 aa)
Score = 312, Expect = 9.9e-27, Identities = 82/290 (28%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFM--FKSVNIKIRYSDGDSAT 293
           KI HIDMD F+A++E+ + PE    P+AVG       VIA+ NY AR  GV+SAM+   A K+C  L +       Y + S  I +     +  IE  S+DE YLDV+++          A  ++  I Q   L  + G +    LAK+A++  KP+G   +  +   +++ DL + K+ G+GP +  +L  LN+    D+ +   +YL   + G+   +L     G+   P+NP+  RK++   ++ +++  + +     + EL   + + +K    +    ++ +K++++D    T
  S:    11 KIIHIDMDCFYAAIEMRDFPELANKPIAVGGAADRRGVIATCNYAARAFGVRSAMSTAQALKLCHHLVLRPVRMEVYRNESQYIRALFEEYTDLIEPLSLDEAYLDVTDSSNCKGSATWMAQELRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNGQKVIRPEEIAAFMLDLPVRKLFGVGPKMEEKLKTLNIKTCGDLHHYSMEYLT-NEFGVMGQRLYDLARGVDERPVNPERIRKSISVEETYLQDLPDVEACFAALPELMVRLEARIKRAGTLSSIHTLFVKLKFNDFQQTT 307
>gi|163812397|ref|ZP_02204070.1| DNA-directed DNA polymerase [Dehalococcoides sp. VS] >gi|157403963|gb|EDO70010.1| DNA-directed DNA polymerase [Dehalococcoides sp. VS] (391 aa)
Score = 312, Expect = 1.0e-26, Identities = 84/291 (28%), Positives = 147/291 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           ++ H D+D+FF SVE A RPE +  P+ VG       V+A+A+Y AR LG+ S M ++ AK +CPQ   I      Y   S+K    L+  S  +E   +DE YL+V+  +  +    E A  ++  I  +  +N ++G + +  +AK+AT  AKP+G   +      +++  L IS + GIG    + L  L +  +  +A     +L +  +G +   L     GI   P+    + K++ R  +    +    FL+  +  L++ I + L+ +    + V IKIR++D  + T+
  S:     6 RVMHADLDAFFVSVEQAIRPELKGKPVIVGGKPERRGVVAAASYEARKLGIHSGMPLLTAKHLCPQAIFIEGTHQLYREYSEKFMQILADFSPFLEPMGLDEAYLEVTGFESLHGSIGEMACKIRRRITAELGINASIGIANSKVVAKIATEHAKPNGQCEVPAGEEAAFLAPLDISVMPGIGKKTEQHLKSLGIDTLGKLAAPPASFL-KSSLGAYAPYLSNAAKGIDNRPVEMPAEAKSISRETTFETDTRNHTFLEAKLGYLSEKIAATLRKRGKQVRVVQIKIRFADFTTLTR 301
>gi|167625088|ref|YP_001675382.1| DNA polymerase IV [Shewanella halifaxensis HAW-EB4] >gi|189027685|sp|B0TQD1|DPO4_SHEHH DNA polymerase IV (Pol IV) >gi|167355110|gb|ABZ77723.1| DNA-directed DNA polymerase [Shewanella halifaxensis HAW-EB4] (358 aa)
Score = 312, Expect = 1.1e-26, Identities = 93/313 (29%), Positives = 158/313 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQ 316
           KI H+DMD F+A+VE+ + PE    P+AVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S++I +     +  IE  S+DE YLDV+ + +        A  ++  I  +  L  + G +   FLAK+A++L KP+G   +  +  + ++  L + KI G+G    ++L +L LH   DI       L+ ++ G   S L     GI    I P+ +RK++G     ++ I    + +  + +LI+EL   ++   K  D       +K+++ D    T         ++I +++   L EQ
  S:     3 KIIHVDMDCFYAAVEMRDFPELRGKPIAVGGRSDRRGVISTCNYEARQFGVRSAMASGYALKLCPDLILVPGRMQVYKEVSNQIRAVFERYTDLIEPLSLDEAYLDVTESSHCKGSATLMAEAIRAEILAETGLTASAGIAPVKFLAKIASDLNKPNGQYVIRPEMIEEFVKTLPLIKIPGVGKVTAKKLADLGLHTCSDIQAYPEPKLV-ERFGKFGSVLIERSKGIDKRAILPNRERKSVGVETTLAKDIHTLEQCRAVMPQLIQELGARVSRSAK--DRAINKQVVKLKFEDFKQTTIEHR----SDEISVNLFYQLLEQ 318
>gi|127513799|ref|YP_001094996.1| DNA polymerase IV [Shewanella loihica PV-4] >gi|189027686|sp|A3QGY9|DPO4_SHELP DNA polymerase IV (Pol IV) >gi|126639094|gb|ABO24737.1| DNA-directed DNA polymerase [Shewanella loihica PV-4] (359 aa)
Score = 312, Expect = 1.1e-26, Identities = 95/313 (30%), Positives = 158/313 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQ 316
           KI H+DMD FFA+VE+ + PE    P+AVG       VI++ NY AR  GV+SAM    A K+CP L ++    + Y  +S +I    +  ++ IE  S+DE YLDVS+           A  ++  I +   L  + G +   FLAK+A++L KP+G   +T      ++  L + KI G+G     +L  + L    D+       L+ ++ G     L     GI    I+P  +RK++G     ++ I  Y + Q  + +LI+EL+  I+   K +  + K V +K+++ D    T         +++ + +  DL +Q
  S:     3 KIIHVDMDCFFAAVEMRDFPELRGKPIAVGGRSDRRGVISTCNYEARKFGVRSAMASAYALKLCPDLILVPGRMSVYKEVSAQIREVFARYTELIEPLSLDEAYLDVSDCTQHQGSATLIAEAIRREIFEVTGLTASAGIAPVKFLAKIASDLNKPNGQYVITPQMIPEFVKTLALIKIPGVGKVTAAKLETMGLITCADVQACSRQSLM-ERFGKFGGVLYDRAQGIDPRGISPHRERKSVGVETTLAKDIYTYEQCQAVMPQLIQELSGRISRSAKSRR-IHKQV-VKLKFDDFKQTT----IEQRSDEVSVKLFYDLLKQ 318
>gi|46447454|ref|YP_008819.1| DNA polymerase IV [Candidatus Protochlamydia amoebophila UWE25] >gi|81626453|sp|Q6MA55|DPO4_PARUW DNA polymerase IV (Pol IV) >gi|46401095|emb|CAF24544.1| probable DNA polymerase IV [Candidatus Protochlamydia amoebophila UWE25] (350 aa)
Score = 311, Expect = 1.1e-26, Identities = 73/196 (37%), Positives = 111/196 (56%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDI 199
           KI HIDMD+F+ASVE+ + P     P+AVG       VIA+ANY+AR  GV+SAM    AK++CP L I++P+ +KY   S  I+      +  IE  S+DE +LDV++           A  ++  I ++  L  + G +   FLAK+A++  KP+G   LT     +++  L + KI GIG  + ++L  L L    D+
  S:     5 KIIHIDMDAFYASVEMRDDPSLVLKPIAVGGDPDKRGVIATANYLARKFGVRSAMPSWKAKQLCPDLIILFPDFDKYKRESKAIHEIFHLFTDLIEPLSLDEAFLDVTDVDALRGSATWIAQEIRQLIWKERGLTASAGVAPNKFLAKVASDWHKPNGQFVLTPKEVDAFMVHLPVEKIFGIGHVMAKKLHSLGLMNCGDL 205
>gi|168713250|ref|ZP_02745527.1| DNA polymerase IV [Clostridium difficile QCD-63q42] >gi|196126313|ref|ZP_03118062.1| DNA polymerase IV [Clostridium difficile ATCC 43255] (365 aa)
Score = 311, Expect = 1.2e-26, Identities = 90/301 (29%), Positives = 158/301 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIA--NVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEY--QEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           KI HIDMD+F+AS+E  +  + +  P+ VG       V+A+ +Y AR  G+ SAM    A   CP    + P  + Y S+S++I       +  +E  S+DE YLDV+  +      IE A  +K  I ++  L  + G S+  FLAK+A++L KP+G   +T++N + ++  L ++K  G+G   +  L  L +    D+   N+     I KK G    K      GI   P+ P+  RK++G   ++ +  +   +E   ++ EL +++   LK  +   K++ +KI+Y D    T+S +  ++ ++
  S:     6 KIIHIDMDAFYASIEQRDNKKLKGRPVIVGGNPQSRGVVATCSYEARKFGIHSAMPSAVAYNRCPYAVFVRPRFDVYKSVSEQIRDIFYRYTDLVEPLSLDEAYLDVTKNKKNIDSSIEIAKQIKKDIFREVGLTSSAGVSYNKFLAKIASDLRKPNGLTVITEENAQDFLDKLPVNKFFGVGKVTSNTLKNLGIKTGYDLRCLNLFELENIFKKRGYELYKF---ARGIDDRPVEPNRVRKSVGAETTLSHNLDIDEEETRNILDELCEEVCHRLKNSEKFGKTLTLKIKYEDFTKITRSLSLEHYIDE 312
>gi|145955787|ref|ZP_01804788.1| hypothetical protein CdifQ_04000996 [Clostridium difficile QCD-32g58] >gi|168697223|ref|ZP_02729500.1| DNA polymerase IV [Clostridium difficile QCD-37x79] >gi|168724881|ref|ZP_02757158.1| DNA polymerase IV [Clostridium difficile QCD-76w55] >gi|168733207|ref|ZP_02765484.1| DNA polymerase IV [Clostridium difficile QCD-97b34] (365 aa)
Score = 311, Expect = 1.3e-26, Identities = 90/301 (29%), Positives = 158/301 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIA--NVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEY--QEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           KI HIDMD+F+AS+E  +  + +  P+ VG       V+A+ +Y AR  G+ SAM    A   CP    + P  + Y S+S++I       +  +E  S+DE YLDV+  +      IE A  +K  I ++  L  + G S+  FLAK+A++L KP+G   +T++N + ++  L ++K  G+G   +  L  L +    D+   N+     I KK G    K      GI   P+ P+  RK++G   ++ +  +   +E   ++ EL +++   LK  +   K++ +KI+Y D    T+S +  ++ ++
  S:     6 KIIHIDMDAFYASIEQRDNKKLKGKPVIVGGNPQSRGVVATCSYEARKFGIHSAMPSAVAYNRCPYAVFVRPRFDVYKSVSEQIRDIFYRYTDLVEPLSLDEAYLDVTKNKKNIDSSIEIAKQIKKDIFREVGLTSSAGVSYNKFLAKIASDLRKPNGLTVITEENAQDFLDKLPVNKFFGVGKVTSNTLKNLGIKTGYDLRCLNLFELENIFKKRGYELYKF---ARGIDDRPVEPNRVRKSVGAETTLSHNLDIDEEETRNILDELCEEVCHRLKSSEKFGKTLTLKIKYEDFTKITRSLSLEHYIDE 312
>gi|52425190|ref|YP_088327.1| DNA polymerase IV [Mannheimia succiniciproducens MBEL55E] >gi|52307242|gb|AAU37742.1| DinP protein [Mannheimia succiniciproducens MBEL55E] (355 aa)
Score = 311, Expect = 1.4e-26, Identities = 87/301 (28%), Positives = 152/301 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQ----EFLKLIKELTDDINSGLKYQDF-MFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           KI HIDMD F+A+VE+ E P     P+AVG       V+ + NY AR  G+ SAM    A K+CP L ++  N   Y  +S +I       + NIE  S+DE YLDV++    +      A  ++ +I  + +L  + G +   FLAK+A++  KP+G   +T     +++  L +SKI G+G    ++L+++ L    D+  +    L+  + G    ++     GI    +   ++RK++G   + +RN ++ +    E  +L   L   I        F  F+ + +K+++ D    T   + V F+ +
  S:     6 KIIHIDMDCFYAAVEMRENPALRDKPIAVGGSVQQRGVLTTCNYPARKFGLHSAMPTGQALKLCPDLILLPVNITLYKQVSHQIKQIFHRYTDNIEPLSLDEAYLDVTDCVQCSGSATWIAEEIRRAIFNELHLTASAGVAPLKFLAKIASDQNKPNGIFVITPGEVDNFVKTLPLSKIPGVGKVTGQKLLQMGLKTCGDVQKLDLTVLL-NRFGKFGQRIWQYSHGIDEREVQSHWQRKSVGVEDTLLRNITDIEQGIVELERLYPILEQRIKRACPDIPFERFRKLGVKLKFEDFQVTTLEKSAVEFKRE 316
>gi|152979982|ref|YP_001355275.1| DNA-damage-inducible protein p [Janthinobacterium sp. Marseille] >gi|151280059|gb|ABR88469.1| DNA-damage-inducible protein p [Janthinobacterium sp. Marseille] (401 aa)
Score = 311, Expect = 1.4e-26, Identities = 86/285 (30%), Positives = 154/285 (54%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHL-------------------------VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVL-GIICDPINPDYKRKNLGRSQSIRN----YSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           +I H+DMD+F+ASVEL   PE    P+ +G +                         V+ ++ Y AR LGV SAM I+ A K+ P   ++  + + Y   S      ++ ++ +IE   IDE Y+D+S    E       AS +KN+++Q   L+C++G +    LAK+ ++L KP+G   LT+ +  + I+ L   KI GIGP    +L  L L+ I+++A   +  L+ +  G  ++     V  GI   P+    + K++ R  +  N      + +    +   L + +   L+ + ++ ++V IK+R++D
  S:    23 RIAHLDMDAFYASVELLRYPELRGQPVVIGGMSVHAPLTQADGSRQYARLRDYAGRGVVTTSTYEARALGVFSAMGIMKAAKLAPDAILLPVDFDAYRHYSRLFKQAVADIAPHIENRGIDEIYIDLSEHAEETHA---LASRIKNAVQQATGLSCSIGIAPNKLLAKICSDLEKPNGLTILTQADIATRIWPLPARKINGIGPRAAEKLTALGLNTIEELAGA-DATLLHEHFGRSYADWLGRVAQGIDERPVVTYSEPKSVSRETTFENNLHAKRDREALGGIFTRLCERVAGDLERKGYVGRTVGIKLRFAD 333
>gi|77920719|ref|YP_358534.1| damage-inducible protein DinP [Pelobacter carbinolicus DSM 2380] >gi|77546802|gb|ABA90364.1| damage-inducible protein DinP [Pelobacter carbinolicus DSM 2380] (399 aa)
Score = 311, Expect = 1.5e-26, Identities = 91/366 (24%), Positives = 186/366 (50%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQY---ENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN--FQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSP--TQKISTESKLEKIRKQ 367
           K  I H+DMD+F+ASVE  + PE +  P+ VG      V+ + +Y AR  G+ SAM +  A ++CPQ  +      +Y  +S +++      +  +E  S+DE +LDV+ ++    E W   + A  ++  ++ +  L  + G +   FLAK+A+  AKPDG   +  +    ++  L + ++ G+GP L + L ++ L  + D+ ++    + R   G    +L     G    P+ P    K++G   +  ++  E +     + +L + + + L+    +  ++ +K++Y+D  + T+S +  +     +  LH+   L E+     K  +++ +S+   N+M+ D+ + L +FD     Q    E  ++ +R++
  S:     8 KRIILHLDMDAFYASVEQLDSPELKGQPVVVGGHRSRGVVCACSYEARTFGIHSAMPMSRALRLCPQAIVQPVRMARYQEISRQVFDIFGRYTDLVEPLSVDEAFLDVTASRRLFGEGW---DIAEKIRRDVRDELGLPISAGIAPNKFLAKLASEQAKPDGVFQV-PERVDDFLLSLPLKRLWGVGPVLLKSLQKMGLRTVADLRHMDRADMER-CFGQAGERLIQLAHGEDERPVEPQRSLKSIGHEDTFDQDIFERETMHVALLDLVERVAARLRKHGLIGTTLTLKVKYADFSTVTRSRSVADGICHARDMLHLAKQLLEKTEAGKKPVRLLGVSLA--NLMDADSGQGL-LFDEDRRNQLKGLEQAMDHVRER 377
>gi|196186995|gb|EDX81971.1| ImpB/MucB/SamB family [Brevundimonas sp. BAL3] (422 aa)
Score = 310, Expect = 1.5e-26, Identities = 102/366 (27%), Positives = 183/366 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASL-VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICD--PINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYD-----QVINLSITANNIMENDNNEQLTIFDSP-TQKISTESKLEKIRKQVNK 370
           I H+D D+F+ASVE  +RPE    P+ VG     V+++A YVAR  GV SAM +  A K CP+  +I PN  KY   S++I   L  L+  I+  S+DE ++D+S T+  N     F  +  +  I+++  L  ++G +   FLAKMA+ + KP GF  +   N ++ +    ++ + G+GP   + L       I D+A      L+++      S LR++ L    D   +NP+  RK +    +       QE L+  +  L + + S  +      + + +K+R SD    T+  +  +     P+     LF    D  K +     ++I + +     +++ ++    +F +P T+ + TE  ++ +R++  K
  S:    44 IAHMDCDAFYASVEKRDRPELRDKPVIVGGGKRGVVSTACYVARQYGVGSAMPMFKALKACPEAVVIKPNFAKYVFESERILGALGRLTPLIQPLSLDEAWVDLSGTERLNGGPPAFQLIRFQKQIEEETGLTVSIGLAPNRFLAKMASEMDKPRGFSVVGAANAQALLAPRPVTALPGVGPVFGKALRSDGYATIGDLAKADLRDLVKR---YGESGLRLHDLAHARDARAVNPERDRKGMSAETTFNEDLSSQEALEAELWPLCEKLASKARRDGVASRVLVLKLRRSDFKIITRRVSLAD-----PIQTARALFAAGRDLLKPELGPPYRLIGIGMAD---IQDADDAPAGLFQTPETRALKTERAIDALREKFGK 411
