>gi|26553603|ref|NP_757537.1| hemolysin [Mycoplasma penetrans HF-2] >gi|26453609|dbj|BAC43941.1| hemolysin [Mycoplasma penetrans HF-2] (246 aa)
Score = 1027, Expect = 6.2e-110, Identities = 246/246 (100%), Positives = 246/246 (100%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK
  S:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
>gi|167750993|ref|ZP_02423120.1| hypothetical protein EUBSIR_01978 [Eubacterium siraeum DSM 15702] >gi|167656172|gb|EDS00302.1| hypothetical protein EUBSIR_01978 [Eubacterium siraeum DSM 15702] (241 aa)
Score = 463, Expect = 1.4e-44, Identities = 104/240 (43%), Positives = 151/240 (62%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           MQK RLD+YL   N  +SR +A  LI    V +NG+I +K++  V+E D + I+ E  KY+ R   KL+ A+ H+ + L+  + IDIG+STGGFT  +++N   KVYS+DVGT+QL+E+L+ + +V+S+E+T+ R    SL    +DFI IDVSFIS+ L+      L  N  + +AL+KPQFE GK   +  G  + ++ HKK+ ++  EF S L  +    I SPI G    NTEYL YL
  S:     1 MQK-RLDVYLSENNTVKSRSLAASLIKQGSVEVNGRICTKASFAVDENDNIRIIGEMPKYIGRGGLKLEKALSHYRLHLDGSVCIDIGASTGGFTDCMIQNGAVKVYSVDVGTDQLDEKLRNDPRVVSMEKTDIRNCVGSL--PAVDFIGIDVSFISLKLVLPSAYALLKNGGECVALIKPQFEAGKNHLSKHGIVRDSKVHKKVCDDISEFASTLGFERGEVISSPITGGDG-NTEYLIYL 238
>gi|146296859|ref|YP_001180630.1| hemolysin A [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410435|gb|ABP67439.1| hemolysin A [Caldicellulosiruptor saccharolyticus DSM 8903] (270 aa)
Score = 432, Expect = 6.0e-41, Identities = 103/242 (42%), Positives = 151/242 (62%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           K R DI LV + +A SR  A+ LI +  V +N Q I K+  L++   ++ + E+ K+VSR   KL+ A+  F+ID++ KIA+DIG+STGGFT  LL++  KKVY +DVG  QL  +L+++ +V++ E+TNFR  E   I D+ID I  DVSFIS+ LI +KIKE        I L+KPQFE G++    KG  + ++ H ++I   I+    L +   G   SPIKG +  N EYL YL+ ++
  S:     2 KKRADILLVEKGFAESREKARALILSGNVYVNNQKIEKAGELIDCNAQIVVKEQLKFVSRGGLKLEKALNFFSIDVSGKIALDIGASTGGFTDCLLQHGAKKVYCVDVGYGQLAWKLREDPRVVNFEKTNFRYFEREKIPDRIDVIVCDVSFISLTLISHKIKEFMEEGTVGILLIKPQFEAGREEVGKKGVVRSSQTHIRVIKKVIDCYFSLGVSIKGLTYSPIKGPEG-NIEYLLYLKQED 243
>gi|78043160|ref|YP_360803.1| hemolysin A [Carboxydothermus hydrogenoformans Z-2901] >gi|77995275|gb|ABB14174.1| hemolysin A [Carboxydothermus hydrogenoformans Z-2901] (266 aa)
Score = 426, Expect = 2.9e-40, Identities = 98/244 (40%), Positives = 146/244 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           K RLD+ +V +   +SR  A+ LI   +V++  Q ++K  T+V E   + IL +  KYVSR  YKL+ A+E F I+L  KI IDIG+STGGFT   L+     VY++DVG  QL+ +L+++ +V+  E+TN R      + +K  F T DVSFIS+ L+  KIKE+     +++ L+KPQFE G++    KG  +    H++++ N +E+   L  + LG   SPI G +  N EYL YL   N K
  S:     2 KKRLDVLMVEKGLVQSREKARALIMAGEVLVGEQKVTKPGTMVTEDSPIRILGQGLKYVSRGGYKLEKALEEFKINLQGKIVIDIGASTGGFTDCALQYGANTVYAVDVGYGQLSLKLRQDPRVVVFERTNIRYFSVDNLPEKPGFATCDVSFISLKLVLPKIKEILAPRGEAVVLIKPQFEAGREKVGKKGVVRDPATHREVLKNLLEYAEGLGFQPLGLTYSPITGLEG-NIEYLLYLSTDNTK 246
>gi|150390272|ref|YP_001320321.1| hemolysin A [Alkaliphilus metalliredigens QYMF] >gi|149950134|gb|ABR48662.1| hemolysin A [Alkaliphilus metalliredigens QYMF] (267 aa)
Score = 422, Expect = 8.4e-40, Identities = 99/244 (40%), Positives = 153/244 (62%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +K+R+D+ LV E Y  SR  A+  I    V+++ Q+I K  T V+E   ++I      YVSR   KL+ A+E F ++L NK+ +DIG+STGGFT  +L+   KKVY+IDVG  QL+ +L+++ +VIS+E+TN R +  + I ++ DF ++DVSFIS+ L+   IK L  +N + IAL+KPQFE G++    KG  +  + H++++    +F     +   G   SPIKG +  N EYL YL+  +E
  S:     3 KKVRIDLRLVEEGYFDSRERAKSSIMAGVVLVDQQVIDKPGTKVDEDLPIKIKGNPIPYVSRGGLKLQKAMEEFQLNLQNKVCMDIGASTGGFTDCMLQKGAKKVYAIDVGYGQLDWKLRQDERVISMERTNIRYVTPTDITEEPDFASVDVSFISLRLVLPVIKNLLCSNGEIIALIKPQFEAGREKVGKKGVVRDIQVHEEVVKEIYDFAKEHELYTHGLSYSPIKGPEG-NIEYLIYLKTNSE 247
>gi|160938272|ref|ZP_02085627.1| hypothetical protein CLOBOL_03168 [Clostridium bolteae ATCC BAA-613] >gi|158438645|gb|EDP16402.1| hypothetical protein CLOBOL_03168 [Clostridium bolteae ATCC BAA-613] (310 aa)
Score = 408, Expect = 3.7e-38, Identities = 94/241 (39%), Positives = 146/241 (60%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M+K RLD+ +V  N A SR  A+ LI +  V +NGQ   K+ T   E  ++E+     KYVSR   KL+ A+  F + L  K+ +D+G+STGGFT  +L+N   KVY++DVG  QL  +L+ +++VI +E+TN R +    I D+I+F +IDVSFIS+  +   +K+L  +  + + L+KPQFE G++    KG  + +  H ++I   +++   +    LG   SPIKG +  N EYL YL+
  S:     1 MKKERLDVLMVQRNLAESREKAKALIMSGIVYVNGQKEDKAGTSFEETVQIEVRGNTLKYVSRGGLKLEKAMSRFGVQLAGKVCMDVGASTGGFTDCMLQNGAVKVYAVDVGHGQLAWKLRNDDRVICMEKTNIRYVTPEDIGDRIEFASIDVSFISLTKVLGPVKQLLTDEGQVVCLIKPQFEAGREKVGKKGVVREKSVHLEVIEMVMDYARSIGFGILGLEFSPIKGPEG-NIEYLLYLQ 242
>gi|188996824|ref|YP_001931075.1| hemolysin A [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931891|gb|ACD66521.1| hemolysin A [Sulfurihydrogenibium sp. YO3AOP1] (268 aa)
Score = 406, Expect = 5.2e-38, Identities = 110/245 (44%), Positives = 151/245 (61%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +QK R+D  LV++    SR  AQ LI +  V +N Q I K  T V     + I E+  YVSR  +KL+  ++ FN+D+ +KI +DIGSSTGGFT  LL+N  KKVY++DVG NQL+E+L+ +++VIS+E+ N R +  + I +KID +  DVSFISI  I   I  L   ++K I L+KPQFEL KK          E H K I + IE L  S   IK+L +  SPIKG +  N E+L  +E K+E
  S:     3 VQKERIDKLLVDKGLVESREKAQALIMSGVVFVNNQKIDKPGTKVPTDANIYIKEKMPYVSRGGFKLEKGLKIFNLDVKDKICLDIGSSTGGFTDCLLQNGAKKVYAVDVGKNQLHEKLRADSRVISIEEFNARYLTENEIPEKIDILVCDVSFISITKILPNICNLLKEDFKGIILIKPQFELSKKEVKDGVVRDKELHFKAIKSVIESLKQSCYCIKDLDF--SPIKGPEG-NIEFLALIERKSE 246
>gi|116058234|emb|CAL53423.1| hemolysin A, putative (ISS) [Ostreococcus tauri] (290 aa)
Score = 405, Expect = 7.6e-38, Identities = 88/239 (36%), Positives = 142/239 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD   V      SR VAQ  I   KV+++GQ ++K+ T      K+E++ E+ KYV RA  KL+ A+E+F +D++   A+D G STGGFT  LL+   +KVY +DVG  Q+ E+++++ +V+ +E+TN R +  + + D +D +T+D+SFIS+  +   I ++       + L+KPQFE  +    +KG  +    H ++I N IE         + +  SPIKGAK+ NTE+L + +
  S:    31 KTRLDELTVMTRPELSRNVAQSWIAQGKVLVDGQPVTKAGTKFKPSVKIEVIAEQPKYVCRAGLKLEKALEYFGVDVSGLTALDSGLSTGGFTDCLLQGGARKVYGVDVGYGQVAEKIRQDERVVIMERTNLRYV--TQLPDVVDIVTLDLSFISVLKVLPAICKILKPGGTMLVLIKPQFEARRSQIGSKGVVRDASVHAEVIQNVIEGAKTFGFDYVAHTTSPIKGAKEGNTEFLAHFK 269
>gi|160880642|ref|YP_001559610.1| hemolysin A [Clostridium phytofermentans ISDg] >gi|160429308|gb|ABX42871.1| hemolysin A [Clostridium phytofermentans ISDg] (266 aa)
Score = 401, Expect = 2.2e-37, Identities = 89/238 (37%), Positives = 146/238 (61%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ LV  N A SR  A+ +I +  V ++GQ   K+ ++      +E+     KYVSR  YKL+ AIE   + L  K+ +D+GSSTGGFT  +L+N   KV+++DVGTNQL  +L+++ +VIS+E+TN R +    IK+++DF++IDV+FIS+  +   +  L  +  + + L+KPQFE G+ K+G      + + H+++I   + + + L    +    SPI+G +  N EYL ++
  S:     2 KERLDVLLVARNLAESREKAKAIIMSGNVYVDGQKEDKAGSMFKPEVSIEVKGTAMKYVSRGGYKLEKAIEEHQLSLEGKVCMDVGSSTGGFTDCMLQNGATKVFAVDVGTNQLAWKLRQDERVISMEKTNIRHVTPEDIKEQVDFVSIDVAFISLTKVLEPVHALMKDGAEIVCLIKPQFEAGREKVGKKGVVREPKVHEEVIEMVMNYANTLGFVLIHLDYSPIRGPEG-NIEYLLHM 240
>gi|168333591|ref|ZP_02691856.1| hemolysin A [Epulopiscium sp. 'N.t. morphotype B'] (268 aa)
Score = 397, Expect = 5.9e-37, Identities = 102/244 (41%), Positives = 145/244 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL--EYKNEK 246
           K RLD+ +     A SR  AQ  I    V ++GQ   K    V    ++E+ ++ KYVSR  +KL+ AI+ FNI L  KI +D+GSSTGGFT  +L+    KVY++DVG  QL   L++N KVISLE+TN R +    I ++I+F +IDVSFIS+  I    K L   + + +AL+KPQFE G++     G  K    H+++I N   +++ +    +G   SPIKG +  N EYL YL  EYK +K
  S:     5 KERLDVLITKRALADSREKAQAYIMAGVVYVDGQKEDKVGLKVKVSAEIEVRQKMKYVSRGGFKLEKAIQKFNISLAGKICMDVGSSTGGFTDCMLQEGAAKVYAVDVGYGQLAWTLRQNPKVISLEKTNMRYVTQEEISEQINFSSIDVSFISLTKILQPTKNLLAKDGEIVALIKPQFEAGREEVKKHGVVKDPIVHQRVIENIWNYVTEIGFSVVGLDFSPIKGPEG-NREYLIYLSNEYKVDK 250
>gi|121534494|ref|ZP_01666317.1| hemolysin A [Thermosinus carboxydivorans Nor1] >gi|121306987|gb|EAX47906.1| hemolysin A [Thermosinus carboxydivorans Nor1] (268 aa)
Score = 397, Expect = 7.1e-37, Identities = 92/240 (38%), Positives = 140/240 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNEL-DKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD+ LV    A SR  A+  I    V ++GQ + K+  +V  + D V   +   YVSR   KL+ A+  F IDL  K   DIG+STGGFT   L++    VY+IDVG  QL   L+ +++VI++E+TN R++ ++ +   +DF+ IDVSFIS++ +    KEL   + + +AL+KPQFE G++    KG  +  + H ++I+  + F     +  +G   SPIKG +  N EYL +L
  S:     1 MPKERLDVLLVKRGLASSRERAKAWIMAGLVRVDGQRVDKAGAMVPLMADIVVTGDNIGYVSRGGLKLEKALRTFGIDLTGKTVADIGASTGGFTDCALKHGAVCVYAIDVGYGQLAWSLRNDDRVINMERTNIRQVTAADLGSPVDFVAIDVSFISLSKVLPVAKELLLPDGQIVALIKPQFEAGREKVGKKGVVRDPQTHMEVISAVVRFAETQGLNPVGLTFSPIKGPEG-NIEYLLHL 241
>gi|170754365|ref|YP_001781431.1| hemolysin A [Clostridium botulinum B1 str. Okra] >gi|169119577|gb|ACA43413.1| hemolysin A [Clostridium botulinum B1 str. Okra] (273 aa)
Score = 394, Expect = 1.3e-36, Identities = 95/239 (39%), Positives = 149/239 (62%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD+ LV +   +SR  A+  I   ++ I+G  I K    + E   +E   E+  YVSR   KL+ +I++F IDLN K+ +DIG+STGGFT  +L+N  KKV+SIDVG  Q   +L+ + +V+ +E+TN R + S  + +K +F +IDVSFIS+ L+   +K+L   N + +AL+KPQFE G+ K+G      ++  HK+++N  ++F   +++  L    SPIKG +  N EYL Y+
  S:     4 KKERLDLLLVEKGIFQSRERAKASIMAGEIFIDGNRIDKCGEKIKESANIEFRGEKLPYVSRGGLKLEKSIKNFGIDLNEKVCLDIGASTGGFTDCMLQNGAKKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTSEELGEKANFASIDVSFISLTLVIPVVKDLLDENGEIMALIKPQFEAGREKVGKKGVVRESSTHKEVVNKIVQFAEKIDLNILNLDFSPIKGPEG-NIEYLIYM 243
>gi|168184566|ref|ZP_02619230.1| hemolysin A [Clostridium botulinum Bf] >gi|182672367|gb|EDT84328.1| hemolysin A [Clostridium botulinum Bf] (273 aa)
Score = 394, Expect = 1.6e-36, Identities = 95/239 (39%), Positives = 149/239 (62%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD+ LV +   +SR  A+  I   ++ I+G  I K    + E   +E   E+  YVSR   KL+ +I++F IDLN K+ +DIG+STGGFT  +L+N  KKV+SIDVG  Q   +L+ + +V+ +E+TN R + S  + +K +F +IDVSFIS+ L+   +K+L   N + +AL+KPQFE G+ K+G      ++  HK+++N  ++F   +++  L    SPIKG +  N EYL Y+
  S:     4 KKERLDLLLVEKGIFQSRERAKASIMAGEIFIDGNRIDKCGEKIKESANIEFRGEKLPYVSRGGLKLEKSIKNFGIDLNEKVCLDIGASTGGFTDCMLQNGAKKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTSEDLGEKANFASIDVSFISLTLVIPVVKDLLDENGEIMALIKPQFEAGREKVGKKGVVRESSTHKEVVNKIVQFAEKIDLNILNLDFSPIKGPEG-NIEYLIYM 243
>gi|160934290|ref|ZP_02081677.1| hypothetical protein CLOLEP_03161 [Clostridium leptum DSM 753] >gi|156866963|gb|EDO60335.1| hypothetical protein CLOLEP_03161 [Clostridium leptum DSM 753] (270 aa)
Score = 393, Expect = 1.8e-36, Identities = 96/240 (40%), Positives = 138/240 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +K RLD  LV+   A SR  A+ LI   +V +  Q   K  T   E  ++E+      YVSR   KL+ A+  F I L +K A+DIG+STGGFT  +L+N  KKVY++DVG  QL  +L+ + +VI+LE+TN R      I D IDFI++DVSFIS+ L+    K    +  +++ L+KPQFE G++    KG  +  D H ++I +    +       LG   SP+KG +  N EYL YL+
  S:     3 EKKRLDQLLVDRGLAPSREKAKALIMAGQVYVQNQKSDKPGTSYTEAVEIEVRGSGLAYVSRGGLKLEKAMRVFPIRLQDKTAMDIGASTGGFTDCMLQNGAKKVYAVDVGYGQLAWKLRTDPRVINLERTNIRYATKEQIPDPIDFISVDVSFISLKLVLPVAKLFMRDGAQAVCLIKPQFEAGREKVGKKGVVRDPDVHVEVIKSVCAMIRENGFSLLGLDYSPVKGPEG-NIEYLAYLQ 243
>gi|153938144|ref|YP_001391202.1| hemolysin A [Clostridium botulinum F str. Langeland] >gi|152934040|gb|ABS39538.1| hemolysin A [Clostridium botulinum F str. Langeland] (273 aa)
Score = 393, Expect = 1.9e-36, Identities = 95/239 (39%), Positives = 149/239 (62%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD+ LV +   +SR  A+  I   ++ I+G  I K    + E   +E   E+  YVSR   KL+ +I++F IDLN K+ +DIG+STGGFT  +L+N  KKV+SIDVG  Q   +L+ + +V+ +E+TN R + S  + +K +F +IDVSFIS+ L+   +K+L   N + +AL+KPQFE G+ K+G      ++  HK+++N  ++F   +++  L    SPIKG +  N EYL Y+
  S:     4 KKERLDLLLVEKGIFQSRERAKASIMAGEIFIDGNRIDKCGEKIKESANIEFRGEKLPYVSRGGLKLEKSIKNFGIDLNEKVCLDIGASTGGFTDCMLQNGAKKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTSEELGEKANFASIDVSFISLTLVIPVVKDLLDENGEIMALIKPQFEAGREKVGKKGVVRESSTHKEVVNKIVQFAEKIDLNILNLDFSPIKGPEG-NIEYLIYM 243
>gi|160893235|ref|ZP_02074023.1| hypothetical protein CLOL250_00781 [Clostridium sp. L2-50] >gi|156865318|gb|EDO58749.1| hypothetical protein CLOL250_00781 [Clostridium sp. L2-50] (264 aa)
Score = 393, Expect = 2.1e-36, Identities = 91/244 (37%), Positives = 146/244 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           K RLD+ +VN   A SR  A+ +I +  V ++     K+ +  +E  ++E+     KYVSR   KL+ A++ F + L  K+A+D+GSSTGGFT  +L+N   KVYS+DVG  QL  +L+ + +V+ +E+TN R +    I+D+I+F +IDVSFIS+  +   +KEL  ++ + + L+KPQFE G++    KG  + +  H +++   ++F   +  K L    SPIKG +  N EYL Y+     K
  S:     2 KERLDVMMVNRGLAESREKAKAIIMSGIVYVDNIKEDKAGSTFDEKAQIEVRGNTLKYVSRGGLKLEKAMDCFGVSLAGKVAMDVGSSTGGFTDCMLQNGAVKVYSVDVGHGQLAWKLRNDERVVCMEKTNIRYVTPDDIEDRIEFASIDVSFISLTKVLPPVKELLTDDGEIVCLIKPQFEAGREKVGKKGVVRDQKVHVEVVEMIVDFARQIGFKTLDLSYSPIKGPEG-NIEYLLYITKDQTK 246
>gi|167770733|ref|ZP_02442786.1| hypothetical protein ANACOL_02079 [Anaerotruncus colihominis DSM 17241] >gi|167667328|gb|EDS11458.1| hypothetical protein ANACOL_02079 [Anaerotruncus colihominis DSM 17241] (270 aa)
Score = 392, Expect = 2.3e-36, Identities = 92/239 (38%), Positives = 140/239 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLDI L  + +  SR  A+ +I   +V INGQ   K    V E   +E+  +  +YVSR   KL+ A++ + I L ++I +DIG+STGGFT  +L+N   KVY++DVG  QL  +L+ + +V++LE+TN R I    + D+IDFI+IDVSFIS+ L+     +L     K++ L+KPQFE G++    KG  +    H +++   + +         G   SP+KG +  N EYL YL+
  S:     6 KKRLDILLTEKEFFPSREKAKAVIMAGQVYINGQKADKPGMDVAEDADIEVRGDTLRYVSRGGLKLEKAMQVWPIVLQDQICMDIGASTGGFTDCMLQNGAAKVYAVDVGYGQLAWKLRNDPRVVNLERTNIRNITREQLPDRIDFISIDVSFISLRLVLPVAAQLLCTGGKAVCLVKPQFEAGREKVGKKGVVRDRATHAEVLVRAVGYALENGFTVHGLDFSPVKGPEG-NIEYLMYLQ 245
>gi|170758649|ref|YP_001787208.1| hemolysin A [Clostridium botulinum A3 str. Loch Maree] >gi|169405638|gb|ACA54049.1| hemolysin A [Clostridium botulinum A3 str. Loch Maree] (273 aa)
Score = 392, Expect = 2.4e-36, Identities = 95/239 (39%), Positives = 149/239 (62%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD+ LV +   +SR  A+  I   ++ I+G  I K    + E   +E   E+  YVSR   KL+ +I++F IDLN K+ +DIG+STGGFT  +L+N  KKV+SIDVG  Q   +L+ + +V+ +E+TN R + S  + +K +F +IDVSFIS+ L+   +K+L   N + +AL+KPQFE G+ K+G      ++  HK+++N  ++F   +++  L    SPIKG +  N EYL Y+
  S:     4 KKERLDLLLVEKGIFQSRERAKASIMAGEIFIDGNRIDKCGEKIKESANIEFRGEKLPYVSRGGLKLEKSIKNFGIDLNEKVCLDIGASTGGFTDCMLQNGAKKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTSEELGEKANFASIDVSFISLTLVIPVVKDLLDENGEIMALIKPQFEAGREKVGKKGVVRESSTHKEVVNKIVQFAEKIDLNILNLDFSPIKGPEG-NIEYLIYM 243
>gi|188589502|ref|YP_001921546.1| hemolysin A [Clostridium botulinum E3 str. Alaska E43] >gi|188499783|gb|ACD52919.1| hemolysin A [Clostridium botulinum E3 str. Alaska E43] (269 aa)
Score = 392, Expect = 2.6e-36, Identities = 98/245 (40%), Positives = 145/245 (59%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K RLDI LV +    SR  A+  I   KV ++GQ + K+   V+ +  +E    + KYVSR   KL+ A++ ++I L +K+ +DIG+STGGFT  +L+N  KKVYS+DVG  Q   +L+ + +V+ +E+TN R +    I + +DF +IDVSFIS+  I      L  +  + +AL+KPQFE G+ K+G      +   HK+++   IEFL    +  LG   SPIKG +  N EYL Y    NEK
  S:     4 KKERLDILLVEKGIITSRDKAKACIMEGKVFVDGQRVDKAGEKVSVIANIEYKGAKLKYVSRGGLKLEKAMKSYDISLEDKVCMDIGASTGGFTDCMLQNGAKKVYSVDVGYGQFAWKLRTDERVVCMERTNIRYVTLEDIGEPLDFASIDVSFISLKKIMPATLGLLKDTGEVVALIKPQFEAGREKVGKKGVVREISTHKEVVYGIIEFLKNEKLNILGVGYSPIKGPEG-NREYLVYFTKDNEK 249
>gi|167746997|ref|ZP_02419124.1| hypothetical protein ANACAC_01709 [Anaerostipes caccae DSM 14662] >gi|167653957|gb|EDR98086.1| hypothetical protein ANACAC_01709 [Anaerostipes caccae DSM 14662] (271 aa)
Score = 391, Expect = 3.3e-36, Identities = 95/244 (38%), Positives = 145/244 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           K RLD+ LV +  A SR  A+ +I +  V ++GQ   K+ T+V E   +EI  +  KYVSR   KL+ A++ FNI L +++ +D+G+STGGFT  +L N  KKVYS+DVG  QL+  L+ + +V+ +E+TN R +    I++   F++IDVSFIS+  I   +  +  N  +  AL+KPQFE G++    KG  +    H ++I    +F S    + L    SPIKG +  N EYL +++   EK
  S:     2 KERLDVLLVKKGLAASREKAKAIIMSGVVFVDGQREDKAGTMVKEELPIEIKGKTLKYVSRGGLKLEKAMKQFNIQLTDRVCMDVGASTGGFTHCMLLNGAKKVYSVDVGHGQLDWGLRNDERVVCMERTNMRYVTPEDIEEPAGFVSIDVSFISLTKILPAVYGILENGGEVTALIKPQFEAGREKVGKKGVVRDPAVHGEVIEKITDFASSNGFELLHLDYSPIKGPEG-NIEYLLHMKKTEEK 246
>gi|28211240|ref|NP_782184.1| hemolysin [Clostridium tetani E88] >gi|28203680|gb|AAO36121.1| hemolysin [Clostridium tetani E88] (272 aa)
Score = 390, Expect = 3.9e-36, Identities = 101/245 (41%), Positives = 150/245 (61%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K+RLD+ LV +    SR  A+  I   ++ ++G    K    +N   K+E   +   YVSR  YKL+ AI+ FN+DL +K+ +DIG+STGGFT  +L+N+ KKVYSIDVG  QL  +L+ N KV+ +E+TNFR I+   I +  DF +IDVSFIS+  I      +  +  + +AL+KPQFE G++    KG  + +  H ++I   ++F   L++K  G   SPIKG +  N EYL Y+  K+EK
  S:     4 KKLRLDLLLVEKEIFTSRERARSSIMAGEIFVDGIRKDKCGEKINVDAKIEFKGDTMPYVSRGGYKLEKAIKDFNVDLKDKVCLDIGASTGGFTDCMLQNHAKKVYSIDVGYGQLAWKLRTNPKVVCMERTNFRHIKFEHIGEYADFASIDVSFISLEKIIPAAINILNDKGEIVALIKPQFEAGREKVGKKGVVREKSTHIEVIEKIVDFAKTLDLKIKGINYSPIKGPEG-NIEYLLYIT-KDEK 248
>gi|148379841|ref|YP_001254382.1| hemolysin A [Clostridium botulinum A str. ATCC 3502] >gi|153933292|ref|YP_001384139.1| hemolysin A [Clostridium botulinum A str. ATCC 19397] >gi|153936268|ref|YP_001387679.1| hemolysin A [Clostridium botulinum A str. Hall] >gi|168180468|ref|ZP_02615132.1| hemolysin A [Clostridium botulinum NCTC 2916] >gi|148289325|emb|CAL83421.1| putative methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152929336|gb|ABS34836.1| hemolysin A [Clostridium botulinum A str. ATCC 19397] >gi|152932182|gb|ABS37681.1| hemolysin A [Clostridium botulinum A str. Hall] >gi|182668775|gb|EDT80753.1| hemolysin A [Clostridium botulinum NCTC 2916] (273 aa)
Score = 390, Expect = 4.1e-36, Identities = 94/239 (39%), Positives = 149/239 (62%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD+ LV +   +SR  A+  I   ++ I+G  I K    + E   +E   E+  YVSR   KL+ +I++F IDLN K+ +DIG+STGGFT  +L+N  KKV+SIDVG  Q   +L+ + +V+ +E+TN R + S  + +K +F +IDVSFIS+ L+   +K+L   + + +AL+KPQFE G+ K+G      ++  HK+++N  ++F   +++  L    SPIKG +  N EYL Y+
  S:     4 KKERLDLLLVEKGIFQSRERAKASIMAGEIFIDGNRIDKCGEKIKESANIEFRGEKLPYVSRGGLKLEKSIKNFGIDLNEKVCLDIGASTGGFTDCMLQNGAKKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTSEELGEKANFASIDVSFISLTLVIPVVKDLLDEDGEIMALIKPQFEAGREKVGKKGVVRESSTHKEVVNKIVQFAEKIDLNILNLDFSPIKGPEG-NIEYLIYM 243
>gi|134298943|ref|YP_001112439.1| hemolysin A [Desulfotomaculum reducens MI-1] >gi|134051643|gb|ABO49614.1| hemolysin A [Desulfotomaculum reducens MI-1] (268 aa)
Score = 390, Expect = 4.4e-36, Identities = 87/240 (36%), Positives = 142/240 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           + K RLD+YLVN  +  SR  A+  +    V ++G+ + K    V     +++  +   +VSR   KL+ A++ F+IDL +++ IDIG+STGGFT   L+N  + VY++DVG  QL  +L+ + +VIS+E+TN R +E   + ++  F T+DVSFIS+ L+  ++  L     + IAL+KPQFE G++    KG  +  E H ++I   +  +  L  + +G   SP++G +  N EYL Y 
  S:     3 VTKERLDVYLVNNGFFPSREKARAAVMAGLVFVDGERVDKPGHQVKAEVSIQVQGKTLPFVSRGGLKLEKAMKEFDIDLKDRVVIDIGASTGGFTDCALQNGARLVYAVDVGYGQLAWKLRSDPRVISMERTNIRYLEPEALTERPSFATVDVSFISLALVLPRVDLLTELVAEGIALIKPQFEAGRERVGKKGVVRDPEVHIEVIEKVLGVVHNLGWQAVGLAFSPVRGPEG-NIEYLLYF 243
>gi|187933335|ref|YP_001886589.1| hemolysin A [Clostridium botulinum B str. Eklund 17B] >gi|187721488|gb|ACD22709.1| hemolysin A [Clostridium botulinum B str. Eklund 17B] (269 aa)
Score = 389, Expect = 5.0e-36, Identities = 97/245 (39%), Positives = 145/245 (59%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K RLDI LV +    SR  A+  I   KV ++GQ + K+   V+ +  +E    + KYVSR   KL+ A++ ++I L +K+ +DIG+STGGFT  +L+N  +KVYS+DVG  Q   +L+ + +V+ +E+TN R +    I + +DF +IDVSFIS+  I      L  +  + +AL+KPQFE G+ K+G      +   HK+++   IEFL   N+  LG   SPIKG +  N EYL Y     EK
  S:     4 KKERLDILLVEKGIITSRDRAKACIMEGKVFVDGQRVDKAGEKVSIIANIEYKGAKLKYVSRGGLKLEKAMKSYDISLEDKVCMDIGASTGGFTDCMLQNGAQKVYSVDVGYGQFAWKLRTDERVVCMERTNIRYVTLEDIGEPLDFASIDVSFISLKKIMPATLGLLKDTGEVVALIKPQFEAGREKVGKKGVVREISTHKEVVYGIIEFLKNENLNILGVGYSPIKGPEG-NREYLVYFTKDAEK 249
>gi|89211746|ref|ZP_01190092.1| Hemolysin A [Halothermothrix orenii H 168] >gi|89158657|gb|EAR78359.1| Hemolysin A [Halothermothrix orenii H 168] (272 aa)
Score = 388, Expect = 7.2e-36, Identities = 95/240 (39%), Positives = 147/240 (61%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +K RLDI L ++ +  +R  A+  I    V++NGQ+ +K+ T V+E  K+ +  +  YVSR   KL+ A+ +F+I+++ K AIDIG+STGGFT  LL++  +KVY+IDVG  QL  +L+++N+V  LE+TNFR +    +  K+  I  DVSFIS+ LI     +    N   I L+KPQFE G  ++G      + + H++++    +F     L+I NL Y  SPI GA  +N E+L  L+
  S:     3 RKKRLDILLTDKGFFETRSRAKRAIMAGDVLVNGQLETKAGTRVSEDVKIRVKNKIPYVSRGGLKLEKALNNFDINVDGKEAIDIGASTGGFTDCLLQHGARKVYAIDVGYGQLAWKLRQDNRVEVLERTNFRYLTPEDLPVKVPIIVSDVSFISLRLIIPPALKFLTENGDIICLIKPQFEAGPDRVGKNGVVKEKKVHRQVLKEMFDFFIGQGLSIVNLDY--SPITGASSKNIEFLVQLK 243
>gi|114566130|ref|YP_753284.1| hypothetical protein Swol_0583 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337065|gb|ABI67913.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (270 aa)
Score = 386, Expect = 1.3e-35, Identities = 89/241 (36%), Positives = 143/241 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M +IRLD  L ++  A SR  A+ +I   +V +NGQ++ K  T V+E  ++E+     +YVSR  +KL+ AIE F +D + ++ +DIG+STGG+T   L++   K++++DVG  QL+ +L+ + +VI+LE+ N R      + + +D IT+DVSFIS  L+F  IKE+   +   ++L+KPQFE G+ K+G          H++++ N I      N+       SPI G K  N EY   L+
  S:     1 MARIRLDSLLYDKALAPSREKARAMILAGEVRVNGQMVDKPGTTVDEEARIELKSHLSRYVSRGGFKLEKAIEDFRLDFSQRVVLDIGASTGGYTDCALQHGAIKIFALDVGYGQLDWKLRNDPRVINLERRNIRYFSREELGEAVDIITMDVSFISTTLLFPVIKEMLKEDGVIVSLIKPQFEAGRGKVGKHGVVRDPVVHREVLLNCINSAQQENLYCTAVSFSPITGPKG-NIEYFIQLK 242
>gi|55980515|ref|YP_143812.1| hemolysin [Thermus thermophilus HB8] >gi|55771928|dbj|BAD70369.1| hemolysin [Thermus thermophilus HB8] (235 aa)
Score = 385, Expect = 1.4e-35, Identities = 94/237 (39%), Positives = 144/237 (60%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +RLD YLV      SR  A+ LI   KV + G+++ K    V E  +VE+L EE+YV R AYKL  A+E F ++   K+A D+G+STGGFTQVLLE   ++VY++DVG  QL+ +L+++ +V++LE+ + R +   ++ + +D + +DVSFIS  L+  K+ EL     +++ L+KPQFELG K    KG  + E   ++ +    E    L  + LG   SP+ G K+ N EY  +L
  S:     1 MRLDRYLVERGLVESREKAKRLIQEGKVRVEGKVVQKPAHPVPEGARVELLAEERYVGRGAYKLLGALEAFPVEPRGKVAADLGASTGGFTQVLLERGARRVYAVDVGKGQLHPRLREDPRVVALEEQDARTL---VLPEPVDLVVMDVSFISSTLLLPKVLELLKPQGEALVLVKPQFELGPK--AHKGVVREEAKRREALRRVREKALELGFQVLGEKESPLPG-KEGNLEYWLWL 232
>gi|46198486|ref|YP_004153.1| hemolysin [Thermus thermophilus HB27] >gi|46196108|gb|AAS80526.1| hemolysin [Thermus thermophilus HB27] (235 aa)
Score = 385, Expect = 1.4e-35, Identities = 95/237 (40%), Positives = 144/237 (60%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +RLD YLV      SR  A+ LI   KV + G+++ K    V E   VE+L EE+YV R AYKL  A+E F ++   K+A D+G+STGGFTQVLLE  V++VY++DVG  QL+ +L+++ +V++LE+ + R +   ++ + +D + +DVSFIS  L+  K+ EL     +++ L+KPQFELG K    KG  + E   ++ +    E    L  + LG   SP+ G K+ N EY  +L
  S:     1 MRLDRYLVERGLVESREKAKRLIQEGKVRVGGKVVQKPAHPVPEGAAVELLAEERYVGRGAYKLLGALEAFPVEPRGKVAADLGASTGGFTQVLLERGVRRVYAVDVGKGQLHPRLREDPRVVALEEEDARTL---VLPEPVDLVVMDVSFISSTLLLPKVLELLKPQGEALILVKPQFELGPK--AHKGVVREEAKRREALRRVRERALELGFQVLGEKESPLPG-KEGNLEYWLWL 232
>gi|195952821|ref|YP_002121111.1| hemolysin A [Hydrogenobaculum sp. Y04AAS1] >gi|195932433|gb|ACG57133.1| hemolysin A [Hydrogenobaculum sp. Y04AAS1] (246 aa)
Score = 385, Expect = 1.4e-35, Identities = 102/242 (42%), Positives = 145/242 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDF--ITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           K RLD+ LV +    SR  AQ  I   +V +NG+ + K+ TLV E D +E+L EEK+VSRA YKL+ AI+ F++D++ KI +DIGSSTGGFT  LL+   K VY++DVG  Q++E+L+K+ +V+  E T+ R  +     D IDF  +T+DVSFIS+  I   IK L     K + L+KPQFEL  K    KG  K +  K + + + I     +  + L Y  +  KG K  N E+  Y   K+
  S:     2 KKRLDLLLVEKGLVSSREKAQAFIMEGRVFVNGKAVLKAGTLVQEEDGIELLGEEKFVSRAGYKLENAIKEFDVDVSEKICLDIGSSTGGFTDCLLQYGAKLVYAVDVGHLQMHEKLRKDPRVMLFEDTDIRVFKKP---DDIDFDIVTVDVSFISLKKIGEYIKNLCSYYTKLLMLVKPQFELSPKY-LKKGIVKDDSAKMLALESVISHFESIGFELLAYTKARPKGTKG-NEEFFTYFILKD 241
>gi|167758092|ref|ZP_02430219.1| hypothetical protein CLOSCI_00430 [Clostridium scindens ATCC 35704] >gi|167663989|gb|EDS08119.1| hypothetical protein CLOSCI_00430 [Clostridium scindens ATCC 35704] (269 aa)
Score = 385, Expect = 1.5e-35, Identities = 90/239 (37%), Positives = 142/239 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLDI LV  N A SR  A+ +I +  V ++GQ   K+     E   +E+      YVSR   KL+ A+ +F++ ++ K+  D+GSSTGGFT  +L+N  +KVY+IDVG  QL+ +L+++ +V+ +E+TN R +    I + +DF +IDVSFIS+  +   I     +  + +AL+KPQFE G++    KG  + +  H ++I+  I++   +    L    SPIKG +  N EYL +LE
