>gi|26553467|ref|NP_757401.1| hypothetical protein MYPE150 [Mycoplasma penetrans HF-2] >gi|26453473|dbj|BAC43805.1| hypothetical protein [Mycoplasma penetrans HF-2] (524 aa)
Score = 2151, Expect = 0.0e+00, Identities = 523/524 (99%), Positives = 524/524 (100%)
  Q:     1 LTMYTQENSFNVKDLRVSFNKKANISKIYEKIQKKYSLREITIHAFVGYHKFKKNTLLVCFSNQKIFIDDEKSKVFFSGVYTYRDIKEIKYHWNEKNELKSYIEFITENYNTFKIKGISKREFNKILEVFDKQKEIYVKSFLEKISSDEKKFELIDETFSYSSVSNFLKNNKNPENNTNNEERKDLENMILDKNLNNPVQDSNQEEQKKLINTSLNSVDEDKEPILSSDLINQSNLLVESLESPKNKKVVNDSLITNTNSFSSSYLVNLLTNEDTLLPGGKKTVVYYLSKKIKELESKSLAINGIDTTPIHLDKKVLKLNTIPVIVETKPISIQSTNAEDELENRLIFTRNWIEYTKHNVVNKVLGVDANGNGAYIDISKASSTSTIDVYKAREYKVNDEVRSGLRSSLTIPFFEKNSRPGLDFFYNNSKTGEKLNITKYDGILFQGVKYYFNVYNEFSKLQKKYIRIFVEDKKSNGDIFRKYELIFEDDSVTYKAYNERSHIIDDTSPNSSSYDLKWLMFFKE 524
           +TMYTQENSFNVKDLRVSFNKKANISKIYEKIQKKYSLREITIHAFVGYHKFKKNTLLVCFSNQKIFIDDEKSKVFFSGVYTYRDIKEIKYHWNEKNELKSYIEFITENYNTFKIKGISKREFNKILEVFDKQKEIYVKSFLEKISSDEKKFELIDETFSYSSVSNFLKNNKNPENNTNNEERKDLENMILDKNLNNPVQDSNQEEQKKLINTSLNSVDEDKEPILSSDLINQSNLLVESLESPKNKKVVNDSLITNTNSFSSSYLVNLLTNEDTLLPGGKKTVVYYLSKKIKELESKSLAINGIDTTPIHLDKKVLKLNTIPVIVETKPISIQSTNAEDELENRLIFTRNWIEYTKHNVVNKVLGVDANGNGAYIDISKASSTSTIDVYKAREYKVNDEVRSGLRSSLTIPFFEKNSRPGLDFFYNNSKTGEKLNITKYDGILFQGVKYYFNVYNEFSKLQKKYIRIFVEDKKSNGDIFRKYELIFEDDSVTYKAYNERSHIIDDTSPNSSSYDLKWLMFFKE
  S:     1 MTMYTQENSFNVKDLRVSFNKKANISKIYEKIQKKYSLREITIHAFVGYHKFKKNTLLVCFSNQKIFIDDEKSKVFFSGVYTYRDIKEIKYHWNEKNELKSYIEFITENYNTFKIKGISKREFNKILEVFDKQKEIYVKSFLEKISSDEKKFELIDETFSYSSVSNFLKNNKNPENNTNNEERKDLENMILDKNLNNPVQDSNQEEQKKLINTSLNSVDEDKEPILSSDLINQSNLLVESLESPKNKKVVNDSLITNTNSFSSSYLVNLLTNEDTLLPGGKKTVVYYLSKKIKELESKSLAINGIDTTPIHLDKKVLKLNTIPVIVETKPISIQSTNAEDELENRLIFTRNWIEYTKHNVVNKVLGVDANGNGAYIDISKASSTSTIDVYKAREYKVNDEVRSGLRSSLTIPFFEKNSRPGLDFFYNNSKTGEKLNITKYDGILFQGVKYYFNVYNEFSKLQKKYIRIFVEDKKSNGDIFRKYELIFEDDSVTYKAYNERSHIIDDTSPNSSSYDLKWLMFFKE 524
>gi|145487444|ref|XP_001429727.1| hypothetical protein GSPATT00005575001 [Paramecium tetraurelia strain d4-2] >gi|124396821|emb|CAK62329.1| unnamed protein product [Paramecium tetraurelia] (714 aa)
Score = 94, Expect = 2.6e-01, Identities = 42/176 (23%), Positives = 81/176 (46%)
  Q:    54 KNTLLVCFSNQKIFIDDEKSKVFFSGVYTYRDIKEIKYHWNEKNELKSYIEFITENYNTF--KIKGISKREFNKILEVFDKQKEIYVKSFLEKISSDEKKFELIDETFSYSSVSNFLKNNKNPENNTNNEERKDLENMILDKNLNNPVQDSNQEEQKKLINTSLNSVDEDKEPILSSD 229
           ++ LL+ F  Q   I + K K  + G+ T +    +  + N+  EL + I+ I E +  +  ++  I+++E   +L V  + KE        +I+S        D   SY  + N   N+ NP N   N++ +      + +NLNN +Q  +Q+EQ +     +++ +     + S D
  S:   429 QDQLLLKFLMQYNGIQERKQKPLYQGILT-KITNYLNSNINQSEELANSIDQIKEEWQKYIDELNEINQKELQWMLGVNPRMKE--------QINSGSSSPFRPDPLISYQGIRNVENNDDNPINQQQNDDAE------VQENLNNEIQSEDQDEQIQYDALQISTHETSNNKVQSDD 591