>gi|148546475|ref|YP_001266577.1| DNA polymerase IV [Pseudomonas putida F1] >gi|189027676|sp|A5VZT3|DPO4_PSEP1 DNA polymerase IV (Pol IV) >gi|148510533|gb|ABQ77393.1| DNA-directed DNA polymerase [Pseudomonas putida F1] (354 aa)
Score = 310, Expect = 1.5e-26, Identities = 67/191 (35%), Positives = 112/191 (58%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGP----SLTRQLIELNLH 194
           KI H+D D F+A++E+ + P     P+AVG       VIA+ NY AR  GV+SAM+   A K+CP L I+ P    Y   S +I++     ++ IE  S+DE YLDVS++Q+ +      A  ++  + +  ++  + G +   FLAK+A++  KP+G   +T +  ++++  L ++++ G+G      LTR  IE  LH
  S:     5 KIIHVDCDCFYAAIEMRDDPRLAGRPMAVGGSPDHRGVIATCNYEARAYGVRSAMSSRHALKLCPDLLIVKPRFEAYREASREIHTIFRDYTELIEPLSLDEAYLDVSDSQWYSGSATRIAEDIRRRVARTLHITVSAGVAPNKFLAKIASDWRKPNGLFVITPNEVETFVAALPVARLHGVGKVTADKLTRLGIETCLH 204
>gi|126662622|ref|ZP_01733621.1| DNA polymerase IV [Flavobacteria bacterium BAL38] >gi|126626001|gb|EAZ96690.1| DNA polymerase IV [Flavobacteria bacterium BAL38] (353 aa)
Score = 310, Expect = 1.6e-26, Identities = 96/353 (27%), Positives = 180/353 (50%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVIN-LSITANNIMENDNNEQLTIFDSPTQKISTESKLE 362
           MD+F+ASVE  + P  +  PLAVG      V+++A+Y AR  GV+SA++ + AKK+CP L  + P  ++Y  +S +I       +  +E  S+DE YLDV+  +  N      A  ++  I ++  L  + G S   F+AK+A++  KP+G  T+  D  + ++  L + K  G+G     ++ +L +    D+     +YL       GLH+ ++   V GI    + P+ K K++G  ++       + F+ + ++ +  ++   L+      K++ +KI+YSD    T+S     F +    +++VD+ + +    +    +  L I+ +N+    NNE+ T      + +S + K E
  S:     1 MDAFYASVEQMDNPNLKGKPLAVGGSEVRGVVSAASYEARKFGVRSAISGIQAKKLCPDLIFVPPRFDRYKEISKQIRKIFLDYTDLVEPLSLDEAYLDVTENKKGNPSATLIAQEIRKRIFEEVGLTASAGISANKFVAKIASDYNKPNGQKTVNPDEIEPFLEKLDVKKFYGVGKVTAEKMYQLGIFTGYDLKQKSVEYLENHFGNSGLHYFQI---VRGIHNSAVKPNRKIKSVGAERTFGENLSSEIFMEERLQSIAKELEKRLQKSKISGKTITLKIKYSDFTLQTRSKTLPYFVSD--KNIIVDVAKDLLYQERLKNSVRLLGISVHNL----NNEEKTRIPLTQKSVSVQLKFE 352
>gi|71756025|ref|XP_828927.1| DNA polymerase kappa [Trypanosoma brucei TREU927] >gi|70834313|gb|EAN79815.1| DNA polymerase kappa, putative [Trypanosoma brucei] (571 aa)
Score = 310, Expect = 1.6e-26, Identities = 88/281 (31%), Positives = 156/281 (55%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVGHL-VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSN--TQYENWKEIE-FASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTL---TKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKND-----------YLIRKKIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYS 287
           H+DMD F+A+VE+ + PEY  +PLAVG + ++++ANYVAR  G++S M      K+CP L I+ P+ + Y   S+ +   ++    N  +  +DE  L+VS    ++E  K  E  AS ++  +  +  L  + G   T  LAK+A+N+ KP+G   L   T+++  +Y+ DL +  + GIG      L  L +  + DI N + +           +L+   IG + W  +  ++LG   D       RK++G  ++ + +   +E  +++  L D     LK  + M + V++KIR++
  S:   137 HLDMDMFYAAVEIKKHPEYAAIPLAVGSVSMLSTANYVARECGIRSGMPGYIGLKVCPNLLILPPDFDAYNEESNTVRRIVAEYDPNFTSLGLDELTLEVSAYIERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTREDVMTYVRDLGLRSVPGIGKVTEALLKGLGITTLSDIYNRRVELCYIFTEKTYCFLLGASIGIMQWPDM-CSILGASIDD-GTGVGRKSVGCERTFKTFQNKEELQEMVDFLVDYSYDELKKHELMCRQVSLKIRWN 434
>gi|157376554|ref|YP_001475154.1| DNA polymerase IV [Shewanella sediminis HAW-EB3] >gi|189027689|sp|A8FYV3|DPO4_SHESH DNA polymerase IV (Pol IV) >gi|157318928|gb|ABV38026.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3] (360 aa)
Score = 310, Expect = 1.6e-26, Identities = 96/313 (30%), Positives = 158/313 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQ 316
           KI HIDMD +FA+VE+ + PE    P+AVG       VI++ NY AR  GV+SAM    A K+CP L ++    + Y  +S +I    S  +  IE  S+DE YLDV++           A  ++  I +   L  + G +   FLAK+A++L KP+G   +T +   +++ DL + KI G+G    ++L ++ L    D+       LI ++ G   S L     GI    I+P  +RK++G     ++ I +  + Q  + +LI+EL   I    K  D       +K++++D    T         +++ + +  DL  Q
  S:     3 KIIHIDMDCYFAAVEMRDFPELRGKPIAVGGRSDRRGVISTCNYEARKFGVRSAMASGYALKLCPDLILVPGRMSVYKEVSAQIREVFSHYTDLIEPLSLDEAYLDVTDCTQCQGSATLIAEAIRQEIFELTGLTASAGIAPIKFLAKIASDLNKPNGQYVITPNMIPAFVKDLPLIKIPGVGKVTGKKLEDIGLITCSDLQAYPEAALI-ERFGKFGSVLIERAQGIDTRNISPHRERKSVGVETTLAKDIYSLEQCQGVMPQLIQELATRIKRSAK--DRTIHKQVVKLKFNDFKQTTIEHR----SDEVSVKLFYDLLSQ 318
>gi|56414559|ref|YP_151634.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|81599398|sp|Q5PF76|DPO4_SALPA DNA polymerase IV (Pol IV) >gi|56128816|gb|AAV78322.1| hypothetical protein DinP (DNA damage-inducible protein) [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (351 aa)
Score = 310, Expect = 1.7e-26, Identities = 85/291 (29%), Positives = 148/291 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI HIDMD FFA+VE+ + P    +P+A+G        I++ANY AR  GV+SAM    A K+CP LT++    + Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHIDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGAISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|70728634|ref|YP_258383.1| DNA polymerase IV [Pseudomonas fluorescens Pf-5] >gi|68342933|gb|AAY90539.1| DNA polymerase IV [Pseudomonas fluorescens Pf-5] (354 aa)
Score = 310, Expect = 1.7e-26, Identities = 75/240 (31%), Positives = 125/240 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKN--DYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           M+ KI HID D F+A++E+ + P     PLAVG       VIA+ NY AR  GV+SAM+   A  +CP L I+ P    Y   S +I++     +  IE  S+DE YLDVS +          A  ++  +  + ++  + G +   FLAK+A++  KP+G   +T D  + ++ +L +SK+ G+G     +L  L    I D   +++     + ++ G    +L     GI   P+  D +R+++
  S:     1 MQRKIIHIDCDCFYAAIEMRDAPHLASKPLAVGGSADRRGVIATCNYEARAYGVRSAMSSRHALTLCPDLVIVKPRMEAYREASKEIHTIFRDYTDLIEPLSLDEAYLDVSESPSFAGSATRIAQDIRRRVSNQLHITVSAGVAPNKFLAKIASDWKKPNGLFVITPDQVEDFVSELPVSKLHGVGKVTADKLGRLG---IVDCLQLRDWSKLALAREFGSFGERLWSLARGIDERPVQNDSRRQSI 244
>gi|91977509|ref|YP_570168.1| DNA polymerase IV [Rhodopseudomonas palustris BisB5] >gi|91683965|gb|ABE40267.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris BisB5] (429 aa)
Score = 310, Expect = 1.8e-26, Identities = 80/289 (27%), Positives = 149/289 (51%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWK-EIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           HID D+F+A+VE  + P+    P+ +G     V+++A Y+AR  GV+SAM +  A  +CP   ++ P+  KY  +  ++   +  L+  +E  SIDE +LD+S T+  +     +  +      ++   +  +VG S   FLAK+A++L KP GF TL +D+ K+ +    +S I G+GP+   ++ +     I D+       L+R + G    +L     GI    + PD   K++    +   +  + +   +++  L+D ++S LK       ++ +K++ SD    T+S
  S:    48 HIDCDAFYATVEKRDNPDLADRPVIIGGGRRGVVSAACYIARTFGVRSAMPMFKALALCPSAAVVRPDMAKYVRVGREVRQAMLQLTPLVEPLSIDEAFLDLSGTERMHGAIAAKVLARFARDTERDIGITVSVGLSCNKFLAKIASDLDKPRGFATLDQDDAKAMLGPRPVSFIFGVGPATAARVAQYGFRTIADLQKADEIDLMR-QFGDEGRRLWRLARGIDNRKVVPDRGAKSISNETTFETDIRDLETLERILWRLSDKVSSRLKSAGLAGSTITLKLKSSDFRQRTRS 340
>gi|117618729|ref|YP_855686.1| DNA polymerase IV [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|189027655|sp|A0KHD5|DPO4_AERHH DNA polymerase IV (Pol IV) >gi|117560136|gb|ABK37084.1| DNA polymerase IV [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (350 aa)
Score = 310, Expect = 1.8e-26, Identities = 87/290 (30%), Positives = 142/290 (48%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG-----RSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI HIDMD F+A+VE+ + P   ++PLA+G       VI++ NYVAR  GV+SAM    A+K+CP L +I      Y  +S  + +     ++ +E  S+DE YLDV+ +          A  ++ +I  +  L  + G +   FLAK+A+   KPDG   +       ++  L + K+ GIG     +L  L L+  +D   + N+ LI  + G     L   + G    P+     RK +G      S  +   + +Q   +LI EL    +     +  M +   IK++++D    T
  S:     3 KIIHIDMDCFYAAVEMRDNPALREVPLAIGGSADRRGVISTCNYVARRFGVRSAMPSALARKLCPPLVLIPGRMAVYKEVSRLLRAIFLRYTEQVEPLSLDEAYLDVTMSPCCGGSATLMAREIRAAINTELGLTASAGVAPNKFLAKLASEQRKPDGLFVIRPQEVDEFVRQLPLGKLPGIGRKTADRLESLGLYSCEDARQLGNEELI-ARFGKLGEMLAGRIWGHDEQPVQAQRVRKTIGVETTLASDVLDEAACWQVLRQLIPELEQRFSVSHGKEQLMGQG--IKLKFADFQQTT 299
>gi|126208514|ref|YP_001053739.1| DNA polymerase IV [Actinobacillus pleuropneumoniae L20] >gi|126097306|gb|ABN74134.1| DNA polymerase IV [Actinobacillus pleuropneumoniae L20] (356 aa)
Score = 310, Expect = 1.8e-26, Identities = 88/292 (30%), Positives = 151/292 (51%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQEFL-KLIKELTDDINSGLKYQDFM-FKSVNIKIRYSDGDSAT 293
           + KI HIDMD F+A++E+ E P     P+AVG       V+ + NY AR  G+ SAM    A K CP L ++  N   Y ++S++I+      +  +E  S+DE YLDV++ +  +      A  ++++I  + +L  + G +   FLAK+A++  KP+G   ++ +N  ++IYDL + KI  +G     +L +L LH   DI +  +   I K  G    +L      I    I  +  RK+L    +    I + +E ++ + +L K+L   +      +    FK + IK+++ D    T
  S:     4 QRKIIHIDMDCFYAAIEMRENPALIGKPVAVGGSVEGRGVLTTCNYEARKFGLHSAMPTAQALKRCPNLILVPVNMPLYKAVSEQIHQIFRRYTDIVELLSLDEAYLDVTDCRQCSGSATWIAQEIRDAIWNELHLTASAGIAPLKFLAKIASDQNKPNGQFVISPENMTAFIYDLPLKKIPRVGKVTNEKLAQLGLHTCGDIQH-SDKAFIYKTFGKFGQRLWEFSHAIDNRKIEANRPRKSLAVENTLPTDIWHLAEAEQIVDELFKKLVFRLQRNWGERSLQEFKKLAIKLKFGDFTQTT 305
>gi|104783086|ref|YP_609584.1| DNA polymerase IV [Pseudomonas entomophila L48] >gi|122402270|sp|Q1I6D5|DPO4_PSEE4 DNA polymerase IV (Pol IV) >gi|95112073|emb|CAK16800.1| DNA polymerase IV, damage-inducible protein P [Pseudomonas entomophila L48] (354 aa)
Score = 310, Expect = 1.9e-26, Identities = 82/290 (28%), Positives = 147/290 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNL---HYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI HID D F+A++E+ + P     P+AVG       VIA+ NY AR  GV+SAM    A K+CP L I+ P    Y   S  I++     +  IE  S+DE YLDV+++Q+        A  ++  + Q+ ++  + G +   FLAK+A++  KP+G   +T D  + ++  L ++++ G+G     +L  L +   H ++D   +    L+R + G    +L     GI    +  D +R+++    +   +  +    L+ + EL   +N  +   D  ++     +K+++ D    T
  S:     5 KIIHIDCDCFYAAIEMRDDPRLAGRPMAVGGQPGQRGVIATCNYEARAYGVRSAMASGHALKLCPDLEIVKPRFEAYREASRDIHTIFRDYTDLIEPLSLDEAYLDVTDSQWFAGSATRIAEDIRRRVAQQLHITVSAGVAPNKFLAKIASDWRKPNGLFVITPDQVEEFVAQLPVARLHGVGKVTADKLARLGIDTCHALRDWPRLA---LVR-EFGSFGERLWGLARGIDERAVQNDSRRQSVSVENTYDHDLPDLNSCLEKLPELLSSLNERIARMDSSYRPDKPFVKVKFHDFSQTT 301
>gi|28899116|ref|NP_798721.1| DNA polymerase IV [Vibrio parahaemolyticus RIMD 2210633] >gi|153836821|ref|ZP_01989488.1| DNA polymerase IV [Vibrio parahaemolyticus AQ3810] >gi|33301073|sp|Q87MB4|DPO4_VIBPA DNA polymerase IV (Pol IV) >gi|28807340|dbj|BAC60605.1| DNA-damage-inducible protein P [Vibrio parahaemolyticus RIMD 2210633] >gi|149749967|gb|EDM60712.1| DNA polymerase IV [Vibrio parahaemolyticus AQ3810] (354 aa)
Score = 309, Expect = 2.0e-26, Identities = 80/258 (31%), Positives = 136/258 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI H+DMD F+A+VE+ + P Y  + LAVG       VI++ NY AR  GV+SAM    A ++CP L ++    + Y  +S +I +     +  IE  S+DE YLDV++           A  ++N I+ +  L  + G +   FLAK+A+++ KP+G   +  +  +  +  L + KI G+G     +L +   +  +DI N     L+R + G   + L     GI    +  + +RK++G  ++  +N S Y E  ++I+E
  S:     7 KIIHVDMDCFYAAVEMRDNPNYRDIALAVGGHEKQRGVISTCNYEARKFGVRSAMPTARALQLCPHLLVVPGRMHIYKQVSLQIRAIFERYTSLIEPLSLDEAYLDVTDATACRGSATLIAESIRNDIRNELGLTASAGIAPIKFLAKVASDMNKPNGQFVIPPEKVQEVVDKLPLEKIPGVGKVSLEKLHQAGFYLCEDIKNSDYRELLR-QFGRQGASLWKRSHGIDDREVVVERERKSVGVERTFSQNISTYDECWQVIEE 269
>gi|157962909|ref|YP_001502943.1| DNA polymerase IV [Shewanella pealeana ATCC 700345] >gi|189027687|sp|A8H771|DPO4_SHEPA DNA polymerase IV (Pol IV) >gi|157847909|gb|ABV88408.1| DNA-directed DNA polymerase [Shewanella pealeana ATCC 700345] (358 aa)
Score = 309, Expect = 2.1e-26, Identities = 89/290 (30%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG----RSQSIRNYSEYQEFL-KLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSAT 293