  S:     2 KERLDILLVKRNLAASREKAKAIIMSGSVFVDGQREDKAGATFPEKAAIEVRGHTLPYVSRGGLKLEKALRNFDVTVDGKVCTDVGSSTGGFTDCMLQNGARKVYAIDVGRGQLDWKLRQDERVVCMEKTNIRYVTPEDIGEPVDFSSIDVSFISLTKVLLPIHNYLKDKGQIVALIKPQFEAGREKVGKKGVVRDKRTHMEVISMVIQYALSIGFSILNLEFSPIKGPEG-NIEYLIHLE 241
>gi|21311777|gb|AAM46848.1|AF498259_1 surface antigen LsaA [Lawsonia intracellularis] (233 aa)
Score = 384, Expect = 1.9e-35, Identities = 95/229 (41%), Positives = 143/229 (62%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           YL+ +NY+     A+ LI + +V IN +++   + L+ + DK+ I +++++VSR AYKL AAIE F +D  NK+ +DIG+STGGF+QV L    K VY++DVG NQL+ +L++N+K+ SLEQTN + I   + + +ID +  DVSFIS+  ++  ++ +   N   I LLKPQFE   K     GF   + H  +I+  I   S  N K +  I SPIKG K +N EY+
  S:     8 YLIEKNYSN----AEILIRSGQVKINNEVVFTPSFLIKDSDKILIEQKKEFVSRGAYKLLAAIEAFKLDFENKVILDIGASTGGFSQVSLNYGAKLVYALDVGNNQLDYKLRQNSKIKSLEQTNLKSISKQMFEVEIDKVVCDVSFISLKEVYKVVEHILKTNDDWIVLLKPQFEASSKYVEKGGFVLEQFHPFLIDRSISQASEHNFKFIDKITSPIKGQKSKNAEYI 232
>gi|160947157|ref|ZP_02094324.1| hypothetical protein PEPMIC_01089 [Peptostreptococcus micros ATCC 33270] >gi|158446291|gb|EDP23286.1| hypothetical protein PEPMIC_01089 [Peptostreptococcus micros ATCC 33270] (244 aa)
Score = 384, Expect = 2.1e-35, Identities = 100/225 (44%), Positives = 144/225 (64%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNE--LDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKN----LGYIVSPIKGA 229
           R DI LVN   A+SR  A+ +IT  +    G+II K + ++ +  L  V+   E+ YV R A KL +AI++F +DL N I +DIG+STGGFTQ++L  N KKVY+IDVGT+QL + L  +++V+SLE  NFR ++  +I +K+DFI+IDVSFIS+  IF  + +    +   +AL+KPQFE   K    KG  K+E   K+I N IE + +  + N    +  I SPI G 
  S:     3 RADICLVNLGLAKSRTHAKRIITEKRAFYYGKIIEKVSMMIEKPGLVIVKATFEDSYVGRGAIKLDSAIKNFKLDLENLICMDIGASTGGFTQIMLNANAKKVYAIDVGTDQLAKSLLADDRVVSLENINFRYLDFEVIGEKLDFISIDVSFISLKYIFENLYKFLKEDSMIVALIKPQFECEGKSLNKKGIVKSE---KVIENVIEKVRLYALGNKLEIISIIDSPILGG 230
>gi|15644324|ref|NP_229376.1| hemolysin [Thermotoga maritima MSB8] >gi|148270346|ref|YP_001244806.1| hemolysin A [Thermotoga petrophila RKU-1] >gi|170289028|ref|YP_001739266.1| hemolysin A [Thermotoga sp. RQ2] >gi|4982145|gb|AAD36643.1|AE001802_12 hemolysin [Thermotoga maritima MSB8] >gi|147735890|gb|ABQ47230.1| hemolysin A [Thermotoga petrophila RKU-1] >gi|170176531|gb|ACB09583.1| hemolysin A [Thermotoga sp. RQ2] (267 aa)
Score = 384, Expect = 2.1e-35, Identities = 96/243 (39%), Positives = 144/243 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD  ++      SR  A+ LI   KV++NG+ ++K++ LV E   VE+LEE KYVSR  YKL++A E F ID++ K+A DIG+STGGFT  LL+   KKVY++DVG  QL+ +L+ + +V+ +E+ N R +    + +K+D +T DVSFIS+  I   I  +  N   ++ L+KPQFE  +K    KG  K    H +++    + L        G   S IKG +  N EY F+++ + E
  S:     4 KKRLDQLVLERGLVESREKAKVLILAGKVLVNGERVTKASKLVPEDANVELLEEPKYVSRGGYKLESAFESFKIDVSGKVACDIGASTGGFTDFLLQRGAKKVYAVDVGYGQLHWKLRNDPRVVVMEKVNARYLNPDDLGEKVDVVTCDVSFISLKKIIPAISRILKNIGDAVLLVKPQFEAPRKF-VKKGIVKDPGVHLEVLEEIRKSLIENGFVVKGCCFSKIKGTEG-NIEYFFWVKKEGE 245
>gi|187779515|ref|ZP_02995988.1| hypothetical protein CLOSPO_03111 [Clostridium sporogenes ATCC 15579] >gi|187773140|gb|EDU36942.1| hypothetical protein CLOSPO_03111 [Clostridium sporogenes ATCC 15579] (273 aa)
Score = 383, Expect = 2.6e-35, Identities = 92/239 (38%), Positives = 148/239 (61%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD+ L+ +   +SR  A+  I   ++ I+G  + K    + E   +E   E+  YVSR   KL+ +I++F IDLN K+ +DIG+STGGFT  +L+N  KKV+SIDVG  Q   +L+ + +V+ +E+TN R + S  + +K +F +IDVSFIS+ L+   +K+L     + +AL+KPQFE G+ K+G      ++  HK++++  ++F   L++  L    SPIKG +  N EYL Y+
  S:     4 KKERLDLLLIKKGIFQSRERAKASIMAGEIFIDGNRVDKCGEKIKESANIEFRGEKLPYVSRGGLKLEKSIKNFGIDLNEKVCLDIGASTGGFTDCMLQNGAKKVFSIDVGYGQFAWKLRVDPRVVCMERTNIRYVTSEDLGEKANFASIDVSFISLTLVIPVVKDLLDEKGEIMALIKPQFEAGREKVGKKGVVRESSTHKEVVDKIVQFAKKLDLNILNLDFSPIKGPEG-NIEYLIYM 243
>gi|167037517|ref|YP_001665095.1| hemolysin A [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856351|gb|ABY94759.1| hemolysin A [Thermoanaerobacter pseudethanolicus ATCC 33223] (264 aa)
Score = 381, Expect = 4.5e-35, Identities = 97/238 (40%), Positives = 144/238 (60%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEI-LEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +K RLD+ LV + +  SR  A+  I   +V ++G+ I K+   VN    +EI +    YVSR   KL+ AIE FNI++  KIA+DIG+STGGFT  LL++ V KVY++DVG  QL+  L+ + +VI++E+TN R +E+  + + +D +TIDVSFIS+ L+     +        IAL+KPQFE G++    KG  +    H+++I   +      N   +G   SPIKGA+  N EYL Y
  S:     4 KKERLDVLLVQKGFFSSREKAKASIMAGEVYVDGKKIEKAGEFVNIDSSIEIKINSLPYVSRGGLKLQKAIETFNINVTGKIALDIGASTGGFTDCLLKHGVIKVYAVDVGYGQLDWSLRNDPRVINMEKTNIRFLET--LPETVDMVTIDVSFISLELVIPSADKFLKPEGDLIALIKPQFEAGREKVGKKGVVRDPAVHREVIEKIVTLFQKFNYGIIGITYSPIKGAEG-NIEYLIY 240
>gi|150016581|ref|YP_001308835.1| hemolysin A [Clostridium beijerinckii NCIMB 8052] >gi|149903046|gb|ABR33879.1| hemolysin A [Clostridium beijerinckii NCIMB 8052] (269 aa)
Score = 381, Expect = 5.1e-35, Identities = 96/245 (39%), Positives = 149/245 (60%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL-EYKNEK 246
           +K RLD+ LV +    SR  A+  I   KV ++GQ + K+   V+    +E   E  KYVSR   KL+ A++ ++I L NK+ +DIG+STGGFT  +L+N   KV+S+DVG  Q   +L+ + +V+ +E+TN R +    I + +DF +IDVSFIS+  I      L  ++ + +AL+KPQFE G+ K+G      +   HK+++++ ++FL   N+  LG   SPIKG +  N EYL Y  + KN+K
  S:     4 KKERLDLLLVEKGIINSREKAKACIMEGKVYVDGQKVDKAGEKVSSNANIEYRGETLKYVSRGGLKLEKAMKTYSISLENKVCMDIGASTGGFTDCMLQNGASKVFSVDVGYGQFAWKLRTDERVVCMERTNIRYVTLEDIGEHLDFASIDVSFISLKKIMPATINLLKDDGEVVALIKPQFEAGREKVGKKGVVREISTHKEVVHDIVDFLLQQNLNVLGVSFSPIKGPEG-NREYLVYFTKDKNKK 250
>gi|160945192|ref|ZP_02092418.1| hypothetical protein FAEPRAM212_02711 [Faecalibacterium prausnitzii M21/2] >gi|158442923|gb|EDP19928.1| hypothetical protein FAEPRAM212_02711 [Faecalibacterium prausnitzii M21/2] (267 aa)
Score = 380, Expect = 5.4e-35, Identities = 85/243 (34%), Positives = 142/243 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           KIRLD YLV     +SR  A+ LI    V +N Q + K+  ++ E   VE+   +  YVSR   KL+ A++ F +  N K+ +DIG+STGGFT  +L+N   KVY++DVG  QL   L+ + +V+++E+TN R +    + + I+F ++DVSFIS++ IF   + +   +   + L+KPQFE G+ K+G          H+++++N + + +       G   SP+KG +  N EYL +++  ++
  S:     2 KIRLDQYLVQNGLVQSRERAKALIMAGVVFVNQQKVDKAGEMIKEDAVVEVRGHDIGYVSRGGLKLEKAMKCFPLTPNGKVCMDIGASTGGFTDCMLQNGAVKVYAVDVGYGQLAWSLRTDARVVNMERTNIRYVTPEDLAEPIEFFSVDVSFISLHHIFPVAQRITTPDAMGVCLVKPQFEAGREKVGKNGVVRDPAVHREVLHNAMSYAAENGFLVRGLDYSPVKGPEG-NIEYLMFVQKSDQ 245
>gi|153814706|ref|ZP_01967374.1| hypothetical protein RUMTOR_00921 [Ruminococcus torques ATCC 27756] >gi|145847737|gb|EDK24655.1| hypothetical protein RUMTOR_00921 [Ruminococcus torques ATCC 27756] (272 aa)
Score = 380, Expect = 5.7e-35, Identities = 88/239 (36%), Positives = 142/239 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD+ LV  N A SR  A+ +I +  V + GQ   K+ +   E   +E+      YVSR   KL+ AI +F++ + +K+  D+GSSTGGFT  +L+N  KKV++IDVG  QL+ +L+ + +VI +E+TN R +    + ++IDF +IDVSFIS+  +   I+     + + +AL+KPQFE G++    KG  + +  H+++I   +++   +         SPIKG +  N EYL +L+
  S:     2 KERLDVLLVKRNLAESREKAKAIIMSGNVFVEGQREDKAGSTFPEEVSIEVRGHTLPYVSRGGLKLEKAIANFDVSVKDKVCTDVGSSTGGFTDCMLQNGAKKVFAIDVGRGQLDWKLRNDPRVICMEKTNIRYVTPEDLGEEIDFSSIDVSFISLTKVLEPIRNYLAKDGEIVALIKPQFEAGREKVGKKGVVREKSTHREVIQKIMDYAMSIGFDLCALDFSPIKGPEG-NIEYLIHLK 241
>gi|158320638|ref|YP_001513145.1| hemolysin A [Alkaliphilus oremlandii OhILAs] >gi|158140837|gb|ABW19149.1| hemolysin A [Alkaliphilus oremlandii OhILAs] (268 aa)
Score = 380, Expect = 5.9e-35, Identities = 94/244 (38%), Positives = 146/244 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           K RLD+ LV + +  SR  A+  I    V ++ + I K  T V +   V +      YVSR   KL+ A++ F++ L +K+ +DIG+STGGFT  +L+N   KVYSIDVG  QL+ +L+++++V+++E+TN R +    I  K DF +IDVSFIS+ L+   +KEL     + +AL+KPQFE G+ K+G          HK ++ + + F +   +K +G   SPIKG +  N EYL Y++   E+
  S:     4 KERLDVVLVEKGFFDSREKAKGAIMAGIVFVDNEKIDKPGTKVKKNGNVVVKGNLIPYVSRGGLKLEKAMKEFDLQLRDKVCLDIGASTGGFTDCMLQNGASKVYSIDVGYGQLDWKLRQDSRVVTMERTNIRYVTLEHIGQKADFASIDVSFISLKLVLPVLKELLKEQGEIVALIKPQFEAGRDKVGKKGVVRDMAVHKSVVVDIVSFAADKGLKVVGLTYSPIKGPEG-NIEYLLYMKNTEEE 248
>gi|72080502|ref|YP_287560.1| haemolysin [Mycoplasma hyopneumoniae 7448] >gi|71913626|gb|AAZ53537.1| haemolysin [Mycoplasma hyopneumoniae 7448] (237 aa)
Score = 379, Expect = 7.0e-35, Identities = 94/224 (41%), Positives = 129/224 (57%)
  Q:    22 AQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           A+ LI    V +N Q        ++ LD + I E++KYVSR A KL+AA ++F ++  +KI +DIG+S GGFTQ  LE   KKVY++D GTNQL+  L+ N KV   E+TN + ++ S   D+ID I  DVSFIS+  +   +K L       I LLKPQFE   K     G      HK +IN  IEF +  + + L +  SPIKG K +NTEY  +   KN+
  S:    15 AESLIRTGYVKLNNQTCYFPGQKISNLDSINIKEKQKYVSRGALKLQAAYDYFKLNFQDKIILDIGASKGGFTQFCLEKGAKKVYALDSGTNQLDYSLRINPKVCVKEKTNIKFVDKSFFNDEIDLIVCDVSFISLKKVLAVVKNLLTQGKNCITLLKPQFEANSKYVQKGGIVPKLYHKFLINRIIEF-AKPSFEFLNFFESPIKGRKSKNTEYFLHFIRKND 237
>gi|71893515|ref|YP_278961.1| haemolysin [Mycoplasma hyopneumoniae J] >gi|71851642|gb|AAZ44250.1| haemolysin [Mycoplasma hyopneumoniae J] (237 aa)
Score = 378, Expect = 1.0e-34, Identities = 94/224 (41%), Positives = 129/224 (57%)
  Q:    22 AQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           A+ LI    V +N Q        ++ LD + I E++KYVSR A KL+AA ++F ++  +KI +DIG+S GGFTQ  LE   KKVY++D GTNQL+  L+ N KV   E+TN + ++ S   D+ID I  DVSFIS+  +   +K L       I LLKPQFE   K     G      HK +IN  IEF +  + + L +  SPIKG K +NTEY  +   KN+
  S:    15 AESLIRTGYVKLNNQTCYFPGQKISNLDSINIKEKQKYVSRGALKLQAAYDYFKLNFQDKIILDIGASKGGFTQFCLEKGAKKVYALDSGTNQLDYSLRINPKVCVKEKTNIKFVDKSFFNDEIDLIVCDVSFISLKKVLVVVKNLLTQGKNCITLLKPQFEANSKYVQKGGIVPKLYHKFLINRIIEF-AKPSFEFLNFFESPIKGQKSKNTEYFLHFIRKND 237
>gi|153810471|ref|ZP_01963139.1| hypothetical protein RUMOBE_00852 [Ruminococcus obeum ATCC 29174] >gi|149833650|gb|EDM88731.1| hypothetical protein RUMOBE_00852 [Ruminococcus obeum ATCC 29174] (269 aa)
Score = 378, Expect = 1.1e-34, Identities = 87/243 (35%), Positives = 143/243 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD+ +V    A SR  A+  I +  V ++GQ   K+ T+  E  K+E+      YVSR   KL+ A+ +F + L+ K+ +D+G+STGGFT  +L+N   KVYSIDVG  QL+ +L+ + +V+ +E+TN R +    +++   F +IDVSFIS+  +   ++ L  ++ + + L+KPQFE G++    KG  +    H ++I   I + S + ++      SPIKG +  N EYL +L+ + E
  S:     2 KKRLDLLMVERALAPSREKAKAYIMSGDVYVDGQKEDKAGTMFKETVKIEVRGNTLPYVSRGGLKLEKAMNNFGVSLDGKVCMDVGASTGGFTDCMLQNGAVKVYSIDVGYGQLDWKLRNDPRVVCMEKTNIRYVLPENLQEPAQFSSIDVSFISLTKVLLPVRNLLTDDGEIVCLIKPQFEAGREKVGKKGVVRDPAVHLEVIEKVIAYASTIAMEPCHLSFSPIKGPEG-NIEYLLHLKKRPE 245
>gi|167040179|ref|YP_001663164.1| hemolysin A [Thermoanaerobacter sp. X514] >gi|166854419|gb|ABY92828.1| hemolysin A [Thermoanaerobacter sp. X514] (266 aa)
Score = 378, Expect = 1.1e-34, Identities = 97/238 (40%), Positives = 144/238 (60%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEI-LEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +K RLD+ LV + +  SR  A+  I   +V ++G+ I K+   VN    +EI +    YVSR   KL+ AIE FNI++  KIA+DIG+STGGFT  LL++ V KVY++DVG  QL+  L+ + +VI++E+TN R +E+  + + +D +TIDVSFIS+ L+     +        IAL+KPQFE G++    KG  +    H+++I   +      N   +G   SPIKGA+  N EYL Y
  S:     4 KKERLDVLLVQKGFFSSREKAKASIMAGEVYVDGKKIEKAGEFVNIDSSIEIKINSLPYVSRGGLKLQKAIETFNINVTGKIALDIGASTGGFTDCLLKHGVIKVYAVDVGYGQLDWSLRNDPRVINMEKTNIRFLET--LPETVDMVTIDVSFISLELVIPSADKFLKPEGDLIALIKPQFEAGREKVGKKGVVRDPAVHREVIEKIVTLFQKFNYGIIGITYSPIKGAEG-NIEYLIY 240
>gi|20807748|ref|NP_622919.1| rRNA methylase [Thermoanaerobacter tengcongensis MB4] >gi|20516302|gb|AAM24523.1| predicted rRNA methylase [Thermoanaerobacter tengcongensis MB4] (265 aa)
Score = 378, Expect = 1.2e-34, Identities = 90/237 (37%), Positives = 144/237 (60%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           K R+D+ LV   +  SR  A+  I   +V ++G+   K+  +V E  K+E+      YVSR   KL+ A++ F ID+  KIA+D+G+STGGFT  LL++  +KVY++DVG  QL+  L+ + +V+ +E+TN R + +  + + +D ITIDVSFIS+ ++     +   +  + +AL+KPQFE G++    KG  + +D HK+++   I+    +N    G   SPIKGA+  N EYL Y
  S:     2 KERIDVLLVKRGFFSSREKAKAAIMAGEVYVDGKRAEKAGEMVKEDSKIEVKGNSLPYVSRGGLKLEKALQLFGIDVRGKIALDVGASTGGFTDCLLKHGAQKVYAVDVGYGQLHWSLRNDPRVVVMEKTNIRFLNA--LPEMVDIITIDVSFISLEIVVPAADKFLKSEGEIVALIKPQFEAGREKVGKKGIVRDKDVHKEVLEKIIKLFKNINYGVCGITYSPIKGAEG-NIEYLIY 237
>gi|177666348|ref|ZP_02942143.1| hemolysin A [Cyanothece sp. PCC 8801] >gi|172074525|gb|EDT59943.1| hemolysin A [Cyanothece sp. PCC 8801] (266 aa)
Score = 377, Expect = 1.2e-34, Identities = 95/240 (39%), Positives = 137/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIES-SLIKDK--IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD  LV  N   SR  AQ LI   +V +N Q+I K  T V    ++E+  + +YVSR  YKL+ A++ F+I +  +I +D G STGGFT  LL+   K+VY +DVG  Q+   L+++ +VI  E+TNFR + S SL  D    D   +DVSFIS+  +   +  L  +  + I L+KPQFE+G+     KG  +  +DH + I+  ++  + L     G   SPIKG    N EYL +L
  S:     1 MTKQRLDTLLVERNLCSSRQEAQGLIRAGEVKVNQQVIDKPGTPVESTAEIELQAKPRYVSRGGYKLEKALKTFDIAVTGRICLDGGISTGGFTDCLLQFGAKQVYGVDVGYGQVAWTLRQDERVILKERTNFRYLTSDSLYGDNPFADLGVMDVSFISLTKVLEPLWHLLVSPREVILLIKPQFEVGRSRVGKKGVVRNPKDHAQAIDQVLQTANNLGWYYQGLTESPIKGPAG-NVEYLLWL 243
>gi|54020395|ref|YP_115731.1| hemolysin [Mycoplasma hyopneumoniae 232] >gi|53987568|gb|AAV27769.1| TlyA haemolysin [Mycoplasma hyopneumoniae 232] (237 aa)
Score = 377, Expect = 1.2e-34, Identities = 95/224 (42%), Positives = 129/224 (57%)
  Q:    22 AQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           A+ LI    V +N Q        ++ LD + I E++KYVSR A KL+AA ++F ++  +KI +DIG+S GGFTQ  LE   KKVY++D GTNQL+  L+ N KV   E+TN + ++ S   D+ID I  DVSFIS+  I   +K L       I LLKPQFE   K     G      HK +IN  IEF +  + + L +  SPIKG K +NTEY  +   KN+
  S:    15 AESLIRTGYVKLNNQTCYFPGQKISNLDSINIKEKQKYVSRGALKLQAAYDYFKLNFQDKIILDIGASKGGFTQFCLEKGAKKVYALDSGTNQLDYSLRINPKVCVKEKTNIKFVDKSFFNDEIDLIVCDVSFISLKKILAVVKNLLTQGKNFITLLKPQFEANSKYVQKGGIVPKLYHKFLINRIIEF-AKPSFEFLNFFESPIKGQKSKNTEYFLHFIRKND 237
>gi|154502461|ref|ZP_02039521.1| hypothetical protein RUMGNA_00274 [Ruminococcus gnavus ATCC 29149] >gi|153796857|gb|EDN79277.1| hypothetical protein RUMGNA_00274 [Ruminococcus gnavus ATCC 29149] (268 aa)
Score = 377, Expect = 1.3e-34, Identities = 88/239 (36%), Positives = 141/239 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD+ LV  N A SR  A+ +I    V + GQ   K+ T   +  ++E+      YVSR   KL+ AI +F++ ++ K+  D+GSSTGGFT  +L+N  +KV++IDVG  QL+ +L+++ +V+ +E+TN R +    + + IDF +IDVSFIS+  +   I+     + + +AL+KPQFE G++    KG  + +  H ++I     +   +  K L    SPIKG +  N EYL +L+
  S:     2 KERLDVLLVKRNLAESREKAKAVIMAGNVFVEGQREDKAGTTFPDTVQIEVRGHVLPYVSRGGLKLEKAIANFDVSVDGKVCTDVGSSTGGFTDCMLQNGARKVFAIDVGRGQLDWKLRQDERVVCMEKTNIRYVVPEDLGEPIDFSSIDVSFISLTKVLEPIRNYLKEDGEIVALIKPQFEAGREKVGKKGVVREKSTHHEVIEKVALYAQSIGFKILNIDFSPIKGPEG-NIEYLIHLK 241
>gi|188159750|ref|ZP_02998860.1| hemolysin A [Mycoplasma mycoides subsp. mycoides LC str. GM12] (268 aa)
Score = 377, Expect = 1.5e-34, Identities = 104/238 (43%), Positives = 141/238 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K+RLD Y+   N  +SR  A++ I N +V +N   I K + LV+  D +EI   + +YVSRA  KLK AI  +NIDL NKI +DIG+STGGFTQ  L+NN   VY++DVGT+QL+  L  N KVI++ Q NFR  +       IDF+  DVSFIS+  IF  +K++   N   + L+KPQFEL  K           DHK+ I   I + +  +   +    SPI G KK+N EYL Y+
  S:     2 KLRLDEYIYKNNLTQSRNKAKEHILNKEVYVNNIAIIKPSFLVDSNDLIEIRSTKLEYVSRAYEKLKKAINKWNIDLTNKICLDIGASTGGFTQCCLDNNASLVYAVDVGTDQLHSSLLNNLKVINMSQYNFRNAKKQDFLKSIDFVCCDVSFISLEKIFLPLKDILEFNTSGVFLIKPQFELQPKNIKNGRINSKLDHKQAILKVISYANNNSFDVINLDYSPILGNKKQNIEYLAYV 240
>gi|116791102|gb|ABK25858.1| unknown [Picea sitchensis] (326 aa)
Score = 377, Expect = 1.5e-34, Identities = 91/244 (37%), Positives = 137/244 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           ++ RLD   V      SR + Q  I   KV+++G++  K+   V +   VEI  E  KYV RA YKL+AA+E  NID+  K+A+D G STGGFT  LL+     VY +DVG  Q+ E+++ + +V  +E+TN R +  S +   +D +T+D+SFISI L+   +K +       + L+KPQFE  + ++G        E HK+++   I  +      N G+I SPIKGA+  N E+L     K E
  S:    80 KRQRLDEVCVERFPQYSRSMIQSWILQGKVLVDGRVAGKAGMAVTDKAIVEITAETPKYVCRAGYKLEAALEKLNIDVAGKVALDSGLSTGGFTDCLLQYGASFVYGVDVGYGQVAERIRTDKRVNVIERTNLRYL--SGLPQNVDLVTLDLSFISILLVMPAVKAVMNQESTLVTLIKPQFEARRSQVGGGGVVRDPEVHKEVLEKIINGVEAFGFTNEGWIESPIKGAEG-NVEFLACFRRKAE 322
>gi|154498042|ref|ZP_02036420.1| hypothetical protein BACCAP_02023 [Bacteroides capillosus ATCC 29799] >gi|150273032|gb|EDN00189.1| hypothetical protein BACCAP_02023 [Bacteroides capillosus ATCC 29799] (268 aa)
Score = 376, Expect = 1.7e-34, Identities = 90/240 (37%), Positives = 138/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYL 240
           M K RLD+ L       SR  AQ +I   +V + GQ + K+     E  ++E+  +   YVSR   KL+ A++ F I L+  I  DIG+STGGFT  +L+N   KVY++DVG  QL   L+ + +VI +E+TN R +    I D++DF +IDVSFIS+ LI   ++ L   +   + L+KPQFE GK+    KG  +    H +++  F     ++N ++  + V     SP++G +  N EYL +L
  S:     1 MAKKRLDVLLCERGLMESRQKAQAVIMAGQVYVGGQKVDKAGAQTEETAEIEVRGKTLAYVSRGGLKLEKAMQSFPIVLSGAICGDIGASTGGFTDCMLQNGAAKVYAVDVGYGQLAWSLRSDERVICMERTNARYLTHEQIPDELDFASIDVSFISLRLILPAVRGLLKPDGHVVCLVKPQFEAGKEKVGKKGVVRDPKVHLEVLEQF-----LINARDADFTVKDMTFSPVRGPEG-NIEYLGFL 241
>gi|145954919|ref|ZP_01803923.1| hypothetical protein CdifQ_04001321 [Clostridium difficile QCD-32g58] >gi|168696607|ref|ZP_02728884.1| putative RNA methyltransferase [Clostridium difficile QCD-37x79] >gi|168726221|ref|ZP_02758498.1| putative RNA methyltransferase [Clostridium difficile QCD-76w55] >gi|168731416|ref|ZP_02763693.1| putative RNA methyltransferase [Clostridium difficile QCD-97b34] >gi|196161837|ref|ZP_03122398.1| putative RNA methyltransferase [Clostridium difficile CIP 107932] (270 aa)
Score = 375, Expect = 2.4e-34, Identities = 94/243 (38%), Positives = 145/243 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K R+D+ LV + Y  SR  A+  I    V ++ Q   K+ T V E   +E+      YVSR   KL+ A+++F++ ++ K+ +DIG+STGGFT  +L+N   KV+SIDVG  QL  +L+++++V+ +E+TN R +     K   DF +IDVSFIS+ L+  K KEL  ++ + +AL+KPQFE G++    KG  + +  H ++I    +F      + LG   SPIKG +  N EYL +L   NE
  S:     2 KKRIDLLLVEQGYFESRERAKKAIMAGLVFVDNQRCDKAGTEVKEDCSIEVKGNPIPYVSRGGLKLEKAMKNFDLTIDGKVCMDIGASTGGFTDCMLKNGAIKVFSIDVGYGQLAWKLRQDDRVVCMERTNIRNVTIEYTKQFADFASIDVSFISLKLVLPKAKELVRHDGEVVALIKPQFEAGREKVGKKGVVREKSTHIEVIKMISDFSVENGFEILGLDFSPIKGPEG-NIEYLIHLRNGNE 245
>gi|116620238|ref|YP_822394.1| hemolysin A [Solibacter usitatus Ellin6076] >gi|116223400|gb|ABJ82109.1| hemolysin A [Solibacter usitatus Ellin6076] (240 aa)
Score = 374, Expect = 2.8e-34, Identities = 92/240 (38%), Positives = 135/240 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGY----IVSPIKGAKKENTEYLFYLEY 242
           K RLD  +V+     SR  AQ LI   +V +NGQ  +K    V    K+E+L    YVSR  YKL  A+ HF +D+  KI  DIGSSTGGFT VLL+N   +V+++DVG  QL+ +++ + +V+  E  N RE+  + I + IDF+T DVSFIS+ LI   +  L     + + L+KPQFE+GK      G  +  +  +     +E      ++ +G+    I S I GA+  N E+L Y  +
  S:     2 KTRLDRLIVDRGLVESREKAQALIMAGEVRVNGQKAAKPGQPVESDCKIEMLSRPPYVSRGGYKLAGALRHFALDVAGKICADIGSSTGGFTDVLLQNGAARVHAVDVGAGQLDWKIRTDPRVVLHEGVNAREVSLAEIGEPIDFLTCDVSFISVTLILPAVVSLLQPTGQMVILIKPQFEVGKGQVGKGGIVREPELHRAACEKVE----RAVREIGFETAIIESSIAGAEG-NKEFLLYAHH 240
>gi|145347940|ref|XP_001418417.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578646|gb|ABO96710.1| predicted protein [Ostreococcus lucimarinus CCE9901] (245 aa)
Score = 373, Expect = 3.6e-34, Identities = 79/216 (36%), Positives = 135/216 (62%)
  Q:    22 AQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           ++  I   KV+++GQ ++K+ T +    K+E++ E+ K+V RA  KL+ A+ HF +D++   A+D G STGGFT  LL++  KKVY +DVG  Q+ E+++++ +VI +E+TN R +    + D +D +T+D+SFIS+  +   I  +       + L+KPQFE  +    +KG  +  + HK++I N I+   +   + + +  SPIKGAK+ NTE+L
  S:     5 SRSWIAQGKVLVDGQPVTKAGTKLKPSVKIEVIAEQPKFVCRAGLKLEKALAHFGVDVSGCTALDSGLSTGGFTDCLLQSGAKKVYGVDVGYGQVAEKIRQDERVIIMERTNLRYVTD--LPDIVDVVTLDLSFISVLKVLPAICRILKPGGTMLVLIKPQFEAKRSQIGSKGVVRDANVHKEVIENVIQGAKLYGFEYIDHTTSPIKGAKEGNTEFL 220
>gi|153853046|ref|ZP_01994455.1| hypothetical protein DORLON_00440 [Dorea longicatena DSM 13814] >gi|149753832|gb|EDM63763.1| hypothetical protein DORLON_00440 [Dorea longicatena DSM 13814] (269 aa)
Score = 373, Expect = 3.9e-34, Identities = 88/239 (36%), Positives = 143/239 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD+ LV  N A SR  A+ +I +  V ++GQ   K+ T   E   +E+      YVSR   KL+ AI++F++ +  K+  D+GSSTGGFT  +L+N   KV++IDVG  QL+ +L+++ +V+ +E+TN R +    I + + F +IDVSFIS+  +   I+     + + +AL+KPQFE G++    KG  + +  H ++I+  I++   +  + L    SPIKG +  N EYL +L+
  S:     2 KERLDVLLVKRNLAASREKAKAIIMSGIVYVDGQKEDKAGTTFPEEATIEVRGHTLPYVSRGGLKLEKAIKNFDVSVEGKVCTDVGSSTGGFTDCMLQNGAVKVFAIDVGRGQLDWKLRQDPRVVCMEKTNIRYVTPEDIGEPVQFSSIDVSFISLTKVLLPIRNYLTEDGQIVALIKPQFEAGREKVGKKGVVREKSTHIEVIHKVIDYAMSIGFEVLNLEFSPIKGPEG-NIEYLVHLQ 241
>gi|83319276|ref|YP_424051.1| hemolysin A [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283162|gb|ABC01094.1| hemolysin A [Mycoplasma capricolum subsp. capricolum ATCC 27343] (269 aa)
Score = 373, Expect = 4.3e-34, Identities = 106/238 (44%), Positives = 143/238 (60%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSK-VVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K+RLD Y+   N  +SR  A++ ITN K V +N   I K + LV+  D +EI   + KYVSRA  KL+ AI  +NIDL NK+ +DIG+STGGFTQ  L+NN K VY++DVGT+QL+  L  N KVI++ Q NFR  +       IDF+  DVSFIS+  IF  +K++   N   + L+KPQFEL  K           DHK+ I   I + +  +   +    SPI G KK+N EYL Y+
  S:     2 KLRLDEYIYKINLTQSRSKAKEHITNKKDVYVNNINIIKPSFLVDNNDVIEIRSTKLKYVSRAYEKLEKAINKWNIDLTNKVCLDIGASTGGFTQCCLDNNAKLVYAVDVGTDQLHSSLLNNLKVINMSQCNFRNAKKQDFLKNIDFVCCDVSFISLEKIFLPLKDIVEFNTSGVFLIKPQFELQPKNIKNGRINSKLDHKQAILKVINYANSNSFDVINLDYSPILGNKKQNIEYLAYI 241
>gi|166030419|ref|ZP_02233248.1| hypothetical protein DORFOR_00080 [Dorea formicigenerans ATCC 27755] >gi|166029777|gb|EDR48534.1| hypothetical protein DORFOR_00080 [Dorea formicigenerans ATCC 27755] (270 aa)
Score = 373, Expect = 4.5e-34, Identities = 88/239 (36%), Positives = 139/239 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD+ LV  N A SR  A+ +I +  V ++ Q   K  T   E  K+E+      YVSR   KL+ A++ F + +  K+  D+GSSTGGFT  +L+N   KV++IDVG  QL+ +L+++ +V+ +E+TN R +    I + +DF +IDVSFIS+  +   I++   +  + +AL+KPQFE G++    KG  + +  H +++   +++ S      L    SPIKG +  N EYL  LE
  S:     2 KERLDVLLVKRNLAASREKAKAIIMSGNVYVDNQKEDKPGTTFPEESKIEVRGHTLPYVSRGGLKLEKAMKEFQVSVEGKVCTDVGSSTGGFTDCMLQNGAVKVFAIDVGHGQLDWKLRQDERVVCMEKTNIRYVTPEDIGEPVDFSSIDVSFISLTKVLMPIRDYLTDKGQIVALIKPQFEAGREKVGKKGVVREKSTHIEVVTMILDYASTHGFHVLDLTFSPIKGPEG-NIEYLVQLE 241
>gi|126698804|ref|YP_001087701.1| putative RNA methyltransferase [Clostridium difficile 630] >gi|168712863|ref|ZP_02745140.1| putative RNA methyltransferase [Clostridium difficile QCD-63q42] >gi|196125109|ref|ZP_03116858.1| putative RNA methyltransferase [Clostridium difficile ATCC 43255] >gi|115250241|emb|CAJ68062.1| putative RNA methyltransferase [Clostridium difficile 630] (270 aa)
Score = 372, Expect = 4.8e-34, Identities = 94/243 (38%), Positives = 145/243 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K R+D+ LV + Y  SR  A+  I    V ++ Q   K+ T V E   +E+      YVSR   KL+ A+++F++ ++ K+ +DIG+STGGFT  +L+N   KV+SIDVG  QL  +L+++++V+ +E+TN R +     K   DF +IDVSFIS+ L+  K KEL  ++ + +AL+KPQFE G++    KG  + +  H ++I    +F      + LG   SPIKG +  N EYL +L   NE
  S:     2 KKRIDLLLVEQGYFESRERAKKAIMAGLVFVDNQRCDKAGTEVKEDCSIEVKGNPIPYVSRGGLKLEKAMKNFDLTIDGKVCMDIGASTGGFTDCMLKNGAIKVFSIDVGYGQLAWKLRQDDRVVCMERTNIRNVTIEDTKQFADFASIDVSFISLKLVLPKAKELVRHDGEVVALIKPQFEAGREKVGKKGVVREKSTHIEVIKMISDFSVENGFEILGLDFSPIKGPEG-NIEYLIHLRNGNE 245
>gi|163782710|ref|ZP_02177706.1| hemolysin [Hydrogenivirga sp. 128-5-R1-1] >gi|159881831|gb|EDP75339.1| hemolysin [Hydrogenivirga sp. 128-5-R1-1] (256 aa)
Score = 372, Expect = 4.9e-34, Identities = 85/235 (36%), Positives = 136/235 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK-IINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           +RLD  L       SR  AQ LI   +V + G+ + K  T +   ++VE+LE  +YVSR   KL+ A+  F ID + K  +D+GSSTGGFT  LL++  +KVY++DVG  Q++ +L+++ +V+  E+T+ R++  + + +K+D ITIDVSFIS+  +   +      N   +AL+KPQFEL  K    KG  +  +H+K  +     F++ L    LG + S  +G+K     +L 
  S:     2 VRLDKLLFERGLVDSREKAQALIMAGQVFVEGRRVDKPGTRLKGDERVEVLELPRYVSRGGDKLEGALRRFGIDPSGKRVLDVGSSTGGFTDCLLQHGAEKVYAVDVGRAQMDFRLREDPRVVLYEKTDARDLTDNHVPEKVDLITIDVSFISLTKVLPSVVRFLKENGLILALVKPQFELCPK-KVKKGIVRDREHRKEAVLKVASFVNELGFNVLGVVKSFPRGSKGNEEFFLL 236