           KI H+DMD F+A+VE+ + PE    P+AVG       VI++ NY AR  GV+SAM    A K+CP L ++      Y  +S +I +     +  IE  S+DE YLDV+++ +        A  ++  I  +  L  + G +   FLAK+A++L KP+G   +  D    ++  L + KI G+G    ++L +L LH   D+       LI ++ G   + L     G+    I+P+ +RK++G     ++ I    + +  + +LI+EL   ++   K  D       +KI++ D    T
  S:     3 KIIHVDMDCFYAAVEMRDFPELRGKPIAVGGRSDRRGVISTCNYEARQFGVRSAMASGYALKLCPDLILVPGRMQVYKEVSSQIRAVFERYTYLIEPLSLDEAYLDVTDSPHCKGSATLIAEAIRADILAETGLTASAGIAPVKFLAKIASDLNKPNGQYVIRPDMINEFVKTLPLIKIPGVGKVTAKKLADLGLHTCSDVQAYPPAQLI-ERFGKFGTVLIERSKGVDKRGISPNRERKSVGVETTLAKDIHTLEQCRAVMPQLIQELGARVSRSAK--DRTIHKQVVKIKFEDFKQTT 299
>gi|149923144|ref|ZP_01911558.1| DNA-directed DNA polymerase [Plesiocystis pacifica SIR-1] >gi|149815982|gb|EDM75497.1| DNA-directed DNA polymerase [Plesiocystis pacifica SIR-1] (409 aa)
Score = 308, Expect = 2.5e-26, Identities = 74/247 (29%), Positives = 132/247 (53%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRS----QSIRNYSEYQEFL 256
           MD+FFAS+E  + P     P+ VGH     V+A+A+Y AR  G  SA  +  A++ CPQ  I+      Y  +S +++  L   +  +E  SIDE +LD+S TQ  +      A  ++ ++ ++  L C+VG +   F+AK+A++  KPDG   +     +++++ L + ++ G+GP     L    +  I DIA +  + L R  +G H   L    +G+   P++P  +RK +       + +R+  E +++L
  S:     1 MDAFFASIEQRDDPRLRGKPVLVGHAGKRGVVAAASYEARRFGCHSAQPMAVARRRCPQAVIVPGRHEVYLGVSAELFEILEGFTPVVEGLSIDEAFLDMSGTQRLHGPPRVAAERIRQTVAERLRLTCSVGIASAKFIAKIASDQDKPDGLTVVEPGRERAFLHRLPVRELWGVGPRTQEVLERYGVRTIGDIAELGLETLER-DLGEHGRHLHQLSVGVDPRPVSPGRERKQVSHENTFGEDLRSRPEIEDWL 254
>gi|167035208|ref|YP_001670439.1| DNA polymerase IV [Pseudomonas putida GB-1] >gi|189027677|sp|B0KTK6|DPO4_PSEPG DNA polymerase IV (Pol IV) >gi|166861696|gb|ABZ00104.1| DNA-directed DNA polymerase [Pseudomonas putida GB-1] (354 aa)
Score = 308, Expect = 2.5e-26, Identities = 79/290 (27%), Positives = 147/290 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI H+D D F+A++E+ + P     P+AVG       VIA+ NY AR  GV+SAM+   A K+CP L I+ P    Y   S +I+      ++ IE  S+DE YLDVS++Q+ +      A  ++  + +  ++  + G +   FLAK+A++  KP+G   +T    ++++  L ++++ G+G     +L  L +    ++       L+R + G    +L     GI    ++ D +R+++    +   +  +    L  + EL D +N  +   D  ++     +K+++ D    T
  S:     5 KIIHVDCDCFYAAIEMRDDPRLAGRPMAVGGSPDHRGVIATCNYEARAYGVRSAMSSRHALKLCPDLLIVKPRFEAYREASREIHGIFRDYTELIEPLSLDEAYLDVSDSQWYSGSATRIAEDIRRRVARTLHITVSAGVAPNKFLAKIASDWRKPNGLFVITPAEVEAFVAALPVARLHGVGKVTADKLTRLGIETCLELREWSRLALVR-EFGSFGERLWGLARGIDERAVHNDSRRQSVSVENTYDTDLPDLASCLARLPELLDSLNERIARMDNSYRPDKPFVKVKFHDFSQTT 301
>gi|118620042|ref|YP_908374.1| DNA polymerase IV [Mycobacterium ulcerans Agy99] >gi|118572152|gb|ABL06903.1| nucleotidyltransferase/DNA polymerase DinP [Mycobacterium ulcerans Agy99] (429 aa)
Score = 308, Expect = 2.5e-26, Identities = 77/291 (26%), Positives = 150/291 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL---IRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI---RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+ SF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++AM    A+++CPQ  ++ P    Y   SD ++      +  +E  S+DE +LDV+  +  +   ++ A+ ++  ++ +  L  TVG + T FLAK+A+  AKPDG L +  ++  ++++ L + ++  +G     +L   +L  + D+A +    L   +   +G     L  N   I    ++   +R+++G  +++    N     E   ++  L D I   ++      ++V +++R+ D   AT+S
  S:    39 ILHADLASFYASVEQRDAPSLRGRPVIVGGGVVLAASYEAKAYGVRTAMGGAQARRLCPQAVVVPPRMRAYMRASDAVFEVFRDCTPLVEPLSVDEAFLDVAGLRRVSGTPVQIAARLREDVRGRVGLPITVGVARTEFLAKVASQEAKPDGLLLVPPEDELAFLHPLPVRRLWEVGAKTAAKLQSHDLCTVADVAELSESALSSMLGAAMGRQLYALSRN---IDRRRVSTGVRRRSVGAQRALGRAGNALSPAELDAVVVTLIDRITGRMRAAGRTGRTVVLRLRFDDFSRATRS 332
>gi|86145684|ref|ZP_01064014.1| DNA polymerase IV [Vibrio sp. MED222] >gi|85836655|gb|EAQ54781.1| DNA polymerase IV [Vibrio sp. MED222] (358 aa)
Score = 308, Expect = 2.6e-26, Identities = 83/258 (32%), Positives = 136/258 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVK-NDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI H+DMD F+A+VE+ + P Y   PLAVG       V+++ NY AR  G++SAM    A ++CP L ++    + Y  +S KI    S  +  IE  S+DE +LDV+++          A  ++  I  + NL  + G +   FLAK+A++L KP+G   +   + +S I +L + KI G+G     +L +      KDI      D L+R   G   + L     GI    +  + +RK++G  ++  +N S Y E  ++I++
  S:    11 KIIHVDMDCFYAAVEMRDNPAYRNRPLAVGGHEKQRGVLSTCNYEARKFGIRSAMPTGKALQLCPNLLVVPGRMSVYVEISKKIREIFSRYTSIIEPLSLDEAFLDVTDSTLCRGSATLIAEAIRRDIWNELNLTASAGIAPIKFLAKVASDLNKPNGQFVIPPQDVQSVIDELPLEKIPGVGKVSIEKLHQAGFFTCKDIKESDYRDLLLR--FGRQGASLWKRSHGIDDREVIIERERKSVGVERTFTQNISTYAECWQVIED 273
>gi|91978101|ref|YP_570760.1| DNA polymerase IV [Rhodopseudomonas palustris BisB5] >gi|91684557|gb|ABE40859.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris BisB5] (396 aa)
Score = 308, Expect = 2.6e-26, Identities = 88/294 (29%), Positives = 155/294 (52%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFAS----LVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + KI H+DMD+F+ASVE  + PE    P+AVG      V+A+A+Y AR  GV+SAM  V A++ CP L  + P    Y ++S +I    +  +  IE  S+DE YL V+    EN + I  A      ++  IK +  LN + G S+  FLAK+A++  KP+G   ++ +   +++  L + K  GIGP+   +   L +    DI      +L     K G ++  +     GI   P+  +  RK++G   +  ++ +E+      ++ L D +    +      ++V +K++++D +  ++S
  S:    43 QRKIIHVDMDAFYASVEQRDNPELWGRPVAVGGSRERGVVAAASYEARKFGVRSAMPSVTARRQCPGLVFVKPRFEVYKAISQQIREIFAEHTLVIEPLSLDEAYLYVT----ENLQGISLARDIALAIRARIKTETGLNASAGISYNKFLAKLASDHRKPNGQYVISPETGPAFVEALPVGKFHGIGPATAARFHALGIQTGLDIRGRTLTFLEAHFGKAGAYYYWISR---GIDERPVRANRIRKSVGAENTFSQDLTEFDAMAAELQPLIDKVWRHCETTGNRGRTVTLKVKFADFEIMSRS 340
>gi|62178884|ref|YP_215301.1| DNA polymerase IV [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|75484717|sp|Q57SU1|DPO4_SALCH DNA polymerase IV (Pol IV) >gi|62126517|gb|AAX64220.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (351 aa)
Score = 308, Expect = 2.6e-26, Identities = 85/291 (29%), Positives = 148/291 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKY--QDFMFKSVNIKIRYSDGDSATK 294
           KI H+DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++      Y   S  +    S  +  IE  S+DE +LDV+++ +        A  ++ +I  +  L  + G +   FLAK+A++L KP+G   +T  +   ++  L ++KI G+G     +L  + L    DI       L+ K+ G     L     GI    +N +  RK++G  +++  +  E+ +   +I+ L  ++   L     D +     +K++++D    T+
  S:     3 KIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARQFGVRSAMPTAMALKLCPHLTLLPGRFVAYKEASRHVRDIFSRYTSLIEPLSLDEAWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYVITPADVPGFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLL-KRFGKFGRVLWERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDLLIARQGVKLKFNDFQQTTQ 300
>gi|92114193|ref|YP_574121.1| DNA-directed DNA polymerase [Chromohalobacter salexigens DSM 3043] >gi|91797283|gb|ABE59422.1| DNA-directed DNA polymerase [Chromohalobacter salexigens DSM 3043] (348 aa)
Score = 308, Expect = 2.7e-26, Identities = 73/237 (30%), Positives = 127/237 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           KI H D D F+A+VE+ + P    +PLA+G       V+A+ NY AR  G+ SAM +  A ++CP LT + P+  KY  +S +I +    L+  +E  S+DE YLDVS            A  +K     +  +  +VG + + FLAK+A++  KPDG   +  +  + ++ +L + ++ G+GP+   +L  L +   +D+ +   D L+ ++ G    +L     GI   P+  + +RK++
  S:     3 KILHADCDCFYAAVEMRDDPALRDVPLAIGGSPEQRGVVATCNYPARAFGIHSAMPMARAMRLCPHLTRLAPDFPKYREVSARIQALFHELTPLVEPLSLDEAYLDVSEVTQCQGSATWMARWLKQEALTRTGIVISVGAAPSKFLAKLASDWDKPDGLYVIAPEEVEPFLLELPVKRLHGVGPATAAKLEGLGIVTCRDLRDWPLDTLL-ERFGKFGRRLFELARGIDERPVQIERERKSV 243
>gi|83594859|ref|YP_428611.1| DNA polymerase IV [Rhodospirillum rubrum ATCC 11170] >gi|83577773|gb|ABC24324.1| DNA-directed DNA polymerase [Rhodospirillum rubrum ATCC 11170] (421 aa)
Score = 308, Expect = 2.8e-26, Identities = 81/284 (28%), Positives = 151/284 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWK--EIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDI-ANVKNDYLIR-KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           I HID D+F+ASVE  + P     PL VGH     V  +A Y+AR  G +SAM +    ++CP+  +I P+  KY ++S ++ + +   +  +E  S+DE YLD+S  ++   +   +  A++ +  ++++  +  ++G S   FLAK+A+++ KP GF  + +    + +  + + ++ G+G +  R+L EL LH I D+    + D L R  KIG     L  +  G     I+PD + K++    +  R+ S   +  + +  L++ +   L        +V +K++  D
  S:    38 IAHIDCDAFYASVEKRDNPSLRDRPLIVGHPGGRGVATTACYIARRFGARSAMPMFKCLELCPEAVVIPPDMAKYKAVSAQVRAIMLEATHRLEPLSLDEAYLDLSEGEHRFARPPAVSLATIARR-VEREIGITVSIGLSSNRFLAKLASDMNKPQGFTVIDEAEAPALLAPMPVKRLHGVGAATERRLAELGLHTIGDLQGRPEADLLARFGKIG---RALHAHAWGRGGRTISPDRETKSISAETTFERDLSRLPDLARALGPLSERVARALTRNALAGATVVLKLKTHD 326
>gi|121635137|ref|YP_975382.1| impB/mucB/samB family protein [Neisseria meningitidis FAM18] >gi|189027672|sp|A1KUQ3|DPO4_NEIMF DNA polymerase IV (Pol IV) >gi|120866843|emb|CAM10601.1| impB/mucB/samB family protein [Neisseria meningitidis FAM18] (352 aa)
Score = 307, Expect = 3.7e-26, Identities = 84/295 (28%), Positives = 150/295 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HIDMD+F+ASVEL E+P  +  P+ V       VI +A+Y AR  G+ SAM++  AK++CPQ   + P+ + Y  +S +I++     +  IE  S+DE YLDV+     N+K I +AS V   I+        L  + G +   FLAK+A++  KP+G   L      +++  L + KI G+G    +++  L +    D+   +   L+    G +  +L   V G    P+  + +R  +    ++      ++    +  L +D+   +  ++   +SV +K++  D    T++  +
  S:     5 KIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICAASYEARQFGLHSAMSVATAKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLSLDEAYLDVT----RNFKNIPYASEVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPNGQFVLPPHKVMAFLETLPLGKIPGVGKVTLKKMQSLGMRTAGDLRRFERGELL-NHFGRYGYRLYDLVRGTDERPVKAERERLQISTEITLPEDLPLEQAAGHLPHLAEDLWRQITRKNVEAQSVTLKLKTYDFRIITRTLTY 302
>gi|93117315|gb|ABE99575.1| DinB [Neisseria meningitidis] >gi|93117317|gb|ABE99576.1| DinB [Neisseria meningitidis] (336 aa)
Score = 307, Expect = 3.7e-26, Identities = 84/295 (28%), Positives = 150/295 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HIDMD+F+ASVEL E+P  +  P+ V       VI +A+Y AR  G+ SAM++  AK++CPQ   + P+ + Y  +S +I++     +  IE  S+DE YLDV+     N+K I +AS V   I+        L  + G +   FLAK+A++  KP+G   L      +++  L + KI G+G    +++  L +    D+   +   L+    G +  +L   V G    P+  + +R  +    ++      ++    +  L +D+   +  ++   +SV +K++  D    T++  +
  S:     5 KIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICAASYEARQFGLHSAMSVATAKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLSLDEAYLDVT----RNFKNIPYASEVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPNGQFVLPPHKVMAFLETLPLGKIPGVGKVTLKKMQSLGMRTAGDLRRFERGELL-NHFGRYGYRLYDLVRGTDERPVKAERERLQISTEITLPEDLPLEQAAGHLPHLAEDLWRQITRKNVEAQSVTLKLKTYDFRIITRTLTY 302
>gi|93117309|gb|ABE99572.1| DinB [Neisseria meningitidis] (335 aa)
Score = 307, Expect = 3.7e-26, Identities = 84/295 (28%), Positives = 150/295 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HIDMD+F+ASVEL E+P  +  P+ V       VI +A+Y AR  G+ SAM++  AK++CPQ   + P+ + Y  +S +I++     +  IE  S+DE YLDV+     N+K I +AS V   I+        L  + G +   FLAK+A++  KP+G   L      +++  L + KI G+G    +++  L +    D+   +   L+    G +  +L   V G    P+  + +R  +    ++      ++    +  L +D+   +  ++   +SV +K++  D    T++  +
  S:     5 KIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICAASYEARQFGLHSAMSVATAKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLSLDEAYLDVT----RNFKNIPYASEVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPNGQFVLPPHKVMAFLETLPLGKIPGVGKVTLKKMQSLGMRTAGDLRRFERGELL-NHFGRYGYRLYDLVRGTDERPVKAERERLQISTEITLPEDLPLEQAAGHLPHLAEDLWRQITRKNVEAQSVTLKLKTYDFRIITRTLTY 302
>gi|118472591|ref|YP_890655.1| DNA polymerase IV [Mycobacterium smegmatis str. MC2 155] >gi|118173878|gb|ABK74774.1| DNA polymerase IV [Mycobacterium smegmatis str. MC2 155] (403 aa)
Score = 307, Expect = 3.8e-26, Identities = 79/291 (27%), Positives = 147/291 (50%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYL---IRKKIGLHWSKLRMNV---LGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           I H D+DSF+ASVE  + P     P+ VG  V+ +A+Y A+  GV++AM+   A+ +CPQ  ++ P    YT  S  +++     +  +E  S+DE +LDVS     +   +E A+ ++  ++++  L  TVG + T FLAK+A+   KPDG L +  D   ++++ L + ++ G+G     +L    +  + D+A +    L   +   +G     L  N+           +    ++ LGR  +  + +E      ++  L D I   ++      ++V +++R+ D   AT+S