>gi|154483650|ref|ZP_02026098.1| hypothetical protein EUBVEN_01354 [Eubacterium ventriosum ATCC 27560] >gi|149735560|gb|EDM51446.1| hypothetical protein EUBVEN_01354 [Eubacterium ventriosum ATCC 27560] (275 aa)
Score = 371, Expect = 5.9e-34, Identities = 91/244 (37%), Positives = 143/244 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           K RLD+ LV    A SR  A+ +I +  V ++ +   K+ T  +E   +E+  +  KYVSR   KL+ A++ F + +  K  +D+G+STGGFT  +L+N   KVYS+DVG  QL  +L ++++VI +++TN R +    I D +DF +IDVSFIS+  +   +K L   N + + L+KPQFE G++    KG  + +  H ++I   IE+   +  K L    SP+KG +  N EYL YL+   E+
  S:     2 KERLDVLLVKRGLAPSREKAKAIIMSGIVFVDNEREDKAGTTFDEKVNIEVRGKTLKYVSRGGLKLEKAMDVFGVKIEGKTCMDVGASTGGFTDCMLQNGAVKVYSVDVGHGQLAWKLVQDDRVICMDRTNIRYVTPDQIDDVLDFASIDVSFISLTKVLLPVKNLLKENGQIVCLIKPQFEAGRENVGKKGVVRDKKVHVQVIEKVIEYAMSIGFKILNLDYSPVKGPEG-NIEYLLYLQNNGEE 246
>gi|167766571|ref|ZP_02438624.1| hypothetical protein CLOSS21_01077 [Clostridium sp. SS2/1] >gi|167711694|gb|EDS22273.1| hypothetical protein CLOSS21_01077 [Clostridium sp. SS2/1] (273 aa)
Score = 371, Expect = 6.2e-34, Identities = 89/240 (37%), Positives = 146/240 (60%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K RLD+ LV +  A SR  A+ +I +  V ++GQ   K+ +  +E  ++ +  +  KYVSR   KL+ A+++F+I L +K+ +D+G+STGGFT  +L+N   KVYS+DVG  QL+ +L+ + +V+ +E+TN R +    I +K  F++IDVSFIS+  I   +  +     + +AL+KPQFE G++    KG  +    H+++I    +F S    + L    SPIKG +  N EYL ++
  S:     1 MKKERLDVLLVKKGLASSREKAKAIIMSGIVFVDGQREDKAGSTFDEKQEIIVKGKTLKYVSRGGLKLEKAMKNFDIVLKDKVCMDVGASTGGFTDCMLQNGAVKVYSVDVGHGQLDWKLRNDERVVCMERTNMRYMTEDDIDEKASFVSIDVSFISLTKILPAVYRILNTGGEVVALIKPQFEAGREKVGKKGVVRDPKVHEEVIEKICDFASTNGFELLHLDYSPIKGPEG-NIEYLLHM 241
>gi|147677532|ref|YP_001211747.1| rRNA methylase [Pelotomaculum thermopropionicum SI] >gi|146273629|dbj|BAF59378.1| predicted rRNA methylase [Pelotomaculum thermopropionicum SI] (266 aa)
Score = 371, Expect = 6.9e-34, Identities = 86/245 (35%), Positives = 137/245 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K+RLD+ L  + Y  SR  AQ  I    V ++G+   K   +V+    +E+      YVSR   KL+ AI+ F + LN ++ ID+G+STGGFT   L++  + VY++DVG  QL  QL+K+ +V+ LE+TN R +    + +  DF  IDVSFIS+  +  K+ EL   + + +AL+KPQFE G+     KG  +    H +++   +  ++ L     G   SP+ G +  N E+L +   K E+
  S:     4 KKLRLDVRLARDGYCPSREKAQAAIMAGLVFVDGERACKPGMMVDPSSVIEVRGCPLPYVSRGGLKLEKAIKVFGLVLNGRVVIDVGASTGGFTDCALKHGARLVYAVDVGYGQLAWQLRKDPRVVVLERTNIRHLTPGCLTETPDFAVIDVSFISLEKVLPKVGELTAPDAEGVALVKPQFEAGRDRVGKKGVVREPSVHVEVLFKVVALVNGLGWAVGGLDYSPVTGPEG-NIEFLLFFRKKGEQ 249
>gi|15606155|ref|NP_213532.1| hemolysin [Aquifex aeolicus VF5] >gi|2983347|gb|AAC06935.1| hemolysin [Aquifex aeolicus VF5] (258 aa)
Score = 371, Expect = 7.0e-34, Identities = 89/243 (36%), Positives = 144/243 (59%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK-IINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +RLD YL ++    SR  AQ +I   +V++NG+++ K    +   +KVE+ E  KYVSR   KL+ AI+ F++DL +K+ +D+GSSTGGFT   L++  KKVY++DVG  Q++ +L+++ +V+  E+T+ RE+    + +K+D IT DVSFIS   +   + +    +   + L+KPQFEL  +    KG  + ++HK+  +   + FL     + LG I S  KG K  N E+      K E+
  S:     1 MRLDKYLTDKGIVPSREKAQAVIMAGQVLVNGKVVDKPGYRLKGNEKVEVKELPKYVSRGGEKLEWAIKRFSLDLKDKVVLDVGSSTGGFTDCALQHGAKKVYAVDVGRGQMDYKLRQDPRVVLYEETDARELSEEHVPEKVDLITCDVSFISSTKVLPNVFKFLKEDGLLLVLVKPQFELCPR-KVKKGVVREKEHKREALQKVVNFLKENGFRILGVIKSKPKGTKG-NEEFFVLAGRKGEE 242
>gi|157363559|ref|YP_001470326.1| hemolysin A [Thermotoga lettingae TMO] >gi|157314163|gb|ABV33262.1| hemolysin A [Thermotoga lettingae TMO] (265 aa)
Score = 371, Expect = 7.2e-34, Identities = 88/238 (36%), Positives = 136/238 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ +     A SR  A+DLI   +VV+NG+I  K  T+  E D++++ E  +YVSR   KL+ A   F +    KI  DIG+STGGFTQ  L++  K+VY+IDVG NQL + L+K+ +V+ +E  N R +    I + +D +  DVSFISI  + + I  +  ++ +++ L+KPQFE+GK    +      E H ++I    +      +  +  I SPI G+K  N EY  ++
  S:     2 KKRLDLIVTERKLAASRSQARDLIKLGRVVVNGKICRKPGTICFEEDEIKLCEPRQYVSRGGEKLEKAYLSFGLKFAEKIVCDIGASTGGFTQFALKHGAKRVYAIDVGKNQLADILRKDERVVCMENFNARNLRLRDIGEHVDIVLCDVSFISIIYLLDPIGLILKDSGEAVLLIKPQFEIGKNQSHS-----VESHLEVIQRIFKKAIDSGLFPVDLIYSPITGSKG-NIEYFAHM 233
>gi|159489434|ref|XP_001702702.1| predicted protein [Chlamydomonas reinhardtii] >gi|158280724|gb|EDP06481.1| predicted protein [Chlamydomonas reinhardtii] (271 aa)
Score = 370, Expect = 8.2e-34, Identities = 84/242 (34%), Positives = 139/242 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL----EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +RLD Y +      SR V Q  I   KV +  ++++K+ T V       ++    +E KYV RA  K++ A+ H+ ID+   +A+D G STGGFT  LL+N  KKVY IDVG NQL+++++++ +V+ +E+ N R +    + + +D  T+D+SFIS+ L+   +   +K    + + L+KPQFE G+ ++G        + H ++I      ++    + +G   SPIKG K  NTE+L Y   + E
  S:     1 MRLDEYCLQLAPQYSRNVIQSFILQGKVRVADKVVTKAGTPVVVGPGGPVVVIDADEPKYVCRAGLKMEKALAHWGIDVRGLVALDSGQSTGGFTDCLLQNGAKKVYGIDVGHNQLHDRIRRDERVVVMEKFNLRHLAPQHLLEMVDIATLDLSFISVLLVIGAVTSVIKPAGGQLVVLIKPQFEAGRGQVGPGGVVRDPKVHAEVIQRVTAGIAAHGYQLVGVTESPIKGDKSGNTEFLAYFHRRPE 248
>gi|169831190|ref|YP_001717172.1| hemolysin A [Candidatus Desulforudis audaxviator MP104C] >gi|169638034|gb|ACA59540.1| hemolysin A [Candidatus Desulforudis audaxviator MP104C] (274 aa)
Score = 369, Expect = 1.3e-33, Identities = 85/240 (35%), Positives = 141/240 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL--NIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +K RLDI L +     SR  A+  I    V +NG  + K  T ++    +E+   +  +VSR  +KL+ A++ F IDL  K+ +D+G+STGGFT   L++    VY++DVG  QL+  L+++ +V+ LE+TN R +  + ++ +  F TIDVSFIS+ L+F ++ EL     + + L+KPQFE G+ +   KG  +  D H +++   ++    L   ++ L Y  SP++G +  N EYL Y +
  S:     3 RKERLDILLHSRGCFPSRERARSAIMAGVVFVNGVRVDKPGTKLDPHADIEVRGPDLAFVSRGGFKLEKALQVFGIDLQGKVVLDVGASTGGFTDCALKHGAALVYAVDVGYGQLDWSLRRDPRVVVLERTNIRHLSPAALEVRPSFFTIDVSFISLRLVFPRVDELTAPGAEGVVLVKPQFEAGRNLVGKKGVVRDPDVHVQVLLGVLKEAQTLGWGVRALDY--SPVRGPQG-NIEYLVYFQ 243
>gi|118047550|ref|ZP_01516184.1| hemolysin A [Chloroflexus aggregans DSM 9485] >gi|117995968|gb|EAV10175.1| hemolysin A [Chloroflexus aggregans DSM 9485] (264 aa)
Score = 369, Expect = 1.3e-33, Identities = 86/237 (36%), Positives = 130/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           M + RLD  LV    A +R  AQ LI   +V++NGQ+ +K+ T V    ++E+     YVSR  +KL  A++ F +D    IA+D+G+STGGFT VLL     +V +IDVG   L+ +L+ + +VI LE+TN R + +     + D   IDVSFIS+ L+   ++ L       +AL+KPQFE G ++    G  +    H ++I + + F     +   G   SPI G    N E+L
  S:     1 MTRQRLDTLLVERGLAETRAKAQALIMAGQVLVNGQVQTKAGTQVAADAQIEVRSGLPYVSRGGFKLAHALDQFELDPTGLIALDVGASTGGFTDVLLRRGAAQVVAIDVGYGILDHRLRNDPRVIVLERTNIRYLTALPDNMRADCAVIDVSFISLRLVLPAVQRLITPEAWIVALIKPQFEAGPQLVGKGGVVRDPAVHAQVIRDVVAFAVTQQLNPAGLTRSPITGPAG-NVEFL 237
>gi|15895346|ref|NP_348695.1| rRNA methylase [Clostridium acetobutylicum ATCC 824] >gi|15025064|gb|AAK80035.1|AE007710_5 Predicted rRNA methylase, YQXC B.subtilis ortholog [Clostridium acetobutylicum ATCC 824] (267 aa)
Score = 368, Expect = 1.3e-33, Identities = 92/241 (38%), Positives = 139/241 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           K RLD+ LV +    SR  A+  I   ++ ++   I K    V    KVE   E+  YVSR  YKL+ AI+ F + L +K+  DIG+STGGFT  +L+N   KV++IDVG  Q   +L+ + +V+ +E+TN R +    I +  +F +IDVSFIS+  +   +  L  ++ + +AL+KPQFE G+ K+G      + E H ++IN  ++FL  + +  LG   SPIKG +  N EYL Y   K
  S:     5 KERLDVLLVEKGIFESREKARASIMAGEIYVDDLRIDKCGQKVKVSSKVEFRGEKMPYVSRGGYKLERAIKSFGLGLKDKVCFDIGASTGGFTDCMLQNGASKVFAIDVGYGQFAWKLRTDPRVVCMERTNVRYVTPEDIGEFGNFASIDVSFISLKKVIPVVINLLKDDGEIVALIKPQFEAGREKVGKRGVVREPETHIEVINTIVDFLKEMKLSILGITYSPIKGPEG-NIEYLVYFSKK 246
>gi|50365145|ref|YP_053570.1| rRNA methylase [Mesoplasma florum L1] >gi|50363701|gb|AAT75686.1| rRNA methylase [Mesoplasma florum L1] (267 aa)
Score = 368, Expect = 1.7e-33, Identities = 97/238 (40%), Positives = 139/238 (58%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSK-VVINGQIISKSNTLVNELDKVEI-LEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD  LV +    +R  A++ I N K V +N  +I+K+  +V+E D ++I L++  +VSRA  KL+  I+ + IDLNNK+ +DIG+STGGFTQV LENN   VY++DVGT+QL+E LK N  V  +++ NFR  +       I+F   DVSFIS++ I   +  L       + L+KP+FE G ++           H ++I NFI +             SPI G KK+N EYL YL
  S:     2 KKRLDEVLVEKALVSTRSKAKEQIVNRKEVYVNNVLITKAGFMVSETDLIDIRLKQSTFVSRAGLKLEKTIKDWKIDLNNKVCLDIGASTGGFTQVCLENNASLVYAVDVGTDQLDESLKNNKLVKDMQKYNFRYAKKEDFDKNIEFFCCDVSFISLDKILPTLNNLIQEQTSGVVLIKPEFEAGSELAKNGKVNLKSTHLQVIKNFIYYSKENGFSVDRLTYSPIVGNKKQNIEYLAYL 241
>gi|163849205|ref|YP_001637249.1| hemolysin A [Chloroflexus aurantiacus J-10-fl] >gi|187600062|ref|ZP_02986295.1| hemolysin A [Chloroflexus sp. Y-400-fl] >gi|10198134|gb|AAG15202.1|AF288458_1 HlyA [Chloroflexus aurantiacus] >gi|163670494|gb|ABY36860.1| hemolysin A [Chloroflexus aurantiacus J-10-fl] >gi|187488351|gb|EDU26319.1| hemolysin A [Chloroflexus sp. Y-400-fl] (260 aa)
Score = 368, Expect = 1.7e-33, Identities = 84/237 (35%), Positives = 131/237 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           M + RLD  LV+   A +R  AQ LI   +V++NGQ+ +K+ TL+ +   VE+     YVSR  +KL  A++ F +D     A+D+G+STGGFT VLL+    +V+++DVG   L+ +L+ + +V++LE+TN R + +       D   IDVSFIS+ L+   ++ L       +AL+KPQFE G K +G          H ++I + + F     +       SPI G    N E+L
  S:     1 MPRQRLDQVLVSRGLAETRARAQALIMAGQVLVNGQVQTKAGTLIADDASVEVRTGLPYVSRGGFKLAHALDQFALDPTGLTALDVGASTGGFTDVLLQRGAGRVFAVDVGYGILDHRLRNDPRVVALERTNIRHLTALPANTLADCAVIDVSFISLRLVLPAVQRLVTPTAWIVALIKPQFEAGPKHVGKGGVVRDPAVHAQVIRDILSFARDCGLNPAALTRSPITGPAG-NVEFL 237
>gi|12034946|gb|AAG46052.1|AF326115_1 TlyA haemolysin [Mycoplasma hyopneumoniae] (232 aa)
Score = 367, Expect = 2.1e-33, Identities = 91/218 (41%), Positives = 125/218 (57%)
  Q:    22 AQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           A+ LI    V +N Q        ++ LD + I E++KYVSR A KL+AA ++F ++  +KI +DIG+S GGFTQ  LE   KKVY++D GTNQL+  L+ N KV   E+TN + ++ S   D+ID I  DVSFIS+  +   +K L       I LLKPQFE   K     G      HK +IN  IEF +  + + L +  SPIKG K +N EY  +
  S:    15 AESLIRTGYVKLNNQTCYFPGQKISNLDSINIKEKQKYVSRGALKLQAAYDYFKLNFQDKIILDIGASKGGFTQFCLEKGAKKVYALDSGTNQLDYSLRINPKVCVKEKTNIKFVDKSFFNDEIDLIVCDVSFISLKKVLVVVKNLLTQGKNCITLLKPQFEANSKYVQKGGIVPKLYHKFLINRIIEF-AKPSFEFLNFFESPIKGQKSKNPEYFSF 231
>gi|163816792|ref|ZP_02208155.1| hypothetical protein COPEUT_02982 [Coprococcus eutactus ATCC 27759] >gi|158448049|gb|EDP25044.1| hypothetical protein COPEUT_02982 [Coprococcus eutactus ATCC 27759] (266 aa)
Score = 367, Expect = 2.2e-33, Identities = 85/238 (35%), Positives = 137/238 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ LV +  A SR  A+ +I +  V ++     K+ T   E  ++E+     KYVSR   KL+ A+ +F + L  K+ +D+G+STGGFT  +L+N   KVYS+DVG  QL  +L+ + +V+ +E+TN R +    I D I+F +IDVSFIS+  +   ++EL     + + L+KPQFE G+ K+G      +   H +++   +++      + L    SPIKG +  N EYL ++
  S:     2 KKRLDVLLVEQGLADSREKAKAIIMSGIVYVDNNKEDKAGTTFEETARIEVRGNTLKYVSRGGLKLEKAMNNFGVTLEGKVCMDVGASTGGFTDCMLQNGAVKVYSVDVGHGQLAWKLRNDERVVCMEKTNIRYVTPDDIDDVIEFASIDVSFISLTKVLPAVRELMTPGGEIVCLIKPQFEAGREKVGKKGVVRELSTHIEVVQMIVDYARANGFRTLHLSYSPIKGPEG-NIEYLLHI 240
>gi|118444316|ref|YP_878057.1| hemolysin A [Clostridium novyi NT] >gi|118134772|gb|ABK61816.1| hemolysin A [Clostridium novyi NT] (270 aa)
Score = 365, Expect = 3.0e-33, Identities = 93/236 (39%), Positives = 140/236 (59%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLDI LV +N   SR  A+  I   K+ +NGQ + K    +    ++E   E   YVSR  +KL+ A++ F+I+L  K+ +DIG+STGGFT  +L+N   KV+SIDVG  Q   +L+ + +V+ +E+TN R +    + +  +F +IDVSFIS+  I   +  L  ++ + +AL+KPQFE G+ K+G      +   HK++I N + FL   N+K  G   SPIKG +  N EYL Y 
  S:     8 RLDILLVEKNIFDSREKAKIAIMEGKIFVNGQRVDKCGQKIKVDSEIEFKGEVMPYVSRGGFKLEKAMKSFDIELQGKVCMDIGASTGGFTDCMLQNGATKVFSIDVGYGQFAWKLRIDPRVVCMERTNARYLTFEDLGEYPNFSSIDVSFISLKKIVPAVVNLLSDDGEVVALIKPQFEAGRDKVGKKGVVREASTHKEVITNILNFLVENNLKIKGLDHSPIKGPEG-NIEYLVYF 244
>gi|18310800|ref|NP_562734.1| hemolysin A [Clostridium perfringens str. 13] >gi|18145481|dbj|BAB81524.1| probable hemolysin [Clostridium perfringens str. 13] (271 aa)
Score = 365, Expect = 3.5e-33, Identities = 94/243 (38%), Positives = 139/243 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK--YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           +K RLD+ LV +  A SR  A+  I    V I  + + K+   V     + I   EK  +VSR  +KL  A++ F IDL  K  +DIG+STGGFT  +L+N+  KV+SIDVG  Q   +L+ + +V+ +E+TN R +    I +  DF +IDVSFIS+  +   +  L  +N + +AL+KPQFE G+ K+G      +   HK++I   ++F     +  LG   SPIKG +  N EYL YL+  N
  S:     7 KKERLDVLLVEQGIAESREKAKRYIMAGMVFIGEKRVDKAGEKVPVSSNI-IFRGEKLPFVSRGGFKLDKAVKSFGIDLKGKRCLDIGASTGGFTDCMLQNDASKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTPEQIGELCDFASIDVSFISLTTVLPAVLNLLNDNGEVMALIKPQFEAGREKVGKKGVVREASTHKEVIKKIVDFALSHKLNILGLDFSPIKGPEG-NIEYLIYLKKDN 250
>gi|77918663|ref|YP_356478.1| rRNA methylase [Pelobacter carbinolicus DSM 2380] >gi|77544746|gb|ABA88308.1| predicted rRNA methylase [Pelobacter carbinolicus DSM 2380] (252 aa)
Score = 364, Expect = 4.3e-33, Identities = 84/243 (34%), Positives = 137/243 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +QK RLD  LV    A+SR  A+ LI   +VV+    + K+   V     + +  E+  YVSR   KL+ A++ F++D+  K+A+D+G+STGGFT  LL+    +VY++DVG  QL   L+++++V++LE+TN R ++   + +K     ID SFIS++ +      L  +  + +AL+KPQFE+G+  +G          H+ ++    +    L  + LG   SPI G K  N E+L YL  +
  S:     6 VQKERLDKLLVVRGLAQSRERARALILAGQVVVGHHTVDKAGAQVATDVSLRLKGEDIPYVSRGGLKLEKALDAFSVDVTGKVAMDVGASTGGFTDCLLQRGAARVYAVDVGYGQLAWSLRQDSRVVNLERTNIRHLQPQALPEKPSLAVIDASFISLDKVLPATLGLLTDQAEIVALIKPQFEVGRGAVGKGGVVRDASQHQAVVERIRQLSEQLGCQVLGVTESPILGPKG-NREFLIYLSKR 249
>gi|1708222|sp|Q06803|HLYA_TREHY Hemolysin A >gi|296626|emb|CAA43858.1| hemolysin [Brachyspira hyodysenteriae] (240 aa)
Score = 362, Expect = 6.6e-33, Identities = 98/234 (41%), Positives = 147/234 (62%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITI-DVSFISIN----LIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED--HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +RLD Y+ +E Y  SR  AQD+I    V +NG  ++     + + D +E+++  KYVSRA  KL+ A   F I + NKI +DIG+STGGFT  LL++  KKVY++DVG NQL  +L+ +N+V+S+E  N ++I   +  D+I  + + DVSFISI     +IF ++  L++  W  + L+KPQFE  ++   +KG    +D   +KI+NN I  +     K +   +SPIKGAK  N EYL
  S:     1 MRLDEYVHSEGYTESRSKAQDIILAGCVFVNGVKVTSKAHKIKDTDNIEVVQNIKYVSRAGEKLEKAFVEFGISVENKICLDIGASTGGFTDCLLKHGAKKVYALDVGHNQLVYKLRNDNRVVSIEDFNAKDINKEMFNDEIPSVIVSDVSFISITKIAPIIFKELNNLEF--W--VTLIKPQFE-AERGDVSKGGIIRDDILREKILNNAISKIIDCGFKEVNRTISPIKGAKG-NIEYL 235
>gi|115484941|ref|NP_001067614.1| Os11g0247400 [Oryza sativa (japonica cultivar-group)] >gi|62734664|gb|AAX96773.1| hemolysin A, putative [Oryza sativa (japonica cultivar-group)] >gi|77549558|gb|ABA92355.1| hemolysin A family protein, expressed [Oryza sativa (japonica cultivar-group)] >gi|113644836|dbj|BAF27977.1| Os11g0247400 [Oryza sativa (japonica cultivar-group)] (295 aa)
Score = 362, Expect = 6.9e-33, Identities = 86/236 (36%), Positives = 138/236 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +K RLD   +      SR   Q  I   KV+++G++++K+ T V++   +EI  E  KYV RA +KL+AAI+ F ID + K+A+D G STGGFT  LL++    VY +DVG  Q+ E+++ + +V  +E+TN R +    +   +D +T+D+SFISI L+   + ++   +   I L+KPQFE  +      G  +    HK++++  I  +      N G+I SPIKGA+  N E+L
  S:    42 KKRRLDEVCLERFQQYSRTYIQSWILQGKVLVDGRVVNKAGTQVSDKSIIEIKAEIPKYVCRAGHKLEAAIKEFGIDCDEKVALDSGLSTGGFTDCLLQHGASHVYGVDVGYGQVAEKIRVHERVSVIERTNLRYLTE--LPQLVDLVTLDLSFISILLVMPAVVKVMKTDSTLITLIKPQFEARRSQVGGGGIVRDPLVHKEVLDRIISGVEQFGFCNKGWIESPIKGAEG-NKEFL 276
>gi|116629412|ref|YP_814584.1| rRNA methylase [Lactobacillus gasseri ATCC 33323] >gi|116094994|gb|ABJ60146.1| Predicted rRNA methylase [Lactobacillus gasseri ATCC 33323] (270 aa)
Score = 362, Expect = 7.9e-33, Identities = 95/240 (39%), Positives = 139/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVI-NGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R D+ L  +    SR  AQ  I    V   N Q I KS     E +   I ++ +KYVSR  +KL+ A++ FNI+L +KI +DIG+STGGFT V L+N  K VY++DVG NQL  +L+ N +V+ +E+ NFR  + +   D + DF   DVSFIS++LI   + E+  ++  ++ L+KPQFE G + +G        E H  +I + ++    +    LG   SPIKG K  N E+L +L
  S:     1 MVKKRADVLLFEQGLFNSRSQAQRAIMAGLVNDHNHQRIDKSGEKFPEDETFHIKDDGKKYVSRGGFKLEKALQVFNINLKDKICLDIGASTGGFTDVALQNGAKLVYALDVGYNQLAWKLRDNPQVVVMEKQNFRYSKPADFTDGLPDFAMTDVSFISLDLIMPPMYEILKDHCDAVCLIKPQFEAGPENVGKHGIVHDHEVHANVIKHTMQMAQKIGFNVLGVDYSPIKGGKG-NIEFLIHL 243
>gi|58337601|ref|YP_194186.1| hemolysin-like protein [Lactobacillus acidophilus NCFM] >gi|58254918|gb|AAV43155.1| hemolysin-like protein [Lactobacillus acidophilus NCFM] (270 aa)
Score = 362, Expect = 8.5e-33, Identities = 95/241 (39%), Positives = 140/241 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVI-NGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K R D+ L  +    SR  AQ  I    V   N Q I KS T   E +K  + ++ +KYVSR  +KL+ A++ FNI+L +KI +DIG+STGGFT V L+N  K VY++DVG NQL  QL+ + +V+ +E+ NFR  +       + DF   DVSFIS++LI   +  +  +   ++ L+KPQFE G + +G        E HK++I + ++    +    LG   SPIKG K  N E+L +L+
  S:     1 MAKQRADVLLAEQGIFHSRSAAQRAIMAGLVSDHNHQRIDKSGTKFPEDEKFYVKDDGKKYVSRGGFKLEKALKVFNINLKDKICLDIGASTGGFTDVALQNGAKMVYALDVGYNQLAWQLRDDPRVVVMEKQNFRYSKPEDFDQGLPDFAMTDVSFISLDLIMPPMYAILKDQCDAVCLIKPQFEAGPENVGKHGIVHDHEVHKQVIEHTMQEALKIGFNVLGVDYSPIKGGKG-NIEFLIHLQ 244
>gi|125717532|ref|YP_001034665.1| rRNA methylase, putative [Streptococcus sanguinis SK36] >gi|125497449|gb|ABN44115.1| rRNA methylase, putative [Streptococcus sanguinis SK36] (271 aa)
Score = 361, Expect = 9.0e-33, Identities = 86/245 (35%), Positives = 143/245 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVI--NGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K R+D+    +    +R  A+  +    V+   NGQ   K    ++   ++ +  E+ +YVSR   KL+ A++ F+I + +++ +DIG+STGGFT V+L+   K VY++DVGTNQL  +L+++ +V+S+EQ NFR  + +  + +  F +IDVSFIS++LI   + E+   + + +AL+KPQFE G++    KG  K +  H  ++     F+        G   SPI+G +  N E+L YLE   E
  S:     1 MAKERVDVLAYRQGLFETREQAKRGVMAGLVIAAANGQRFDKPGEKIDAATELRLKGEKLRYVSRGGLKLEKALQVFDISVADRVTLDIGASTGGFTDVMLQYGAKLVYAVDVGTNQLAWKLRQDERVVSMEQYNFRYAQRTDFEQEPSFASIDVSFISLSLILPALHEILARDGQVVALIKPQFEAGREQIGKKGIVKDKKVHLAVLEKVTAFMLEAGFSVRGLDFSPIQGGQG-NVEFLAYLEKSTE 248
>gi|154251238|ref|YP_001412062.1| hemolysin A [Parvibaculum lavamentivorans DS-1] >gi|154155188|gb|ABS62405.1| hemolysin A [Parvibaculum lavamentivorans DS-1] (247 aa)
Score = 361, Expect = 9.3e-33, Identities = 87/236 (36%), Positives = 133/236 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +K RLDI L+    A +R  AQ  I    V + G+I +K   LV    ++ +L  E  YVSR A KL  A++HF ID +  + +D+G+STGGFT+VLLE  V  V +IDVG  QL E++ ++ +V ++E  N ++I   ++  +ID I  D+SFIS+         L     + IAL+KPQFE+G + +G      +   H+++  N   +L  +  +  G + SPIKG    N E+L
  S:     4 EKRRLDIALLERGLASTRARAQAAIKAGHVRVAGEIATKPADLVAPEAEISMLAPEHPYVSRGALKLVHALDHFGIDPSGSLCLDLGASTGGFTEVLLERGVASVVAIDVGHGQLAEKIAQDTRVRAIEGLNAKDISRDIVPGRIDLIVADLSFISLEKALPPALALAERGARLIALIKPQFEVGPENVGKGGIVREPALHERVCANIAGWLEKMGWRVEGIVESPIKGGDG-NREFL 240
>gi|167464888|ref|ZP_02329977.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Paenibacillus larvae subsp. larvae BRL-230010] (278 aa)
Score = 361, Expect = 9.7e-33, Identities = 89/238 (37%), Positives = 135/238 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS-LIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K R+D+ LV + Y  SR  A+  I    V +N + + K    +     + +      YVSR   KL+ A++ F+ID+   + +DIGSSTGGFT   L++    VY+IDVG NQL+  L+ + +V  +E+TNFR + S+ L   K +F TIDVSFIS+ +I   +K++  N  + +AL+KPQFE G+ K+G +        H ++I   +EF   +     G   SPI G +  N E+L YL
  S:     4 KERIDVLLVEQGYYESREKAKAAIMAGLVFVNEESVDKPGIKICRKADIRVKGAVHPYVSRGGLKLEKALKLFSIDVTGAVMLDIGSSTGGFTDCALQHGASYVYAIDVGYNQLDWSLRSDERVNVMERTNFRYLTSADLQGPKPNFATIDVSFISLKIILPPLKQILGNFGEVVALIKPQFEAGREKVGKSGVVRDPAVHVQVIEEVVEFAETIGFFMKGLTFSPITGGEG-NIEFLVYL 243
>gi|85859632|ref|YP_461834.1| rRNA methylase [Syntrophus aciditrophicus SB] >gi|85722723|gb|ABC77666.1| rRNA methylase [Syntrophus aciditrophicus SB] (277 aa)
Score = 361, Expect = 1.0e-32, Identities = 89/245 (36%), Positives = 142/245 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +KIRLD+ LVN   + SR  A+ LI +  V+++ +   K+  LV+    V I  ++  YVSR   KLK A++ F ID+ + +A+D+G+STGGFT  LL+   ++VY++DVG  QL  +L+ + +VI +E+TN R  + + +   +D +TID SFIS+ L+     +        +AL+KPQFE+GK      G  +     + ++N+   FL  + ++ LG IVSP+ G K  N E+        EK
  S:     6 EKIRLDLLLVNRGLSASRERARALILSGAVLVDEKPADKAGALVSCAASVRIKGKDHPYVSRGGLKLKGALDAFQIDVRDLVALDVGASTGGFTDCLLQEGARRVYALDVGYGQLAWKLRTDPRVICIERTNIRYFDGTGMDVPVDLVTIDASFISLKLVIPAALKFLGEGGLLLALIKPQFEVGKGQVGKGGVVREPALRQNVLNDLTAFLRDMGLEVLGSIVSPLPGPKG-NREFFVSARLPEEK 251
>gi|148264094|ref|YP_001230800.1| hemolysin A [Geobacter uraniireducens Rf4] >gi|146397594|gb|ABQ26227.1| hemolysin A [Geobacter uraniireducens Rf4] (250 aa)
Score = 360, Expect = 1.1e-32, Identities = 85/243 (34%), Positives = 142/243 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           M K RLD  L++   A+SR  A+ LI   +VV++  +  K+  +V    ++ +  E   +VSR   KL+ A++ F ID+N  + +D+G+STGGFT  LL+   KK++++DVG  QL  +L+++ +V++LE+TN R +E   +++  D   ID SFIS++ +      L  +    +AL+KPQFE+G+ ++G        + H ++I+      + L++   G   SPI G K  N E+L YLE K
  S:     1 MAKERLDKILLDRGLAQSRERAKALIMAGQVVVDDHLADKAGQMVALEAEIRLKGEVHPFVSRGGLKLQKALDEFAIDVNGLVVMDVGASTGGFTDCLLQRGAKKIFAVDVGYGQLAWKLRQDERVVNLEKTNIRYLEPDRLEEIPDMAVIDASFISLDKVLPATIRLISDTGVVVALIKPQFEVGRGEVGKGGVVRDEKKHAEVISAITVLAADLDLTIKGITESPILGPKG-NKEFLIYLEKK 244
>gi|125973345|ref|YP_001037255.1| hemolysin A [Clostridium thermocellum ATCC 27405] >gi|196252472|ref|ZP_03151129.1| hemolysin A [Clostridium thermocellum DSM 4150] >gi|125713570|gb|ABN52062.1| hemolysin A [Clostridium thermocellum ATCC 27405] >gi|196198081|gb|EDX92921.1| hemolysin A [Clostridium thermocellum DSM 4150] (270 aa)
Score = 360, Expect = 1.2e-32, Identities = 95/243 (39%), Positives = 144/243 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           M+K RLD+ LVN  + +SR  A+  I    V +N +   K    V ++D +  ++E    YVSR   KL+ AI  FNIDL +K AID+G+STGGFT  +L+N  KKV+++DVG  QL  +L+ + +V+ +E+TN R ++   I    DF +IDVSFIS+  +   +  L  ++ + + L+KPQFE G+ K+G        + H++++ + I F     +K  G   SPIKG +  N EYL YL  K
  S:     1 MKKERLDVLLVNRGFFQSREKAKSSIMAGVVFVNDKKEDKPGVKV-DVDSIITIKENVHPYVSRGGLKLEKAIRVFNIDLKDKTAIDVGASTGGFTDCMLKNGAKKVFAVDVGYGQLAWELRNDERVVCMERTNIRYVKPEDIGILADFSSIDVSFISLKKVIPVVINLLKDDGELLCLIKPQFEAGREKVGKHGVVRDKKVHEEVVKDIITFSLKEGLKIRGLDFSPIKGPEG-NIEYLVYLSKK 244
>gi|172035830|ref|YP_001802331.1| hemolysin A [Cyanothece sp. ATCC 51142] >gi|171697284|gb|ACB50265.1| hemolysin A [Cyanothece sp. ATCC 51142] (270 aa)
Score = 360, Expect = 1.3e-32, Identities = 92/240 (38%), Positives = 132/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFRE-IESSLIKD--KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K+RLD+ LV  N   SR  AQ  I   +V +N +II K  T +     +E+ ++  YVSR   KL+ A++ F I +  +I +D G STGGFT  LL+   K+VY +DVG  Q+   L+++ +VI  E+TNFR  I   L +D  K D   +DVSFIS+  +   +  L     + I L+KPQFE+G+     KG  +  +D  + I   ++    L     G  VSPI G    NTEYL +L
  S:     1 MSKLRLDLLLVERNLCSSRQQAQRCIRAGEVKVNQRIIDKPGTEIEITADIELKQKPPYVSRGGLKLEKALKMFKIAVEGRICLDGGISTGGFTDCLLQAGAKQVYGVDVGYGQVAWSLRQDQRVILKERTNFRYLIPEELYQDNPKADLGVMDVSFISLTKVLEPLWNLLQEPREVILLIKPQFEVGRSRVGKKGVVRDPQDQSQAIYQVLQTAYTLGWFCCGLTVSPITGPAG-NTEYLAWL 243
>gi|150020827|ref|YP_001306181.1| hemolysin A [Thermosipho melanesiensis BI429] >gi|149793348|gb|ABR30796.1| hemolysin A [Thermosipho melanesiensis BI429] (264 aa)
Score = 360, Expect = 1.3e-32, Identities = 95/243 (39%), Positives = 144/243 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K R+D+ LV +    SR  A+ LI +  V++N + + K   LV+    + I ++EKYVSR  YKL+ A + F  ++ +KIA DIG+STGGFT  LL+N +KKVY +DVG  QL+ +++ N K I LE+TN + ++   +++K+D    DVSFISI  IF  IK++  ++ +++ L+KPQFE GK K+G        + H ++I   I       +K +    S IKG    N EY  YL+   E
  S:     2 KERIDLLLVKKGLVESREKAKRLIMSGNVIVNEERVDKVGKLVDINATIRIKQKEKYVSRGGYKLEGAHKSFKFEIKDKIACDIGASTGGFTDFLLQNGIKKVYCVDVGYGQLHWKIRNNKKTIVLEKTNAKNLD---LEEKVDLAVCDVSFISITKIFPTIKKILKDDGEAVVLIKPQFEAGKSKVGKGGIVRDPKVHVEVITKVINSTIANGLKPISLDYSKIKGTDG-NIEYFLYLKNSKE 241
>gi|186685337|ref|YP_001868533.1| hemolysin A [Nostoc punctiforme PCC 73102] >gi|186467789|gb|ACC83590.1| hemolysin A [Nostoc punctiforme PCC 73102] (272 aa)
Score = 360, Expect = 1.4e-32, Identities = 92/245 (37%), Positives = 134/245 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K RLD  LV  N   SR +AQ LI   +V +N Q++ K  T V+   ++ I E   +VSR   KL  A+  F I +  +I +D G STGGFT  LL+   K+VY IDVG  Q++ +L+ +++VI  E+TN R++    +    D I D   +DVSFIS+  I   + +L   N +++ L+KPQFE+G+     KG  +   D    I   ++    L  K  G   SPI G    N EYL +L  ++E
  S:     1 MAKQRLDTLLVELNLCSSRALAQRLIQAGEVTVNQQLVDKPGTEVDISAQINIKERSPFVSRGGEKLSKALSVFAIPVAERICLDGGISTGGFTDCLLQAGAKQVYGIDVGYGQVDWRLRNDSRVILRERTNLRQLRPDELYSENDPIPDLAVVDVSFISLTKILPALWQLTQANREAVLLVKPQFEVGRSRVGKKGVVRDPNDQADAIFQVLQVAHGLGWKYKGLTWSPITGPAG-NIEYLLWLAMESE 249
>gi|191164617|ref|ZP_03026479.1| hemolysin A [Geobacter sp. M21] >gi|190994272|gb|EDV69738.1| hemolysin A [Geobacter sp. M21] (257 aa)
Score = 359, Expect = 1.5e-32, Identities = 85/245 (34%), Positives = 138/245 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K RLD  ++    A SR  A+ LI   +VV++  +  K+  +V+   ++ +  E   YVSR   KL   +E F ID+    AID+G+STGGFT  LL+    +VY++DVG  QL  +L+++ +V+S+E+TN R +E  ++ +  D   ID SFIS++ +      L       +AL+KPQFE+G+ ++G        + H++++ +  E    L +  LG   SPI G K  N E+L +L+ + E
  S:     1 MTKERLDKLVLERGLAPSRERAKALIMAGQVVVDDHLADKAGLMVSIEAEIRLKGEPLPYVSRGGLKLAEGLERFGIDVAGLCAIDVGASTGGFTDCLLQRGATRVYAVDVGYGQLAWKLREDPRVVSMEKTNIRHLEPGMLPESPDLAVIDASFISLDKVLPPTLRLIKPEGIVVALIKPQFEVGRGQVGKGGVVRDEKKHQEVVESIGELARGLGLLVLGVCDSPILGPKG-NKEFLIHLKKQGE 246
>gi|110800396|ref|YP_696501.1| hemolysin A [Clostridium perfringens ATCC 13124] >gi|110803042|ref|YP_699101.1| hemolysin A [Clostridium perfringens SM101] >gi|168210819|ref|ZP_02636444.1| hemolysin A [Clostridium perfringens B str. ATCC 3626] >gi|168215446|ref|ZP_02641071.1| hemolysin A [Clostridium perfringens NCTC 8239] >gi|182625677|ref|ZP_02953446.1| hemolysin A [Clostridium perfringens D str. JGS1721] >gi|110675043|gb|ABG84030.1| hemolysin A [Clostridium perfringens ATCC 13124] >gi|110683543|gb|ABG86913.1| hemolysin A [Clostridium perfringens SM101] >gi|170711111|gb|EDT23293.1| hemolysin A [Clostridium perfringens B str. ATCC 3626] >gi|177909079|gb|EDT71554.1| hemolysin A [Clostridium perfringens D str. JGS1721] >gi|182382420|gb|EDT79899.1| hemolysin A [Clostridium perfringens NCTC 8239] (271 aa)
Score = 359, Expect = 1.6e-32, Identities = 93/243 (38%), Positives = 138/243 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK--YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           +K RLD+ LV +  A SR  A+  I    V I  + + K+   V     + I   EK  +VSR  +KL  A++ F IDL  K  +DIG+STGGFT  +L+N+  KV+SIDVG  Q   +L+ + +V+ +E+TN R +    I +  DF +IDVSFIS+  +   +  L  +  + +AL+KPQFE G+ K+G      +   HK++I   ++F     +  LG   SPIKG +  N EYL YL+  N
  S:     7 KKERLDVLLVEQGIAESREKAKRYIMAGMVFIGEKRVDKAGEKVPVSSNI-IFRGEKLPFVSRGGFKLDKAVKSFGIDLKGKRCLDIGASTGGFTDCMLQNDASKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTPEQIGELCDFASIDVSFISLTTVLPAVLNLLNDKGEVMALIKPQFEAGREKVGKKGVVREASTHKEVIKKIVDFALSHKLNILGLDFSPIKGPEG-NIEYLIYLKKDN 250
>gi|168186202|ref|ZP_02620837.1| hemolysin A [Clostridium botulinum C str. Eklund] >gi|169295649|gb|EDS77782.1| hemolysin A [Clostridium botulinum C str. Eklund] (270 aa)
Score = 359, Expect = 1.7e-32, Identities = 94/241 (39%), Positives = 142/241 (58%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL----EYKNE 245
           RLD+ LV +    SR  A+  I   KV +NGQ + K    +    ++E   E   YVSR  +KL+ A++ F+I+L  K+ +DIG+STGGFT  +L+N   KV+SIDVG  Q   +L+ + +V+ +E+TN R +    + +  +F +IDVSFIS+  I   +  L  ++ + +AL+KPQFE G+ K+G      +   HK++I N + FL   ++K  G   SPIKG +  N EYL Y      YK E
  S:     8 RLDVLLVEKKIFDSREKAKIAIMEGKVFVNGQRVDKCGQKIKVDSEIEFKGEVMPYVSRGGFKLEKAMKSFDIELQGKVCMDIGASTGGFTDCMLQNGATKVFSIDVGYGQFAWKLRIDPRVVCMERTNARYLTLEDLGECANFSSIDVSFISLRKIVPAVANLLSDDGEVVALIKPQFEAGRDKVGKKGVVREASTHKEVITNILNFLVENDLKIKGLDHSPIKGPEG-NIEYLVYFTKDKNYKKE 253
>gi|168214392|ref|ZP_02640017.1| hemolysin A [Clostridium perfringens CPE str. F4969] >gi|169343538|ref|ZP_02864537.1| hemolysin A [Clostridium perfringens C str. JGS1495] >gi|169298098|gb|EDS80188.1| hemolysin A [Clostridium perfringens C str. JGS1495] >gi|170714133|gb|EDT26315.1| hemolysin A [Clostridium perfringens CPE str. F4969] (271 aa)
Score = 359, Expect = 1.8e-32, Identities = 93/243 (38%), Positives = 138/243 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK--YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           +K RLD+ LV +  A SR  A+  I    V I  + + K+   V     + I   EK  +VSR  +KL  A++ F IDL  K  +DIG+STGGFT  +L+N+  KV+SIDVG  Q   +L+ + +V+ +E+TN R +    I +  DF +IDVSFIS+  +   +  L  +  + +AL+KPQFE G+ K+G      +   HK++I   ++F     +  LG   SPIKG +  N EYL YL+  N
  S:     7 KKERLDVLLVEQGIAESREKAKRYIMAGMVFIGEKRVDKAGEKVPVSSNI-IFRGEKLPFVSRGGFKLDKAVKSFGIDLKGKRCLDIGASTGGFTDCMLQNDASKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTPEQIGELCDFASIDVSFISLTTVLPAVLNLLNDKGEVMALIKPQFEAGREKVGKKGVVREASTHKEVIKKIVDFALSHKLNILGLDFSPIKGPEG-NIEYLIYLKKDN 250
>gi|154249375|ref|YP_001410200.1| hemolysin A [Fervidobacterium nodosum Rt17-B1] >gi|154153311|gb|ABS60543.1| hemolysin A [Fervidobacterium nodosum Rt17-B1] (263 aa)
Score = 358, Expect = 2.0e-32, Identities = 88/206 (42%), Positives = 132/206 (64%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIE 209
           +RLD  L+ + +  SR  AQ +I N  V+++G++ +K +   +   K+ IL++ KYVSRA YKL+  ++ + ID++ KIA DIGSSTGGF   LL+N VKKVY++DV T QL+ ++  +++V+ +E+ N R I    I DK+D ITIDVSFISI  +   I +L  N  K I+L+KPQFE      T KG  K  + H ++I   ++
  S:     6 LRLDQLLILKGFVESRTKAQQMIENGLVLLDGKVCTKPSKKCHSDSKIIILDDLKYVSRAGYKLEGLLKEYKIDVSGKIACDIGSSTGGFIDCLLQNGVKKVYAVDVNTKQLHSKISLDDRVVKIEK-NARYISKKDISDKLDIITIDVSFISITKLLEGILQLSENYTKIISLIKPQFE---TTNTDKGIVKDKKTHIEVIRKIVK 208
>gi|145619739|ref|ZP_01775785.1| hemolysin A [Geobacter bemidjiensis Bem] >gi|144943989|gb|EDJ79068.1| hemolysin A [Geobacter bemidjiensis Bem] >gi|197088391|gb|ACH39662.1| hemolysin A [Geobacter bemidjiensis Bem] (257 aa)
Score = 358, Expect = 2.3e-32, Identities = 84/245 (34%), Positives = 139/245 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K RLD  ++    A SR  A+ LI   +VV++  +  K+  +V    ++ +  E   YVSR   KL   +E F I +    AID+G+STGGFT  LL+    +VY++DVG  QL  +L+++++V+S+E+TN R +E  ++ +  D   ID SFIS++ +      L   +   +AL+KPQFE+G+ ++G        + H++++ +  E    L +K LG   SPI G K  N E+L +L+ + +
  S:     1 MTKERLDKLVLERGLAPSRERAKALIMAGQVVVDDHLADKAGLMVPVEAEIRLKGEPLPYVSRGGLKLAEGLERFGIVVAGLCAIDVGASTGGFTDCLLQRGATRVYAVDVGYGQLAWKLREDSRVVSMEKTNIRHLEPGMLPESPDLAVIDASFISLDKVLPPTLRLIKPDGVVVALIKPQFEVGRGQVGKGGVVRDEKKHQEVVESIGELARGLGLKVLGVCDSPILGPKG-NKEFLIHLQKQGD 246
>gi|189485330|ref|YP_001956271.1| putative rRNA methylase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287289|dbj|BAG13810.1| putative rRNA methylase [uncultured Termite group 1 bacterium phylotype Rs-D17] (250 aa)
Score = 357, Expect = 2.6e-32, Identities = 89/240 (37%), Positives = 137/240 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           RLD+ L  + +A +R  AQ  I +  + +N QI  +  TLV + D +E+     YVSR   KL++ +E   IDL   I +DIG+STGGFT  +L+    KVY++DVG  QL+ +L+++ +V+++E  NFR  ++S +KD IDF TIDVSFIS++ I          N   +A++KPQFEL +     KG  + +   +K IN   +    L  K +    S +KG +  N E+  +L  K+
  S:     9 RLDVLLFEKGFAETRTKAQAFIMSGNIFVNNQIQYRPGTLVGKEDSIEVRNANPYVSRGGLKLESVLETLAIDLEGYICLDIGASTGGFTDCMLQKGAIKVYAVDVGAGQLHYRLRQDKRVVNIENVNFRYFDNSFLKDNIDFTTIDVSFISLDKILPVAYRSISKNGFVLAMIKPQFEL-EASEIKKGVVRDKKLRQKAINKIKKVALDLGFKIISEADSCLKGLRG-NLEHFIFLSKKH 247
>gi|156740575|ref|YP_001430704.1| hemolysin A [Roseiflexus castenholzii DSM 13941] >gi|156231903|gb|ABU56686.1| hemolysin A [Roseiflexus castenholzii DSM 13941] (272 aa)
Score = 357, Expect = 2.6e-32, Identities = 87/239 (36%), Positives = 135/239 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK--------IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K+RLD  LV    A +R  AQ LI   +V +NG    K   LV +  ++E++    YVSR  YKL  A++ F +   N +A+DIG+STGGFT VLL+    +VY++DVG   ++ +L+++ +V+ LE+TN R +E     ++         D   IDVSFIS+ L+   ++ L   N   IAL+KPQFE G  ++G          H  ++ + + F + + +   G   SPI G    N E+L +L
  S:     3 KKVRLDQLLVQRGLAETRARAQALILAGEVRVNGVTRHKGGELVPDDAEIEVIGALPYVSRGGYKLAHALDTFALSPANLVALDIGASTGGFTDVLLQRGAARVYAVDVGYGLIDWRLRQDPRVVVLERTNIRYLEVLPSPEEEALAAPVLADCAVIDVSFISLKLVLPAVQRLLQPNAWMIALIKPQFEAGPAQVGKGGVVRDPAVHAAVVRDVLTFAATIGLSPHGLTRSPITGPAG-NVEFLAWL 249
>gi|75910708|ref|YP_325004.1| hemolysin A [Anabaena variabilis ATCC 29413] >gi|75704433|gb|ABA24109.1| Hemolysin A [Anabaena variabilis ATCC 29413] (272 aa)
Score = 356, Expect = 3.2e-32, Identities = 94/245 (38%), Positives = 132/245 (53%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K RLD  LV  N   SR +AQ LI   +V +N Q+I K  T V+   +++I E  ++VSR   KL   +E F I +N ++ +D G STGGFT  LL+   K VY IDVG  Q +  L+ N +VI  E+TN R+++   +    D I D   +DVSFIS+  I   + +L     +++ L+KPQFE+GK     KG  +   D    I    +    L  K  G   SPI G    N EYL +L  ++E
  S:     1 MAKQRLDNLLVELNLCNSRTLAQRLIQAGEVTVNEQVIDKPGTEVDVAAQIKIKERSRFVSRGGEKLAKGLELFAISVNGRVCLDGGISTGGFTDCLLQAGAKLVYGIDVGYGQTDWGLRNNPQVILRERTNLRQLQPEDLYGDGDAIPDLAVVDVSFISLTKILPALWQLTQPPREAVLLVKPQFEVGKSRVGKKGVVRDPHDQADAIFQVWQAADKLGWKYKGLTWSPITGPAG-NIEYLLWLNMESE 249
>gi|186899963|ref|ZP_02972923.1| hemolysin A [Cyanothece sp. PCC 7424] >gi|186692899|gb|EDU17515.1| hemolysin A [Cyanothece sp. PCC 7424] (270 aa)
Score = 355, Expect = 4.7e-32, Identities = 93/246 (37%), Positives = 135/246 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK----IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K RLD  LV  N   SR +AQ LI   +V +N QII K  T V+   ++++  +  YVSR   KLK AIE F I +  +I +D G STGGFT  LL+   K+VY +DVG  Q+   L+++ +VI  E+TNFR +  S +  +     D   +D+SFIS+  + + + EL  +  + + L+KPQFE+G+     KG  +  +DH + I    +    L     G   SPI G    N EYL +L    E+
  S:     1 MAKQRLDNLLVTLNLCSSRQLAQRLIRAGEVRVNQQIIDKPGTEVDPGAEIQLQAKPLYVSRGGEKLKKAIEFFKIPVEGRICLDGGISTGGFTDCLLQYGAKRVYGVDVGYGQVAWSLRQDQRVILKERTNFRYLTYSELYSEDDPPADLGVMDLSFISLTKVLHPLWELLVSPREVVLLIKPQFEVGRDRVGKKGVVRNPKDHAQAIFGVWQGAKGLGWNYGGLTWSPITGPAG-NVEYLLWLSMTAEQ 250
>gi|184155735|ref|YP_001844075.1| hemolysin [Lactobacillus fermentum IFO 3956] >gi|183227079|dbj|BAG27595.1| hemolysin [Lactobacillus fermentum IFO 3956] (271 aa)
Score = 354, Expect = 6.2e-32, Identities = 90/241 (37%), Positives = 143/241 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLI--------TNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR-EIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M+K R+DI LV +    SR  A+  +         N ++   GQ I  + TL  +  K+       YVSR   KL  A++ F I + NK+ +DIGSSTGGFT V+L+N  K+ Y++DVGTNQL  QL+ + +V+ +EQTNFR   +      + +F +IDVSFIS+++    + ++     + +AL+KPQFE GK+ +G      + + H++++   + F++      LG   SPIKG +  N E+L +L+
  S:     1 MEKERVDILLVKQGLFDSREQAKRAVMAGEILGLNNERLDKPGQKIPVTTTLHMKGKKM------PYVSRGGLKLAKALQVFKISVENKVVLDIGSSTGGFTDVMLQNGAKRSYALDVGTNQLVWQLRDDPRVVVMEQTNFRYSKKEDFTAGQPEFASIDVSFISLSMTLPPLAQILTPGGEVVALIKPQFEAGKEHVGKHGIIRERKVHEEVLTRVLSFMAADGFDVLGLDYSPIKGGQG-NVEFLAHLK 244
>gi|42519418|ref|NP_965348.1| hemolysin-like protein [Lactobacillus johnsonii NCC 533] >gi|41583706|gb|AAS09314.1| hemolysin-like protein [Lactobacillus johnsonii NCC 533] (270 aa)
Score = 354, Expect = 6.4e-32, Identities = 96/240 (40%), Positives = 136/240 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVI-NGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R D+ L  +    SR  AQ  I    V   N Q I KS     E +   I ++ +KYVSR  +KL+ A++ FNIDL  KI +DIG+STGGFT V L+N  K VY++DVG NQL  +L+ N +V+ +E+ NFR  +     D + DF   DVSFIS++LI   + E+  +   ++ L+KPQFE G + +G        E H  +I + ++    +    LG   SPIKG K  N E+L +L
  S:     1 MSKKRADVLLFEQGLFNSRSQAQRAIMAGLVNDHNHQRIDKSGEKFPEDEVFHIKDDGKKYVSRGGFKLEKALQVFNIDLKGKICLDIGASTGGFTDVALQNGAKLVYALDVGYNQLAWKLRDNPQVVVMEKQNFRYSKPVDFTDGLPDFAMTDVSFISLDLIMPPMYEILKDKCDAVCLIKPQFEAGPENVGKHGIVHDHEVHANVIKHTMKVAQKIGFNILGVDYSPIKGGKG-NIEFLIHL 243
>gi|172056946|ref|YP_001813406.1| hemolysin A [Exiguobacterium sibiricum 255-15] >gi|171989467|gb|ACB60389.1| hemolysin A [Exiguobacterium sibiricum 255-15] (268 aa)
Score = 354, Expect = 6.9e-32, Identities = 83/239 (34%), Positives = 136/239 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLV-NELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFY 239
           ++KIRLD+ LV      +R  A+  I    V    + + K+   V +++D     +   YV R  YK++ A+  F+ID++ +  +DIGSSTGGFT   L+N    +Y++DVG+NQL+ +L+ +++V ++E+TNFR     +   +  F TIDVSFIS+ LI   +K +       IAL+KPQFE G+     KG  + E  H +++   ++F       ++ L +  SPI G +  N E+L +
  S:     4 VKKIRLDVLLVERGLCETREKAKRTIMAGLVFSGTERLEKAGEKVKSDIDLTVKGQVMPYVGRGGYKMEKALAVFDIDVSGRTGLDIGSSTGGFTDCALQNGAAHMYALDVGSNQLDWKLRSDDRVTAMEKTNFRHATPDMFPVQPSFATIDVSFISLRLILPPLKAILAEGGDVIALVKPQFEAGRDDVGKKGIVRDERIHDRVLKEMVDFFVREGFYVQQLDF--SPITGGEG-NIEFLLH 243
>gi|164688606|ref|ZP_02212634.1| hypothetical protein CLOBAR_02251 [Clostridium bartlettii DSM 16795] >gi|164603019|gb|EDQ96484.1| hypothetical protein CLOBAR_02251 [Clostridium bartlettii DSM 16795] (275 aa)
Score = 353, Expect = 7.4e-32, Identities = 95/243 (39%), Positives = 144/243 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K R+D+ LV + +  SR  A+  I    V ++ Q   K+ T V    K+E+      YVSR   KL+ A+++F+I L +K+ +DIG+STGGFT  +L+N  +KV+SIDVG  QL  +L+++++V+ +E+TN R +     K+  DF +IDVSFIS+ L+      L     + +AL+KPQFE GK K+G      +   H ++I    +F   +  +I NL Y  SPIKG +  N EYL +L   NE
  S:     7 KKRIDVLLVEQGFFESREKAKRSIMAGLVFVDNQKCDKAGTEVKTDAKIEVKGNPIPYVSRGGLKLEKAMKNFDITLQDKVCMDIGASTGGFTDCMLQNGARKVFSIDVGYGQLAWKLRQDDRVVCMERTNIRYVTIEDTKEFADFASIDVSFISLKLVLPVAHNLIIPGGEIVALIKPQFEAGKDKVGKKGVVREKSTHIEVIEMVSKFAVETGFSILNLDY--SPIKGPEG-NIEYLIHLRNSNE 250
>gi|119511719|ref|ZP_01630823.1| Hemolysin A [Nodularia spumigena CCY9414] >gi|119463628|gb|EAW44561.1| Hemolysin A [Nodularia spumigena CCY9414] (270 aa)
Score = 353, Expect = 8.5e-32, Identities = 90/240 (37%), Positives = 131/240 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD  LV+ N   SR +AQ LI   +V +N Q++ K+ T V+   ++++ E  ++VSR   KL  A++ F I    +I +D G STGGFT  LL+   K+VY IDVG  Q++  L+ + +VI  E+TN R +    +    D+I D   +DVSFIS+  I   +  L  +   ++ L+KPQFE+GK     KG  +   D    I   ++    L  K  G   SPI G    N EYL +L
  S:     1 MVKQRLDTLLVDLNLCSSRALAQRLIQAGEVTVNQQVVDKAGTEVDTAAQIKVKERSRFVSRGGEKLIKALDAFPISTTGRICLDGGISTGGFTDCLLQAGAKQVYGIDVGYGQVDWGLRNDPRVILRERTNLRNLTPEDLYSEADEIPDLAVVDVSFISLTKILPALWRLTKSPRDAVLLVKPQFEVGKSRVGKKGVVRDPHDQADAIFQVLQVACQLGWKYKGLTWSPITGPAG-NIEYLLWL 244
>gi|15828642|ref|NP_326002.1| hemolysin A [Mycoplasma pulmonis UAB CTIP] >gi|14089584|emb|CAC13344.1| HEMOLYSIN A [Mycoplasma pulmonis] (238 aa)
Score = 352, Expect = 9.9e-32, Identities = 86/216 (39%), Positives = 130/216 (60%)
  Q:    22 AQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           A  LI +SKV +N + +   + LV + D +EI+  ++YVSR AYKL  AIE F +D  +KI +DIGSSTGGF+QV L N  KKVY++D GTNQL+ +L+  + V+  E TN + I   + ++++D    DVSFIS+  +F  ++ +   N   +AL+KPQFE  K +    G+   + H++IIN  I F      + + +  S   G K +N EY+
  S:    17 AVGLILSSKVKVNDEFVLLPSYLVKQNDIIEIVNVKEYVSRGAYKLLQAIEDFKLDFKDKIVLDIGSSTGGFSQVALINGAKKVYALDSGTNQLDYKLRILDNVVVYENTNLKNINPKMFEEQLDICVCDVSFISLKEVFKVLQSVLKKNKSLMALIKPQFEAPKNLVEKGGYVNVKYHEEIINKVINFAHDYEFELVQFFPSKTPGKKAKNIEYI 232
>gi|121601957|ref|YP_988720.1| hemolysin A [Bartonella bacilliformis KC583] >gi|120614134|gb|ABM44735.1| hemolysin A [Bartonella bacilliformis KC583] (250 aa)
Score = 352, Expect = 1.1e-31, Identities = 94/242 (38%), Positives = 139/242 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL---EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI-ESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILN-IKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           RLD+ LV +N+  +R  A+D +    V ++GQI+SK+  +++  D  EI+     + YVSRAA KL  A++ F +     IA+DIG+STGGFTQVLLE     V ++DVG NQ +  L  N+ V  LE  N R++ +  L   +ID I  DVSFIS+ L+   +  L     +++ L+KPQFE+G++ IG           KK      ++L+     K  G I SPI G+   N EYL + E + E+
  S:     6 RLDVLLVEKNFFTTRSRARDAVVRQTVKVDGQIVSKAGKMIS--DDAEIIVCDPAQNYVSRAALKLIGALDAFPVVTTQVIALDIGASTGGFTQVLLERGASHVIAVDVGHNQFDACLSNNSAVTLLEGLNVRDLRQEHLGGREIDLIVSDVSFISLKLVLPSVFALIKKKAQAVLLVKPQFEVGREGIGKGGVLKNPSIAKKTAEELFDWLNTQKGWKAKGLIPSPITGSDG-NLEYLLFGEKRIEQ 250
>gi|157328913|emb|CAO23325.1| unnamed protein product [Vitis vinifera] (252 aa)
Score = 352, Expect = 1.2e-31, Identities = 84/243 (34%), Positives = 139/243 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD   +      SR   Q  I   KV ++G++++K+ T V++   VEI+ E  KYV RA YKL+AAIE   ++++ K+A+D G STGGFT  LL+     +Y +DVG  Q+ ++++++ +V  +E+TN R +    +  K+D +T+D+SFISI L+   +  +       + L+KPQFE  +      G  +    H++++   I+ +     +  G+I SP+KGA+  NTE+L     K E
  S:    11 KRRLDEVCLERFQQYSRTFIQSWILQGKVFVDGKVVNKAGTPVSDKAVVEIMAEVPKYVCRAGYKLEAAIEQLGVEVSGKVALDSGLSTGGFTDCLLQYGASFIYGVDVGYGQVADKIRRDERVSVVERTNLRYLPG--LPQKVDLVTLDLSFISILLVMPAVVNVMKEESTLVTLVKPQFEARRSQVGGGGIVRDPLVHQEVLERIIKGVESFGFECKGWIESPLKGAEG-NTEFLVCFTRKPE 252
>gi|148657960|ref|YP_001278165.1| hemolysin A [Roseiflexus sp. RS-1] >gi|148570070|gb|ABQ92215.1| hemolysin A [Roseiflexus sp. RS-1] (267 aa)
Score = 351, Expect = 1.2e-31, Identities = 86/239 (35%), Positives = 138/239 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIES----SLIKDKI--DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K+RLD  LV    A +R  AQ LI   +V ++G +  K+  LV E   +E+  +  YVSR  YKL  A++ FN+   N  A+D+G+STGGFT VLL+    +VY++DVG   ++ +L+++ +V+ +E+TN R +E+        D +  D  TIDVSFIS+ L+   ++ L   +   +AL+KPQFE G  ++G          H  ++   + F + + ++  G   SPI G    N E+L +L
  S:     3 KKVRLDHLLVQRGLAETRARAQALILAGEVRVDGVVRLKAGELVPEDAGIELAGKLPYVSRGGYKLAHALDAFNLSPANFTALDVGASTGGFTDVLLQRGAARVYAVDVGYGLIDVRLRQDPRVVVIERTNIRYLEALPPLEGSSDPVFADCATIDVSFISLKLVLPAVQRLIRPDAWIVALIKPQFEAGPAQVGKGGVVRDPSVHADVLRQVLTFSAAIGVQPHGLTRSPILGPAG-NVEFLAWL 247
>gi|187736312|ref|YP_001878424.1| hemolysin A [Akkermansia muciniphila ATCC BAA-835] >gi|187426364|gb|ACD05643.1| hemolysin A [Akkermansia muciniphila ATCC BAA-835] (242 aa)
Score = 351, Expect = 1.3e-31, Identities = 89/241 (36%), Positives = 134/241 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K RLDI LV+ N   SR +AQ LI   +V + G   +K    VNE   + I    +YVSR   K++ A+  F +    K+ +DIG+STGGFT  LL++   +V++IDVGTNQL  +L+++ +VI  E+ N R +    I +++D I  DVSFIS+  I      L      ++ L+KPQFEL  + IG          H++ +++   F++  LN   +G   SPI G    N E+L +L+
  S:     1 MSKQRLDILLVSRNLVESRELAQRLIIAGEVNVGGHPSTKPGLKVNEDADITIRNRPRYVSRGGLKMEGALNAFPVSAEGKVCLDIGASTGGFTDCLLQHGAARVHAIDVGTNQLVWKLRQDPRVIVKEKFNARYMTPEDIGEQVDLIVSDVSFISLKKILPAAFPLLKQGGDALVLIKPQFELQPEDIGPGGIVRDPALHRRAVDSIRTFVTDELNRSWMGCEPSPITGTDG-NHEFLAWLK 242
>gi|168206128|ref|ZP_02632133.1| hemolysin A [Clostridium perfringens E str. JGS1987] >gi|170662441|gb|EDT15124.1| hemolysin A [Clostridium perfringens E str. JGS1987] (271 aa)
Score = 351, Expect = 1.3e-31, Identities = 92/243 (37%), Positives = 138/243 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK--YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           +K RLD+ LV +  A SR  A+  I    V I  + + K+   V     + I   E+  +VSR  +KL  A++ F IDL  K  +DIG+STGGFT  +L+N+  KV+SIDVG  Q   +L+ + +V+ +E+TN R +    I +  DF +IDVSFIS+  +   +  L  +  + +AL+KPQFE G+ K+G      +   HK++I   ++F     +  LG   SPIKG +  N EYL YL+  N
  S:     7 KKERLDVLLVEQGIAESREKAKRYIMAGMVFIGEKRVDKAGEKVPVSSNI-IFRGERLPFVSRGGFKLDKAVKSFGIDLKGKRCLDIGASTGGFTDCMLQNDASKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTPEQIGELCDFASIDVSFISLITVLPAVLNLLNDKGEVMALIKPQFEAGREKVGKKGVVREASTHKEVIKKIVDFALSNKLNILGLDFSPIKGPEG-NIEYLIYLKKDN 250
>gi|157151300|ref|YP_001449998.1| hemolysin-like protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157076094|gb|ABV10777.1| hemolysin-like protein [Streptococcus gordonii str. Challis substr. CH1] (271 aa)
Score = 351, Expect = 1.4e-31, Identities = 88/241 (36%), Positives = 140/241 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K R+D+    +    +R  A+  +    VV  INGQ   K    +++  ++++  E+ K+VSR   KL+ A++ F I +  K+ +DIG+STGGFT V+L+N    VY++DVGTNQL  +L+++ +VIS+EQ NFR  + +       F +IDVSFIS++LI   +KE+     + +AL+KPQFE G++     G  K +  H  ++     F+  L     G   SPI+G    N E+L +L+
  S:     1 MTKERVDVLAFKQGLFETREQAKRGVMAGLVVSVINGQRFDKPGEKIDDTTELKLKGEKLKFVSRGGLKLEKALQAFGISVKEKVTLDIGASTGGFTDVMLQNGASLVYAVDVGTNQLAWKLRQDQRVISMEQFNFRYAKRTDFDQTPQFASIDVSFISLSLILPALKEILAEEGQVVALIKPQFEAGREQIGKNGIVKDKKVHVAVLEKVTSFMVELGFSVKGLDYSPIQGGHG-NVEFLAHLK 244
>gi|83590353|ref|YP_430362.1| hemolysin A [Moorella thermoacetica ATCC 39073] >gi|83573267|gb|ABC19819.1| hemolysin A [Moorella thermoacetica ATCC 39073] (271 aa)
Score = 351, Expect = 1.5e-31, Identities = 87/240 (36%), Positives = 132/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD+ LV      SR  A+  I   +V++N   + K    V +   + +L +   YVSR   KL  A+E F+IDL+ KI +D+G+STGGFT   L++   +VY++DVG  QL   L+++ +VI +E+ N R +ESS   +  D  TIDVSFIS+  +   +        + IAL+KPQFE G  ++G      +   H+ ++   +     L +K  G   SPIKG +  N E+L +L
  S:     1 MAKERLDLLLVRRGLYPSREQARTAIMAGEVLVNDVPVDKPGAAVPDTATIRLLGQHLPYVSRGGLKLARALEVFSIDLHGKIILDVGASTGGFTDCALKHGAARVYAVDVGYGQLAWSLRQDPRVIVMERVNARYLESSSFGEPADVATIDVSFISLLKVLPAVASCLKPEGEIIALVKPQFEAGPGRVGKKGVVREAAVHRAVLQEVLAAAVDLGLKIKGLTYSPIKGPEG-NVEFLLWL 241
>gi|95929505|ref|ZP_01312248.1| hemolysin A [Desulfuromonas acetoxidans DSM 684] >gi|95134621|gb|EAT16277.1| hemolysin A [Desulfuromonas acetoxidans DSM 684] (250 aa)
Score = 351, Expect = 1.5e-31, Identities = 86/241 (35%), Positives = 134/241 (55%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           K RLD  +V     RSR  A+ LI +  V++N  +I K+ T V     + +   +  YVSR   KL   +E F +++N ++A+D+G+STGGFT  LL+N   KVY++DVG  QL  +L+++++V++LE+TN RE+    + D  D   ID SFIS+  +      +   +   +AL+KPQFE+GK      G  + E  H ++I+   +    LN        SPI G K  N E+L +L  +
  S:     5 KERLDKRVVELGLCRSRERARALIMSGNVLVNETVIDKAGTRVAVDAAIRVRGGDLPYVSRGGLKLAGGLEQFGLEVNGRVAVDVGASTGGFTDCLLQNGAAKVYAVDVGYGQLAWKLREDDRVVNLERTNIRELTREQLGDVPDLAVIDASFISLEKVLPPTLAVLAADADIVALIKPQFEVGKGNVGKGGVVRDEQQHAQVIDKIRQLAETLNCDVSALCESPILGPKG-NREFLIHLRRR 246
>gi|118727595|ref|ZP_01576190.1| hemolysin A [Clostridium cellulolyticum H10] >gi|118662993|gb|EAV69659.1| hemolysin A [Clostridium cellulolyticum H10] (270 aa)
Score = 350, Expect = 1.6e-31, Identities = 95/240 (39%), Positives = 139/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILN--IKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K RLD+ LVN+    SR   +  I    V I+G    K  T V     +EI E    +VSR   KL  A+ +F+IDL NK  +DIG+STGGFT  +L+N   KV +IDVG  QL  +L+ + +VI +E+TN R ++   I    DF +IDVSFIS+  +   +  +  +  + + L+KPQFE G+ K+G       +  HK++I+  I F++  N  +K L +  SPIKG +  N EYL Y+
  S:     1 MEKERLDVLLVNKGLFESREKCKSAIMAGLVWIDGIREDKPGTKVPVECTIEIRENLNPFVSRGGLKLAKAVSNFDIDLANKTCLDIGASTGGFTDCMLKNGAAKVVAIDVGYGQLAWELRNDPRVICMERTNVRYVKPEDIGFLSDFASIDVSFISLTKVLPAVLAVLKDEAELVCLIKPQFEAGREKVGKHGVVRDSGVHKEVIHYIINFVTAANLFVKELSF--SPIKGPEG-NIEYLLYI 241
>gi|78222437|ref|YP_384184.1| hemolysin A [Geobacter metallireducens GS-15] >gi|78193692|gb|ABB31459.1| Hemolysin A [Geobacter metallireducens GS-15] (260 aa)
Score = 350, Expect = 1.7e-31, Identities = 85/236 (36%), Positives = 138/236 (58%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV+    +SR  A+ LI   +VV+N  +  K+ T V     + +  E+  +VSR   KL  A++ F +D+ + +AID+G+STGGFT  LL+   +KVY++DVG  QL  +L+++ +V++LE+TN R +E   + +  D   ID SFIS++ +      L  +    +AL+KPQFE+GK      G  + E  H+++++N +     L+++  G   SPI G K  N E+L +L
  S:    15 RLDKLLVDRGLVQSRERARALIMAGQVVVNDHLADKAGTQVPLDADIRLKGEDIPFVSRGGLKLARALDEFGLDVTDMVAIDVGASTGGFTDCLLQRGARKVYAVDVGYGQLAWKLRQDPRVVNLEKTNIRYLEPDALPEVPDLAVIDASFISLDKVLPPTLRLIRDGGAVVALIKPQFEVGKGEVGKGGVVRDEGKHREVVDNVVALAESLDLQVGGITESPILGPKG-NREFLIHL 251
>gi|110004829|emb|CAK99162.1| probable ribosomal 23s rrna methyltransferase protein [Spiroplasma citri] (269 aa)
Score = 350, Expect = 1.8e-31, Identities = 102/239 (42%), Positives = 149/239 (62%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLE 241
           KIRLD  +VN N A SR  A+ +I  + V+++     K   LV +LD +  L  E  KYVSRA  KL   +  FN+ + N + +DIG+STGGFT  LL+N+ KKVY++DVGTNQL  +L+ N +V+SLE+TNFR +  +L   D+I+    DVSFIS++ I   +K++   N  +  L+KPQFE  K+    +G     +HK I  + I+ +  L + N G+ V     SPI G KK+N E++  L+
  S:     2 KIRLDQLMVNNNLAPSREKAKAMILANNVLVDNVPALKPGELV-KLDSIIKLRGERLKYVSRAGEKLAKGLTAFNLTVKNLVCLDIGASTGGFTDCLLQNDAKKVYAVDVGTNQLAWKLRNNPRVVSLEKTNFRYVTKALFAPDEIEIACCDVSFISLDKIIPPLKDIILLNHYAFFLIKPQFESTKE-AVKRG---KINHKAIHYDVIKKIFALALNN-GFSVNNCDYSPILGNKKKNIEFICLLQ 242