  S:    11 ILHADLDSFYASVEQRDDPALRGRPVIVGGGVVLAASYEAKAYGVRTAMSGGQARALCPQAIVVPPRMAAYTQASRDVFAVFHDTTPLVEPLSVDEAFLDVSGLARVSGTPVEIAARLRARVREQVGLPITVGIARTKFLAKVASQEGKPDGLLLVPPDRELAFLHPLPVRRLWGVGAKTAEKLRAHGIETVADVAELSEATLGSMVGGAMGRQLFTLSRNIDRRRVTTGVRRSSVGAQRALGRRGNSMSAAEVD---AVVVNLVDRITRRMRAAGRTGRTVVLRLRFDDFGRATRS 304
>gi|114772601|ref|ZP_01449965.1| DNA polymerase IV [alpha proteobacterium HTCC2255] (361 aa)
Score = 307, Expect = 3.9e-26, Identities = 65/196 (33%), Positives = 109/196 (55%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDI 199
           KI H+DMD F+A+VE+ + P    +P+A+G       VI++ NY AR  GV+SAM+   A ++CP L ++    ++Y ++SD I    +  +  IE  S DE YLDV+++ Y N      A  ++  I+ +  L  + G +   F+AK+A++  KP+G   +T      ++  + + KI G+G     +L  L L   KD+
  S:     8 KIIHVDMDCFYAAVEMRDNPALRDIPIAIGGSSDRRGVISTCNYPARRFGVRSAMSTAHALRLCPDLVLLPGRMSEYKAVSDHIREIFNRYTTLIEPLSWDEAYLDVTDSPYFNGSATRIAQDIRRVIEAETGLTASAGVAPIKFVAKVASDENKPNGLCVITPQKLDEFVSTMSLHKIPGVGKVTVEKLNHLGLFTCKDV 208
>gi|13488542|ref|NP_109549.1| DNA polymerase IV [Mesorhizobium loti MAFF303099] >gi|22095629|sp|Q98NW7|DPO43_RHILO DNA polymerase IV 3 (Pol IV 3) >gi|14028296|dbj|BAB54888.1| DNA-damage-inducible protein P [Mesorhizobium loti MAFF303099] (361 aa)
Score = 307, Expect = 4.3e-26, Identities = 86/292 (29%), Positives = 150/292 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASA----NYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI H+DMD+F+ASVE  + PE    PLAVG           +Y AR  GV+SAM  V AK+ CP+L  + P  + Y ++S +I    +  +  IE  S+DE YLDV+  +         A +++  I +   L  + G S+  FLAKMA++  KP+G   +T  +  +++  L ++K  G+GP+   ++  L +    D+      +L +   K GL + ++      I    ++PD  RK++G   +   +  + +  L  +K L   +    + +    ++V +KI+++D    T+S
  S:    11 KIIHVDMDAFYASVEQRDNPELRGKPLAVGGAAARGVVAAASYEARAFGVRSAMPSVTAKRKCPELIFVPPRFDVYRAVSAQIRDVFAEHTDLIEPLSLDEAYLDVTQNRLNISSATTIAEMIRAKILEVTGLTASAGISYNKFLAKMASDQNKPNGQFVITPRHGPAFVETLPVNKFHGVGPATAAKMEALGIETGADLKERSLSFLQQHFGKSGLWYYQI---ARAIDERAVDPDRPRKSIGAEDTFAADIVDLETSLAELKPLVAKVWGYCEGKGIRGRTVTLKIKFADFQQITRS 306
>gi|167366334|ref|ZP_02300477.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris TIE-1] >gi|192292178|ref|YP_001992783.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris TIE-1] >gi|192285927|gb|ACF02308.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris TIE-1] (412 aa)
Score = 306, Expect = 4.4e-26, Identities = 74/196 (37%), Positives = 112/196 (57%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEI----EFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDI 199
           KI H+DMD+F+ASVE  + P     P+AVG      V+A+A+Y AR  GV+SAM  V AK+ CP L  + P    Y ++S +I    +  +  IE  S+DE YLDV+    EN + I    + A  ++  IK+   LN + G S+  FLAK+A++  KP+G   ++ +   S++  L + K  GIGP+   +   L +    DI
  S:    22 KIIHVDMDAFYASVEQRDDPALRGKPVAVGGSRERGVVAAASYEARKFGVRSAMPSVTAKRQCPDLIFVKPRFEVYKAISQQIREIFAEHTAIIEPLSLDEAYLDVT----ENLQNIPLARDIALAIRAKIKEVTGLNASAGISYNKFLAKLASDHRKPNGQYVISPEMGPSFVEGLPVGKFHGIGPATAAKFNALGIRTGSDI 221
>gi|83319646|ref|YP_424398.1| ImpB/MucB/SamB family protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283532|gb|ABC01464.1| ImpB/MucB/SamB family protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (408 aa)
Score = 306, Expect = 4.5e-26, Identities = 122/373 (32%), Positives = 199/373 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFL-SSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKND--YLIRKKIGLHWSKLRMNVLGIICDPIN---PDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYS-DGDSATKSFNFVNFQNQIPLHVVVDLFEQISD------FSKYDQ----------VINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKII 377
           I HIDMD+FFAS    + PE +  P+ + +     +I++A+Y AR   +K+AM +  AKK+ P++  I  + N  +++S +I+ F+ ++ +  IE  SIDE YLDVS+    N   ++ A  ++  I   FNL C++G  F  F AKM+T+L KP+G    T  NFK  I+ + I+K+ G+G S  + L    +  IKD+A + +   Y +  K GL    L+   LG+  D IN    +YK  +   + +   Y +Y E   +I  L+  I + L     + K++ IKIRY  D     K  +  +   QI L    +  E+I +      ++ Y+Q          V  L     N ++ D N Q+ I     ++I    K+E +   +NK   K +I
  S:     6 IIHIDMDAFFASCMQLKHPELKNKPIVISNSFDKSIISAASYEARKYNIKAAMPLFKAKKLYPKIISIRADMNFISNISSQIWEFIKTNYTNKIEIASIDEAYLDVSDLIL-NIDVLQLAKNIQKDIYNHFNLTCSLGIGFNRFSAKMSTSLNKPNGITLTTITNFKHNIWPIPINKMYGVGESSIKILNHTKIKTIKDLALLSDAQIYELLNKKGL---VLKNEALGLGSDYINYLSSEYKSISKETTLNTPIY-QYDEIETIILNLSKFITNKLVKNQLLCKTIEIKIRYKIDEKIFDKQKHLTSKHKQITLKNHTNDLEKIYNSAIDCFYNLYEQNKGILLIGVGVSKLIHKNQNWVQLDINNQINI---DKKQIDNALKIENMIFNINKKFKKPVI 397
>gi|83945511|ref|ZP_00957858.1| DNA polymerase IV [Oceanicaulis alexandrii HTCC2633] >gi|83851087|gb|EAP88945.1| DNA polymerase IV [Oceanicaulis alexandrii HTCC2633] (394 aa)
Score = 306, Expect = 4.9e-26, Identities = 86/281 (30%), Positives = 146/281 (51%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASL-VKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICD--PINPDYKRKNLGRSQSIRNYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIR 285
           I HID D+FFASVE  + PE E  P+ +G     V+++A YVAR  GVKSAM +  A K CP   ++ P    Y +   +I + +  ++  +E  SIDE +LD+S T+  +        L ++  I  +  +  +VG SF  FLAK A++L KP+GF  + + +  +++  + +  + G+GP L ++L    L+ + D+       L RK      S LR+  L    D   ++P+ +RK++    +  +    +  LK  +  L   +   +K Q    + V +KI+
  S:    12 IAHIDCDAFFASVEKRDNPELEDQPVIIGGGKRGVVSTACYVARLYGVKSAMPMFKALKACPDAVVVRPRMAVYAAEGKRIRAMMEDVTPLVEPLSIDEAFLDLSGTEKLHGAPPALTLLRLQRRILNEVGVTVSVGLSFNKFLAKTASDLDKPNGFSVIGRADAPAFLAQMKVGDVYGVGPVLGKKLNADGLYTLSDVLRRSEGDLARKYGD---SGLRLARLARAQDDRKVSPERERKSVSAETTFNDDVSDKSVLKDRLWPLCVKVADRMKAQGVAGRVVTLKIK 296
>gi|86132392|ref|ZP_01050986.1| DNA polymerase IV [Cellulophaga sp. MED134] >gi|85816953|gb|EAQ38137.1| DNA polymerase IV [Dokdonia donghaensis MED134] (370 aa)
Score = 306, Expect = 5.5e-26, Identities = 93/313 (29%), Positives = 161/313 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHLVI----ASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDG--DSATKSFNFVNFQNQIPLHVVVDLFEQ 316
           KI H+DMD+F+ASVE  + P+     +AVG        ++A+Y AR  GV+SAM    A+K+CP L  +  N  +Y  +S +I S     +  +E  S+DE YLDV+  +         AS ++  IK+K  LN + G S   F+AK+A+++ KP+G  T+  +   +++ +L I K  GIG     ++    +    D+     +YL     K G ++  +   V GI    + P+  RK+L   ++ R N +     L+ ++ + +++   L+      K++ +KI+YSD    + +K+ +      +I L    DL  Q
  S:     8 KIIHVDMDAFYASVEQLDNPDLRGKAIAVGGGGERGVVSAASYEARKYGVRSAMAGALARKLCPDLIFVKTNFERYREVSAQIRSVFHEFTDLVEPLSLDEAYLDVTENKVGMPSATVIASWIRQCIKEKTGLNASAGISINKFIAKVASDINKPNGQKTIPPEEVITFLEELDIKKFYGIGKKTAEKMYLHGIFTGMDLKLKSKEYLSDNFGKSGAYYYDI---VRGIQHSEVKPNRIRKSLAAERTFRENITSEIFMLEKLEHIAEEVERRLEKSKVAGKTITLKIKYSDFTLQTRSKTLDLYVRSKEIILETAKDLLYQ 326
>gi|90416204|ref|ZP_01224136.1| DNA polymerase IV [marine gamma proteobacterium HTCC2207] >gi|90331929|gb|EAS47143.1| DNA polymerase IV [marine gamma proteobacterium HTCC2207] (359 aa)
Score = 305, Expect = 6.1e-26, Identities = 77/247 (31%), Positives = 125/247 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYS 250
           KI H D D F+A+VE+ + P   + P+A+G       V+A+ NY AR  GV+SAM    A K+CP L ++     KY   S KI       +  +E  S+DE +LDV+     +      A  ++ +I ++  +  + G +   FLAK+A++L KPDG   +T  N  +++  L + +I G+G     +L  L +    D+   +   L+  K G+   +L     GI   P+N + +RK+L      R YS
  S:     9 KIIHCDCDCFYAAVEMRDDPSLRQYPIAIGGKSDRRGVVATCNYKAREYGVRSAMPTGQALKLCPDLVVVPGTMAKYREASMKIRQIFYRYTDKVEPLSLDEAFLDVTECTQCSGSATLIAEEIRRTIAEEVGVTASAGVASNKFLAKVASDLNKPDGQYVITPQNIAAFVKQLEVKRINGVGKVTNEKLSRLGVKTCGDLQAFELLDLV-DKFGVFGKRLHDLCRGIDNRPVNANSRRKSLSVE---RTYS 256
>gi|83309722|ref|YP_419986.1| DNA polymerase IV [Magnetospirillum magneticum AMB-1] >gi|82944563|dbj|BAE49427.1| Nucleotidyltransferase/DNA polymerase [Magnetospirillum magneticum AMB-1] (393 aa)
Score = 305, Expect = 6.7e-26, Identities = 78/284 (27%), Positives = 148/284 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVS-NTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           I HID D+F+ASVE  + P     P+ VGH     V+ +A YVAR  G +SAM +  A ++CP   +I PN  KY  +S +I +     +  +E  S+DE YLD+S   +  +       + +  +I+ +  +  +VG S+  FLAKMA++L KP+GF  + ++  ++++    ++ + GIG +   ++ +  +  I  +  +     +  + G    +L   V GI   P+NPD   K++    +  R+  + +   + +  L + +   L+  +   ++V +K++ +D
  S:    45 IAHIDCDAFYASVEKRDNPALADKPVIVGHPGGRGVVTTACYVARKFGPRSAMPMFKALELCPHAVVIPPNIAKYKQVSAQIRALFEKATPLVEPLSLDEAYLDLSPGVRLVDRPAAVLLARLARAIRLQVGITVSVGLSYNKFLAKMASDLNKPEGFSVIGREEAEAFLAPRPVTALFGIGAATAARMADQGITTIAQLQALPETEFV-ARWGKFGRRLAGMVHGIDHRPVNPDRPAKSVSTETTFARDIRDAKALTEALPPLAEGVARRLERVNLAGRTVVLKLKTAD 333
>gi|167729940|emb|CAO80852.1| Nucleotidyltransferase/DNA polymerase involved in DNA repair [Candidatus Cloacamonas acidaminovorans] (353 aa)
Score = 305, Expect = 6.8e-26, Identities = 87/301 (28%), Positives = 159/301 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLI-KELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQ 304
           KI HIDMD+FFA++E+ E P  +   + VG       V+++ +Y AR  GV S M+   A  +CP+   I+P+ N Y  +S +I       +  +E  S+DE YLDV+  +      ++ A L+K  I +K  L C+ G S+  FLAK+ ++L KPDG   +  +     ++ L I K  GIG   + +L +  ++   D+   +   LIR   K G  +  +   V GI    +  +++ K+L    +     +  ++L +I ++L + +++ L+ +     ++ +KI+Y + +  T+S N  ++ N+
  S:     3 KIIHIDMDAFFAAIEIRENPRLKGKCVIVGGPPNSRGVVSTCSYEARKFGVHSGMSSYQAWNLCPEAIFIHPHFNLYKKVSHQIREIFYQWTDLVEPLSLDEAYLDVTENKLGEDDAVKIAKLIKAEILEKTGLTCSAGVSYNKFLAKIGSDLNKPDGLTYIPPEKASEILFALPIEKFYGIGKVTSAKLKKKGINNGADLYKYELKDLIRLLGKAGHFYYYV---VRGIDKREVITEFEPKSLSCETTFYEDIDNLDYLLIILQQLAERLSNRLRQKGIRGNNITLKIKYDNFELITRSSNTPSYINK 308
>gi|156452483|ref|ZP_02058854.1| DNA-directed DNA polymerase [Methylobacterium chloromethanicum CM4] >gi|156188743|gb|EDO20941.1| DNA-directed DNA polymerase [Methylobacterium chloromethanicum CM4] (425 aa)
Score = 305, Expect = 6.9e-26, Identities = 81/281 (28%), Positives = 154/281 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKE-----IEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICD--PINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           I H+D D+F+A++E  + P     PL +G     V+++A Y+AR  GV+SAM + +A K CP  T++ P+  KY  +  ++ + + +L+  +E  SIDE +LD+S T+  +        + FA+ V+  +     ++ +VG S   FLAK+A++L KP GF  +  ++  +++ D  +  + GIG S   +L  LN+H + DI         R +  L    LR+  L    D  P+ P  + K++    +   + + +++   ++ +L + +++ LK  +    SV +K++
  S:    38 IAHVDCDAFYAAIEKRDDPSLRDKPLIIGGGKRGVVSTACYLARISGVRSAMPMFEALKRCPDATVLRPDMEKYARVGREVRAMMLALTPLVEPVSIDEAFLDLSGTERLHGTSPALTLVRFAARVEAEV----GISVSVGLSDNKFLAKIASDLDKPRGFSIIAGEDAATFLADKPVGILPGIGESARNRLASLNIHRVGDIPRADP---TRLQASLGRDALRLIDLAAGRDRRPVRPTREAKSVSSETTFSTDLTRFEDLRPILWQLCEKVSARLKRAELAAGSVTLKLK 322
>gi|188584444|ref|YP_001927889.1| DNA-directed DNA polymerase [Methylobacterium populi BJ001] >gi|179347942|gb|ACB83354.1| DNA-directed DNA polymerase [Methylobacterium populi BJ001] (415 aa)
Score = 304, Expect = 7.7e-26, Identities = 82/281 (29%), Positives = 150/281 (53%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKE-----IEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICD--PINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           I H+D D+F+A++E  + P     PL +G     V+++A Y+AR  GV+SAM + +A K CP  T++ P+  KY  +  ++   + +L+  +E  SIDE +LD+S T+  +          FA+ V+  +     +  +VG S   FLAK+A++L KP GF  +  D   +++ D  +  + GIG S   +L  LN+H + D++       +R +  L    LR+  L    D  P+ P  + K++    +   +   +++   ++  L + ++S LK  +    SV +K++
  S:    28 IAHVDCDAFYAAIEKRDDPSLRDKPLIIGGGKRGVVSTACYLARISGVRSAMPMFEALKRCPDATVLRPDMEKYARVGREVREMMLALTPLVEPVSIDEAFLDLSGTERVHGASPALTLARFAARVETEV----GITVSVGLSANKFLAKIASDLDKPRGFSIIAGDEAAAFLADRPVGILPGIGESARNRLAALNIHRVGDLSRADP---VRLQASLGRDALRLIDLAAGRDRRPVRPSREAKSVSAETTFATDLVRFEDLRPILWRLCEKVSSRLKRAELAAGSVTLKLK 312