>gi|167935781|ref|ZP_02522856.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus cereus AH1134] >gi|168140159|ref|ZP_02583388.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus cereus G9842] (279 aa)
Score = 350, Expect = 2.0e-31, Identities = 87/246 (35%), Positives = 140/246 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R+D+ LV      +R  A+  I    V  N   + K    +++  ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   +EF         G   SPI G    N E+L +L++  E+
  S:     3 VKKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKISQDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVEFALKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|170790199|gb|EDT31243.1| ribosomal RNA large subunit methyltransferase J [Oligotropha carboxidovorans OM5] (243 aa)
Score = 350, Expect = 2.1e-31, Identities = 78/228 (34%), Positives = 123/228 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGA 229
           ++ R D+ LV      SR  AQ  I    V  NG++I+K +  +     +       +VSR   KL AA+EH+ +D+ + + +D+G+STGGFT+VLL N    V++IDVGT QL+  L+ N K++SLE T+ R +E   ++ + D   ID SFIS+ L+   +        + +AL+KPQFE G+     KG  + E  H+ I ++   F +     ++    S I G 
  S:     3 ERKRADVLLVERGLFESRARAQAAIEAGLVTANGKVIAKVSESIPVDADISAEPAHPWVSRGGVKLAAALEHYPLDIEDHVCVDVGASTGGFTEVLLANGASLVFAIDVGTAQLHPSLRGNPKIVSLENTDIRSLEGRRLEVRPDVAVIDTSFISLKLVLPAVFSFTAAPMQMLALIKPQFEAGRA-QVKKGIVRDEAVHRAICDDIAAFAAAQGCTDIEVFPSAIAGG 230
>gi|153953857|ref|YP_001394622.1| rRNA methylase [Clostridium kluyveri DSM 555] >gi|146346738|gb|EDK33274.1| Predicted rRNA methylase [Clostridium kluyveri DSM 555] (274 aa)
Score = 349, Expect = 2.2e-31, Identities = 88/238 (36%), Positives = 137/238 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K R+D+ LV++    SR  A+  I   ++ ++G+ + K    +     +E   E+  +VSR   KL+ A++ FNI L NK+ +DIG+STGGFT  +L+   KKV+SIDVG  Q   +L+ + +V+ +E+TN R +    I +  DF +IDVSFIS+  +   +  L   N   +AL+KPQFE G++    KG  + +  H ++I   + FL   N+K +    SPIKG +  N EYL Y 
  S:     5 KERIDVLLVDKGIFSSRERARASIMAGEIFVDGRRVDKCGQNIKRSSNIEFRGEKLPFVSRGGLKLQKALKKFNIILKNKVCLDIGASTGGFTDCMLQKGAKKVFSIDVGYGQFAWKLRTDERVVCMERTNIRYVTFKDIGEYCDFASIDVSFISLKKVLPAVINLLKENGSIVALIKPQFEAGREKVGKKGVVREQSTHIEVIKAIVTFLKENNLKIISLDYSPIKGPEG-NIEYLIYF 243
>gi|67926067|ref|ZP_00519319.1| Hemolysin A [Crocosphaera watsonii WH 8501] >gi|67852087|gb|EAM47594.1| Hemolysin A [Crocosphaera watsonii WH 8501] (270 aa)
Score = 349, Expect = 2.3e-31, Identities = 88/240 (36%), Positives = 133/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKD--KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K+RLD+ LV  +   SR  AQ  I   +V +N +II K  T V     +E+  +  YVSR   K++ A++ FNI + ++I +D G STGGFT  LL+   ++VY +DVG  Q+   L+++ +VI  E+TNFR +    L +D  + D   +D+SFIS+  +   +  L     + I L+KPQFE+G+     KG  +  +DH + I   ++    L     G  VSPI G    N EYL +L
  S:     1 MSKLRLDLLLVKRDLCSSRQQAQRCIRAGEVKVNQRIIDKPGTEVEITADIELKAKPPYVSRGGLKVEKALKSFNIAVKDRICLDGGISTGGFTDCLLQAGARQVYGVDVGYGQVAWSLRQDPRVILKERTNFRYLSPEDLYQDNPRADLGVMDLSFISLTKVLGPLWNLLLEPREVILLIKPQFEVGRSRVGKKGVVRDPQDHSQAIYQVLQTTYSLGWLCCGLTVSPITGPAG-NKEYLAWL 243
>gi|167628427|ref|YP_001678926.1| hemolysin a, putative [Heliobacterium modesticaldum Ice1] >gi|167591167|gb|ABZ82915.1| hemolysin a, putative [Heliobacterium modesticaldum Ice1] (274 aa)
Score = 349, Expect = 2.3e-31, Identities = 84/239 (35%), Positives = 134/239 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD+ LV+E  + +R  A+  I    V ++G+ + K+ TL+ +  +V +  E   YVSR  +KL  A+E F ++L+    ID+G+STGGFT V L N   +V ++DVG  Q    L+K+ +V  LE+TN R +   ++ +K     IDV+FIS+  +   +  L       +AL+KPQFE G++    KG  +  + H ++I   + + +    K  G   SPI G +  N EYLF+L+
  S:     4 KKRLDVRLVDEGLSPTREKARAAILAGLVQVDGKRVDKAGTLIADSARVTVTGEACPYVSRGGFKLAKALEVFPLNLSGLTVIDVGASTGGFTDVALRNGAARVIAVDVGYGQFAWSLRKDPRVRCLERTNIRHLTPEVLGEKAQAAVIDVAFISLEKVLPAVAALLEEPGHVMALIKPQFEAGREKVGKKGVVRDPQVHCEVIEGLVRWATERGWKVRGLDYSPITGPEG-NIEYLFFLQ 243
>gi|169201214|ref|ZP_02860444.1| hemolysin A [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169084289|gb|EDS65013.1| hemolysin A [Rhizobium leguminosarum bv. trifolii WSM2304] (261 aa)
Score = 349, Expect = 2.4e-31, Identities = 86/234 (36%), Positives = 129/234 (55%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV+     SR  A+D +    V I GQ+++K+  L+ +   +EI +  + YVSRAA KL +A+EHF +D      +DIG+STGGFT+VLL+     V +IDVG  Q++ ++  + +V + E  N R + +  I +  DFI  DVSFIS+ L      ++      ++ L+KPQFE G++     G  K       +   +E  F+  +  K+LG I SPI G    N EYL 
  S:    21 RLDQLLVSRGLFASRSRARDAVQRGTVRIAGQVVTKAGALIGDDAAIEIDDPAQDYVSRAALKLASALEHFRLDPAGHHCLDIGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRIAADPRVTNKEGLNARHLTAEDIGEPADFIVSDVSFISLKLALAPALDIAEAGAVAVLLVKPQFEAGREAIGKGGLLKDPSSAPAVAAELERWFIEDMGWKSLGLIPSPIAGGDG-NQEYLL 256
>gi|167756951|ref|ZP_02429078.1| hypothetical protein CLORAM_02500 [Clostridium ramosum DSM 1402] >gi|167703126|gb|EDS17705.1| hypothetical protein CLORAM_02500 [Clostridium ramosum DSM 1402] (266 aa)
Score = 348, Expect = 2.8e-31, Identities = 100/237 (42%), Positives = 144/237 (60%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLV----NELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYL 237
           M+K R+D+ LV + +  SR  A+  I    V  +  II K  T +    N   K  I+    YVSR   KL+ A++ F +D+ ++I +DIGSSTGGFT   L+N VK VY+IDVGTNQL  +L+ + +VI  EQTNFR   S L +  I  F +IDVSFIS+  IF+ +K +  +  + +AL+KPQFE G++    KG  K    H+K+I + IE+ +     ++ L Y  SPI G +  N E+L
  S:     1 MKKERIDVLLVEQGFFDSREKAKRAIMAGIVHDDYDIIDKPGTKIPIDSNLHVKGNIM---PYVSRGGLKLERALKEFELDITDRIMVDIGSSTGGFTDCALQNGVKLVYAIDVGTNQLVWKLRNDPRVIVKEQTNFRYATSELFEHGIPTFASIDVSFISLKYIFDALKNILHSGNQVVALIKPQFEAGREEVGKKGIVKEPSVHQKVIQHVIEYANHDGFVLEKLTY--SPITGGEG-NIEFL 239
>gi|78358021|ref|YP_389470.1| hemolysin A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78220426|gb|ABB39775.1| hemolysin A [Desulfovibrio desulfuricans G20] (249 aa)
Score = 348, Expect = 2.8e-31, Identities = 86/236 (36%), Positives = 134/236 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVI-----NGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYL 237
           +K R D  +  +  A SR  A+ LI   KV +       + + K  T  +    +E+   E++VSR AYKL  AIE F +D+   +A+D G+STGGFT  LL++   +VY++DVG NQL+E+++ +++V+S+E  N R     L+ +++D I  DVSFIS+ LI               AL+KPQFE+G    T KG  + E   ++ ++  ++F    L +   G + S IKG K  N EY+
  S:     3 RKERADQLVYEQGLAESREQAKRLIMAGKVYVLRPGAEPEPVGKPGTRYDACWHMELKGVERFVSRGAYKLLTAIETFGLDVQGMVALDAGASTGGFTDCLLQHGAARVYAVDVGKNQLHERMRSDSRVVSMEGVNLRTAPDDLLPEQVDIIVADVSFISLTLILPACLRFLRKGGVVAALVKPQFEVGAG-QTVKGVVRDEALRRQAVDKVLDFARDQLGLTVQGVVPSAIKGPKG-NQEYI 243
>gi|30022258|ref|NP_833889.1| hemolysin A [Bacillus cereus ATCC 14579] >gi|168136576|ref|ZP_02579805.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus cereus B4264] >gi|29897815|gb|AAP11090.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus cereus ATCC 14579] (279 aa)
Score = 348, Expect = 2.9e-31, Identities = 87/246 (35%), Positives = 140/246 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R+D+ LV      +R  A+  I    V  N   + K    +++  ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   +EF         G   SPI G    N E+L +L++  E+
  S:     3 VKKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKISQDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVEFALKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|168005710|ref|XP_001755553.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162693260|gb|EDQ79613.1| predicted protein [Physcomitrella patens subsp. patens] (266 aa)
Score = 348, Expect = 3.0e-31, Identities = 82/236 (34%), Positives = 138/236 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITN-SKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +K+RLD   + +    SR + Q  I    KV+++G+  +K+ + V    K++I+ E  KYV RA YKL+AA+E F  D+N K+ +D G STGGF+  LL+N   ++Y +DVG  Q+ E+++ + +V  +E+TN R +    + +++D +T+D+SFISI L+   +  +       I L+KPQFE  + ++G          HK+++   I  +     +  G+I SPI GA+  N E+L
  S:     3 RKMRLDELCMEQFPQYSRSLIQSWILQVGKVIVDGRPAAKAGSSVKPTSKIDIIAEVPKYVCRAGYKLEAALEKFCHDVNGKVVLDAGLSTGGFSDCLLQNGAARIYGVDVGYGQVAEKIRVDQRVTIMERTNLRYLPG--LPEQVDLVTLDLSFISILLVMPTVCSVMKPESSIITLIKPQFEARRSQVGGGGIVRDPAVHKEVLQRVISGVEGFGFECQGWIQSPITGAEG-NIEFL 238
>gi|28378304|ref|NP_785196.1| hemolysin-like protein [Lactobacillus plantarum WCFS1] >gi|28271139|emb|CAD64044.1| hemolysin homolog [Lactobacillus plantarum WCFS1] (272 aa)
Score = 348, Expect = 3.1e-31, Identities = 84/245 (34%), Positives = 145/245 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M+K R+D+ LV +    +R  A+  +   +++ +N + + K    +    ++ +  +   YVSR   KL+ A++ F ID+ +K  +DIGSSTGGFT V+L+N  K  Y++DVG+NQL  +L+++ +V+ +E TNFR  + +   + + +F +IDVSFIS++LI   +  +  N    +AL+KPQFE G++     G  +    H+ ++ + +EF        LG   SPIKG +  N E+L +L+  +E
  S:     1 MEKERVDVLLVQQGLFDTREKAKRAVMAGEILGVNEERLDKPGMKIPVATELHLKGKPMPYVSRGGLKLEKALKSFEIDVTDKTVLDIGSSTGGFTDVVLQNGAKMSYALDVGSNQLVWKLRQDPRVVVMEHTNFRYSKLADFTQGQPNFASIDVSFISLHLILPPLHAIIENGGSVVALIKPQFEAGRENVGKHGIVRDPAVHQAVLTDIVEFAQANGYNVLGLDYSPIKGGEG-NIEFLIHLQATDE 248
>gi|125576760|gb|EAZ17982.1| hypothetical protein OsJ_032191 [Oryza sativa (japonica cultivar-group)] (839 aa)
Score = 347, Expect = 4.2e-31, Identities = 79/212 (37%), Positives = 129/212 (60%)
  Q:    26 ITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           I   KV+++G++++K+ T V++   +EI  E  KYV RA +KL+AAI+ F ID + K+A+D G STGGFT  LL++    VY +DVG  Q+ E+++ + +V  +E+TN R +    +   +D +T+D+SFISI L+   + ++   +   I L+KPQFE  +      G  +    HK++++  I  +      N G+I SPIKGA+  N E+L
  S:   610 IAGRKVLVDGRVVNKAGTQVSDKSIIEIKAEIPKYVCRAGHKLEAAIKEFGIDCDEKVALDSGLSTGGFTDCLLQHGASHVYGVDVGYGQVAEKIRVHERVSVIERTNLRYLTE--LPQLVDLVTLDLSFISILLVMPAVVKVMKTDSTLITLIKPQFEARRSQVGGGGIVRDPLVHKEVLDRIISGVEQFGFCNKGWIESPIKGAEG-NKEFL 820
>gi|125533964|gb|EAY80512.1| hypothetical protein OsI_034471 [Oryza sativa (indica cultivar-group)] (897 aa)
Score = 347, Expect = 4.2e-31, Identities = 79/212 (37%), Positives = 129/212 (60%)
  Q:    26 ITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           I   KV+++G++++K+ T V++   +EI  E  KYV RA +KL+AAI+ F ID + K+A+D G STGGFT  LL++    VY +DVG  Q+ E+++ + +V  +E+TN R +    +   +D +T+D+SFISI L+   + ++   +   I L+KPQFE  +      G  +    HK++++  I  +      N G+I SPIKGA+  N E+L
  S:   668 IAGRKVLVDGRVVNKAGTQVSDKSIIEIKAEIPKYVCRAGHKLEAAIKEFGIDCDEKVALDSGLSTGGFTDCLLQHGASHVYGVDVGYGQVAEKIRVHERVSVIERTNLRYLTE--LPQLVDLVTLDLSFISILLVMPAVVKVMKTDSTLITLIKPQFEARRSQVGGGGIVRDPLVHKEVLDRIISGVEQFGFCNKGWIESPIKGAEG-NKEFL 878
>gi|34763176|ref|ZP_00144142.1| Putative cell adhesion protein (contact hemolysin TlyA-related) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887145|gb|EAA24250.1| Putative cell adhesion protein (contact hemolysin TlyA-related) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (268 aa)
Score = 347, Expect = 4.6e-31, Identities = 105/243 (43%), Positives = 147/243 (60%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSN--TLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K+RLD YLV   Y     +A+  I    ++IN Q I K     L++++  + I E++  YVSR   KL+ AI+ FN+D  +KI +DIG+STGGFT   L+N  K VY++DVGTNQL+ +L+ +++V S+E  +  ++E S + DKID I +D+SFISI  +  KIKEL   N  +I L+KPQFE  K+    KG    T  HK+IIN  IE      +      VSPIKG K  N EYL     K++
  S:     8 KMRLDEYLVENEYFEDLEIAKRQIMVGNIIINEQKIDKPGEIILLDKIKSIRIKEKDTPYVSRGGLKLEKAIKTFNLDFKDKIVLDIGASTGGFTDCSLQNGAKFVYAVDVGTNQLDWKLRNDSRVKSIENKHINDLEKSDLNDKIDIIVMDISFISIKKVLYKIKELLKENGFAIFLIKPQFE-AKRNEIEKGIVNDTNVHKRIINEVIEEAKNYQLFLENLTVSPIKGTKG-NIEYLVEFSKKDK 252
>gi|94264457|ref|ZP_01288245.1| Hemolysin A [delta proteobacterium MLMS-1] >gi|93455088|gb|EAT05312.1| Hemolysin A [delta proteobacterium MLMS-1] (251 aa)
Score = 346, Expect = 5.0e-31, Identities = 89/236 (37%), Positives = 134/236 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           K RLD  LV    A SR  AQ LI    V    +++ K+ TLV     + + E    YVSR   KL AA++HF ID    +AIDIG+STGGF+  LL+   ++VY++DVG  QL  +L+++ +V+  E+TN R +  +   +++D   ID SFIS+ L+   +  L     + +AL+KPQFE G++     G  + E  H++++ +  EF   L +  LG I SP+ G K  N E+L 
  S:     2 KERLDKLLVARGLATSRPRAQALIGAGLVSNASRVLDKAGTLVAVDTPLHVKENPCPYVSRGGLKLAAALDHFAIDPAGLVAIDIGASTGGFSDCLLQRGARRVYAVDVGYGQLAWKLRQDQRVVVKERTNARYLTPADFPEQLDLAVIDASFISLKLLLPPLLPLLRPGARLVALIKPQFEAGRERLGKGGVVRDERVHQEVVASIEEFALQLALNRLGVIPSPLPGPKG-NREFLL 238
>gi|49475233|ref|YP_033274.1| hemolysin-like protein [Bartonella henselae str. Houston-1] >gi|49238038|emb|CAF27245.1| Hemolysin-like protein [Bartonella henselae str. Houston-1] (249 aa)
Score = 346, Expect = 5.2e-31, Identities = 93/241 (38%), Positives = 138/241 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI-ESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKN----LGYIVSPIKGAKKENTEYLFYLEYKNE 245
           RLDI LV +N+  +R  A+D I    V +NG+II K+  ++ +  ++ + +  + YVSRAA KL  A++ F I  +   AIDIG+STGGFTQVLLE   + V ++DVG NQL+ +L  N+ +  LE  N R++ +  L   +ID I  DVSFIS+ L    +  L     +++ L+KPQFE+G++  +  G  K  D  +           LN +      G + S I GA   N EYL + E K+E
  S:     6 RLDILLVEKNFFTTRSRARDAIVRQTVKVNGEIILKAGQIIPDDAEIVVFDPAQNYVSRAALKLMGALDAFPIVTDKVTAIDIGASTGGFTQVLLERGAEHVIAVDVGHNQLDARLFGNSAITLLEGLNVRDLKQEHLGGREIDLIVSDVSFISLKLALPPVLSLAKQGAQAVLLVKPQFEIGREFLSKGGILK--DLSRAKQTAEGLFDWLNTQRGWIAKGLLPSSIAGADG-NLEYLLFGEKKSE 249
>gi|85709089|ref|ZP_01040155.1| Hemolysin HlyA [Erythrobacter sp. NAP1] >gi|85690623|gb|EAQ30626.1| Hemolysin HlyA [Erythrobacter sp. NAP1] (311 aa)
Score = 346, Expect = 6.1e-31, Identities = 85/235 (36%), Positives = 129/235 (54%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           K R+D  LV    A SR  AQ L+    V +  + ++K    V E   +E+   +  +VSR   KL  AIEHF++D    +AID+GSSTGGFT VLL N    V+++D GTNQL  +L+++++V  LEQT+ R +    I    +++  D SFI +  +  +  EL     + +AL+KPQFE+ K ++G          H+++ N   E+L  L     G + SPI G +  N E+L
  S:    70 KKRVDHLLVERELAESRTRAQALVMAGVVFVGEEKVAKPGQQVAEDAALEVRGRDHPWVSRGGIKLAHAIEHFDLDPTGAVAIDVGSSTGGFTDVLLSNGAAHVFAVDSGTNQLAWKLRQDDRVTVLEQTSARILTRDQIDRDCNWVVCDASFIGLAKVLERPLELAAQECQLVALIKPQFEVEKHEVGKGGVVRDPALHERVCNEVREWLEGLGWDIEGIVESPITGPQG-NVEFL 305
>gi|65321561|ref|ZP_00394520.1| COG1189: Predicted rRNA methylase [Bacillus anthracis str. A2012] (279 aa)
Score = 345, Expect = 6.1e-31, Identities = 86/245 (35%), Positives = 138/245 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K R+D+ LV      +R  A+  I    V  N   + K    + +  ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     4 KKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPQDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|30264251|ref|NP_846628.1| hemolysin A [Bacillus anthracis str. Ames] >gi|47778290|ref|YP_021043.2| hemolysin A [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187078|ref|YP_030330.1| hemolysin A [Bacillus anthracis str. Sterne] >gi|52141320|ref|YP_085509.1| hemolysin A [Bacillus cereus E33L] >gi|118479367|ref|YP_896518.1| hemolysin A [Bacillus thuringiensis str. Al Hakam] >gi|166995755|ref|ZP_02262215.1| hemolysin A [Bacillus cereus AH820] >gi|177654811|ref|ZP_02936568.1| hemolysin A [Bacillus anthracis str. A0174] >gi|190565875|ref|ZP_03018794.1| hemolysin A [Bacillus anthracis Tsiankovskii-I] >gi|196034836|ref|ZP_03102243.1| hemolysin A [Bacillus cereus W] >gi|196041645|ref|ZP_03108937.1| hemolysin A [Bacillus cereus NVH0597-99] >gi|196046292|ref|ZP_03113518.1| hemolysin A [Bacillus cereus 03BB108] >gi|30258896|gb|AAP28114.1| hemolysin A [Bacillus anthracis str. Ames] >gi|47551995|gb|AAT33518.2| hemolysin A [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181005|gb|AAT56381.1| hemolysin A [Bacillus anthracis str. Sterne] >gi|51974789|gb|AAU16339.1| hemolysin A [Bacillus cereus E33L] >gi|118418592|gb|ABK87011.1| hemolysin A [Bacillus thuringiensis str. Al Hakam] >gi|172080472|gb|EDT65558.1| hemolysin A [Bacillus anthracis str. A0174] >gi|190562794|gb|EDV16760.1| hemolysin A [Bacillus anthracis Tsiankovskii-I] >gi|195992375|gb|EDX56336.1| hemolysin A [Bacillus cereus W] >gi|196022762|gb|EDX61443.1| hemolysin A [Bacillus cereus 03BB108] >gi|196027633|gb|EDX66248.1| hemolysin A [Bacillus cereus NVH0597-99] (279 aa)
Score = 345, Expect = 6.4e-31, Identities = 86/245 (35%), Positives = 138/245 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K R+D+ LV      +R  A+  I    V  N   + K    + +  ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     4 KKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPQDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|169190165|ref|ZP_02850140.1| hemolysin A [Paenibacillus sp. JDR-2] >gi|169003212|gb|EDS50084.1| hemolysin A [Paenibacillus sp. JDR-2] (278 aa)
Score = 345, Expect = 6.9e-31, Identities = 87/243 (35%), Positives = 137/243 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K R+D+ LV   +  SR  A+  +    V++N + + K    V    ++++      YVSR   KL+ AI  F+IDL+ ++ +DIG+STGGFT   L++    VY+IDVG NQL+  L+++ +V  +E+TNFR  + + L      F +IDVSFIS+ LI   +  L       +AL+KPQFE G+ K+G +    +   HK+++   ++  S L  K      SPI G +  N E+L Y  ++NE
  S:     6 KERIDVLLVERGFYESREKAKAAVMAGLVLVNNEPVDKGGMKVPREAEIKVKGAIHPYVSRGGLKLEKAIRSFDIDLSGRVMLDIGASTGGFTDCALQHGASFVYAIDVGYNQLDWSLRQDERVRVMERTNFRYAQPADLNGPPPTFASIDVSFISLKLILPALSGLLSVGSGIVALIKPQFEAGREKVGKSGVVREPSVHKEVLETVLKTASELGYKLQNLTFSPITGGEG-NIEFLAYWTWENE 250
>gi|171778672|ref|ZP_02919768.1| hypothetical protein STRINF_00620 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282629|gb|EDT48053.1| hypothetical protein STRINF_00620 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (274 aa)
Score = 345, Expect = 7.4e-31, Identities = 93/245 (37%), Positives = 143/245 (58%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K R+D+      L        RGV   L+ N   VING+   K    +++  ++++  E+ KYVSR   KL+ A++ F I +N +  IDIG+STGGFT V+L+N  K VY++DVGTNQL  +L+++ +V S+EQ NFR  E +   K +  F +IDVSFIS+NLI   +  +  ++ + +AL+KPQFE G+ +IG          H+K++     F         G   SPI+G    N E+L +L+  ++
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVN---VINGERYDKPGEKIDDATELKLKGEKLKYVSRGGLKLEKALQVFEISVNGQTTIDIGASTGGFTDVMLQNGAKLVYAVDVGTNQLVWKLRQDERVRSMEQYNFRYAELADFTKGQPTFASIDVSFISLNLILPALHNILADDGQVVALIKPQFEAGRDQIGKNGIIRDNAVHQKVLETVTSFAVNFGFTVKGIDFSPIQGGHG-NIEFLAHLQKSDD 249
>gi|49480918|ref|YP_038237.1| hemolysin A [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49332474|gb|AAT63120.1| hemolysin A [Bacillus thuringiensis serovar konkukian str. 97-27] (279 aa)
Score = 344, Expect = 8.1e-31, Identities = 86/245 (35%), Positives = 137/245 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K R+D+ LV      +R  A+  I    V  N   + K    +    ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     4 KKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPHDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|76799063|ref|ZP_00781255.1| hemolysin A [Streptococcus agalactiae 18RS21] >gi|76585578|gb|EAO62144.1| hemolysin A [Streptococcus agalactiae 18RS21] (266 aa)
Score = 344, Expect = 8.3e-31, Identities = 95/241 (39%), Positives = 150/241 (62%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLE 241
           M K R+D+      L +      RGV   ++ N   VING+   K    V +  ++++  E+ KYVSR   KL+ A++ F I + +K+ IDIG+STGGFT V+L++  + VY++DVGTNQL  +L+++++V S+EQ NFR  +    K+ + +F +IDVSFIS+NLI   +KE+  +  + +AL+KPQFE G++     G  K +  H+K++     F      K+ GY V     SPI+G    N E+L +L+
  S:     1 MAKERVDVLAYKQGLFDTREQAKRGVMAGMVIN---VINGERYDKPGEKVADDTELKLKGEKLKYVSRGGLKLEKALQVFEISVADKLTIDIGASTGGFTDVMLQSGARLVYAVDVGTNQLVWKLRQDHRVRSMEQYNFRYAQKEDFKEGLPEFASIDVSFISLNLILPALKEILVDGGQVVALIKPQFEAGREQIGKNGIVKDKLVHEKVLTTVTNF-----TKDYGYTVKHLDFSPIQGGHG-NIEFLMHLQ 245
>gi|163941934|ref|YP_001646818.1| hemolysin A [Bacillus weihenstephanensis KBAB4] >gi|163864131|gb|ABY45190.1| hemolysin A [Bacillus weihenstephanensis KBAB4] (279 aa)
Score = 344, Expect = 9.3e-31, Identities = 85/246 (34%), Positives = 139/246 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R+D+ LV      +R  A+  +    V  N   + K    +++  ++ +  +   YVSR  YKL+ A+E F +DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     3 VKKERVDVLLVERGLIETREKAKRAVMAGLVYANEMRLDKPGEKISQDTEITVKGQVMPYVSRGGYKLEKALETFQLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLRLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFALKEGYNIEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|55821222|ref|YP_139664.1| hemolysin, putative [Streptococcus thermophilus LMG 18311] >gi|55823134|ref|YP_141575.1| hemolysin, putative [Streptococcus thermophilus CNRZ1066] >gi|116627948|ref|YP_820567.1| hemolysin, putative [Streptococcus thermophilus LMD-9] >gi|55737207|gb|AAV60849.1| hemolysin, putative [Streptococcus thermophilus LMG 18311] >gi|55739119|gb|AAV62760.1| hemolysin, putative [Streptococcus thermophilus CNRZ1066] >gi|116101225|gb|ABJ66371.1| Predicted rRNA methylase [Streptococcus thermophilus LMD-9] (288 aa)
Score = 343, Expect = 1.1e-30, Identities = 92/241 (38%), Positives = 143/241 (59%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K R+D+      L        RGV   L+ N   VING+   K    +++  ++++  E+ +YVSR   KL+ A+  FN+ + + I IDIG+STGGFT V+L+N  K VY++DVGTNQL  +L+++++V S+EQ NFR  E     + +  F +IDVSFIS+NLI   + ++  +  + +AL+KPQFE G+ +IG      ++  H+K++     F         G   SPI+G    N E+L +LE
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVN---VINGERYDKPGEKIDDGTELKLKGEKLRYVSRGGLKLEKALAVFNLSVEDMITIDIGASTGGFTDVMLQNGAKLVYAVDVGTNQLVWKLRQDDRVRSMEQYNFRYAEPVDFTEGLPSFASIDVSFISLNLILPALAKILVDGGQVVALVKPQFEAGREQIGKNGIVRESSIHEKVLETVTAFAVDYGFSVKGLDFSPIQGGHG-NIEFLAHLE 245
>gi|119486986|ref|ZP_01620858.1| Hemolysin A [Lyngbya sp. PCC 8106] >gi|119455915|gb|EAW37049.1| Hemolysin A [Lyngbya sp. PCC 8106] (300 aa)
Score = 343, Expect = 1.3e-30, Identities = 90/245 (36%), Positives = 137/245 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE------------SSLIKDKI-------------DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K RLD  L++ N   SR +AQ LI   +V++N Q+I K  T ++   ++++ +   +VSR   KL  A+++F I+++ +I ID G STGGFT  LL+   K++Y IDVG  Q++ +L+ + +VI LE+TN R +             S L K  I             D   +DVSFIS+  +   +  L     + + L+KPQFE+GK     KG  ++  D    I         L  K  G   SP++G    N EYL +L  + E
  S:     1 MAKQRLDTLLIDRNLCSSRHIAQRLIRAGEVMVNQQVIDKPGTEIDLEAQIKVKQRSPFVSRGGEKLIKALDYFKINVSERICIDGGISTGGFTDCLLQAGAKRIYGIDVGYGQVDWRLRTDPRVILLERTNLRHLTPEQLYSQSEHSISPLAKKDIEPDTKESDLESYADLAVVDVSFISLTKVLPALWHLLQLPREVVLLVKPQFEVGKGRVGKKGVVRSPFDQADTIFQVCSTAETLGWKYRGLTGSPLQGPAG-NIEYLLWLSVEGE 270
>gi|113477291|ref|YP_723352.1| hemolysin A [Trichodesmium erythraeum IMS101] >gi|110168339|gb|ABG52879.1| hemolysin A [Trichodesmium erythraeum IMS101] (284 aa)
Score = 343, Expect = 1.3e-30, Identities = 94/245 (38%), Positives = 141/245 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR----------------EIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M K RLD+ LV  N   SR  AQ LI   +V++N QI+ K  T V+    +++ ++  YVSR  YKL  A+E+F+I ++N+I +D G STGGFT  LL+   K +Y IDVG  Q++ +L+ +++VI  E+TN R                E++ +  +       +DVSFIS+  I   + EL     ++I L+KPQFE+GK+    KG  ++  D  + I       + L  K  G   SPI+G    N EYL +L   +E
  S:     1 MPKQRLDVLLVERNLCSSRQKAQVLIRAGEVMVNQQIVDKPGTEVDLESNIKVKQKSLYVSRGGYKLAKALEYFSISISNRICLDGGISTGGFTDCLLQAGAKLIYGIDVGYGQVDWKLRNDSRVILKERTNIRYLTPQELYGDSLILNYELQENTKEIYPSLAVVDVSFISLAKILPALWELLIPPRETILLVKPQFEVGKERVGKKGVVRSYNDQAEAIFQVCCSANNLGWKYAGLTWSPIQGPAG-NIEYLLWLNLDSE 261
>gi|154686690|ref|YP_001421851.1| YqxC [Bacillus amyloliquefaciens FZB42] >gi|154352541|gb|ABS74620.1| YqxC [Bacillus amyloliquefaciens FZB42] (281 aa)
Score = 342, Expect = 1.5e-30, Identities = 91/244 (37%), Positives = 132/244 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISK-SNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +K RLD+ LV +  A +R  A+  I    V  N   + K    +  +L         KYVSR   KL+ A+E F + +  K  IDIGSSTGGFT   L+N  ++ Y++DVG NQL  +L+++ +V+ +E+TNFR  E S   + + +F TIDVSFIS+ LI   +K L       IAL+KPQFE G++    KG  +    H  ++    +F +       G   SPI G    N E+L +LE+  E
  S:     4 KKERLDVLLVEKGLAETREKAKRAIMAGIVYSNENRLDKPGEKIARDLPLTVKGNPLKYVSRGGLKLEKALEVFPVSVKGKTMIDIGSSTGGFTDCALQNGAERSYAVDVGYNQLAWKLRQDERVVVMERTNFRYSEPSDFTEGLPEFATIDVSFISLRLILPVLKTLLVPGSDCIALVKPQFEAGRESVGKKGIVRDPGVHTDVLRRMNQFAASEGYTVKGLSFSPITGGDG-NIEFLLHLEWGGE 249
>gi|187606249|ref|ZP_02992415.1| hemolysin A [Exiguobacterium sp. AT1b] >gi|187481694|gb|EDU19732.1| hemolysin A [Exiguobacterium sp. AT1b] (271 aa)
Score = 342, Expect = 1.5e-30, Identities = 87/241 (36%), Positives = 140/241 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKV--EILEEEK-----YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFYLEY 242
           +K RLD+ LV    A +R  A+      + V+ G + S +  L    DKV  +I  E K     YV R   KL+ A++ F +D+  ++ IDIGSSTGGFT   L+N   ++Y++DVG NQL  +L+ +++V+ +E+ NFR   +     + DF TIDVSFIS+ L+   +K++   +   +AL+KPQFE GK     KG  +  + H+++ ++ + + +     ++ L Y  SPI G    N E+L +  Y
  S:     5 KKTRLDVLLVERGLAETREKAK------RSVMAGLVYSGTERLDKAGDKVFDDIPLEVKGQVLPYVGRGGLKLEKALDVFPLDVFGRVGIDIGSSTGGFTDCALQNGATQMYAVDVGYNQLAWKLRSDDRVVVMERMNFRHATADQFPIQPDFATIDVSFISLRLMVPPLKQILKQDGVVMALVKPQFEAGKADVGKKGIVRDRNVHERVASDMVRYFASEGFFVEALDY--SPITGGDG-NIEFLLFARY 246
>gi|84703781|ref|ZP_01017609.1| Hemolysin HlyA [Parvularcula bermudensis HTCC2503] >gi|84690215|gb|EAQ16056.1| Hemolysin HlyA [Parvularcula bermudensis HTCC2503] (243 aa)
Score = 341, Expect = 1.8e-30, Identities = 92/234 (39%), Positives = 130/234 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTED----HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +RLD YLV   + RSR  A+ +I +  V +NG  + K+   +   D+VE   E+  YVSRAA+KL AA+E F+ D  + + +DIG+STGGFTQVL     ++VY++DVG  QL  ++     VI+LE  N + +    + + I F+T DVSFIS   +      L      +  L KPQFELG   IG  KG   T D     + +  +   FLS      +GY+ SPI G    N E+L
  S:     1 MRLDSYLVEAGHVRSRERAKKVIGDGYVWVNGVQVRKAGRSLQPTDRVEFRGEDFAYVSRAAFKLLAALEAFSFDPQDLLCLDIGASTGGFTQVLCLKGARRVYAVDVGHGQLAPEVAGAPPVINLEGVNAKTLTRHEVPEPISFLTCDVSFISARKVLPAAMALCGPEAIAAILFKPQFELGPGAIG--KGGLVTWDTAAVERVVREDMTSFLSEQGWDLIGYLPSPIVGGDG-NAEWL 237
>gi|21910689|ref|NP_664957.1| putative hemolysin [Streptococcus pyogenes MGAS315] >gi|28895621|ref|NP_801971.1| putative hemolysin [Streptococcus pyogenes SSI-1] >gi|21904892|gb|AAM79760.1| putative hemolysin [Streptococcus pyogenes MGAS315] >gi|28810870|dbj|BAC63804.1| putative hemolysin [Streptococcus pyogenes SSI-1] (275 aa)
Score = 341, Expect = 2.2e-30, Identities = 92/240 (38%), Positives = 142/240 (59%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     + +  F +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S       G   SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFSEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHG-NIEFLAHL 244
>gi|77409334|ref|ZP_00786037.1| hemolysin A [Streptococcus agalactiae COH1] >gi|77172066|gb|EAO75232.1| hemolysin A [Streptococcus agalactiae COH1] (275 aa)
Score = 341, Expect = 2.3e-30, Identities = 95/241 (39%), Positives = 150/241 (62%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLE 241
           M K R+D+      L +      RGV   L+ N   VING+   K    V +  ++++  E+ KYVSR   KL+ A++ F I + +K+ IDIG+STGGFT V+L++  + VY++DVGTNQL  +L+++++V S+EQ NFR  +    K+ + +F +IDVSFIS+NLI   +KE+  +  + +AL+KPQFE G++     G  K +  H+K++     F      K+ GY V     SP++G    N E+L +L+
  S:     1 MAKERVDVLAYKQGLFDTREQAKRGVMAGLVIN---VINGERYDKPGEKVADDTELKLKGEKLKYVSRGGLKLEKALQVFEISVADKLTIDIGASTGGFTDVMLQSGARLVYAVDVGTNQLVWKLRQDHRVRSMEQYNFRYAQKEDFKEGLPEFASIDVSFISLNLILPALKEILVDGGQVVALIKPQFEAGREQIGKNGIVKDKLVHEKVLTTVTNF-----TKDYGYTVKHLDFSPVQGGHG-NIEFLMHLQ 245
>gi|19746451|ref|NP_607587.1| putative hemolysin [Streptococcus pyogenes MGAS8232] >gi|50914596|ref|YP_060568.1| hemolysin [Streptococcus pyogenes MGAS10394] >gi|139473478|ref|YP_001128194.1| hemolysin-like protein [Streptococcus pyogenes str. Manfredo] >gi|19748653|gb|AAL98086.1| putative hemolysin [Streptococcus pyogenes MGAS8232] >gi|50903670|gb|AAT87385.1| Hemolysin [Streptococcus pyogenes MGAS10394] >gi|134271725|emb|CAM29958.1| hemolysin-like protein [Streptococcus pyogenes str. Manfredo] (275 aa)
Score = 340, Expect = 2.3e-30, Identities = 92/240 (38%), Positives = 142/240 (59%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     + +  F +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S       G   SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFNEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHG-NIEFLAHL 244
>gi|51892979|ref|YP_075670.1| putative rRNA methylase [Symbiobacterium thermophilum IAM 14863] >gi|51856668|dbj|BAD40826.1| putative rRNA methylase [Symbiobacterium thermophilum IAM 14863] (257 aa)
Score = 340, Expect = 2.3e-30, Identities = 78/236 (33%), Positives = 136/236 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKG--FAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD+ LV+  +  SR  AQ+ I    V +NG++I+K    V+  D +E+  +   YV R   KL+ A++ F ID   ++ +D+G+STGGFT  LL    ++VY++DVG +QL+  L+++ +V+ +E+T+ R + +  + + ++   +DVSFIS+ L+   +  L     + +AL+KPQFE+G   G  KG        H+  ++  +   + L +  +  I SPI G +  N E+L + 
  S:     5 RLDVALVSRGHFPSRERAQEAIAAGMVRVNGRVITKPARKVDPGDAIEVTGDPIGYVGRGGLKLQGALDQFGIDPAGRVCLDVGASTGGFTDCLLRRGARRVYAVDVGRDQLHPSLRQDPRVVVMEETDIRSVAA--LPEPVELAAVDVSFISLTLVLPAVARLLAPAGQIVALIKPQFEVGPG-GVGKGCIVRDPAQHRLAVDRVLRRAAELGLACVRVIDSPILGTEG-NREFLAWF 239
>gi|24379061|ref|NP_721016.1| putative hemolysin [Streptococcus mutans UA159] >gi|24376958|gb|AAN58322.1|AE014902_10 putative hemolysin [Streptococcus mutans UA159] (275 aa)
Score = 340, Expect = 2.5e-30, Identities = 95/241 (39%), Positives = 147/241 (60%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLE 241
           M K R+D+      L N      RGV   L+ N   VING+   K    ++E  ++++  ++ KYVSR   KL+ A++ F I ++ +I +DIG+STGGFT V+L+N  + VY++DVGTNQL  +L+++ +V S+EQ NFR  E S   + +  F +IDVSFIS+NLI   + ++  +  + +AL+KPQFE G++     G  K +  H+ ++     F +     N G+ V     SPI+G    N E+L YLE
  S:     1 MPKERVDVLAYKQGLFNTREQAKRGVMAGLVVN---VINGERYDKPGEKIDEATELKLKGDKLKYVSRGGLKLEKALKVFVISVDGQITLDIGASTGGFTDVMLQNGAQLVYAVDVGTNQLVWKLRQDERVCSMEQYNFRYAEPSDFERGQPTFASIDVSFISLNLILPALSKILTDGGQVVALIKPQFEAGREQIGKHGIVKDKSVHETVLETVTTFAT-----NYGFTVKELDFSPIQGGHG-NIEFLAYLE 245
>gi|94990755|ref|YP_598855.1| lantibotic precursor [Streptococcus pyogenes MGAS10270] >gi|94544263|gb|ABF34311.1| Lantibotic precursor [Streptococcus pyogenes MGAS10270] (275 aa)
Score = 340, Expect = 2.6e-30, Identities = 92/240 (38%), Positives = 142/240 (59%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     + +  F +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S       G   SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFNEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHG-NIEFLAHL 244
>gi|42783294|ref|NP_980541.1| hemolysin A [Bacillus cereus ATCC 10987] >gi|42739222|gb|AAS43149.1| hemolysin A [Bacillus cereus ATCC 10987] (279 aa)
Score = 340, Expect = 2.6e-30, Identities = 85/245 (34%), Positives = 137/245 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K R+D+ LV      +R  A+  I    V  N   + K    + +  ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    A +KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     4 KKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPQDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAAXIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|15675401|ref|NP_269575.1| putative hemolysin [Streptococcus pyogenes M1 GAS] >gi|71911043|ref|YP_282593.1| hemolysin [Streptococcus pyogenes MGAS5005] >gi|13622587|gb|AAK34296.1| putative hemolysin [Streptococcus pyogenes M1 GAS] >gi|71853825|gb|AAZ51848.1| hemolysin [Streptococcus pyogenes MGAS5005] (275 aa)
Score = 340, Expect = 2.7e-30, Identities = 92/240 (38%), Positives = 142/240 (59%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     + +  F +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S       G   SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFNEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHG-NIEFLAHL 244
>gi|152976580|ref|YP_001376097.1| hemolysin A [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025332|gb|ABS23102.1| hemolysin A [Bacillus cereus subsp. cytotoxis NVH 391-98] (279 aa)
Score = 339, Expect = 3.1e-30, Identities = 88/246 (35%), Positives = 145/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R+D+ +V      +R  A+  I    V  N   + K    + E   + I  +   YVSR  YKL+ A++ F +DL +KI IDIGSSTGGFT   L+N VK  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N   +AL+KPQFE G++    KG  + +  H+ ++   ++F      ++++L +  SPI G    N E+L +L++  E+
  S:     3 VKKERVDVLVVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPEDTPITIKGQVMPYVSRGGYKLEKALQVFQLDLQDKIMIDIGSSTGGFTDCALQNGVKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLTPNGDVVALIKPQFEAGREQVGKKGIVRDKKVHEAVVEMIVDFALQEGYDVQDLTF--SPITGGDG-NIEFLIHLKWYGER 250
>gi|148998634|ref|ZP_01826073.1| hemolysin A, putative [Streptococcus pneumoniae SP11-BS70] >gi|168577216|ref|ZP_02723025.1| hemolysin A [Streptococcus pneumoniae MLV-016] >gi|182684066|ref|YP_001835813.1| hemolysin A, putative [Streptococcus pneumoniae CGSP14] >gi|147755471|gb|EDK62519.1| hemolysin A, putative [Streptococcus pneumoniae SP11-BS70] >gi|182629400|gb|ACB90348.1| hemolysin A, putative [Streptococcus pneumoniae CGSP14] >gi|183577198|gb|EDT97726.1| hemolysin A [Streptococcus pneumoniae MLV-016] (271 aa)
Score = 339, Expect = 3.2e-30, Identities = 88/246 (35%), Positives = 145/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS+NLI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +       +    LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLNLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKVHQNVLESVTAMAVEVGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|94266002|ref|ZP_01289724.1| Hemolysin A [delta proteobacterium MLMS-1] >gi|93453431|gb|EAT03850.1| Hemolysin A [delta proteobacterium MLMS-1] (251 aa)
Score = 339, Expect = 3.2e-30, Identities = 87/236 (36%), Positives = 133/236 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           K RLD  LV    A SR  AQ LI    V    +++ K+ TLV     + + E    YVSR   KL AA++HF ID    +AIDIG+STGGF+  L +   +++Y++DVG  QL  +L+++ +V+  E+TN R +  +   +++D   ID SFIS+ L+   +  L     + +AL+KPQFE G++     G  + E  H++++ +  EF   L +  LG I SP+ G K  N E+L 
  S:     2 KERLDKLLVARGLATSRPRAQALIGAGLVSNASRVLDKAGTLVAVDTPLHVKENPCPYVSRGGLKLAAALDHFAIDPAGLVAIDIGASTGGFSDCLRQRGARRIYAVDVGYGQLAWKLRQDQRVVVKERTNARYLTPADFPERLDLAVIDASFISLKLLLPPLLPLLRPGARLVALIKPQFEAGRERLGKGGVVRDERVHQEVVASIEEFALQLALNRLGVIPSPLPGPKG-NREFLL 238
>gi|166981802|ref|ZP_02253253.1| hemolysin A [Bacillus cereus AH187] >gi|168161510|ref|ZP_02596743.1| hemolysin A [Bacillus cereus H3081.97] (279 aa)
Score = 339, Expect = 3.3e-30, Identities = 85/245 (34%), Positives = 138/245 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K R+D+ LV      +R  A+  I    V  N   + K    + +  ++ +  +   YVSR  YKL+ A+E F+++L +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     4 KKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPQDTEITVKGQVMPYVSRGGYKLEKALETFHLNLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 250
>gi|56808395|ref|ZP_00366147.1| COG1189: Predicted rRNA methylase [Streptococcus pyogenes M49 591] >gi|94994733|ref|YP_602831.1| Lantibotic precursor [Streptococcus pyogenes MGAS10750] >gi|94548241|gb|ABF38287.1| Lantibotic precursor [Streptococcus pyogenes MGAS10750] (275 aa)
Score = 339, Expect = 3.3e-30, Identities = 92/240 (38%), Positives = 142/240 (59%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     + +  F +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S       G   SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFNEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHG-NIEFLAHL 244
>gi|22536678|ref|NP_687529.1| hemolysin A [Streptococcus agalactiae 2603V/R] >gi|25010614|ref|NP_735009.1| hemolysin A [Streptococcus agalactiae NEM316] >gi|76788457|ref|YP_329232.1| hemolysin A [Streptococcus agalactiae A909] >gi|77405295|ref|ZP_00782391.1| hemolysin A [Streptococcus agalactiae H36B] >gi|77412375|ref|ZP_00788685.1| hemolysin A [Streptococcus agalactiae CJB111] >gi|77414005|ref|ZP_00790177.1| hemolysin A [Streptococcus agalactiae 515] >gi|22533518|gb|AAM99401.1|AE014214_15 hemolysin A [Streptococcus agalactiae 2603V/R] >gi|23094968|emb|CAD46189.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563514|gb|ABA46098.1| hemolysin A [Streptococcus agalactiae A909] >gi|77159931|gb|EAO71070.1| hemolysin A [Streptococcus agalactiae 515] >gi|77161563|gb|EAO72564.1| hemolysin A [Streptococcus agalactiae CJB111] >gi|77176090|gb|EAO78863.1| hemolysin A [Streptococcus agalactiae H36B] (275 aa)
Score = 339, Expect = 3.3e-30, Identities = 95/241 (39%), Positives = 150/241 (62%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLE 241
           M K R+D+      L +      RGV   ++ N   VING+   K    V +  ++++  E+ KYVSR   KL+ A++ F I + +K+ IDIG+STGGFT V+L++  + VY++DVGTNQL  +L+++++V S+EQ NFR  +    K+ + +F +IDVSFIS+NLI   +KE+  +  + +AL+KPQFE G++     G  K +  H+K++     F      K+ GY V     SPI+G    N E+L +L+
  S:     1 MAKERVDVLAYKQGLFDTREQAKRGVMAGMVIN---VINGERYDKPGEKVADDTELKLKGEKLKYVSRGGLKLEKALQVFEISVADKLTIDIGASTGGFTDVMLQSGARLVYAVDVGTNQLVWKLRQDHRVRSMEQYNFRYAQKEDFKEGLPEFASIDVSFISLNLILPALKEILVDGGQVVALIKPQFEAGREQIGKNGIVKDKLVHEKVLTTVTNF-----TKDYGYTVKHLDFSPIQGGHG-NIEFLMHLQ 245
>gi|160915114|ref|ZP_02077327.1| hypothetical protein EUBDOL_01122 [Eubacterium dolichum DSM 3991] >gi|158432913|gb|EDP11202.1| hypothetical protein EUBDOL_01122 [Eubacterium dolichum DSM 3991] (260 aa)
Score = 339, Expect = 3.4e-30, Identities = 83/238 (34%), Positives = 138/238 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYV-SRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFN------KIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +R+D YLV + Y  +R  AQD I    V ++G+ I K++ ++ E  +V + +EE  + SRA +KL   ++ F I L ++I ID+G+STGGF+ V L    K+VY++DVG +QL E LK++ +++++E  N R +   +   + DF  +DVSFIS+ LI        K KEL       + L+KPQFE G       G  K E  H +++ + + ++  L +       S I G +  N E++ +++
  S:     1 MRIDQYLVEKGYFTTRTRAQDAIKKGCVSVDGKTIMKNSFVIEEGKEVTVFQEELVLASRAGFKLYDVLKDFEICLQDRICIDVGASTGGFSDVCLRQGAKRVYAVDVGHDQLLEHLKQDPRIVNMEGVNCRYLTKDMFSPQPDFACMDVSFISVKLILPALISCMKHKEL-------VILIKPQFEAGNAYVNKHGIVKEERVHVQVLKDMLAYVCSLQLYVHHLQASSILG-RGGNKEFVMHIK 238
>gi|116333611|ref|YP_795138.1| rRNA methylase [Lactobacillus brevis ATCC 367] >gi|116098958|gb|ABJ64107.1| Predicted rRNA methylase [Lactobacillus brevis ATCC 367] (271 aa)
Score = 339, Expect = 3.4e-30, Identities = 80/223 (35%), Positives = 134/223 (60%)
  Q:    19 RGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--------KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +G+   L    + V+ G+I+ K+   +++   +  ++ E         YVSR  +KL  A+E F ID+ ++I +DIGSSTGGFT V+L+N  +  Y++DVG+NQL  +L+++ +VI +E TNFR  + +   K +  F +IDVSFIS+ LI   +K++       +AL+KPQFE  ++     G  +    H++++   I+F        LG   SPI+G +  N E+L +L+
  S:    13 QGLFTSLDEAKRAVMAGEILGKNEERLDKPGSLIPIDTELHLKGHPLPYVSRGGFKLAKALEVFKIDVTDRIVLDIGSSTGGFTDVMLQNGAQLSYALDVGSNQLVWKLRQDPRVIVMEHTNFRYSQLADFTKGQPTFASIDVSFISLKLILPPLKQILAVGGDVVALIKPQFEASREDVGNHGIVRDRAVHEQVVQTIIDFAVATGYSVLGLDFSPIRGGEG-NIEFLVHLQ 244
>gi|147833203|emb|CAN64221.1| hypothetical protein [Vitis vinifera] (250 aa)
Score = 339, Expect = 3.9e-30, Identities = 76/216 (35%), Positives = 130/216 (60%)
  Q:    30 KVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           KV ++G++++K+ T V++   VEI+ E  KYV RA YKL+AAIE   ++++ K+A+D G STGGFT  LL+     +Y +DVG  Q+ ++++++ +V  +E+TN R +    +  K+D +T+D+SFISI L+   +  +       + L+KPQFE  +      G  +    H++++   I+ +     +  G+I SP+KGA+  NTE+L     K E
  S:    36 KVFVDGKVVNKAGTPVSDKAVVEIMAEVPKYVCRAGYKLEAAIEQLGVEVSGKVALDSGLSTGGFTDCLLQYGASFIYGVDVGYGQVADKIRRDERVSVVERTNLRYLPG--LPQKVDLVTLDLSFISILLVMPAVVNVMKEESTLVTLVKPQFEARRSQVGGGGIVRDPLVHQEVLERIIKGVESFGFECKGWIESPLKGAEG-NTEFLVCFTRKPE 250
>gi|148544404|ref|YP_001271774.1| hemolysin A [Lactobacillus reuteri F275] >gi|184153767|ref|YP_001842108.1| hemolysin [Lactobacillus reuteri F275] >gi|148531438|gb|ABQ83437.1| hemolysin A [Lactobacillus reuteri F275] >gi|183225111|dbj|BAG25628.1| hemolysin [Lactobacillus reuteri F275] (273 aa)
Score = 338, Expect = 4.1e-30, Identities = 90/240 (37%), Positives = 144/240 (60%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNEL-DKVEIL-------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K R+D+ LV +    SR  A+      + V+ G+I+ K+N  +++   K+ I         +  YVSR   KL  A++ F+I + +K  +DIGSSTGGFT V+L+N  K  Y++DVGTNQL  QL+++ +V+ +EQTNFR  + +     + +F +IDVSFIS+ LI   + ++     + +AL+KPQFE GK+ +G        + H+ ++   + F    +   LG   SPIKG +  N E+L +L
  S:     1 MKKERVDVLLVQQGLFDSREQAK------RAVMAGEILGKNNERLDKPGQKIPITTTLHMKGHKMPYVSRGGLKLAKALKVFDISVKDKTVLDIGSSTGGFTDVMLQNGAKLSYALDVGTNQLVWQLREDPRVVVMEQTNFRYSKLADFTSGQPEFASIDVSFISLRLILPPLAQILKMGGEVVALIKPQFEAGKEHVGKNGIIHDHKVHRAVLEEVLTFAREDHFDILGLDYSPIKGGQG-NMEFLVHL 243
>gi|15615341|ref|NP_243644.1| hemolysin-like protein [Bacillus halodurans C-125] >gi|10175399|dbj|BAB06497.1| hemolysin-like protein [Bacillus halodurans C-125] (272 aa)
Score = 338, Expect = 4.2e-30, Identities = 84/245 (34%), Positives = 140/245 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K R+D+ LV      +R  A+  I    V    + + K    V+    + +  E   YVSR   KL+ AI  F++ L +++ +DIG+STGGFT   L+N    VY++DVG NQL  +L+++ +V+ +E+TNFR ++  +++  + +  TIDVSFIS+ LI   +K +   N   +AL+KPQFE G++    KG  + +  H+K+++  +EF         G   SPI G +  N E+L +L ++ +K
  S:     3 KKERVDVLLVERGLMETREKAKRSIMAGLVFSGHERVDKPGLKVDRDTPLSVKGEVLPYVSRGGLKLEKAIRAFDLHLTDRVVLDIGASTGGFTDCALQNGATFVYAVDVGYNQLAWKLRQDERVVVMERTNFRYLKPEVLERGLPNMATIDVSFISLKLILPVLKTMLLENSDVVALVKPQFEAGREEVGKKGIVRDKSVHQKVLSTIVEFALKEGYAVGGLDFSPITGGEG-NIEFLLHLMWRKDK 249
>gi|183219509|ref|YP_001837505.1| putative ribosomal RNA methyltransferase, putative hemolysine TlyA-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189909651|ref|YP_001961206.1| rRNA methylase/Hemolysin-tylA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|106879730|emb|CAJ90434.1| putative ribosomal RNA methyltransferase [Leptospira biflexa serovar Patoc] >gi|167774327|gb|ABZ92628.1| rRNA methylase/Hemolysin-tylA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167777931|gb|ABZ96229.1| Putative ribosomal RNA methyltransferase, putative hemolysine TlyA-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (257 aa)
Score = 338, Expect = 4.8e-30, Identities = 99/244 (40%), Positives = 147/244 (60%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIES----SLIKDKIDFITIDVSFISINLIFNKIKELKWN----NWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSIL----NIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +KIRLD YLV E YA+   +AQ LI +  V++N  I+SK  TL++  DKV   E+ K YVSR AYKL  A + +  I +  K  ID+G+STGGF QVLLE    +V ++DVG  QL +++  + KV  L++T+ RE+      +L K+   +IT+D+SFIS+  +F+ +  L       +W+ I+L KPQFE+            + +  K I N   +L I      ++ LG   SPI+GA   N E+L   E ++E
  S:     4 EKIRLDDYLVREGYAKDLKLAQSLILSGSVLVNDTIVSKVGTLISNKDKVRTKEKIKTYVSRGAYKLLGAFDRWKTIQVEGKTCIDLGASTGGFCQVLLEKGAIRVIAVDVGYGQLAQKIANDPKVFVLDRTHLRELPKLPLGALTKET--WITMDLSFISLVPVFSHLLPLFQKYPDIHWQGISLFKPQFEVHPSKLEKGILIDSHNIGKTIKNV--WLKIKKNDPKLEFLGLGESPIQGADG-NREFLIRWERRSE 256
>gi|194466514|ref|ZP_03072501.1| hemolysin A [Lactobacillus reuteri 100-23] >gi|194453550|gb|EDX42447.1| hemolysin A [Lactobacillus reuteri 100-23] (273 aa)
Score = 338, Expect = 5.1e-30, Identities = 90/240 (37%), Positives = 144/240 (60%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNEL-DKVEIL-------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K R+D+ LV +    SR  A+      + V+ G+I+ K+N  +++   K+ I         +  YVSR   KL  A++ F+I + +K  +DIGSSTGGFT V+L+N  K  Y++DVGTNQL  QL+++ +V+ +EQTNFR  + +     + +F +IDVSFIS+ LI   + ++     + +AL+KPQFE GK+ +G        + H+ ++   + F    +   LG   SPIKG +  N E+L +L
  S:     1 MKKERVDVLLVQQGLFDSREQAK------RAVMAGEILGKNNERLDKPGQKIPITTTLHMKGHKMPYVSRGGLKLAKALKVFDISVKDKTVLDIGSSTGGFTDVMLQNGAKLSYALDVGTNQLVWQLREDPRVVVMEQTNFRYSKLADFTSGQPEFASIDVSFISLRLILPPLAQILKMGGEVVALIKPQFEAGKEHVGKNGIIHDHKVHRAVLEEVLTFAQEDHFDILGLDYSPIKGGQG-NMEFLVHL 243
>gi|108799917|ref|YP_640114.1| hemolysin A [Mycobacterium sp. MCS] >gi|119869027|ref|YP_938979.1| hemolysin A [Mycobacterium sp. KMS] >gi|126435545|ref|YP_001071236.1| hemolysin A [Mycobacterium sp. JLS] >gi|108770336|gb|ABG09058.1| hemolysin A [Mycobacterium sp. MCS] >gi|119695116|gb|ABL92189.1| hemolysin A [Mycobacterium sp. KMS] >gi|126235345|gb|ABN98745.1| hemolysin A [Mycobacterium sp. JLS] (269 aa)
Score = 337, Expect = 6.2e-30, Identities = 77/245 (31%), Positives = 137/245 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLV--NELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++ R+D  LV    ARSR  A +LI   +V ++G   +K  T V       V+  +E  +VSR A+KL  A++ F+ID+ ++  +D G+STGGFT+VLL+   ++V ++DVG  QL   L+ + +V+ +E+TN RE+   +I   +D +  D+SFIS+  +   +      +   + ++KPQFE+GK ++G     ++ E   + + +     + L  + +G   SP+ G    N EY  +L  + ++
  S:     3 RRARVDAELVRRGLARSRQQAAELIGAGRVTVDGMPAAKPATAVAVTAHIAVDTADERSWVSRGAHKLIGALDAFDIDVADRRGLDAGASTGGFTEVLLDRGAREVVAVDVGYGQLAWSLRSDERVVVVERTNVRELTPEMIGGPVDLVVADLSFISLATVLPALTACASPDADIVPMVKPQFEVGKDRVGAGGVVSEPELRAESVLSVAAKAAGLGWETVGATASPLPGPSG-NVEYFLWLRARTDR 249
>gi|81428295|ref|YP_395295.1| putative rRNA methylase, hemolysin A-like protein [Lactobacillus sakei subsp. sakei 23K] >gi|78609937|emb|CAI54984.1| Putative rRNA methylase, hemolysin A homolog [Lactobacillus sakei subsp. sakei 23K] (276 aa)
Score = 337, Expect = 6.4e-30, Identities = 86/240 (35%), Positives = 139/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNE----LDKVEILEEE----KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K R+D+ LV +    SR   +      + ++ G++  K++  +++    +D   +L  +     YV R A KL  AI+ F+IDL +K+ +DIGSSTGGFT V L N  ++ Y++DVG NQL  +L+++ +V+ +E+ NFR  +     D + DF   DVSFIS++ I   +K +   N  ++AL+KPQFE G   +G        + HK ++ + + F        LG   SPIKG +  N E+L +L
  S:     1 MKKERVDVLLVQQGLFESREQGK------RAIMAGEVYGKNDERIDKPGEKIDAETVLRVKGHKIPYVGRGALKLAKAIDVFDIDLKDKLTLDIGSSTGGFTDVALRNGARRCYALDVGYNQLAWKLREDPRVVVMERVNFRYSQPEDFTDGLPDFAMTDVSFISLHKILVPLKPILKPNCDAVALIKPQFEAGPANVGKNGIVRDPKVHKNVVTDIVNFSLATGYDVLGLDFSPIKGGEG-NIEFLIHL 243
>gi|167471946|ref|ZP_02336650.1| hemolysin [Rickettsia africae ESF-5] (251 aa)
Score = 336, Expect = 7.0e-30, Identities = 97/237 (40%), Positives = 132/237 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN--ELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+ + +     +A+ LI   KV    + + K    VN  + D    L +  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE   K ++++DVG  +L+ +L+ N+ +  LE+TN R +    I  K D I  D SFIS+  I   +  L   +   IAL+KPQFE+ K      G  K    H+K+ N    +L    N K  G I SPI GAK  N E+L
  S:     1 MTKIRLDKYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQVNINDTDIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGELHPKLRDNSHIKVLEKTNARYLTDQQIITKPDLIVCDASFISLTTILPTVLNLVKEDCMLIALIKPQFEVEKHEVEQGGVIKNPLLHQKVCNKIKAWLEKEHNFKIFGIIASPILGAKG-NQEFL 240
>gi|144900834|emb|CAM77698.1| Hemolysin A [Magnetospirillum gryphiswaldense MSR-1] (251 aa)
Score = 336, Expect = 7.2e-30, Identities = 83/235 (35%), Positives = 132/235 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFE-LGKKIGTTKGFAKTEDHKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYL 237
           ++R+D  LV+   A SR  AQ L+    V++ G+ I K+ T V E   +E+  ++  +VSR   KL  A++ F ID   K+A+D+G+STGGFT VLL     +VY++DVG  QL  +L+ +++VI LE+TN R + +  I  ++D +  D SFI +  +      L  +    +AL+KPQFE    ++G      + E H ++      +L S    + +G   SPIKG +  N E+L
  S:     4 RVRIDQLLVDRGLAESRARAQALVMAGLVIVGGKKIDKAGTQVAEDAGIELKGQDHPWVSRGGLKLVEALDRFAIDPTGKVAVDVGASTGGFTDVLLSRGAARVYAVDVGHGQLAWKLRSDDRVIVLERTNARYLTTEQIPQRVDMVVCDASFIGLETVLPAALTLAGDGATLVALIKPQFEVGKGRVGKGGVVREPELHAEVCERITTWLPSNPGWEVIGLCDSPIKGPEG-NKEFL 240
>gi|169334432|ref|ZP_02861625.1| hypothetical protein ANASTE_00832 [Anaerofustis stercorihominis DSM 17244] >gi|169259149|gb|EDS73115.1| hypothetical protein ANASTE_00832 [Anaerofustis stercorihominis DSM 17244] (267 aa)
Score = 336, Expect = 7.2e-30, Identities = 94/243 (38%), Positives = 140/243 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD+ L     A SR  A+ LI    V +N Q + K+ T V+    + I   +  +VSR  +KL  A++ F+ D+  K  +D+G+S+GGFT  LL+N  KKVYSIDVG  Q   +L+++ +V+ LE+TNFR +E   + + ID + +DVSFISI  + + +     ++   I L+KPQFE GK +           HKK++ + I  L    L ++ L Y  SPIKG K  N E++ Y+  KNE
  S:     4 KERLDVLLFESGMAESREKAKRLIMAGVVFVNDQRVDKAGTKVDIYSNIIIKGNDNPFVSRGGFKLDKALKVFDADVTGKTCMDVGASSGGFTDCLLQNGAKKVYSIDVGYGQFAYKLRQDERVVCLEKTNFRNMEFEKVGEMIDTVVMDVSFISILKLADNLLNFLKDDGFYICLIKPQFEAGKDLVGNGIIKDKNIHKKVVKDVIYGLKDKGLYVEKLDY--SPIKGPKG-NREFIAYVT-KNE 245
>gi|78777541|ref|YP_393856.1| hemolysin A [Sulfurimonas denitrificans DSM 1251] >gi|78498081|gb|ABB44621.1| Hemolysin A [Sulfurimonas denitrificans DSM 1251] (236 aa)
Score = 336, Expect = 7.7e-30, Identities = 96/237 (40%), Positives = 134/237 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKE-NTEYLFYLE 241