>gi|170727937|ref|YP_001761963.1| DNA-directed DNA polymerase [Shewanella woodyi ATCC 51908] >gi|169813284|gb|ACA87868.1| DNA-directed DNA polymerase [Shewanella woodyi ATCC 51908] (364 aa)
Score = 304, Expect = 8.3e-26, Identities = 83/241 (34%), Positives = 128/241 (53%)
  Q:     1 MKN---KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLG 241
           MKN   KI HIDMD +FA+VE+ + PE    P+AVG       VI++ NY AR  GV+SAM    A K+CP L ++    + Y  +S +I    +  +  IE  S+DE YLDV+  +         A  ++  I +   L  + G +   FLAK+A++L KP+G   +T D   S+I  L ++KI G+G    ++L ++ L    ++       LI ++ G     L     GI    I+P  +RK++G
  S:     1 MKNILRKIIHIDMDCYFAAVEMRDFPELRGKPIAVGGRSDRRGVISTCNYEARAFGVRSAMASGYALKLCPDLILVPGRMSVYKEVSAQIRDIFARYTDLIEPLSLDEAYLDVTECKQCQGSATLIAQAIRQEIFEVTGLTASAGIAPVKFLAKVASDLNKPNGQYVITPDMISSFITTLPLTKIPGVGKVTGKKLEDIGLTTCGELQAYPKSELI-ERFGKFGKILIERAQGIDERAISPHRERKSVG 248
>gi|170748058|ref|YP_001754318.1| DNA-directed DNA polymerase [Methylobacterium radiotolerans JCM 2831] >gi|170654580|gb|ACB23635.1| DNA-directed DNA polymerase [Methylobacterium radiotolerans JCM 2831] (360 aa)
Score = 304, Expect = 8.5e-26, Identities = 83/292 (28%), Positives = 144/292 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL-IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI HIDMD+F+ASVE  + P     PLAVG      V+A+A+Y AR  GV+SAM    A+++CP L  + P    Y ++S++I +  +  +  IE  ++DE YLDV+            A  ++  I ++  L  + G S+  FLAK+A++  KP+    +T      ++  L I +  G+GP    ++  L +    D+     + L R+  G   +       GI   P+     RK++G   +  + +   E L   +  L D + +    +    ++V +K+++SD    T++
  S:     9 KIIHIDMDAFYASVEQRDDPSLRGKPLAVGGSRERGVVAAASYEARRFGVRSAMPSATARRLCPDLLFVKPRFEVYRAISEEIRAVFARHTAVIEPVALDEAYLDVTENLLGLPTATAVAKAIRAEILERTGLVASAGVSYNKFLAKVASDHRKPNALFVITPAMGPDFVAALPIGRFHGVGPVTEAKMKRLGIETGADLRAWTPERL-RETFGSAGAYYHAVARGIDGRPVRAHRVRKSIGAETTFSDDTAAFEVLAARLAPLFDKVWAAADAKGMRARTVTLKLKFSDFAQVTRA 304
>gi|149371089|ref|ZP_01890684.1| putative DNA polymerase [unidentified eubacterium SCB49] >gi|149355875|gb|EDM44433.1| putative DNA polymerase [unidentified eubacterium SCB49] (369 aa)
Score = 304, Expect = 8.7e-26, Identities = 105/361 (29%), Positives = 180/361 (49%)
  Q:     2 KNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFN---FVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLE 362
           + KI H+DMD+F+ASV   + P      +AVG      VI++A+Y AR  GV+SAM    A K+CP L  +  +  +Y  +SD++       +  +E  S+DE YLDV+  +  N      A  ++  IK++  LN + G S   F+AK+A+++ KP+G  T+  +    ++  L I K  G+G  +  ++    ++   D+     ++L     K G ++  +   V GI    + P   RK+L   ++   N +     L+ +  +++++   LK      K+V +KI+YSD    T+S     +++ +N I   V   LF++       + V  L I+    M N NNE+       T K+S E K E
  S:     8 QRKIIHVDMDAFYASVAQLDDPSLVGKAIAVGGSGRRGVISAASYEARKFGVRSAMAGSLAIKLCPHLIFVKTDFERYKEISDRVRKIFFEYTDLVEPLSLDEAYLDVTENKKGNPSASLIALEIRQKIKERTGLNASAGISINKFIAKVASDINKPNGQKTVPPEEVIPFLEVLDIKKFYGVGKVMKEKMYRHGIYTGLDLKGKSIEFLSENFGKSGAYYYNI---VRGIHNSEVKPSRTRKSLAAERTFSENIASEIFMLEKLAPISEEVERRLKKSKVAGKTVTLKIKYSDFTLQTRSKTLPLYISDKNLIMETVTELLFQE----GMKNSVRLLGIS----MSNLNNEK-----KQTLKVSEEKKYE 362
>gi|153833959|ref|ZP_01986626.1| DNA polymerase IV [Vibrio harveyi HY01] >gi|148869697|gb|EDL68678.1| DNA polymerase IV [Vibrio harveyi HY01] (357 aa)
Score = 304, Expect = 8.8e-26, Identities = 78/258 (30%), Positives = 135/258 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI H+DMD F+A+VE+ + P Y  + LAVG       VI++ NY AR  GV+SAM    A ++CP L ++    + Y  +S +I +     ++ IE  S+DE YLDV+++          A  ++  I  +  L  + G +   FLAK+A+++ KP+G   +  D  +  +  L + KI G+G     +L +   +  +DI N     L+R + G   + L     GI    +  + +RK++G  ++   N + Y E  ++I++
  S:    10 KIIHVDMDCFYAAVEMRDHPSYRGVALAVGGHEKQRGVISTCNYEARKFGVRSAMPTARALQLCPNLLVVPGRMHVYKQVSQQIRAIFERYTQLIEPLSLDEAYLDVTDSTACRGSATLIAESIRRDIHTELGLTASAGIAPIKFLAKVASDMNKPNGQFVIPPDKVQEVVDKLPLEKIPGVGKVSLEKLHQAGFYLCEDIKNSDYRELLR-QFGRQGASLWKRSHGIDDREVVVERERKSVGVERTFSENIATYDECWQVIED 272
>gi|163854117|ref|YP_001642160.1| DNA polymerase IV [Methylobacterium extorquens PA1] >gi|163665722|gb|ABY33089.1| DNA-directed DNA polymerase [Methylobacterium extorquens PA1] (425 aa)
Score = 304, Expect = 9.0e-26, Identities = 80/281 (28%), Positives = 152/281 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ--YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICD--PINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           I H+D D+F+A++E  + P     PL +G     V+++A Y+AR  GV+SAM + +A K CP  T++ P+  KY  +  ++ + + +L+  +E  SIDE +LD+S T+  +     +  A      ++ +  +  +VG S   FLAK+A++L KP GF  +  ++  +++ D  +  + GIG S   +L  LN+H + DI  V      R +  L    LR+  L    D  P+ P  + K++    +   + + +++   ++ +L + +++ LK  +    SV +K++
  S:    38 IAHVDCDAFYAAIEKRDDPSLRDKPLIIGGGKRGVVSTACYLARISGVRSAMPMFEALKRCPDATVLRPDMEKYARVGREVRAMMLALTPLVEPVSIDEAFLDLSGTERLHGTSPALTLARFAAR-VEAEVGITVSVGLSDNKFLAKIASDLDKPRGFSIIAGEDAATFLADKPVGILPGIGESARNRLAALNIHRVGDIPRVDP---TRLQASLGRDALRLIDLAAGRDRRPVRPTREAKSVSSETTFSADLTRFEDLRPILWQLCEKVSARLKRAELAAGSVTLKLK 322
>gi|93117311|gb|ABE99573.1| DinB [Neisseria meningitidis] >gi|93117319|gb|ABE99577.1| DinB [Neisseria meningitidis] (336 aa)
Score = 303, Expect = 9.6e-26, Identities = 83/295 (28%), Positives = 149/295 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HIDMD+F+ASVEL E+P  +  P+ V       VI +A+Y AR  G+ SAM++  AK++CPQ   + P+ + Y  +S +I++     +  IE  S+DE YLDV+     N+K I +AS V   I+        L  + G +   FLAK+A++  KP+G   L      +++  L + KI G+G    +++  L +    D+   +   L+    G +  +L     G    P+  + +R  +    ++      ++    +  L +D+   +  ++   +SV +K++  D    T++  +
  S:     5 KIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICAASYEARQFGLHSAMSVATAKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLSLDEAYLDVT----RNFKNIPYASEVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPNGQFVLPPHKVMAFLETLPLGKIPGVGKVTLKKMQSLGMQTAGDLRRFERGELL-NHFGRYGYRLYDLARGTDERPVKAERERLQISTEITLPEDLPLEQAAGHLPHLAEDLWRQITRKNVEAQSVTLKLKTYDFRIITRTLTY 302
>gi|169182549|ref|ZP_02843065.1| DNA-directed DNA polymerase [Thauera sp. MZ1T] >gi|169010420|gb|EDS57186.1| DNA-directed DNA polymerase [Thauera sp. MZ1T] (369 aa)
Score = 303, Expect = 1.0e-25, Identities = 76/237 (32%), Positives = 118/237 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           KI H D D F+ASVE+ + P     P+AVG       VIA+ NY AR  GV SAM    A ++CPQL ++ P+  +Y   S +I +     +  +E  S+DE YLDV+  +         A  ++  I+ +  +  + G +   F+AK+A++  KPDG   +   +  +++  L + KI G+G     +L  L  H   D+       L R + G   + L     GI   P+ PD  RK+L
  S:     3 KIIHCDCDCFYASVEMRDDPTLRGRPVAVGGRAETRGVIATCNYEARAFGVHSAMPTARALQLCPQLVLLAPDFERYREASRRILAIYHDYTALVEPLSLDEAYLDVTGVERCRGSASLMAQEIRARIRAEVGITASAGIAPNKFIAKVASDWNKPDGQFVVRPQDVDAFVAALPVKKIFGVGKVTAARLARLGAHTCADLRAWSVAELTR-EFGSFGASLHRLCRGIDERPVQPDRVRKSL 243
>gi|121533358|ref|ZP_01665186.1| DNA-directed DNA polymerase [Thermosinus carboxydivorans Nor1] >gi|121307917|gb|EAX48831.1| DNA-directed DNA polymerase [Thermosinus carboxydivorans Nor1] (382 aa)
Score = 303, Expect = 1.0e-25, Identities = 81/295 (27%), Positives = 158/295 (53%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHLVI----ASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           M+  I H+DMD+F+A+VE  + PE+   P+ +G +      A+A+Y AR  GV+SAM++ +A++ CP    + P+ +KY  +S +I + L   S  +E  ++DE +LDV+  +      +  A  +K +I+++  L  + G +   FLAK+A++L KPDG   +  +   +++  L +S++ GIG +    L  + +  I  +A V+   L+ K  G     L+    G+   P+ P  + K++G   +   +    +E    +  L + I   L+   +  +++ +K+R++   + T+S
  S:     1 MQRWIIHVDMDAFYAAVEQRDNPEFRGRPVIIGGVGGRGVVATASYEARQFGVRSAMSMAEARRRCPHGVFLAPDHDKYARISAQIRAILDRFSPLVEPLALDEAFLDVTGMELLYPDPVAIARAIKAAIREEVKLTASAGVAPNKFLAKLASDLNKPDGLTVIRPEEAAAFLAPLPVSRLWGIGEATAAALARVGITTIGQLAAVETS-LLEKYCGKAARDLQRLACGLDDRPVIPYQEPKSIGNEVTFAEDLFRREEMETELLALAEKIGWRLRTGGYAGRTITLKVRFASFRTLTRS 299
>gi|187478526|ref|YP_786550.1| DNA polymerase IV [Bordetella avium 197N] >gi|115423112|emb|CAJ49643.1| DNA polymerase IV [Bordetella avium 197N] (360 aa)
Score = 303, Expect = 1.1e-25, Identities = 74/231 (32%), Positives = 118/231 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPD 234
           KI HIDMD+F+ASVE  +RPE    P+ V       V+ +A+Y AR  GV SAM +  A+++CP    + P+ N+Y ++S ++    S  +  IE  S+DE YLDV+  +         A  ++  I+++  L  + G +   FLAK+A++  KPDG   L       ++  L + K+ G+G     +L  L +H + D+A      L     G H  +L     G+    + PD
  S:     7 KIVHIDMDAFYASVEQRDRPELRGQPVVVAWTGARSVVCAASYEARRFGVHSAMAVSRAQRLCPDAVYVPPDFNRYRAVSRQVREIFSRHTDLIEPLSLDEAYLDVTVNKLGLPSATAVAEAIRAQIQRETGLTASAGVAPNKFLAKIASDWNKPDGLFVLRPAKVLEFLQPLPVRKVPGVGRVTQARLESLGIHTVGDLATCAPAEL-EHHFGRHGLRLHELARGLDEREVQPD 240
>gi|188586939|ref|YP_001918484.1| DNA-directed DNA polymerase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351626|gb|ACB85896.1| DNA-directed DNA polymerase [Natranaerobius thermophilus JW/NM-WN-LF] (408 aa)
Score = 303, Expect = 1.1e-25, Identities = 89/359 (24%), Positives = 178/359 (49%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKD----IANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLE 362
           +I HIDMD+F+ASVE  + PE E  P+ +G     V+++  Y AR  G+ SAM +  A+++CP    + P+ +KY  +S +I       +  +E  S+DE +LDV+ +       +  A  ++  I  +  L C++G +   F+AK+A++L KP G   +     + ++  L + K+ G+G   T ++     H I +    +A  +N   + K   +    L +   G     + P+   K++G+    +Q +   S+Y + +  + + ++ + + L+   +  K+V +KIR S   + TK            ++       Q  +    D++  L +T +N++ +   +QL++ D   ++   E +L+
  S:    15 QILHIDMDAFYASVEKRDNPELEDKPVIIGGSRRGVVSTCCYKARKYGLHSAMPMYRAQRLCPHGVYLRPDMDKYRRVSQEIKKIFLEFTPLVEPLSLDEAFLDVTGSLNLFGDAVNIAEKIQTQISDQLQLTCSIGVATNKFIAKVASDLKKPAGLTHVPTGKEQDFLAPLPVDKLWGVGEKTTARIKSRGYHTIGELQQMLAKAQNINSLAKSFNITEDTLLL-AKGYDDREVVPEEPPKSIGQEKTFAQDLTAGSQYNQLIPHLLKFSEQVGARLRKAGYKGKTVTVKIRDSRFKTWTKQKTVPETDQDKEIYAHAQELLQNMNLKPSDEIRLLGVTVSNLVSS-TQQQLSL-DMSNEQYEKEQQLQ 381
>gi|194539414|ref|YP_002074465.1| ImpB/MucB/SamB family [Vibrio sp. Ex25] >gi|151937969|gb|EDN56813.1| ImpB/MucB/SamB family [Vibrio sp. Ex25] (356 aa)
Score = 303, Expect = 1.2e-25, Identities = 88/277 (31%), Positives = 146/277 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGR----SQSIRNYSE---------YQEFLKLIKELTDD---INSGL--KYQDFMFKSV 280
           KI H+DMD F+A+VE+ + P Y  + LAVG       VI++ NY AR  GV+SAM+   A ++CP L ++    + Y  +S +I +     +  IE  S+DE YLDV+++          A  ++  I  +  L  + G +   FLAK+A+++ KP+G   +  D  +  I  L +  I G+G     +L +   +  +DI N     L+R + G   + L     GI    +  + +RK++G     SQ+I +Y E         Y E  K ++  + D   I  G+  K+ DF   ++
  S:     9 KIIHVDMDCFYAAVEMRDNPSYRGIALAVGGHEKQRGVISTCNYEARKYGVRSAMSTARALQLCPHLLVVPGRMHVYKQVSQQIRAIFERYTPIIEPLSLDEAYLDVTDSTACRGSATLIAESIRRDIWNELGLTASAGIAPIKFLAKVASDMNKPNGQFVIPPDKVQEVIDTLPLENIPGVGKVSLEKLHQAGFYRCEDIKNSDYRELLR-QFGRQGASLWQRSHGIDNREVVVERERKSVGVERTFSQNISSYDECWQVIEDKLYPELEKRLERASPDKSIIKQGIKVKFADFQLTTI 307
>gi|86134767|ref|ZP_01053349.1| DNA polymerase IV [Tenacibaculum sp. MED152] >gi|85821630|gb|EAQ42777.1| DNA polymerase IV [Polaribacter dokdonensis MED152] (360 aa)
Score = 302, Expect = 1.3e-25, Identities = 89/292 (30%), Positives = 153/292 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVGHLVI----ASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR--KKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           KI H+DMD+++ASV   + PE     +AVG        ++A+Y AR  GVKSAM+ V AK+ CP +  +  +  +Y  +S +I       +  +E  S+DE YLDV+N +  N    E A  ++  I  K  L  + G S   F+AK+A+++ KP+G  T+  +    ++ +L ++K  G+G     ++  L +    D+     + L +   K GLH+  +   V GI    + P+  RK++G  ++ R N S     L  + ++ D+I   +   +   K++ +KI+YSD    T+S