           RLD YLV      SR  AQ++I    V +NG+ I KS+  +   DKV + E ++YVSRAA+KL A +   +++L +K A+DIGSSTGGFTQVLLE   K+V ++DVG  QL+  LK + +V S E+ + RE +S       D +  DV+FIS+  I + +  L  +  K I L KPQFE+G++    K    T D K I+   I+F  +           SP K   KE N EY +  E
  S:     3 RLDNYLVENGQCESRNKAQNIIKEGLVSVNGEQIIKSSYALKSSDKVVVKEHKEYVSRAAFKLSAFLGELSLNLKDKTALDIGSSTGGFTQVLLEEGAKEVTAVDVGREQLHVSLKNDARVHSYEECDIREFKSD---KSFDIVVSDVAFISLLYILDDVDRLSHD--KIILLFKPQFEVGREAKRDKNGVVT-DEKAILQAMIKFEDTCKLKDWKLLKKSPSKITGKEGNLEYCYLFE 235
>gi|94986449|ref|YP_594382.1| hemolysin A [Lawsonia intracellularis PHE/MN1-00] >gi|94730698|emb|CAJ54060.1| hemolysin A [Lawsonia intracellularis PHE/MN1-00] (251 aa)
Score = 336, Expect = 8.2e-30, Identities = 100/242 (41%), Positives = 141/242 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDK----------VEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKS--IALLKPQFEL-GKKIGTTKGFAK-TEDHKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
            K+R D  +  +  A SR  A+ LI   KV +     + S T+   L+K            ++  E++VSR AYKL  A++ F ID+ + I +D G+STGGFT  LL++   KVY+IDVG  QL+E+L  N +VI++E  N R     LI +++D +TIDVSFIS+ LI      ++W       IAL+KPQFEL   KI   KG  K T    + +   I F  S L +  +G + S IKG K  N EYL YL+ +
  S:     4 HKVRADELVFLQGLAESREQAKRLIMAGKVTLT----NNSTTIPLRLEKPGHKYPLESICSLIGVERFVSRGAYKLLTALDFFKIDVKSCICLDAGASTGGFTDCLLQHGASKVYAIDVGKGQLHEKLYTNEQVINIEGVNLRTASKDLIPEEVDILTIDVSFISLTLILPSC--IRWLKASGIIIALIKPQFELYPDKI--KKGVVKETSLQYEAVEKIIHFCQSELGLIFIGVVPSVIKGPKG-NQEYLIYLKKR 251
>gi|149181865|ref|ZP_01860354.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus sp. SG-1] >gi|148850404|gb|EDL64565.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus sp. SG-1] (275 aa)
Score = 335, Expect = 9.2e-30, Identities = 96/246 (39%), Positives = 142/246 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLEYKNEK 246
           ++K RLD+ LV    A +R  A+  +    V      + K    VNE   + I      YVSR   KL+ A+E F++ ++ K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR ++   L+ D  +F T+DVSFIS++LI   +K L   +   IAL+KPQFE GK     KG  +      I +  IE ++ L +K  GY +     SPI G +  N E+L +L +  EK
  S:     3 VKKQRLDVLLVERGLAETREKAKRAVMAGLVYSKESRLDKPGEKVNEDIPLTIKGNVLPYVSRGGLKLEKALEKFDLSVDGKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVKPEDLVSDMPNFATMDVSFISLSLILPVLKTLLVRDSDVIALIKPQFEAGKDQVGKKGIVRD---PAIHHAVIEKIANLALKE-GYDIRDISFSPITGGEG-NIEFLIHLSWHGEK 250
>gi|111657820|ref|ZP_01408537.1| hypothetical protein SpneT_02001002 [Streptococcus pneumoniae TIGR4] >gi|148989223|ref|ZP_01820603.1| hemolysin A, putative [Streptococcus pneumoniae SP6-BS73] >gi|149008193|ref|ZP_01831698.1| hemolysin A, putative [Streptococcus pneumoniae SP18-BS74] >gi|169833625|ref|YP_001694641.1| hemolysin A [Streptococcus pneumoniae Hungary19A-6] >gi|194398471|ref|YP_002037808.1| hemolysin A, putative [Streptococcus pneumoniae G54] >gi|147760374|gb|EDK67354.1| hemolysin A, putative [Streptococcus pneumoniae SP18-BS74] >gi|147925201|gb|EDK76280.1| hemolysin A, putative [Streptococcus pneumoniae SP6-BS73] >gi|168996127|gb|ACA36739.1| hemolysin A [Streptococcus pneumoniae Hungary19A-6] >gi|194358138|gb|ACF56586.1| hemolysin A, putative [Streptococcus pneumoniae G54] (271 aa)
Score = 335, Expect = 9.6e-30, Identities = 87/246 (35%), Positives = 145/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +       +    LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKVHQNVLESVTAMAVEVGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|158338042|ref|YP_001519218.1| hemolysin A, putative [Acaryochloris marina MBIC11017] >gi|158308283|gb|ABW29900.1| hemolysin A, putative [Acaryochloris marina MBIC11017] (272 aa)
Score = 335, Expect = 9.8e-30, Identities = 85/241 (35%), Positives = 133/241 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS--LIKDKI--DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K RLD  LV+     SR  AQ +I   +V +N QII K  T V    ++++ ++  +VSR  +KL+ A+  F I + ++I +D G STGGFT  LL+   ++VY IDVG  Q+  +L+ + +VI  E+TN R ++ +    +D    D   IDVSFIS+  +   + +L     + + L+KPQFE+GK ++G       +  H+  I    +  S L     G   SP+ G K  N E+L +L+
  S:     1 MAKQRLDTLLVSLELCTSRQQAQRVIRAGEVKVNDQIIDKPGTEVQLTAEIQVKQKSPFVSRGGHKLEKALAEFPIQIQDRICLDGGISTGGFTDCLLQAGAQQVYGIDVGYGQVAWKLRNDPRVILKERTNLRHLQPADLFTEDATIPDLGVIDVSFISLTKVLPALWQLLQPPREMVLLVKPQFEVGKDRVGKHGVVRDSHAHRDAIAQVYQAASALGWHYAGVTWSPLPGPKG-NIEFLLWLQ 245
>gi|15892745|ref|NP_360459.1| hemolysin [Rickettsia conorii str. Malish 7] >gi|15619922|gb|AAL03360.1| hemolysin [Rickettsia conorii str. Malish 7] (251 aa)
Score = 335, Expect = 9.8e-30, Identities = 97/237 (40%), Positives = 134/237 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEI---LEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+ + +     +A+ LI   KV    + + K    VN ++  EI   L +  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE   K ++++DVG  +L+ +L+ N  +  LE+TN R +    I  K D I  D SFIS+  I   +  L   +   IAL+KPQFE+ K      G  K    H+K+ +   ++L    N K  G I SPI GAK  N E+L
  S:     1 MTKIRLDEYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQVN-INDTEIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGELHPKLRDNPHIKVLEKTNARYLTDKQIITKPDLIVCDASFISLTTILPTVLNLVKEDCMLIALIKPQFEVEKHEVEQGGVIKNPLLHQKVCDKIKDWLEKEHNFKIFGIIASPILGAKG-NQEFL 240
>gi|71903831|ref|YP_280634.1| hemolysin [Streptococcus pyogenes MGAS6180] >gi|71802926|gb|AAX72279.1| hemolysin [Streptococcus pyogenes MGAS6180] (275 aa)
Score = 335, Expect = 1.1e-29, Identities = 91/240 (37%), Positives = 141/240 (58%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFI-TIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     +    + +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S       G   SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFNEGQPVLASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKGLDFSPIQGGHG-NIEFLAHL 244
>gi|89099258|ref|ZP_01172136.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus sp. NRRL B-14911] >gi|89086104|gb|EAR65227.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus sp. NRRL B-14911] (281 aa)
Score = 334, Expect = 1.2e-29, Identities = 93/245 (37%), Positives = 139/245 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K RLD+ LV      +R  A+  I    V  N   + K    V     + +  + K   YVSR   KL+ AI+ F++D++ K+ +DIG+STGGFT   L+N  K  Y++DVG NQL  +L+++ +V  +E+TNFR +  + L  +  DF +IDVSFIS+ LI   +K L       IAL+KPQFE G++    KG  +    H  +I+  I F      +++NL Y  SPI G    N E+L +L ++ EK
  S:     4 KKERLDVLLVERGLIETREKAKRAIMAGLVYTNESRLDKPGEKVGA--DIPLTVKGKLIPYVSRGGLKLEKAIKEFDVDISGKVLLDIGASTGGFTDCALQNGAKMSYALDVGYNQLAWKLRQDERVEVMERTNFRYVTPADLAGEMPDFASIDVSFISLKLILPVLKTLLVPGSDVIALVKPQFEAGREQVGKKGIVRDPKVHADVIDRMIRFSLEQGYDVRNLSY--SPITGGDG-NIEFLLHLRWEGEK 250
>gi|46581315|ref|YP_012123.1| hemolysin A [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120601504|ref|YP_965904.1| hemolysin A [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46450736|gb|AAS97383.1| hemolysin A [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120561733|gb|ABM27477.1| hemolysin A [Desulfovibrio vulgaris subsp. vulgaris DP4] (253 aa)
Score = 334, Expect = 1.2e-29, Identities = 85/239 (35%), Positives = 141/239 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKV-VINGQIISKSNTLVN------ELD-KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K R D  +     A SR  A+ +I   +V V+ G + +     V+      +LD + E+   E++VSR AYKL  AI++F  D+   +A+D G+STGGFT  LL++   +VY++DVG  QL+E+++ + +V++LE+TN R   + LI +++D +  DVSFIS+ L+     +      + +AL+KPQFE+G    T +G  + E   +  ++  + +    L + + G + S IKG K  N EYL  L
  S:     3 RKERADQLVHEAGLAESREQAKRMIMAGQVFVLRGPLAAPVAEPVDKPGHKFDLDARFEVRGRERFVSRGAYKLLTAIDYFKFDVTGFVALDAGASTGGFTDCLLQHGAVRVYAVDVGHGQLHERMQADPRVVNLERTNLRTAPADLIPEQVDIVVADVSFISLTLVLEPCMQWLKPGGRVVALVKPQFEVGAH-QTDRGVVRDEGLQQAAVDKVLTYCRETLGLVHEGTVPSAIKGPKG-NQEYLVCL 249
>gi|47569435|ref|ZP_00240116.1| hemolysin A [Bacillus cereus G9241] >gi|47553850|gb|EAL12220.1| hemolysin A [Bacillus cereus G9241] (220 aa)
Score = 334, Expect = 1.2e-29, Identities = 75/188 (39%), Positives = 115/188 (61%)
  Q:    59 YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +  + ++  +  F +IDVSFIS+ LI   +K +   N    AL+KPQFE G++    KG  +    H+ ++   ++F         G   SPI G    N E+L +L++  E+
  S:     3 YVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFISLKLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDG-NIEFLIHLKWHGER 191
>gi|116748858|ref|YP_845545.1| hemolysin A [Syntrophobacter fumaroxidans MPOB] >gi|116697922|gb|ABK17110.1| hemolysin A [Syntrophobacter fumaroxidans MPOB] (240 aa)
Score = 334, Expect = 1.2e-29, Identities = 76/229 (33%), Positives = 129/229 (56%)
  Q:    10 LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           LV+     SR  AQ LI  ++V+++G+ ++K+   V+   K+E+   +  YVSR   KL+ AI  F I +   +A+D+G+STGGF   LL+   ++VY++DVG  QL  +L+++ +V+ LE+ N R +   L+ + +   T+D SFIS+ L+   +        + IAL+KPQFE+G+ ++G        E H+++  +  EF        +    SP+ G K  N E+L 
  S:     2 LVDRGLTASRERAQALILAARVLVDGRKVTKTGQQVSVDSKIELTGADMPYVSRGGLKLEHAIATFGIGVEGMVAMDVGASTGGFVDCLLQRGARRVYAVDVGYGQLAWKLRQDPRVVVLEKHNIRFLPRDLVPEAVQVATMDTSFISLKLVIPAVIPFLARGARLIALIKPQFEVGRSQVGKGGVVKDPELHRRVCESITEFCRESGFTAIDVTPSPVLGPKG-NREFLL 231
>gi|115376377|ref|ZP_01463614.1| hemolysin A [Stigmatella aurantiaca DW4/3-1] >gi|115366584|gb|EAU65582.1| hemolysin A [Stigmatella aurantiaca DW4/3-1] (246 aa)
Score = 334, Expect = 1.3e-29, Identities = 86/240 (35%), Positives = 131/240 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK-IINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +K RLDI +V    A SR  AQ LI   +VV+  Q + K   LV    ++ +  E   YVSR   KLKAAI+ F +++  K+  DIG+STGGFT  LL+    +V++IDVG  QL+E+L+ + +V S E+ N R + +  + +K   I IDVSFIS+  +   +          +AL+KPQFE+G++     G  + ED ++  I++   F+    +   G +  P+ G    N E L   E
  S:     4 RKERLDILVVERGLAESRTKAQALILAGQVVVGDQRVDKPGALVPVEAEMRLKGEVLPYVSRGGLKLKAAIDRFGLEVRGKVGADIGASTGGFTDCLLQEGALRVHAIDVGYGQLHEKLRTDARVRSRERVNARYLTAEDLPEKAGVIVIDVSFISLTQVLPSVLPFLEAGGLLVALVKPQFEVGRENIGKGGVVRDEDARQSAIDSVTAFVREQGLTVRGVMDCPVPGPAG-NVEALLVAE 244
>gi|67459268|ref|YP_246892.1| hemolysin A [Rickettsia felis URRWXCal2] >gi|67004801|gb|AAY61727.1| Hemolysin A [Rickettsia felis URRWXCal2] (254 aa)
Score = 334, Expect = 1.4e-29, Identities = 97/244 (39%), Positives = 138/244 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLV--------NELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIE-FLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           M KIRLD YL++      +G+  D+     ++I G++ +K   L+        N++D    L +  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE   K ++++DVG  +L+ +L+ N ++  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K    H+K+ +   + F    N K  G I SPI GAK  N E+L   + KN
  S:     1 MTKIRLDEYLLH------KGLVTDITIARSLIIQGKVHNKHEQLIKPGIQVNINDIDIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGELHPKLRDNPQIKVLEKTNARYLTDKQITTKPDLIVCDASFISLTTILPTPLNLAKEDCMLIALIKPQFEVEKHEVEQGGIIKNPLLHQKVCDKIKDWFEKEHNFKIFGIIESPILGAKG-NKEFLICGKRKN 247
>gi|189218344|ref|YP_001938986.1| rRNA methylase [Methylokorus infernorum V4] >gi|189185202|gb|ACD82387.1| rRNA methylase [Methylacidiphilum infernorum V4] (250 aa)
Score = 334, Expect = 1.4e-29, Identities = 93/243 (38%), Positives = 138/243 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQ--IISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           M+K RLD+ LV +N   SR  A+ LI   KV   G+  ++ K + L       E+ E+EKYVSR  YKL+A  +   + L  K+ +D+GSSTGGF+  LL+   + VY +DVG   L+ +L+ + ++   E  N R ++        DFI++DVSFIS+ LI   +  L     K  AL+KPQFE+G+ +   KG  + E   +K+I     +L S   ++ L  I SPI G ++ N EYL+ LE K
  S:     1 MKKERLDLLLVKKNLVSSREEAKRLILAGKVSAIGKPGLVLKPSQLFGLDQDFELTEKEKYVSRGGYKLEALFQAVPLKLEGKVCLDVGSSTGGFSDCLLQQGARTVYCVDVGKGLLHWKLRSDPRIKVKEGINARYLKKEDFDTLFDFISVDVSFISLKLILPPLFPLLSPQGKVCALIKPQFEVGRHLVGKKGIVRDEKLREKLIGELELWLESHYPMQTLAVIPSPILG-QEGNQEYLWLLERK 246
>gi|168484956|ref|ZP_02709901.1| hemolysin A [Streptococcus pneumoniae CDC1873-00] >gi|168493126|ref|ZP_02717269.1| hemolysin A [Streptococcus pneumoniae CDC3059-06] >gi|172041901|gb|EDT49947.1| hemolysin A [Streptococcus pneumoniae CDC1873-00] >gi|183576542|gb|EDT97070.1| hemolysin A [Streptococcus pneumoniae CDC3059-06] (271 aa)
Score = 334, Expect = 1.5e-29, Identities = 87/246 (35%), Positives = 144/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +            LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|16079482|ref|NP_390306.1| hypothetical protein BSU24260 [Bacillus subtilis subsp. subtilis str. 168] >gi|1731101|sp|P19672|YQXC_BACSU Uncharacterized protein yqxC >gi|1303921|dbj|BAA12577.1| YqiF [Bacillus subtilis] >gi|2634860|emb|CAB14357.1| yqxC [Bacillus subtilis subsp. subtilis str. 168] (269 aa)
Score = 333, Expect = 1.6e-29, Identities = 86/237 (36%), Positives = 130/237 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVE-------ILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR-EIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           +K RLD+ LV    A +R  A+      + ++ G + S  N L    +K++            +YVSR   KL+ A++ F + + +KI IDIGSSTGGFT   L+N  K+ Y++DVG NQL  +L+++ +V+ +E+TNFR    +   K   +F TIDVSFIS+ LI   ++ L       +AL+KPQFE G++    KG  +    H  ++   I F +       G   SPI G    N E+L 
  S:     4 KKERLDVLLVERGLAETREKAK------RAIMAGIVYSNENRLDKPGEKIDRDLPLTVKGNPLRYVSRGGLKLEKALKEFPVSVKDKIMIDIGSSTGGFTDCALQNGAKQSYAVDVGYNQLAWKLRQDERVVVMERTNFRYATPADFTKGMPEFATIDVSFISLRLILPVLRTLLVPGSDCMALVKPQFEAGRESVGKKGIVRDPKVHADVLKRMISFSAAEGYICKGLSFSPITGGDG-NIEFLL 242
>gi|153007893|ref|YP_001369108.1| hemolysin A [Ochrobactrum anthropi ATCC 49188] >gi|151559781|gb|ABS13279.1| hemolysin A [Ochrobactrum anthropi ATCC 49188] (253 aa)
Score = 333, Expect = 1.6e-29, Identities = 90/237 (37%), Positives = 129/237 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSIL-NIKNLGYIVSPIKGAKKENTEYLF 238
           + +RLD  LV      +R  A+D I    V ++G+ ++K    V    K+ + +    YVSRAA KL AA++HF +D+  + A+DIG+STGGFTQVLLE     V +IDVG +QL+E L+ + +V + E  N R +E S L   +ID +  DVSFIS+ L                 L+KPQFE G++ IG        +D ++I      +L  L   + LG   SPI+G    N EYL 
  S:     8 KNLRLDQLLVELGLFATRSRARDAIQRGTVKVDGKPVTKPGQTVLRTAKIAVDDPASAYVSRAALKLIAALDHFELDVKGRTALDIGASTGGFTQVLLERGASHVLAIDVGHDQLHETLRADPRVTNKEGLNARALELSHLDGREIDCVVSDVSFISLKLALPPALAFAQKGAICALLVKPQFEAGREAIGKGGILRDPKDGERIAEELKSWLETLPGWRALGLCPSPIEGGDG-NREYLL 247
>gi|148985098|ref|ZP_01818337.1| hemolysin A, putative [Streptococcus pneumoniae SP3-BS71] >gi|148993814|ref|ZP_01823216.1| hemolysin A, putative [Streptococcus pneumoniae SP9-BS68] >gi|149002570|ref|ZP_01827502.1| hemolysin A, putative [Streptococcus pneumoniae SP14-BS69] >gi|149019196|ref|ZP_01834558.1| hemolysin A, putative [Streptococcus pneumoniae SP23-BS72] >gi|168489032|ref|ZP_02713231.1| hemolysin A [Streptococcus pneumoniae SP195] >gi|147759181|gb|EDK66174.1| hemolysin A, putative [Streptococcus pneumoniae SP14-BS69] >gi|147922543|gb|EDK73661.1| hemolysin A, putative [Streptococcus pneumoniae SP3-BS71] >gi|147927639|gb|EDK78664.1| hemolysin A, putative [Streptococcus pneumoniae SP9-BS68] >gi|147931066|gb|EDK82045.1| hemolysin A, putative [Streptococcus pneumoniae SP23-BS72] >gi|183572470|gb|EDT92998.1| hemolysin A [Streptococcus pneumoniae SP195] (271 aa)
Score = 333, Expect = 1.6e-29, Identities = 87/246 (35%), Positives = 144/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +            LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|83945407|ref|ZP_00957755.1| hemolysin A [Oceanicaulis alexandrii HTCC2633] >gi|83851241|gb|EAP89098.1| hemolysin A [Oceanicaulis alexandrii HTCC2633] (245 aa)
Score = 333, Expect = 1.6e-29, Identities = 94/236 (39%), Positives = 128/236 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIIN-NFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +R D YLV   Y  +R  AQ  I   KV +N  I+ K +  + E    EIL E    YVSRAA KL   ++ F +D   K  +DIGSSTGGFT+VLLE    +V ++DVG +QL   L+ + +V+SLE T+ R +   LI+D     +  D SFIS+  +  +  EL     + I L KPQFE+G K     G  K E   ++   N   F +  ++  LG   SPI+G    N EYLFY
  S:     1 MRADKYLVEHGYFDTRARAQAAIAAGKVSVNDVILVKPSQTIPE--GAEILAEAAHPYVSRAALKLVKGLDAFGVDPAGKRCLDIGSSTGGFTEVLLERGAARVVAVDVGRDQLAPALRAHPQVLSLEGTDARNLTRELIEDAAPGLLVCDASFISLEKVLARPLELLGEGGEMIVLFKPQFEVGPKFVGKGGLVKDEAAVELAKENARAFFARASVPVLGETGSPIRGGDG-NREYLFY 237
>gi|168486527|ref|ZP_02711035.1| hemolysin A [Streptococcus pneumoniae CDC1087-00] >gi|183570460|gb|EDT90988.1| hemolysin A [Streptococcus pneumoniae CDC1087-00] (271 aa)
Score = 333, Expect = 1.6e-29, Identities = 87/246 (35%), Positives = 144/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G++ IG        + H+ ++ +            LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREHIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|15888079|ref|NP_353760.1| hemolysin [Agrobacterium tumefaciens str. C58] >gi|15155705|gb|AAK86545.1| hemolysin [Agrobacterium tumefaciens str. C58] (250 aa)
Score = 333, Expect = 1.7e-29, Identities = 88/234 (37%), Positives = 132/234 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV+  +  SR  A+D ++   V +NG+I++K +  V    K+ I +  + YVSRAA KL AA++HF +D      +D+G+STGGFT+VLL    K V +IDVG  Q++ +++ + +V SLE  N R + +  I ++ I FI  DVSFIS+ L      EL      ++ L+KPQFE G+   +  G  K  +    +   +E      +  K+LG I SPI G    N E+L 
  S:     9 RLDQLLVSRGHFASRSRARDAVSRGTVSVNGKIVTKPSQTVAANVKIAITDPAQAYVSRAALKLTAALDHFKLDPRGLDCLDVGASTGGFTEVLLHRGAKHVVAIDVGHGQIHPRIENDPRVTSLEGLNARFLTTDDIDERPIGFIVSDVSFISLKLALAPALELAEPGALAVLLVKPQFEAGRDAISKAGLLKEPETAPAVAAELERWLTEDMGWKSLGLIPSPISGGDG-NVEFLL 245
>gi|56420926|ref|YP_148244.1| hypothetical protein GK2391 [Geobacillus kaustophilus HTA426] >gi|47076822|dbj|BAD18362.1| unknown conserved protein [Geobacillus kaustophilus] >gi|56380768|dbj|BAD76676.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (282 aa)
Score = 333, Expect = 1.8e-29, Identities = 90/241 (37%), Positives = 131/241 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-----YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEY 242
           +K RLD+ LV    A +R  A+  I    V  N   + K    V     V+I  E K     YVSR   KL+ A+  F+I + NKI +DIG+STGGFT   L++  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +      K   +   IDVSFIS+ LI   +K +       IAL+KPQFE GK+    KG  +  + H++++ + I+F        L    SPI G    N E+L +  Y
  S:     4 KKERLDVLLVERGLAETREKAKRAIMAGLVYSNDVRLDKPGEKV----PVDIPLEVKGNPLPYVSRGGLKLEKALREFHIRVENKIVLDIGASTGGFTDCALQHGAKLTYAVDVGYNQLAWKLRQDERVVVMERTNFRYVTPDQFTKGLPEVAVIDVSFISLRLILPVVKTVMVPGGDVIALVKPQFEAGKEKVGKKGIIRDPNIHEEVLESIIQFACAEGFDVLHLTYSPITGGDG-NIEFLLHAAY 246
>gi|157738061|ref|YP_001490745.1| hemolysin A [Arcobacter butzleri RM4018] >gi|157699915|gb|ABV68075.1| hemolysin A [Arcobacter butzleri RM4018] (232 aa)
Score = 333, Expect = 1.9e-29, Identities = 104/233 (44%), Positives = 144/233 (61%)
  Q:     8 IYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIG-TTKGFAKTEDH-KKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +YL      +SR  A +LI ++KV  +G+II+K +  V +  K+E+LE++ YVSRAAYKLK  ++   N DL +K A+DIGSSTGGFTQ+LLEN +KKV  +DVGTNQL+E++K N+K+   E T+ R  ES  I    D +T DVSFISI  I + I  L   +   I L KPQFE+G  +    KG  K  +  +K  +NF+   +ILN       +S ++G K  N E  FY 
  S:     1 MYLTTNFNIQSRNKATELIKSNKVKCDGEIITKPSFNVLDFHKIELLEDDFYVSRAAYKLKFFLQELKNFDLKDKNALDIGSSTGGFTQILLENEIKKVTCVDVGTNQLHERIKYNDKINFFENTDIRNFESDEI---FDIVTCDVSFISILNIIDAINTLASKD--IIILFKPQFEVGSNVKRDKKGIVKDNNAIQKARDNFLNKTNILNWTLKYSNISKLQG-KDGNVEEFFYF 230
>gi|91205423|ref|YP_537778.1| hemolysin A [Rickettsia bellii RML369-C] >gi|91068967|gb|ABE04689.1| Hemolysin A [Rickettsia bellii RML369-C] (249 aa)
Score = 332, Expect = 2.0e-29, Identities = 95/237 (40%), Positives = 135/237 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN--ELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD +L+ + +A +  VAQ LI   KV    + ++K+ T VN  + D    L +  YVSR A KL  A++HF I+ +  + ID GSSTGGFT+VLLE   + V+++DVG  +L+ +L+ N ++I LE+TN R +    I  + D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K    H+K+ N    +L    N +  G + SPI GAK  N E+L
  S:     1 MTKIRLDEFLLQKGFAPNIQVAQSLIMQGKVHNKHEQLTKAGTQVNINDTDIKVKLPKHNYVSRGALKLIKALDHFKINPSGMVCIDFGSSTGGFTEVLLEQGAELVFAVDVGYGELHHRLRDNPQIIVLEKTNARYLTEKQITIQPDLIVCDASFISLTTILPASFALAKKDCLLIALIKPQFEVEKHEVEEGGIIKNPLLHQKVCNKIKAWLEEEHNFEIFGIVESPILGAKG-NKEFL 240
>gi|157827026|ref|YP_001496090.1| hemolysin A [Rickettsia bellii OSU 85-389] >gi|157802330|gb|ABV79053.1| Hemolysin A [Rickettsia bellii OSU 85-389] (249 aa)
Score = 332, Expect = 2.0e-29, Identities = 94/237 (39%), Positives = 136/237 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN--ELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD +L+ + +A +  VAQ LI   KV    + ++K+ T VN  + D    L +  YVSR A KL  A++HF I+ +  + ID+GSSTGGFT+VLLE   + V+++D+G  +L+ +L+ N ++I LE+TN R +    I  + D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K    H+K+ N    +L    N +  G + SPI GAK  N E+L
  S:     1 MTKIRLDEFLLQKGFAPNIQVAQSLIMQGKVHNKHEQLTKAGTQVNINDTDIKVKLPKHNYVSRGALKLIKALDHFKINPSGMVCIDLGSSTGGFTEVLLEQGAELVFAVDIGYGELHHRLRDNPQIIVLEKTNARYLTEKQITIQPDLIVCDASFISLTTILPASFALAKKDCLLIALIKPQFEVEKHEVEEGGIIKNPLLHQKVCNKIKAWLEEEHNFEIFGIVESPILGAKG-NKEFL 240
>gi|108757719|ref|YP_632808.1| hemolysin A [Myxococcus xanthus DK 1622] >gi|108461599|gb|ABF86784.1| hemolysin A [Myxococcus xanthus DK 1622] (246 aa)
Score = 332, Expect = 2.0e-29, Identities = 82/227 (36%), Positives = 128/227 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKG 228
           +K RLD+ +V    A SR  AQ LI   +VV+  Q + K  TL+ +  ++ +  E   YVSR   KLK AI+ F +D+  K+A DIG+STGGFT  LL++   +V++IDVG  QL+E+L+ + +V S E+ N R +    + + +  + IDVSFIS+  +   +          +AL+KPQFE+G     K G  +  A  +D    I+    F+    ++ LG + S + G
  S:     4 RKERLDVLVVERGLAESRTKAQALILAGQVVVGDQRVDKPGTLIPQEAELRLKGEVLPYVSRGGLKLKGAIDRFGLDVRGKVAADIGASTGGFTDCLLQHGATRVHAIDVGYGQLHEKLRTDPRVRSRERVNARYLTEEDLPETVGVVVIDVSFISLTQVLPSVLTYLAPGGLLVALVKPQFEVGPDRVGKGGVVRDVAARQD---AIDTVTAFVREQGLEVLGLMDSTVPG 232
>gi|149012255|ref|ZP_01833324.1| hemolysin A, putative [Streptococcus pneumoniae SP19-BS75] >gi|147763581|gb|EDK70516.1| hemolysin A, putative [Streptococcus pneumoniae SP19-BS75] (271 aa)
Score = 332, Expect = 2.0e-29, Identities = 87/246 (35%), Positives = 144/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +            LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDVKIHQNVLESVTAMAVEAGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|168491125|ref|ZP_02715268.1| hemolysin A [Streptococcus pneumoniae CDC0288-04] >gi|183574498|gb|EDT95026.1| hemolysin A [Streptococcus pneumoniae CDC0288-04] (271 aa)
Score = 332, Expect = 2.3e-29, Identities = 87/246 (35%), Positives = 143/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV   NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +            LG   SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVFNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|94988854|ref|YP_596955.1| lantibotic precursor [Streptococcus pyogenes MGAS9429] >gi|94992745|ref|YP_600844.1| lantibotic precursor [Streptococcus pyogenes MGAS2096] >gi|94542362|gb|ABF32411.1| lantibotic precursor [Streptococcus pyogenes MGAS9429] >gi|94546253|gb|ABF36300.1| Lantibotic precursor [Streptococcus pyogenes MGAS2096] (275 aa)
Score = 332, Expect = 2.4e-29, Identities = 93/240 (38%), Positives = 145/240 (60%)
  Q:     1 MQKIRLDIY-----LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLS--ILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K R+D+      L        RGV   L+ +   VINGQ   K    +++  ++++  E+ KYVSR   KL+  +  F + + N+I IDIG+STGGFT V+L++  K VY++DVGTNQL  +L+++ +V S+EQ NFR  +     + +  F +IDVSFIS++LI   +  +  +  + IAL+KPQFE G++    KG  K +  H+K+I   ++F S     +K L +  SPI+G    N E+L +L
  S:     1 MPKERVDVLAYKQGLFETREQAKRGVMAGLVVS---VINGQRYDKPGDKIDDGTELKLKGEKLKYVSRGGLKLEKGLHVFGVSVANQIGIDIGASTGGFTDVMLQDGAKLVYAVDVGTNQLVWKLRQDPRVRSMEQYNFRYAQPEDFNEGQPVFASIDVSFISLSLILPALHNVLSDQGQVIALIKPQFEAGREQIGKKGIVKDKQIHEKVIQKVMDFASGYGFTVKELDF--SPIQGGHG-NIEFLAHL 244
>gi|34581533|ref|ZP_00143013.1| hemolysin [Rickettsia sibirica 246] >gi|28262918|gb|EAA26422.1| hemolysin [Rickettsia sibirica 246] (251 aa)
Score = 332, Expect = 2.5e-29, Identities = 95/237 (40%), Positives = 132/237 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN--ELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+ + +     +A+ LI   KV    + + K    VN  + D    L +  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE   K ++++DVG  +L+ +L+ N  +  LE+TN R +    I  K D I  D SFIS+  I   +  L   +   IAL+KPQFE+ K      G  +    H+K+ +   ++L    N K  G I SPI GAK  N E+L