  S:     9 KIIHVDMDAYYASVAELDNPELRGKAIAVGGGGDRGVVSAASYEARKFGVKSAMSNVLAKQKCPHIIFVKSDFARYKELSAQIREIFFEYTDLVEPLSLDEAYLDVTNNKKNNPSANEIAREIRQKIYDKTGLRASAGISINKFIAKVASDINKPNGQKTIHPEEVIQFLEELPVNKFYGVGKVTAAKMYNLGIFVGNDLKKRSLEELTQLFGKSGLHYYNI---VRGIHKSEVKPNRIRKSVGAERTFRENISSEIYMLDKLNDIADEIEKRMHKSNTKGKTITLKIKYSDFTQQTRS 304
>gi|88804092|ref|ZP_01119612.1| DNA polymerase IV [Robiginitalea biformata HTCC2501] >gi|88784971|gb|EAR16140.1| DNA polymerase IV [Robiginitalea biformata HTCC2501] (404 aa)
Score = 302, Expect = 1.4e-25, Identities = 93/367 (25%), Positives = 186/367 (50%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF-VNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQ 367
           M+  I H+D+D+FF SVE       +  P+ VG L    V+A+ +Y  RG GV S M +  A+++CP+  II  N   Y+  SD++   +       E  SIDE+Y D+S      +    +AS ++  I ++  L  + G S    ++K+AT  AKP+  L +     K ++  L I KI  +G    + L  L L  ++ +  +  D ++++ +G + + +     GI   P+ P  +RK++   ++  R+  +      ++  +T+++   L+    +   V +K+RYSD ++ ++         + I +  V+DLFE++ D     ++I +  +  +++    N Q+ +FD   + ++  + +++IR++
  S:     1 MQKTILHLDLDTFFVSVERKLDSRLKNKPILVGGLSDRGVVAACSYETRGYGVHSGMPMRMARELCPEAVIIRGNAGTYSKHSDEVTDIIREQVPLFEKSSIDEFYADLSGMD-RFFGCYRYASELRERIIRESGLPISFGLSVNKVVSKVATGEAKPNNQLKIDFGYEKPFLAPLSIKKIPMVGDKTYQTLRNLGLRQVRTLQEMPLD-VVQRVLGANGTVIWKRANGIDNRPVIPFCERKSISTERTFDRDTIDVVRLRGILTAMTENLAFQLRRGGKLTACVTVKLRYSDFNTYSRQLRIPYTSADHILIPRVMDLFERLYDRRLLVRLIGVRFS--HLVP--GNYQIDLFDDTQEALNLYAAMDRIRER 367
>gi|115402397|ref|XP_001217275.1| hypothetical protein ATEG_08689 [Aspergillus terreus NIH2624] >gi|114189121|gb|EAU30821.1| hypothetical protein ATEG_08689 [Aspergillus terreus NIH2624] (540 aa)
Score = 302, Expect = 1.4e-25, Identities = 83/292 (28%), Positives = 154/292 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYE-NWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTL--TKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLH-WSKLRMNVLGIICDPINP--DYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           + H+D D+FFA+VE  +RPE + +P+AVG  V+ + NY AR  GV+S M    AKK+CPQL ++  N +KYT+ + +I +  +      E+ SIDE YL+++    E N    E  S ++  + +K  ++ + G +    +AK+A+N  KP+G   +   +D    ++ +L + K+ G+G    R+L  + +    DI   +   L+ K  G   +  L    LG+    I P  +Y+RK++G   +       +EF   +  +  ++   L    F  +++ +K++ +  +  T+ +
  S:    52 VIHVDCDAFFAAVEELDRPELKTVPMAVGKGVLTTCNYEARKFGVRSGMASFVAKKLCPQLILLPQNYDKYTAKAQEIRAIFTQYDPLFESASIDEAYLNITAYCLENNLGPEEVVSRMRAEVLEKTQISVSAGIAANAKIAKIASNRNKPNGQFCVPNDRDAIMEFMRELPVRKVNGVGRVFERELDAIGVKTCGDIYPARA--LLAKLFGEKAFQFLAQCYLGLGRTKIQPVENYERKSVGTETTFSEIGTKEEFRAKLLWVAQELEKDLARTQFKGRTLVLKVKLATFEVLTRQY 347
>gi|19568891|gb|AAL91957.1|AF483094_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 302, Expect = 1.5e-25, Identities = 84/287 (29%), Positives = 149/287 (51%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  + +L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELHLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|93117305|gb|ABE99570.1| DinB [Neisseria meningitidis] (335 aa)
Score = 302, Expect = 1.6e-25, Identities = 83/295 (28%), Positives = 149/295 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HIDMD+F+ASVEL E+P  +  P+ V       VI +A+Y AR  G+ SAM++  AK++CPQ   + P+ + Y  +S +I++     +  IE  S+DE YLDV+     N+K I +A  V   I+        L  + G +   FLAK+A++  KP+G   L      +++  L + KI G+G    +++  L +    D+   +   L+    G +  +L   V G    P+  + +R  +    ++      ++    +  L +D+   +  ++   +SV +K++  D    T++  +
  S:     5 KIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICAASYEARQFGLHSAMSVATAKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLSLDEAYLDVT----RNFKNIPYAGDVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPNGQFVLPPHKVMAFLETLPLGKIPGVGKVTLKKMQSLGMRTAGDLRRFERGELL-NHFGRYGYRLYDLVRGTDERPVKAERERLQISTEITLPEDLPLEQAAGHLPHLAEDLWRQITRKNVEAQSVTLKLKTYDFRIITRTLTY 302
>gi|15677305|ref|NP_274460.1| DNA-damage-inducible protein P [Neisseria meningitidis MC58] >gi|22095639|sp|Q9JYS8|DPO4_NEIMB DNA polymerase IV (Pol IV) >gi|7226689|gb|AAF41808.1| DNA-damage-inducible protein P [Neisseria meningitidis MC58] (318 aa)
Score = 302, Expect = 1.6e-25, Identities = 83/295 (28%), Positives = 149/295 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKF----NLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF 298
           KI HIDMD+F+ASVEL E+P  +  P+ V       VI +A+Y AR  G+ SAM++  AK++CPQ   + P+ + Y  +S +I++     +  IE  S+DE YLDV+     N+K I +A  V   I+        L  + G +   FLAK+A++  KP+G   L      +++  L + KI G+G    +++  L +    D+   +   L+    G +  +L   V G    P+  + +R  +    ++      ++    +  L +D+   +  ++   +SV +K++  D    T++  +
  S:     5 KIIHIDMDAFYASVELREQPHLKGRPVVVAWEGARSVICAASYEARQFGLHSAMSVATAKRLCPQAVYVPPHFDLYRQVSAQIHAVFRRYTDLIEPLSLDEAYLDVT----RNFKNIPYAGDVAKEIRAAIFAETGLTASAGIAPNKFLAKIASDWRKPNGQFVLPPHKVMAFLETLPLGKIPGVGKVTLKKMQSLGMRTAGDLRRFERGELL-NHFGRYGYRLYDLVRGTDERPVKAERERLQISTEITLPEDLPLEQAAGHLPHLAEDLWRQITRKNVEAQSVTLKLKTYDFRIITRTLTY 302
>gi|154498603|ref|ZP_02036981.1| hypothetical protein BACCAP_02593 [Bacteroides capillosus ATCC 29799] >gi|150272342|gb|EDM99536.1| hypothetical protein BACCAP_02593 [Bacteroides capillosus ATCC 29799] (424 aa)
Score = 301, Expect = 1.7e-25, Identities = 65/210 (30%), Positives = 114/210 (54%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGL 214
           I H DM+ F+ASVE+   PE    PLAV       H ++ +ANY+A+  GVK+ M I  AK+ CPQL  + P+ ++Y  +S          +  +E   +DE +LDV+ +       +  A  + + IK +  +  ++G +     AK+ ++  KPD    + +DN+K  +Y L +  ++ +GP+ +++L  + +  I  +A    D L R+  K+GL
  S:    14 ILHCDMNCFYASVEMQRHPELRDTPLAVCGSQEERHGIVLTANYIAKPYGVKTGMAIWQAKQRCPQLVTLPPDMDEYIRISRYAREIYEDYTDQVEPFGLDESWLDVTGSVGLYGSPMIIAREISSRIKSELGITASIGVANNKITAKLGSDYKKPDAITRIEQDNYKEIVYPLPVEDLLYVGPATSKKLRAIGIDTIGRLAECPEDVLQRRLGKMGL 231
>gi|19568901|gb|AAL91962.1|AF483099_1 DNA polymerase DinB [Escherichia coli] >gi|19568903|gb|AAL91963.1|AF483100_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 301, Expect = 1.8e-25, Identities = 84/287 (29%), Positives = 148/287 (51%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|33592070|ref|NP_879714.1| DNA polymerase IV [Bordetella pertussis Tohama I] >gi|33596271|ref|NP_883914.1| DNA polymerase IV [Bordetella parapertussis 12822] >gi|33602069|ref|NP_889629.1| DNA polymerase IV [Bordetella bronchiseptica RB50] >gi|33566040|emb|CAE36936.1| DNA-damage-inducible protein p [Bordetella parapertussis] >gi|33571714|emb|CAE41211.1| DNA-damage-inducible protein p [Bordetella pertussis Tohama I] >gi|33576507|emb|CAE33585.1| DNA-damage-inducible protein p [Bordetella bronchiseptica RB50] (361 aa)
Score = 301, Expect = 1.9e-25, Identities = 63/200 (31%), Positives = 111/200 (55%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIA 200
           ++ KI HIDMD+F+ASVE  + P    LP+ V       V+ +A+Y AR  GV SAM    A+++CP    + P+ N+Y  +S ++ +  +  +  IE  S+DE YLDV+  +       E A +++  I+++  L  + G +   FLAK+A++  KPDG   +       ++  L + K+ G+G  +  +L +L +  + D++
  S:     4 LQRKIVHIDMDAFYASVEQRDNPALRGLPVVVAWTGPRSVVCAASYEARRYGVHSAMAAARAQRLCPDAVYVPPDFNRYREVSRQVRAIFARHTDLIEPLSLDEAYLDVTCNKLGLASATEVAQIIRRQIREETGLTASAGVAPNKFLAKIASDWNKPDGLFVIKPSRVLDFLQPLPVRKVPGVGKVMQARLEQLGIQTVGDLS 207
>gi|19568865|gb|AAL91944.1|AF483081_1 DNA polymerase DinB [Escherichia coli] >gi|19568869|gb|AAL91946.1|AF483083_1 DNA polymerase DinB [Escherichia coli] >gi|19568871|gb|AAL91947.1|AF483084_1 DNA polymerase DinB [Escherichia coli] >gi|19568873|gb|AAL91948.1|AF483085_1 DNA polymerase DinB [Escherichia coli] >gi|19568875|gb|AAL91949.1|AF483086_1 DNA polymerase DinB [Escherichia coli] >gi|19568877|gb|AAL91950.1|AF483087_1 DNA polymerase DinB [Escherichia coli] >gi|19568879|gb|AAL91951.1|AF483088_1 DNA polymerase DinB [Escherichia coli] >gi|19568881|gb|AAL91952.1|AF483089_1 DNA polymerase DinB [Escherichia coli] >gi|19568889|gb|AAL91956.1|AF483093_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 301, Expect = 1.9e-25, Identities = 82/287 (28%), Positives = 150/287 (52%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|117928651|ref|YP_873202.1| DNA polymerase IV [Acidothermus cellulolyticus 11B] >gi|117649114|gb|ABK53216.1| DNA-directed DNA polymerase [Acidothermus cellulolyticus 11B] (466 aa)
Score = 301, Expect = 1.9e-25, Identities = 64/201 (31%), Positives = 117/201 (58%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVGHL----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYE---NWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKND 205
           + H D+D+F+A+VE  ++P     P+ VG L    V+A+A+Y AR  GV+SAM++V+A+  CPQ   + P    Y ++S +I    +  S  +E  S+DE YLD++ + +E       +E A  +K  ++    L+ +VG   +  +AK+A++L KPDG   +       ++  L +++I G+GP+   +L  + +H I ++A +  +
  S:    28 VLHADVDAFYAAVEQRDKPSLRGHPVIVGGLGPRGVVATASYEARRYGVRSAMSMVEARARCPQAAFLAPRFAVYRAVSAQIMDIFAEFSALVEPLSLDEAYLDIATSAHEPISTEAAVEIARRIKEKVRAVTGLSISVGAGNSKLVAKIASDLDKPDGLRVVPAGAEADFLAPLPVTRIPGVGPATAARLHNVGVHTIGELAALSEE 235
>gi|19568885|gb|AAL91954.1|AF483091_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 301, Expect = 1.9e-25, Identities = 84/287 (29%), Positives = 148/287 (51%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLI-RKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+   K D +I  K+ G     L     GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRARGGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPTFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQ--KCDLVILLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|19568883|gb|AAL91953.1|AF483090_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 301, Expect = 2.0e-25, Identities = 82/287 (28%), Positives = 150/287 (52%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|156975532|ref|YP_001446438.1| DNA polymerase IV [Vibrio harveyi ATCC BAA-1116] >gi|156527126|gb|ABU72212.1| hypothetical protein VIBHAR_03264 [Vibrio harveyi ATCC BAA-1116] (372 aa)
Score = 301, Expect = 2.0e-25, Identities = 77/258 (29%), Positives = 135/258 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI H+DMD F+A+VE+ + P Y  + LAVG       VI++ NY AR  GV+SAM    A ++CP L ++    + Y  +S +I +     ++ IE  S+DE YLDV+++          A  ++  I  +  L  + G +   FLAK+A+++ KP+G   +  +  +  +  L + KI G+G     +L +   +  +DI N     L+R + G   + L     GI    +  + +RK++G  ++   N + Y E  ++I++
  S:    25 KIIHVDMDCFYAAVEMRDNPSYRGVALAVGGHEKQRGVISTCNYEARKFGVRSAMPTARALQLCPNLLVVPGRMHVYKQVSQQIRAIFERYTQLIEPLSLDEAYLDVTDSTACRGSATLIAESIRRDIHTELGLTASAGIAPIKFLAKVASDMNKPNGQFVIPPEKVQEVVDKLPLEKIPGVGKVSLEKLHQAGFYLCEDIKNSDYRELLR-QFGRQGASLWKRSHGIDDREVVVERERKSVGVERTFSENIATYDECWQVIED 287
>gi|194556192|ref|YP_002091219.1| DNA damage inducible protein P [Pseudomonas aeruginosa 2192] >gi|126198585|gb|EAZ62648.1| DNA damage inducible protein P [Pseudomonas aeruginosa 2192] (349 aa)
Score = 301, Expect = 2.0e-25, Identities = 78/290 (26%), Positives = 149/290 (51%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           KI HID D F+A++E+ + P      LAVG       V+A+ +Y AR  GV+SAM +  A K+CP L ++ P  + Y ++S +I++     +  IE  S+DE YLDVS + +        A  ++  + ++ ++  + G +   FLAK+A++  KPDG   +T +    ++ +L ++K+ G+G     +L  + +    D+       L+R + G    +L     GI   P+  D +R+++    +  R+  +    L+ +  L  +++  L+  D  ++     +K+++ D    T
  S:     3 KIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVR-EFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLGELDGRLQRLDGSYRPDKPFVKLKFHDFTQTT 299
>gi|194291215|ref|YP_002007122.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Cupriavidus taiwanensis] >gi|193225050|emb|CAQ71061.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Cupriavidus taiwanensis] (359 aa)
Score = 301, Expect = 2.1e-25, Identities = 73/245 (29%), Positives = 125/245 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVGHL-----VIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS 245
           ++ KI H D D F+ASVE+ + P     P+AVG       VIA+ NY AR  GV+SAM    A K CP+L I+ P  +KY  +S +I++     +  +E  S+DE YLDVS   +        A  ++  ++ +  +  + G   + F+AK+A++  KPDG   +      +++  L + +I G+G     +L  L      D+     D L R + G+  ++L     G+    + P+ +RK++   ++
  S:    11 VQRKIIHCDCDCFYASVEMRDDPSLRGRPMAVGGAPDRRGVIATCNYEARAYGVRSAMASAQALKRCPELLIVRPAMDKYREVSRRIFAIYREYTALVEPLSLDEAYLDVSLCTHHAGSATRIAEEIRQRVRDEVGVTVSAGVGPSKFVAKIASDWNKPDGLFVVRPAAVDAFVAALPVERIHGVGRVTAAKLRRLGAETCGDLRPWSPDRLHR-EFGVFGARLYKLCRGVDERAVTPERERKSISVEET 259
>gi|152989713|ref|YP_001349935.1| DNA polymerase IV [Pseudomonas aeruginosa PA7] >gi|189027674|sp|A6VA50|DPO4_PSEA7 DNA polymerase IV (Pol IV) >gi|150964871|gb|ABR86896.1| DNA damage inducible protein P [Pseudomonas aeruginosa PA7] (349 aa)
Score = 301, Expect = 2.1e-25, Identities = 69/237 (29%), Positives = 126/237 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           KI HID D F+A++E+ + P      LAVG       V+A+ +Y AR  GV+SAM +  A K+CP L ++ P  + Y ++S +I++     ++ IE  S+DE YLDVS + +        A  ++  + ++  +  + G +   FLAK+A++  KPDG   +T +    ++ +L ++K+ G+G     +L  + +    D+       L+R + G    +L     G+   P+  D +R+++
  S:     3 KIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTELIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELRITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVR-EFGSFGERLWSLAHGVDERPVEVDSRRQSV 243
>gi|19568895|gb|AAL91959.1|AF483096_1 DNA polymerase DinB [Escherichia coli] >gi|19568897|gb|AAL91960.1|AF483097_1 DNA polymerase DinB [Escherichia coli] >gi|19568899|gb|AAL91961.1|AF483098_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 301, Expect = 2.1e-25, Identities = 82/287 (28%), Positives = 150/287 (52%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPTFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|86357263|ref|YP_469155.1| DNA polymerase IV [Rhizobium etli CFN 42] >gi|86281365|gb|ABC90428.1| DNA damage inducible P protein [Rhizobium etli CFN 42] (430 aa)
Score = 300, Expect = 2.1e-25, Identities = 91/379 (24%), Positives = 203/379 (53%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ--YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS-IRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNF---VNFQNQIPLHVVVDLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPT-QKISTESKLEKIRKQVNKTLNKKIIHYPSSRSN 385
           HID D+F+A+VE  + PE    P+ +G     V+++A Y+AR  GV+SAM +  A + CPQ T+I P+  KY  +  ++ + +  L+  ++  SIDE +L++  T+  + +      A   +  I+++  +  +VG S+  FLAK+A++L KP GF  + ++    ++    ++ I G+G +    L    +  I  +  ++ + L+R+   IG   ++L     GI    ++ +   K++    +   + S Y + + +++ L++ ++  LK  D   ++V +K++ +D  + T++          ++I   V ++L E+ +D +K+ ++I + +T  ++ +    +   + D  + ++ + E+ ++K+R +  K   +    + SS+ +
  S:    47 HIDCDAFYAAVEKRDNPELADKPVIIGGGKRGVVSTACYIARIHGVRSAMPMFKALEACPQATVIRPDMEKYVRVGRQVRALMQDLTPLVQPLSIDEAFLELGGTERLHHDPPARTLAKFARR-IEKEIGITVSVGLSYCKFLAKVASDLQKPRGFSVIGREEAVEFLAPRPVTTIWGVGKAFAATLEADGIRTIGQLQQMEENDLMRRYGSIGQRLARLSR---GIDDREVHLNDAAKSVSAETTFFDDISRYDDLVPILRNLSEKVSWRLKKNDIAGQTVVLKMKSADFKTRTRNRKLEDPTQLADRI-FRVGLELLEKETDGTKF-RLIGIGVT--DLGDATRADPPDLIDRQSGRRAAAEAAMDKLRDKFGKNTVETGYTFGSSKRD 429
>gi|169830932|ref|YP_001716914.1| DNA-directed DNA polymerase [Candidatus Desulforudis audaxviator MP104C] >gi|169637776|gb|ACA59282.1| DNA-directed DNA polymerase [Candidatus Desulforudis audaxviator MP104C] (395 aa)
Score = 300, Expect = 2.2e-25, Identities = 80/285 (28%), Positives = 146/285 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-------RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIR 285
           M+  I   D+D+F+ASV  A  P  +  P+ V         V+ +A+Y A+G GVK+ M + +A+++CP    + P  + Y   S +I   +   +  +E  SIDE +LDV+  +       E A  +K  I+++  + C+VG      LAKMA  L KPDG   L  ++  + ++ L + ++ G+GP     L  L +  I D+A+     L + + G++   L     G+   P++P    ++L R +S        R+Y  + E   +I EL D + + ++   +  ++V + ++
  S:     1 MERAILLADVDAFYASVHQALDPGLKGRPVVVAGDPAARRGVVLAASYEAKGRGVKTGMPVREARRLCPDGVFLKPQHHLYLHFSTRILGIMRDFTPLVEPFSIDEAFLDVTGCRNLFGPPEEIALALKRRIRREVGVTCSVGIGPNKLLAKMAAGLRKPDGLTVLRHEDVPARLWPLPVRELFGVGPRYEEHLRRLGIRTIGDLASFPVRVL-KMRFGVYGELLWRCANGVDESPVDP----RSLDRCKSAGHQITLPRDYRRHGEIRVVILELADQVAARVRAGGYAGRTVVLSLK 293
>gi|15596120|ref|NP_249614.1| DNA polymerase IV [Pseudomonas aeruginosa PAO1] >gi|116048846|ref|YP_792353.1| DNA polymerase IV [Pseudomonas aeruginosa UCBPP-PA14] >gi|194550259|ref|YP_002085287.1| DNA damage inducible protein P [Pseudomonas aeruginosa C3719] >gi|122257953|sp|Q02I83|DPO4_PSEAB DNA polymerase IV (Pol IV) >gi|22095637|sp|Q9I534|DPO4_PSEAE DNA polymerase IV (Pol IV) >gi|9946826|gb|AAG04312.1|AE004526_7 DNA damage inducible protein P [Pseudomonas aeruginosa PAO1] >gi|115584067|gb|ABJ10082.1| DNA damage inducible protein P [Pseudomonas aeruginosa UCBPP-PA14] >gi|126171205|gb|EAZ56716.1| DNA damage inducible protein P [Pseudomonas aeruginosa C3719] (349 aa)
Score = 300, Expect = 2.2e-25, Identities = 70/237 (29%), Positives = 126/237 (53%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNL 240
           KI HID D F+A++E+ + P      LAVG       V+A+ +Y AR  GV+SAM +  A K+CP L ++ P  + Y ++S +I++     +  IE  S+DE YLDVS + +        A  ++  + ++ ++  + G +   FLAK+A++  KPDG   +T +    ++ +L ++K+ G+G     +L  + +    D+       L+R + G    +L     GI   P+  D +R+++
  S:     3 KIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVR-EFGSFGERLWGLAHGIDERPVEVDSRRQSV 243
>gi|88858237|ref|ZP_01132879.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Pseudoalteromonas tunicata D2] >gi|88819854|gb|EAR29667.1| DNA polymerase IV, devoid of proofreading, damage-inducible protein P [Pseudoalteromonas tunicata D2] (341 aa)
Score = 300, Expect = 2.3e-25, Identities = 85/288 (29%), Positives = 152/288 (52%)
  Q:    10 MDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKE-----LTDDINSGLKYQDFMFK--SVNIKIRYSDGDSATKSFN 297
           MD F+A+VE+ + P   KLP+A+G      V+ +ANYVAR  GV++AM+   AKK+CP L +I    + Y ++S +I +     +  +E  S+DE YLDV++ Q         A  +++ I  +  L  + G +   F+AK+A++L KP+G   +     + ++  L + KI G+G     +L  + L   +D+ +    +++   +G    +L     G     +NPD  RK+L    S+ +  EY     L+ E     L  ++   L+ Q  + +   +++K+++SD  S T  F+
  S:     1 MDCFYAAVEMRDNPALTKLPIAIGGNSRRGVLCTANYVARQFGVRAAMSNYQAKKLCPDLVMIPGRMDVYKNISKQIRAIFYRYTDLVEPLSLDEAYLDVTDCQACFGSATLIARQIRDEIFAQTQLTASAGIAPIKFIAKIASDLNKPNGQFVVEPSQVQPFLAQLALQKIPGVGKVTFEKLKVMGLLQGQDVIDRGESWMLH-HLGQFGLELFRKCAGKHVGQVNPDRTRKSL----SVEHTYEYDLTSYLLCEEKLSGLLIELQVRLEKQQLLDRIGKLSVKVKFSDFVSTTADFS 294
>gi|19568905|gb|AAL91964.1|AF483101_1 DNA polymerase DinB [Escherichia coli] >gi|19568911|gb|AAL91967.1|AF483104_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 300, Expect = 2.3e-25, Identities = 82/287 (28%), Positives = 150/287 (52%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|19568893|gb|AAL91958.1|AF483095_1 DNA polymerase DinB [Escherichia coli] (336 aa)
Score = 300, Expect = 2.3e-25, Identities = 82/287 (28%), Positives = 150/287 (52%)
  Q:     8 IDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIG-LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLK--YQDFMFKSVNIKIRYSDGDSATK 294
           +DMD FFA+VE+ + P    +P+A+G       VI++ANY AR  GV+SAM    A K+CP LT++    + Y   S+ I    S  +  IE  S+DE YLDV+++ + +      A  ++ +I  +  L  + G +   FLAK+A+++ KP+G   +T     +++  L ++KI G+G     +L  + L    D+       L+++  K G + W + +    GI    +N +  RK++G  +++  +   + E   +I+ L  ++   L     D +     +K+++ D    T+
  S:     1 VDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAKEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVTLLKRFGKFGRILWERSQ----GIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQ 294
>gi|154247780|ref|YP_001418738.1| DNA polymerase IV [Xanthobacter autotrophicus Py2] >gi|154161865|gb|ABS69081.1| DNA-directed DNA polymerase [Xanthobacter autotrophicus Py2] (432 aa)
Score = 300, Expect = 2.4e-25, Identities = 78/291 (26%), Positives = 152/291 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQ-YENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRK--KIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           + H+D D+FFA+VE  + P    +PL +G     V+++A Y+AR  GV+SAM +  A  +CP+  ++ PN  KY ++  ++ + +  L+  +E  SIDE +LD+S TQ           +    +++++  +  +VG +   FLAK+A++L KP GF  L +     ++     + I G+G +   +L +   H I D+       L R+    GL  S+L     G+    + P+ + K++    +  R+    +   + +  L+++++  LK+     ++V +K++ +D    T+S
  S:    44 VAHVDCDAFFAAVEKRDDPSLADVPLIIGGGKRGVVSTACYIARIKGVRSAMPMFKALALCPEAVVLKPNMEKYRTVGRQVRAMMQQLTPLVEPLSIDEAFLDLSGTQALHGASPARTLARFAQAVEREVGITVSVGLAANKFLAKIASDLDKPRGFSVLGQTEAAGFLAPRPATFIWGVGAAFGGKLAKDGFHTIADLQRAAPADLARRYGAEGLRLSRL---AFGVDTRAVEPEREAKSVSAETTFERDMGALRPLEQTLYALSEEVSDRLKHAGIAGRAVTLKLKSADFRLRTRS 338
>gi|21230058|ref|NP_635975.1| DNA polymerase IV [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769949|ref|YP_244711.1| DNA polymerase IV [Xanthomonas campestris pv. campestris str. 8004] >gi|188993162|ref|YP_001905172.1| DNA polymerase IV [Xanthomonas campestris pv. campestris] >gi|81304097|sp|Q4UQI2|DPO4_XANC8 DNA polymerase IV (Pol IV) >gi|24211642|sp|Q8PCW8|DPO4_XANCP DNA polymerase IV (Pol IV) >gi|21111581|gb|AAM39899.1| DNA polymerase IV [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575281|gb|AAY50691.1| DNA polymerase IV [Xanthomonas campestris pv. campestris str. 8004] >gi|167734922|emb|CAP53134.1| DNA polymerase IV [Xanthomonas campestris pv. campestris] (359 aa)
Score = 300, Expect = 2.4e-25, Identities = 79/293 (26%), Positives = 149/293 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKL------IKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSF 296
           KI H+DMD+F+ASVE  + P     P+ V       V+ +A+Y AR  G++SAM  V A+++CP    + P+  +Y ++S ++       +  +E  S+DE YLDV+  +       E A L++  I+++  L  + G +   FLAK+A++  KPDG   +      +++  L +++I G+G  +  +L  L +  + D+  ++    ++   G     L     GI   P+ PD +       QS+ +   + E L L      I+ L +      +  + + ++V +K++ S+    T+S+
  S:     3 KIVHVDMDAFYASVEQRDDPSLRGKPVVVAWRGARSVVCAASYEARTFGIRSAMPAVRAERLCPDAVFVPPDFARYKAVSRQVREIFHRHTDLVEPLSLDEAYLDVTEAKTGMQLATEIAQLIRTQIREETQLTASAGIAPNKFLAKIASDWRKPDGQFVIAPSRVDAFLLPLPVNRIPGVGKVMDGKLAALGIVTVSDL-RLRPLEELQAHFGSFGQSLYRRARGIDERPVEPDQE------VQSVSSEDTFSEDLALDALDPHIQRLAEKTWHATRRTERIGRTVVLKLKTSNFRILTRSY 298
>gi|153893741|ref|ZP_02014379.1| DNA-directed DNA polymerase [Opitutaceae bacterium TAV2] >gi|151580189|gb|EDN44104.1| DNA-directed DNA polymerase [Opitutaceae bacterium TAV2] (416 aa)
Score = 300, Expect = 2.4e-25, Identities = 83/284 (29%), Positives = 148/284 (52%)
  Q:     5 IFHIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFA-SLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDI-----------ANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYK-RKNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           I H+D D+FF SVELA +P+Y    +AVG     +IASA+Y AR  GV + M    A KICP L I+ P+K  Y  +S +++    +L+  ++  SIDE YLDV+   ++   EI  A   ++N I Q+  +  ++G +    +A++A+ L KP GF+ +      +++  L I K+ G+G      L    L  + DI           A    +  +   +G  W  L     G    P++ D++  K+  + ++   +  ++     + K + D++   ++      +++ +K+RY D
  S:    21 IVHLDADAFFVSVELALQPQYRGKKVAVGGRERGIIASASYEARACGVYTPMPTARALKICPDL-ILLPHKGSYGDVSRRMFDLCENLTPIVQRNSIDEGYLDVTMCGFKTQDEIVAAIRDLQNRIWQQLQIPVSMGIATNRLVAQIASKLRKPRGFVVVPPGEEAAFLAPLSIGKLPGVGQKTEETLNARGLRIVSDITTLAARCLAPGAGATGERELAATLGSGWPDLVAAARGEDDRPVHTDHEDAKSYSKQETFPADVGDFATIESVAKGMIDELMPDIRADGKRVRTLTVKVRYGD 320
>gi|30249204|ref|NP_841274.1| UMUC family protein [Nitrosomonas europaea ATCC 19718] >gi|30180523|emb|CAD85130.1| UMUC family (DNA-repair) [Nitrosomonas europaea ATCC 19718] (385 aa)
Score = 300, Expect = 2.6e-25, Identities = 87/297 (29%), Positives = 155/297 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-------------------------HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLH---WSKLRMNVLGIICDPINPDYKRKNLGRSQSIR---NYSEYQEFLK-LIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVN 300
           +I H+DMD+F+ASVEL   PE   LP+ +G                           V+ ++ Y AR  GV SAM I+ A ++ P   ++  + + Y   S      ++ ++ +IE   IDE Y+D+S    E       AS +K +++    L+C++G +    LAK++++L KPDG   LT  +  + I+ L + KI GIGP    +L+ L +  I ++A  +   L++   G     W  L  +  G    P+    + K++ R  +     +  E +E L  +  EL   +   L+ + ++ +++ IK+RY +  + T+     N
  S:    10 RIAHLDMDAFYASVELLRYPELRGLPVVIGGRSVHQPVIQPDGKRSYVRLRDYTGRGVVTTSTYEARAYGVFSAMGIMRAAQLAPDAILLPADFDTYRHYSRLFKDAIARITPHIEDRGIDEIYIDLSEHPDET---ASLASSIKQAVRDATGLSCSIGIAPNKLLAKISSDLEKPDGLTILTHTDIPNRIWPLSVRKINGIGPKAEEKLVRLGIQKIGELAKAELS-LLQAHFGRSNAIW--LHDSAHGRDSRPVVISSESKSISREATFERDLHVQEDREILSDIFTELCTRVAEDLQRKGYVGRTIGIKLRYENFQTITRDLTVRN 332
>gi|16079428|ref|NP_390252.1| DNA polymerase IV [Bacillus subtilis subsp. subtilis str. 168] >gi|1731083|sp|P54560|DPO42_BACSU DNA polymerase IV 2 (Pol IV 2) >gi|1303974|dbj|BAA12629.1| YqjW [Bacillus subtilis] >gi|2634806|emb|CAB14303.1| yqjW [Bacillus subtilis subsp. subtilis str. 168] (412 aa)
Score = 300, Expect = 2.7e-25, Identities = 104/371 (28%), Positives = 194/371 (52%)
  Q:     1 MKNK-IFHIDMDSFFASVELAERPEYEKLPLAV-------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMAT-NLAK--PDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDY--KRKNLGRSQSI-RNYSEYQEFLKLI-KELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQI----PLHVVVDLFEQIS----DFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKT 371
           MK K IF +DM SF+ASVE AE P  +  P+ V       G +V+A+   +A+  GV +A  + +A++ CP+  ++ P   +Y  +S +I + L   +  +E  SIDE ++D++ +Q      +E A  ++  I ++  +   VG      LAK+A  N AK   +G  TLTK+N K+ ++ L +  + G+G  +   L  + +  I  +A    D L++KK G++   L M   GI   P++      +K +G   ++ R+Y  + + +K++  EL++++    +    M ++V++  R +D D  T       F  Q+    P +   D++E +      F     V  L +  +  + +D+  QL +F    +K+S    ++ I+ +   T
  S:     2 MKEKVIFLVDMQSFYASVEKAENPHLKNRPVIVSGDPEKRGGVVLAACP-LAKQKGVVNASRLWEAQEKCPEAVVLRPRMQRYIDVSLQITAILEEYTDLVEPYSIDEQFMDITGSQKLFGTPMEIAKSIQGRIMREIGVYARVGIGPNKALAKIACDNFAKKNKNGIFTLTKENMKTEMWPLPVGSMFGVGSRMKHHLNRMGISTIGGLAAFPLD-LLKKKWGINGHVLWMTANGIDYSPVSTSSLDGQKAIGHGMTLPRDYEHFDKEIKVVLLELSEEVCRRSRNAGVMGQTVSVSCRGADFDWPT------GFNRQVKLAEPTNSTQDVYEAVRRLFLTFWDGKPVRRLGVNLSQ-LSSDDIWQLNLFQDYAKKMSLGYVMDGIKNRFGDT 386
>gi|187929043|ref|YP_001899530.1| DNA-directed DNA polymerase [Ralstonia pickettii 12J] >gi|187725933|gb|ACD27098.1| DNA-directed DNA polymerase [Ralstonia pickettii 12J] (357 aa)
Score = 300, Expect = 2.7e-25, Identities = 77/285 (27%), Positives = 144/285 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQS----IRNYSEYQ-EFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSD 288
           KI H D D F+A++E+ + P     PLAVG       V+A+ NY AR  G+ SAM +  A K CP L I+ P+  KY  ++ +I++   S +  +E  S+DE YLDV+++          A  ++  ++++  +  + G +   F+AK+A++  KPDG   +  +   +++ +L + ++ G+G     +L  L      D+     D L ++  G+   +L     GI    + P   RK++   ++    +R   + Q E + L+++L   +         M     +K+R++D
  S:     3 KIIHCDCDCFYAAIEMRDDPRLVGKPLAVGGRPERRGVVATCNYEARKFGIHSAMPMAQAVKRCPDLLIVPPSMEKYRQVARQIFAIYHSYTPLVEPLSLDEAYLDVTDSPMLAGSGTRIAEDIRRRVREEIGITVSAGVAPNKFIAKIASDWNKPDGLFVVRPEQIDAFVAELPVDRLFGVGKVTAAKLRRLGAETCGDLRAWGTDRL-QQHFGVFGFRLHDLCRGIDHRQVQPSQIRKSVSVEETYATDLRTLDDCQRELIILVEQLAARVERARAGN--MIHKTYVKLRFAD 294
>gi|118728367|ref|ZP_01576920.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10] >gi|118662249|gb|EAV68957.1| DNA-directed DNA polymerase [Clostridium cellulolyticum H10] (413 aa)
Score = 300, Expect = 2.8e-25, Identities = 97/384 (25%), Positives = 196/384 (51%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGII--CDPINPDYKR--KNLGRSQSI-RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVV---------DLFEQISDFSKYDQVINLSITANNIMENDNNEQLTIFDSPTQKISTESKLEKIRKQVNKTLNKKIIHYPSSRS 384
           M   I H D+++F+ASVE    P++   PLAV       H ++ + NY+A+  G+K+   I  AK+ CP L ++ PN   Y   S       S  S  +E+  IDE ++DVS +        + A+ ++  IK +  +  +VG SF    AK+ ++L K +    + ++NFK  +++L++ +++ +G S  ++L ++ +  I D+A +   + IR+ +G  W ++  N    +   +    DY    K +G S +  R+    ++       L + +   L+  +    ++ I IR  D + A+     +  Q ++P+   +         ++F   +++S Y  + +L I A +++  D++ QL+ FD+  ++     +LE +   ++  + K+  HY   R+
  S:     1 MDRVILHCDLNNFYASVECLYNPQFRDYPLAVCGSQDLRHGIVLAKNYIAKKFGIKTGEAIWQAKQKCPNLVVVNPNYALYLRFSKDAREIYSRYSNLVESFGIDECWIDVSESTKLFGDGEKIANEIRALIKTELGVTASVGVSFNKIFAKLGSDLQKSNATTVINQNNFKEMVWNLNVGELLYVGRSTRKKLNQIGIMTIGDLAGLPPSF-IRRYLG-KWGEILWNFANGMDYSEVTATDYHETIKGIGNSMTTARDLVNTEDVKLTFTVLAESVAERLRKHNLKGSTIQIYIR--DNELAS-----IERQAKLPVSSYISGEITRKAMNIFN--TNWSWYKPIRSLGIRATDLVTADSHTQLSFFDNYNKR----PQLENLEFSID-AIRKRFGHYSVQRA 388
>gi|90022152|ref|YP_527979.1| DNA-directed DNA polymerase [Saccharophagus degradans 2-40] >gi|89951752|gb|ABD81767.1| DNA-directed DNA polymerase [Saccharophagus degradans 2-40] (358 aa)
Score = 299, Expect = 2.8e-25, Identities = 85/293 (29%), Positives = 145/293 (49%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSE-YQEFLKLIKELTDDINSGLKYQDFMFKSVN--IKIRYSDGDSAT 293
           M  KI H D D FFA++E+ + P     P+AVG       VI++ NY AR  GV+SAM    A ++CP L I+  N  KY   S ++       +  +E  S+DE +LDVS            A  +K  I +   +  + G +   FLAK+A+++ KP+G   +  +  + ++  L +SKI G+G    +++ +L L+  +D+ N K+   + +  G    +L     GI    + P   RK+L    +  N  E  ++ ++ +  L  ++ S L      +K V    KI+++D  + T
  S:     1 MSRKIIHCDADCFFAAIEMRDDPSLMGRPIAVGGRSDRRGVISTCNYEAREYGVRSAMASAHALRLCPDLIILPHNMEKYRLASMQMREIFYDYTDLVEPLSLDEAFLDVSGCSKHYGSATLIAKEIKQRIHKDVGITVSAGAANCKFLAKIASDINKPNGLTVIPPEKTEEFVLTLPVSKIFGVGKVTQQKMAKLGLYTCRDLKN-KSQIELSEHFGSFGQRLFELCRGIDKREVKPSRSRKSLSVEHTFPNDLENIEQCIESLPPLFVELKSRLNKLSDRYKVVKAFTKIKFNDFSTTT 300
>gi|59711341|ref|YP_204117.1| DNA polymerase IV [Vibrio fischeri ES114] >gi|59479442|gb|AAW85229.1| DNA polymerase IV [Vibrio fischeri ES114] (365 aa)
Score = 299, Expect = 2.9e-25, Identities = 100/329 (30%), Positives = 166/329 (50%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANV-KNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIK-ELTDDINSGLKYQD---FMFKSVNIKIRYSDGDSATKSFNFVNFQNQIPLHVVVDLFEQISDFSKYDQV--INLSIT 332
           KI HIDMD F+A+VE+ + P    +PLAVG       V+++ NY AR  G++SAM    A K+CP L ++      Y  +S  I+      +  IE  S+DE YLDVS+    +      A  ++  I  +  L  + G +   FLAK+A++L KP+G   +T D+  + I  L + KI G+G     +L +  L+  +DI    + D L+  K G   + L     GI    +  +  RK++G  ++   N S + E   +I+  L  ++   L   +   F+ K   IKI+++D    T      +  + + L    +L E++ +  K  ++  I LS+T
  S:    18 KIIHIDMDCFYAAVEMRDNPSLRNVPLAVGGHERQRGVLSTCNYEARKFGIRSAMPTGKALKLCPNLVVVPGRMQVYKEVSHHIHRIFRRYTDKIEPLSLDEAYLDVSDCSLLHGSATLIAEQIRKDIFNELQLTASAGIAPLKFLAKIASDLNKPNGQYVITPDSMMNEIKGLPLEKIPGVGKVSLERLHQFGLYTCEDIQKSDQRDLLL--KFGKMGASLWKRSHGIDEREVVTERNRKSVGVERTFTHNISSFNECWDVIENRLFPELEKRLLKANGSTFIAKQ-GIKIKFADFQQTT----IEHVHHNLTLPFFKELLEEVLERQKGREIRLIGLSVT 352
>gi|120610644|ref|YP_970322.1| DNA-directed DNA polymerase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120589108|gb|ABM32548.1| DNA-directed DNA polymerase [Acidovorax avenae subsp. citrulli AAC00-1] (425 aa)
Score = 299, Expect = 3.1e-25, Identities = 88/294 (29%), Positives = 154/294 (52%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLA----------------------------------VGHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLD---VSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIR---KKIG--LHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIRNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATK 294
           +  +I H+DMD+F+ASVEL   P+ + LP                                    VG  VI +A Y AR  GV SAM ++ A ++CPQ  ++  +   Y   S +    + S++  +E   +DE Y+D   V   Q E  + +  A L++ SI +   L C++G +    +AKMA+   KP+G   + + + ++ I+ L   KI GIGP    +L    +H I D+A    D+L+R   K  G  LH +    +   ++ +   P    +     + +    +  E  ++  +L + +   L+ + ++ K++ IK+RY D   AT+
  S:    28 LPRRIAHLDMDAFYASVELLRYPQLKGLPAVIGGGRRSEDEALARAYAGRESEIPVEAFPLLRDYVGRGVITTATYPARQFGVGSAMGLMKAARLCPQAILLPVDFASYRRFSRQFKDVILSIAPVMEDRGVDEVYIDFTAVPGGQREGGRVL--ARLIQKSIFEVTGLTCSIGVAPNKLIAKMASEFNKPNGISIVHEGDLQAAIWPLACRKINGIGPKADAKLQSYGIHTIGDLAARPRDWLVRTFGKAYGAWLHEAAWGRDDRAVVTES-EPVSMSRETTFDRDLHAVRDRAELGRIFTDLCERVAEDLRRKGYVGKTIGIKLRYDDFRIATR 360
>gi|86749530|ref|YP_486026.1| DNA polymerase IV [Rhodopseudomonas palustris HaA2] >gi|86572558|gb|ABD07115.1| DNA-directed DNA polymerase [Rhodopseudomonas palustris HaA2] (429 aa)
Score = 299, Expect = 3.2e-25, Identities = 77/289 (26%), Positives = 148/289 (51%)
  Q:     7 HIDMDSFFASVELAERPEYEKLPLAVG---HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWK-EIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSIR-NYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYSDGDSATKS 295
           HID D+F+A+VE  + PE    P+ +G     V+++A Y+AR  GV+SAM +  A  +CP   ++ P+  KY  +  ++   +  L+  +E  SIDE +LD+S T+  +     +  +     I++   +  +VG S   FLAK+ ++L KP GF TL +D+ ++ +    +  I G+GP+   ++ +     I D+       L+R + G    +L     GI    + PD   K++    +   +  +++   +++  L++ ++S LK       ++ +K++  D    T+S
  S:    48 HIDCDAFYATVEKRDNPELADRPVIIGGGKRGVVSAACYIARTFGVRSAMPMFKALALCPSAAVVRPDMAKYVRVGREVRQAMLQLTPLVEPLSIDEAFLDLSGTERMHGTIAAKVLARFARDIERDVGITVSVGLSCNKFLAKITSDLDKPRGFATLDQDDARAMLGPRPVGFIFGVGPATAARIAQHGFRTIADLQKADEIELMR-QFGDEGRRLWRLARGIDDRKVVPDRGAKSISNETTFETDIRDFETLERILWRLSEKVSSRLKGAALAGSTITLKLKTGDFRQRTRS 340
>gi|146295661|ref|YP_001179432.1| DNA-directed DNA polymerase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409237|gb|ABP66241.1| DNA-directed DNA polymerase [Caldicellulosiruptor saccharolyticus DSM 8903] (411 aa)
Score = 299, Expect = 3.2e-25, Identities = 88/287 (30%), Positives = 146/287 (50%)
  Q:     1 MKNKIFHIDMDSFFASVELAERPEYEKLPLAV------GHLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSK-LRMNVLGIICDPINPDYKRKNL-GRSQSI---RNYSEYQEFLKLIKELTDDINSGLKYQDFMFKSVNIKIRYS 287
           M   I H D+++F+ASVE   RPE +  P+AV       H ++ + N +A+  G+++   I  A K CP L I+ PN   Y   S  +    S  +  IE   IDE +LDV+ +        + A  +K  IK +  L  +VG SF    AK+ ++  KPD    +TK+NFK  ++ L    ++ +G +  ++L    ++ I DIA    +YL  K+I   W + L +   G+   P+ P     N+ G   SI   R+ + Y++   +I+ L++ +   L+ Q     +V + IR S
  S:     1 MGRVILHCDLNNFYASVECLYRPELKNKPVAVCGESELRHGIVLAKNQIAKSYGIQTGDVIWQALKKCPNLVILKPNFPLYIRFSKLVQQIYSEYTDLIEPFGIDECWLDVTESTKILGSGRKIAYEIKERIKTELGLTVSVGVSFNKVFAKLGSDYKKPDAVTVITKENFKQIVWPLPAKDLLYVGSATEKKLSSRAIYTIGDIAKSSPEYL--KRILGKWGEVLWIFANGLDTTPVTPPLFEDNIKGIGNSITLPRDLTCYEDAEYVIRMLSESVAQRLRQQYLKCYTVQVWIRDS 296
>gi|91223441|ref|ZP_01258706.1| DNA polymerase IV [Vibrio alginolyticus 12G01] >gi|91191527|gb|EAS77791.1| DNA polymerase IV [Vibrio alginolyticus 12G01] (356 aa)
Score = 299, Expect = 3.3e-25, Identities = 78/258 (30%), Positives = 135/258 (52%)
  Q:     4 KIFHIDMDSFFASVELAERPEYEKLPLAVG-----HLVIASANYVARGLGVKSAMNIVDAKKICPQLTIIYPNKNKYTSMSDKIYSFLSSLSKNIETGSIDEWYLDVSNTQYENWKEIEFASLVKNSIKQKFNLNCTVGNSFTPFLAKMATNLAKPDGFLTLTKDNFKSYIYDLHISKIIGIGPSLTRQLIELNLHYIKDIANVKNDYLIRKKIGLHWSKLRMNVLGIICDPINPDYKRKNLGRSQSI-RNYSEYQEFLKLIKE 261
           KI H+DMD F+A+VE+ + P Y  + LAVG       VI++ NY AR  GV+SAM+   A ++CP L ++    + Y  +S +I +     +  IE  S+DE YLDV+++          A  ++  I  +  L  + G +   FLAK+A+++ KP+G   +  +  +  I  L +  I G+G     +L +   +  +DI N     L+R + G   + L     GI    +  + +RK++G  ++  +N + Y E  ++I+E
  S:     9 KIIHVDMDCFYAAVEMRDNPSYRGIALAVGGHEKQRGVISTCNYDARKYGVRSAMSTARALQLCPHLLVVPGRMHVYKQVSQQIRAIFERYTPIIEPLSLDEAYLDVTDSTACRGSATLIAESIRRDIWSELGLTASAGIAPIKFLAKVASDMNKPNGQFVIPPEKVQEVIDSLPLENIPGVGKVSLEKLHQAGFYRCEDIKNSDYRELLR-QFGRQGASLWQRSHGIDNREVVVERERKSVGVERTFSQNIATYDECWQVIEE 271