  S:     1 MTKIRLDQYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQVNINDTDIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGELHPKLRDNPHIKVLEKTNARYLTDKQIITKPDLIVCDASFISLTTILPTVLNLVKEDCMLIALIKPQFEVEKHEVEQGGVIQNPLLHQKVCDKIKDWLEKEHNFKIFGIIASPILGAKG-NQEFL 240
>gi|169350496|ref|ZP_02867434.1| hypothetical protein CLOSPI_01264 [Clostridium spiroforme DSM 1552] >gi|169292816|gb|EDS74949.1| hypothetical protein CLOSPI_01264 [Clostridium spiroforme DSM 1552] (266 aa)
Score = 331, Expect = 2.9e-29, Identities = 96/237 (40%), Positives = 140/237 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYL 237
           M+K R+D+ LV + +  SR  A+  I    V  +  II K  T +     + +      YVSR   KL+ A++ F++D+ +KI +DIGSSTGGFT   L+N  K VY++DVGTNQL  +L+ + +VI  EQTNFR     L ++ I    +IDVSFIS+  IFN +K +   N + +AL+KPQFE GK+    KG  K +  H ++I + I++       + NL Y  SPI G +  N E+L
  S:     1 MKKERIDVLLVEQGFFDSREKAKRAIMAGIVHDDYDIIDKPGTKIPINSNLHVKGNIMPYVSRGGLKLEKALKDFSLDIKDKIMVDIGSSTGGFTDCALQNGAKLVYAVDVGTNQLVWKLRNDPRVIVKEQTNFRYATIDLFQEGIPTLASIDVSFISLKHIFNALKNILKANNQVVALIKPQFEAGKEDVGKKGIVKDKKIHCRVIKDVIKYAKEDGFTLTNLTY--SPITGGEG-NIEFL 239
>gi|104774285|ref|YP_619265.1| putative RNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514370|ref|YP_813276.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423366|emb|CAI98222.1| Putative RNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093685|gb|ABJ58838.1| Predicted rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (271 aa)
Score = 330, Expect = 3.4e-29, Identities = 85/239 (35%), Positives = 138/239 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--------KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR-EIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K R D+ L  +    SR  AQ      + ++ G +   ++  +++  +   ++EE        KYVSR  +KL+ A++ +NIDL +K+ +DIG+STGGFT V L+N  K VY++DVG NQL  QL+ + +V+ +E+ NFR  + +   +   DF   DVSFIS++LI   + E+  +   ++ L+KPQFE G +     G  +    H+ +I + +     +    LG   SPIKG K  N E+L +L+
  S:     4 KERADVLLAAKGNFNSRTQAQ------RAIMAGLVTDHNHQRIDKAGEKFPVDEEFFIKKDNLKYVSRGGFKLEKAVKVWNIDLKDKVCLDIGASTGGFTDVALQNGAKLVYALDVGYNQLAWQLRDDPRVVVMERQNFRYSVPADFTEGLPDFAMTDVSFISLDLIMPPMYEILKDQGDAVCLIKPQFEAGPENVGKHGIVRDHAVHQAVIEHTMAKALEIGFSILGVDYSPIKGGKG-NIEFLLHLK 245
>gi|39996521|ref|NP_952472.1| hemolysin A [Geobacter sulfurreducens PCA] >gi|39983402|gb|AAR34795.1| hemolysin A [Geobacter sulfurreducens PCA] (227 aa)
Score = 330, Expect = 3.6e-29, Identities = 75/212 (35%), Positives = 123/212 (58%)
  Q:    30 KVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +VV+N  +  K+   V    ++ +  E+  +VSR   KL  A+E F ID+ +  AID+G+STGGFT  LL+   +KVY++DVG  QL  +L+++++V++LE+TN R +E   + +      ID SFIS++ +      L       +AL+KPQFE+G+ ++G        E H+++I + +     L +  LG   SPI G K  N E+L +L+
  S:     4 QVVVNDHLADKAGLQVPVEAEIRLKGEDIPFVSRGGLKLARALEEFGIDVADMTAIDVGASTGGFTDCLLQRGARKVYAVDVGYGQLAWKLRQDSRVVNLEKTNIRYLEPGALPETPGLAVIDASFISLDKVLPSTLRLIGEEGVIVALIKPQFEVGRGEVGKGGVVRDEEKHRRVIADVVALAEGLGLMVLGVTESPILGPKG-NREFLIHLK 216
>gi|169824536|ref|YP_001692147.1| putative hemolysin [Finegoldia magna ATCC 29328] >gi|167831341|dbj|BAG08257.1| putative hemolysin [Finegoldia magna ATCC 29328] (252 aa)
Score = 328, Expect = 5.7e-29, Identities = 101/243 (41%), Positives = 144/243 (59%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIF-NKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +R+D+YL    +A SR  A+ LI N  V   G+++ K +  +N  D+VE+ +  +YV R A KL  A E FNI   + + +DIGSSTGGFTQVLL+NN K+VY+IDVG NQ+ ++L+ +++V   E TNFR I       K D I  DVSFIS+ +I  N +K LK N+ + + L+KPQFEL  K          ++H  IIN    +L+  ++       SPIKG K  N EYL ++   + K
  S:     1 MRIDVYLCENKFASSRTKAKALIENELVYYQGKLVKKPSLEINS-DEVEVKKHTEYVGRGALKLLKAFEVFNIG-EHDLCLDIGSSTGGFTQVLLQNNAKEVYAIDVGDNQMVDELRHDSRVKLFENTNFRNINVDEYP-KFDLIVCDVSFISLKMIIPNAVKMLK-NDGEMVFLIKPQFELKSK---NHIINNKKEHLSIINEINNYLNNKDMYISEITNSPIKG-KSGNIEYLIHITNLDNK 236
>gi|13357999|ref|NP_078273.1| hemolysin [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168281604|ref|ZP_02689271.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168307749|ref|ZP_02690424.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762432|ref|YP_001752522.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11279182|pir||C82891 hemolysin UU436 [imported] - Ureaplasma urealyticum >gi|6899427|gb|AAF30848.1|AE002140_7 hemolysin [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828009|gb|ACA33271.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902941|gb|EDT49230.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676028|gb|EDT87933.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 14 str. ATCC 33697] (247 aa)
Score = 328, Expect = 6.0e-29, Identities = 93/242 (38%), Positives = 141/242 (58%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKY-VSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTT-KGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           RLD YL N N   +R  A DLI   +V +N   + K + LV + D VEI  +E Y VS+  YKL   I+  N+ + N +  D+GSSTGGFT   L+   KK+Y+IDVG + L+  LKK+ K+I+ E+TN + ++ S   + +D I  D+SFIS+  IF  IK++       + L+KPQFELGK + +  KG  + +  +++ IN  I      + +      + I   KK+N EY+ +L+ K+EK
  S:     4 RLDHYLKNTNQCETRSKAIDLIKRGRVFVNNFQVLKPSFLVKQTDSVEIKNDEMYFVSKGGYKLLKIIKEINLIIKNFVIADLGSSTGGFTDCCLQLGAKKIYAIDVGVDLLHPSLKKSYKIINYEKTNVKNLDKSYFLEDLDLIVGDLSFISLEQIFPIIKKISSPKTLLLLLIKPQFELGKDVASKYKGLIQNQKLQQLAINKIINLAKNYDFECKHLTPTDIFDEKKQNQEYMIFLQ-KHEK 247
>gi|189425760|ref|YP_001952937.1| hemolysin A [Geobacter lovleyi SZ] >gi|189422019|gb|ACD96417.1| hemolysin A [Geobacter lovleyi SZ] (249 aa)
Score = 328, Expect = 6.1e-29, Identities = 90/243 (37%), Positives = 130/243 (53%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL---EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD  +V    A SR  AQ LI   +VV+      K+   V   D+VEI    E   YVSR   KL   ++ F ID   +IAID+G+STGGFT  LL+    +VY++DVG  QL  +L+++ +V+ +E+TN R ++   ++   D   ID SFIS+NL+      L     + +AL+KPQFE+GK      G  +    H++++       + L  + LG   SPI GA   N E+L  L    E
  S:     4 KQRLDKLMVERGLAPSREKAQALIMAGQVVVGDHAAQKAGQQVT--DEVEIRIKGELLPYVSRGGLKLAQGLDAFGIDPAGRIAIDVGASTGGFTDCLLQRGASRVYAVDVGYGQLAWKLREDARVVVMEKTNIRHLQPESLEPLPDLAVIDASFISLNLVLPPTLALLKRPAEVVALVKPQFEVGKGAVGKGGIVRDPKLHEEVLAGMERLATELGAELLGICDSPITGADG-NREFLMGLRMTGE 247
>gi|149184256|ref|ZP_01862574.1| Hemolysin HlyA [Erythrobacter sp. SD-21] >gi|148831576|gb|EDL50009.1| Hemolysin HlyA [Erythrobacter sp. SD-21] (253 aa)
Score = 328, Expect = 6.2e-29, Identities = 82/236 (34%), Positives = 127/236 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +K RLD  LV+     SR  AQ L+    V    Q +SK    + E   +++   +  +VSR   KL  AI+HF ++     A+DIGSSTGGFT VLL+     V+++D GTNQL  +L+++ +V  LEQT+ R +   +I   + ++  D SFI +  +  +  EL     + +AL+KPQFE+G++    KG       H ++ N    +   L  +  G + SPIKG +  N E+L
  S:    11 KKRRLDQMLVDRGLVESRTRAQALVMAGLVFSGEQKLSKPGQQMAEDAPLDVRGRDHPWVSRGGIKLAHAIKHFGLNPTGVTAMDIGSSTGGFTDVLLQGGADHVFAVDSGTNQLAWKLRQDERVTVLEQTSARILTPEMIDRPVGWVVCDASFIGLAKVLERPLELAERECRMVALIKPQFEVGREEVGKKGVVSDPALHARVCNEVRGWTEGLGFEVQGIVESPIKGPEG-NVEFL 247
>gi|188586310|ref|YP_001917855.1| hemolysin A [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350997|gb|ACB85267.1| hemolysin A [Natranaerobius thermophilus JW/NM-WN-LF] (276 aa)
Score = 328, Expect = 6.4e-29, Identities = 91/238 (38%), Positives = 136/238 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD  LV++ Y  SR  A+  I    V ++ Q I K    V+ LD    ++ +  KYVSR  YKL+ A++ F++++ ++IA+DIG+STGGFT  LL N    VY++DVG  QL  +L+ + +V   E+TN R + S L  D  D  TIDVSFIS+ L+   + E+  +    + L+KPQFE  K     KG  K +D + ++++  ++     LN    G   SPI G    N E+L +L
  S:     5 KNRLDQLLVDKGYFASREQAKRNIMAGLVFVDNQKIDKPGKKVH-LDVPLYVKNDHLKYVSRGGYKLEKALDEFSVNVEDRIAVDIGASTGGFTDCLLANGAAHVYAVDVGYGQLAWRLRNSQQVTVHEKTNIRHVNSDLFDDIPDLATIDVSFISLRLVIPIVNEILAHPKDILVLIKPQFEADKDQVGKKGVIKDKDIQIEVLHKVLDMAKTDLNFNVCGLTFSPITGPAG-NIEFLAFL 244
>gi|159898450|ref|YP_001544697.1| hemolysin A [Herpetosiphon aurantiacus ATCC 23779] >gi|159891489|gb|ABX04569.1| hemolysin A [Herpetosiphon aurantiacus ATCC 23779] (267 aa)
Score = 328, Expect = 6.6e-29, Identities = 81/241 (33%), Positives = 136/241 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE--SSLIKDKIDFIT---IDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           ++K RLD+ LV    A +R  AQ LI   +V++N Q  +K+ T+++   ++ +     YV R   KL  A++ FNI+    +A+D+G+ TGGF+ VLL+ +   VY+IDVG  QL+ +++++ +V  LE+TN R +E      +      T   +DVSFIS+ L+   +  L   +   + L+KPQFE G + +G       +  H+++I    +  + L +   G   SPI GA+  N E+L Y +
  S:     4 VKKHRLDVLLVELQLAPTRAKAQALIMAGEVIVNSQAETKAGTMIDPAAQITLKSSLPYVGRGGLKLAHALDSFNINPQGCVALDVGACTGGFSDVLLQRDAAHVYAIDVGYGQLDWKIRQDPRVTVLERTNIRYLEHLPHAEQQPAPLATCGVVDVSFISLGLVLPAMLRLLTADAWIVCLIKPQFEAGPEHVGKGGIVRDSAVHRQVIERVAQQANNLGLGLTGLTRSPITGAEG-NIEFLGYFQ 249
>gi|157828691|ref|YP_001494933.1| hemolysin [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933411|ref|YP_001650200.1| hemolysin [Rickettsia rickettsii str. Iowa] >gi|157801172|gb|ABV76425.1| hemolysin [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908498|gb|ABY72794.1| hemolysin [Rickettsia rickettsii str. Iowa] (251 aa)
Score = 328, Expect = 6.6e-29, Identities = 96/237 (40%), Positives = 130/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN--ELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+ + +     +A+ LI   KV    + + K    VN  + D    L +  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE   K ++++DVG   L+ +L+ N  +  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K    H+K+ +   ++L    N K  G I SPI GAK  N E+L
  S:     1 MTKIRLDEYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQVNINDTDIKVKLPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGGLHPKLRDNPHIKVLEKTNARYLTDKQIITKPDLIVCDASFISLTTILPTALNLVKEDCMLIALIKPQFEVEKHEVEQGGVIKNPLLHQKVCDKIKDWLEKEHNFKIFGIIASPILGAKG-NQEFL 240
>gi|171911749|ref|ZP_02927219.1| hemolysin A [Verrucomicrobium spinosum DSM 4136] (245 aa)
Score = 328, Expect = 6.9e-29, Identities = 82/240 (34%), Positives = 134/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKI---INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD  LV      SR   + LI    V++N   ++K+  LV E   + +    KYVSR  +K++ A+  F +    K+  D+G+STGGFT  LL++   K+++ DVGTNQL  +L+ + +V+S E  N R +++  + +++D I  DVSFIS+ L+ +   ++     +++ L+KPQFEL + +IG      + E H+K    I  F++       K  G   SPI+G    N E+L ++
  S:     1 MAKQRLDHLLVARGLCASREQGKRLILAGDVLVNDVPVTKAGQLVPEDSVIRVKVPPKYVSRGGFKMEGALAAFGVSPEGKVCFDVGASTGGFTDCLLQHGAVKIFAFDVGTNQLVWKLRSDPRVVSRENYNVRHLKAEDVGEEVDLIVADVSFISLTLVLSPAFQVLKVGGEALVLIKPQFELSREEIGRGGIVREKELHEKACLKIETFVKCQPGWVWK--GLTDSPIQGTDG-NREFLAWI 241
>gi|110602080|ref|ZP_01390227.1| hemolysin A [Geobacter sp. FRC-32] >gi|110547217|gb|EAT60496.1| hemolysin A [Geobacter sp. FRC-32] (247 aa)
Score = 328, Expect = 7.0e-29, Identities = 83/240 (34%), Positives = 134/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD  L++   A SR  A+ LI   +VV++  +  K+  +V    ++ +  E   +VSR   KL+ A++ F ID+   + +D+G+STGGFT  LL+    KV ++DVG  QL  +L+++ +VI+LE+TN R +E   + +      ID SFIS++ +   +  L   +   +AL+KPQFE+G+ ++G        + H ++I+        L +K  G   SPI G K  N E+L YL
  S:     1 MAKERLDKILLDRRLAPSRERAKALIMAGQVVVDDHLADKAGQMVAVDAEIRLKGEVLPFVSRGGLKLQKALDEFAIDVTGLVVMDVGASTGGFTDCLLQRGAAKVIAVDVGYGQLAWKLRQDERVINLEKTNIRYLEQEKLGEVPQMAVIDASFISLDKVLPPVLNLISPSAVVVALIKPQFEVGRGEVGKGGVVRDVKKHAEVISVITALALDLKLKVKGITESPILGPKG-NREFLIYL 241
>gi|18404536|ref|NP_566765.1| bacterial hemolysin-related [Arabidopsis thaliana] >gi|9279726|dbj|BAB01316.1| hemolysin-like [Arabidopsis thaliana] >gi|21593347|gb|AAM65296.1| hemolysin, putative [Arabidopsis thaliana] (301 aa)
Score = 328, Expect = 7.0e-29, Identities = 80/236 (33%), Positives = 130/236 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +K RLD   V      SR + Q  I   KV+++G+ + K+   V+    ++I  E  K+V R   KL+AA+E  ++D++ K+ +D G STGGFT  LL      VY +DVG  Q+ ++++ + KV  +E+TN R +    +  K+D +T+D+SFISI  +   I  +   +   + L+KPQFE  + ++G        E H++++   I  +      N G+I SPIKGA   N E+L
  S:    53 KKQRLDEACVERFNEYSRTLIQSWIMQGKVLVDGRRVIKAGMPVSTTAAIKITAEVPKFVCRGGLKLEAALEKLDVDVSEKVVLDAGLSTGGFTDCLLRYGAAHVYGVDVGYGQVADKIRNDKKVTVIERTNLRYLPG--LPQKVDVVTLDLSFISILKVMPAIMNVMKEDATLVTLVKPQFEARRQQVGKGGIVRDPEVHQEVLEKIINGVERYGFTNKGFIESPIKGADG-NIEFL 287
>gi|167971562|ref|ZP_02553839.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700951|gb|EDU19233.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma parvum serovar 6 str. ATCC 27818] (247 aa)
Score = 328, Expect = 7.2e-29, Identities = 93/242 (38%), Positives = 141/242 (58%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKY-VSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTT-KGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           RLD YL N N   +R  A DLI   +V +N   + K + LV + D VEI  +E Y VS+  YKL   I+  N+ + N +  D+GSSTGGFT   L+   KK+Y+IDVG + L+  LKK+ K+I+ E+TN + ++ S   + +D I  D+SFIS+  IF  IK++       + L+KPQFELGK + +  KG  + +  +++ IN  I      + +      + I   KK+N EY+ +L+ K+EK
  S:     4 RLDHYLKNTNQCETRSKAIDLIKRGRVFVNNFEVLKPSFLVKQTDSVEIKNDEMYFVSKGGYKLLKIIKEINLIIKNFVIADLGSSTGGFTDCCLQLGAKKIYAIDVGVDLLHPSLKKSYKIINYEKTNVKNLDKSYFLEDLDLIVGDLSFISLEQIFPIIKKISSPKTLLLLLIKPQFELGKDVASKYKGLIQNQKLQQLAINKIINLAKNYDFECKHLTPTDIFDEKKQNQEYMIFLQ-KHEK 247
>gi|138895962|ref|YP_001126415.1| hemolysin A [Geobacillus thermodenitrificans NG80-2] >gi|134267475|gb|ABO67670.1| Hemolysin A [Geobacillus thermodenitrificans NG80-2] (281 aa)
Score = 327, Expect = 7.7e-29, Identities = 87/241 (36%), Positives = 129/241 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI-KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEY 242
           +K RLD+ LV      +R  A+  I    V  N   + K    V     +E+      YVSR   KL+ A+  F I + NKI +DIG+STGGFT   L++  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +   L  K   +   IDVSFIS+ LI   +K +       IAL+KPQFE GK+    KG  +  D H++++ + ++F        L    SPI G    N E+L ++ Y
  S:     4 KKERLDVLLVERGLVETREKAKRAIMAGLVYSNDIRLEKPGEKVPADIPLEVKGNPLPYVSRGGLKLEKALREFQISVENKIVLDIGASTGGFTDCALQHGAKLSYAVDVGYNQLAWKLRQDERVVVMERTNFRYVTPDLFTKGMPEVAVIDVSFISLRLILPVVKTVIVPGGDVIALVKPQFEAGKENVGKKGIVRDPDVHREVLESIVQFACAEGFDILHLSYSPITGGDG-NIEFLLHVVY 246
>gi|162447341|ref|YP_001620473.1| rRNA methyltransferase, putative [Acholeplasma laidlawii PG-8A] >gi|161985448|gb|ABX81097.1| rRNA methyltransferase, putative [Acholeplasma laidlawii PG-8A] (232 aa)
Score = 327, Expect = 8.2e-29, Identities = 93/236 (39%), Positives = 135/236 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDH-KKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +RLD YL +     +R    D I    V I+ ++I+K +  V E   V+  +++ +VSR   KL+ AI+ F ID++NK+ ID+G+STGGFTQ +L +  K VY+ DVGT+QL + L+ + +V S EQTN  ++       + D I IDVSF S+  I + +        + I LLKPQFE  K +   KG  K+E    KII    + L  L+++ LG+  SPI G K  N EYL Y
  S:     1 MRLDKYLTDHYKDITRSQFSDFIKRGFVTIDDKVITKPSFDVLEHHVVKFNKDDVFVSRGGEKLEHAIDVFGIDISNKVVIDVGASTGGFTQSVLNHGAKHVYAYDVGTDQLAKSLRSDVRVSSFEQTNILDVNLP----ENDLIVIDVSFTSVLPILSHVTPFA---KEIIFLLKPQFETTKDM-LKKGILKSEKEISKIIEKTTQHLKSLSLQILGFTPSPITG-KDGNQEYLIY 228
>gi|163867875|ref|YP_001609079.1| hemolysin-like protein [Bartonella tribocorum CIP 105476] >gi|161017526|emb|CAK01084.1| hemolysin-like protein [Bartonella tribocorum CIP 105476] (247 aa)
Score = 327, Expect = 8.7e-29, Identities = 85/239 (35%), Positives = 129/239 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           RLDI LV +N+  +R  A+D +    V +NG+I+ K+     E  ++ + +  + YVSRAA KL  A++ F I  +   AID+G+STGGFTQVLLE     V ++DVG +Q +++L  +  +  LE  N R+ +   +  + ID I  DVSFIS+ L    +  L     +++ L+KPQFE+G+K     G       K+       +L+        G + SPI G    N EYL + E K
  S:     6 RLDILLVEKNFFTTRSRARDAVMRQTVKVNGEIVCKAGQTFFENAEIVVCDPAQNYVSRAALKLITALDAFPIVTDKVTAIDVGASTGGFTQVLLERGAAHVIAVDVGHHQFDKRLLGSCAITLLEGLNVRDFQQEHLGGREIDLIVSDVSFISLKLALPPVLSLAKKGAQAVLLVKPQFEVGRKHLGKGGILDPSRAKETAEGLFVWLNTQTGWCAKGLLPSPITGGDG-NMEYLLFGEKK 246
>gi|124026568|ref|YP_001015683.1| rRNA methyltransferase [Prochlorococcus marinus str. NATL1A] >gi|123961636|gb|ABM76419.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. NATL1A] (264 aa)
Score = 327, Expect = 9.5e-29, Identities = 87/239 (36%), Positives = 133/239 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKV-VINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKI-DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD++L+ +   ++R  AQ+LI   KV  INGQI+ K    V +  ++E+ +  +YVSR   KL  A   F +D+ N+I +D G STGGFT  LL+    KVY +DVG  Q    ++ + +V+ LE+TN R +    +    D I DF   D+SFIS+ ++   IK  L+ +  + + L+KPQFE+GK K+G          H + +   +           G I SP+KG    N EYL ++
  S:     3 KKSRLDLHLLTKGLVKTRQEAQNLIRAGKVKTINGQILDKPGQEVLKDLEIEVTQPLRYVSRGGEKLAEAFNQFPLDIKNRICLDAGISTGGFTDCLLQQGAAKVYGVDVGYGQTAWSIRNDPRVVLLERTNIRHLTPEKLFNDGDPIPDFAVADLSFISLKIVLPSIKSLLQSDRSELLVLVKPQFEVGKDKVGKGGVVRDHSLHAEAVEGVVNESKKYGWNPKGLIASPLKGPAG-NQEYLLWM 247
>gi|72382832|ref|YP_292187.1| hemolysin A [Prochlorococcus marinus str. NATL2A] >gi|72002682|gb|AAZ58484.1| hemolysin A [Prochlorococcus marinus str. NATL2A] (264 aa)
Score = 326, Expect = 1.0e-28, Identities = 87/239 (36%), Positives = 132/239 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKV-VINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKI-DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD++L+ +   ++R  AQ+LI   KV  INGQI+ K    V    ++E+ +  +YVSR   KL  A   F +D+ N+I +D G STGGFT  LL+    KVY +DVG  Q    ++ + +V+ LE+TN R +    +    D I DF   D+SFIS+ ++   IK  L+ +  + + L+KPQFE+GK K+G          H + +   +           G I SP+KG    N EYL ++
  S:     3 KKSRLDLHLLTKGLVKTRQEAQNLIRAGKVKTINGQILDKPGQEVLRDLEIEVTQPLRYVSRGGEKLAEAFNQFPLDIKNRICLDAGISTGGFTDCLLQQGAAKVYGVDVGYGQTAWSIRNDPRVVLLERTNIRHLTPEKLFNDGDPIPDFAVADLSFISLKIVLPSIKSLLQSDRSELLVLVKPQFEVGKDKVGKGGVVRDHSLHAEAVEGVVNESKKYGWNPKGLIASPLKGPAG-NQEYLLWM 247
>gi|192813474|ref|ZP_03042136.1| hemolysin A [Geobacillus sp. Y412MC10] >gi|192797739|gb|EDV74257.1| hemolysin A [Geobacillus sp. Y412MC10] (246 aa)
Score = 326, Expect = 1.0e-28, Identities = 85/236 (36%), Positives = 127/236 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           QK R+D+ LV + Y  SR  A+  I    V    + I K+   +    ++++      YVSR   KL+ AI  F +D+  +  +DIGSSTGGFT   L++    VY+IDVG NQL+  L+ + +V  +E+TNFR +    +   + DF +IDVSFIS+ +I   +K L        AL+KPQFE G+ K+G +      + HK ++   + F   L  K      SPI G +  N E+L
  S:     5 QKERIDVLLVEQGYYESREKAKAAIMAGLVYAGTERIEKAGMKIPRTSELKVKGSVHPYVSRGGLKLEKAIRTFGLDMKGRTMLDIGSSTGGFTDCALQHGASYVYAIDVGYNQLDWSLRNDERVCVMERTNFRYMTPEDLNGPLPDFASIDVSFISLRIILPPLKLLLGKPGDVAALIKPQFEAGREKVGKSGVVRDPKVHKDVLTQVLTFADGLGFKLKNLTFSPITGGEG-NIEFL 242
>gi|90961513|ref|YP_535429.1| hemolysin [Lactobacillus salivarius UCC118] >gi|90820707|gb|ABD99346.1| Hemolysin [Lactobacillus salivarius UCC118] (275 aa)
Score = 325, Expect = 1.4e-28, Identities = 92/243 (37%), Positives = 141/243 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--------KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           M+K R+D+ LV +    +R  A+      + V+ G+I+ ++   +++      ++ E         YVSR   KL+ A++ F +D  NK  +DIGSSTGGFT V L+   K  Y++DVGTNQL  +L+++++V+ +E TNFR  +     K + D  TIDVSFIS+ LI   + E+  NN   IAL+KPQFE GK K+G        + H +++N  I F +  N   +    SPI G +  N E+L +L  K
  S:     1 MKKERVDVLLVKQGLFSTREQAK------RAVMAGEILGENEERLDKPGMKISVDTELHFKGTKMPYVSRGGLKLEKALKVFKVDAKNKTMLDIGSSTGGFTDVALQKGAKLSYALDVGTNQLAWKLRQDDRVVVMENTNFRYSKLEDFTKGQPDLATIDVSFISLQLILPTLHEIIQNNGDVIALIKPQFEAGKEKVGKHGIVRDPKVHLEVLNKIISFAAEENYDVVELDFSPITGGEG-NIEFLVHLVSK 246
>gi|15903129|ref|NP_358679.1| hypothetical protein spr1086 [Streptococcus pneumoniae R6] >gi|116516842|ref|YP_816535.1| hemolysin A, putative [Streptococcus pneumoniae D39] >gi|15458709|gb|AAK99889.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077418|gb|ABJ55138.1| hemolysin A, putative [Streptococcus pneumoniae D39] (271 aa)
Score = 325, Expect = 1.4e-28, Identities = 86/246 (34%), Positives = 143/246 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV--INGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           M K R+D+    +    +R  A+  +    VV  +NG+   K    + +  ++++  E+ KYVSR   KL+ A++ F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +            L    SPI+G    N E+L YL  K EK
  S:     1 MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLDLDFSPIQGGHG-NIEFLAYL--KKEK 247
>gi|58038728|ref|YP_190692.1| hemolysin HlyA [Gluconobacter oxydans 621H] >gi|58001142|gb|AAW60036.1| Hemolysin HlyA [Gluconobacter oxydans 621H] (253 aa)
Score = 325, Expect = 1.4e-28, Identities = 84/237 (35%), Positives = 129/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL-NIKNLGYIVSPIKGAKKENTEYL 237
           M K R D  LV+     SR  AQ LI    V  + + I+K+   + E   + +  ++  +VSR   KL  AIEHF +D   +IAID+G+STGGFT VLL +  +KVY++DVG  QL  +++ + +V+ LE+TN R + +  I +    +  D SFI +  +     EL   +  ++AL+KPQFE G+     KG  +    H ++     E+ + L   + LG   SPI G +  N E+L
  S:     1 MAKRRADQLLVDRGLVESRTRAQALIMAGLVYTSDRRIAKAGDQLPEDAPLALKGQDHPWVSRGGLKLIHAIEHFGLDPKGRIAIDVGASTGGFTDVLLTHGAEKVYAVDVGHGQLAWKIRSDERVVVLEKTNARALTAEQIPEPAGIVVCDASFIGLRTVLPAALELTTPDAWAVALIKPQFEAGRGEVGAKGVVRDPAVHDRVCEEIREWFAALPGWEVLGIEASPITGPEG-NREFL 239
>gi|163761046|ref|ZP_02168124.1| hemolysin-like protein [Hoeflea phototrophica DFL-43] >gi|162281827|gb|EDQ32120.1| hemolysin-like protein [Hoeflea phototrophica DFL-43] (259 aa)
Score = 325, Expect = 1.4e-28, Identities = 85/233 (36%), Positives = 131/233 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS-LIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKII-NNFIEFLSIL-NIKNLGYIVSPIKGAKKENTEYL 237
           RLD  LV   +  SR  A+D I+   + ++G+++ K+  LV+    ++I +  + YVSRAA KLKA +E F  D   + A+DIG+STGGFTQVLLE     V ++DVG +QL+  L ++++V +LE  N RE+ +  L   +I  +  DVSFIS+ L       L      ++ L+KPQFE+G+      G  K      +I      +L  +   + +G + SPI G+   N E+L
  S:    18 RLDQILVRLGHYESRARARDAISRGAITVDGKVLMKAGVLVSPTAAIDIADPAQAYVSRAALKLKAGLEAFGFDPAGRTALDIGASTGGFTQVLLEAGAAHVIAVDVGHDQLHPSLTRDSRVSNLEGLNARELGADHLAGHEIGAVVSDVSFISLKLALPPALTLAAPGAFAVLLVKPQFEVGRAGIGKGGLLKDPAQGPLIAEELAAWLGAMPGWRAVGPVASPIAGSDG-NHEFL 253
>gi|156451468|ref|ZP_02057844.1| hemolysin A [Methylobacterium chloromethanicum CM4] >gi|156189732|gb|EDO21925.1| hemolysin A [Methylobacterium chloromethanicum CM4] (250 aa)
Score = 325, Expect = 1.4e-28, Identities = 79/236 (33%), Positives = 122/236 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +++R D +LV   + RSR  A+  I    V  +G+++++   LV    ++E      YVSR   KL AA++ F +D      +D+G+STGGFT VLL      ++++DVG +QL+  L+ N +V SLE T+ R +    I+      TIDVSFI + L+   +     +     AL+KPQFE G+ ++G        E H ++       L  L     G I SPI+G    N E+L
  S:     4 ERLRADRFLVERGHFRSRAQARAAIEAGLVSADGRLVTRPADLVESSARIEASAPHPYVSRGGLKLAAALDAFGLDPAGLPCLDVGASTGGFTDVLLRRGAAHIHAVDVGRDQLDAALRANPRVTSLEGTDIRALSPGAIQPAPQLATIDVSFIGLRLVLPAVAAQLADEAAIAALIKPQFEAGRERVGRGGIVRDAEVHAEVCEGVRAVLVGLGFTVSGPIPSPIEGGDG-NREFL 239
>gi|125624485|ref|YP_001032968.1| hypothetical protein llmg_1687 [Lactococcus lactis subsp. cremoris MG1363] >gi|124493293|emb|CAL98261.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (268 aa)
Score = 324, Expect = 1.7e-28, Identities = 88/238 (36%), Positives = 138/238 (57%)
  Q:     3 KIRLDIYLVNENYARSR-----GVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFRE-IESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K R+D+   N+    +R     GV   L+ +SK   +G+   K    +++  ++ +  E+ +YVSR   KL+ A++ FNI +  K  +DIGSSTGGFT V+L+N  K VY++DVGTNQL  +++ + +V+ +EQ NFR  + S   + +  F +IDVSFIS+ LI   + E+     +  AL+KPQFE G+ ++G        + HK  I   +   + L +   G   SPIKG    N E+L +L
  S:     2 KERIDVLATNQGLFETREQAKRGVMAGLVVDSK---SGERYDKPGQKIDDGTELRLKGEKLRYVSRGGLKLEKALKEFNIKIEGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNALLSDFEQGRPAFTSIDVSFISLELILPPLYEILEEGGEVAALIKPQFEAGREQVGKNGIIRDPKVHKMTIEKVLAAATRLGLSIKGLTFSPIKGGAG-NVEFLVHL 243
>gi|16331005|ref|NP_441733.1| hypothetical protein slr0950 [Synechocystis sp. PCC 6803] >gi|1653500|dbj|BAA18413.1| slr0950 [Synechocystis sp. PCC 6803] (274 aa)
Score = 324, Expect = 1.8e-28, Identities = 87/238 (36%), Positives = 126/238 (52%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDK--IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD  LV +    SR +AQ LI   +V +N Q++ K  TLV     VE+ +   YVSR   KL  A+  F ID+  +I +D G STGGFT  LL+    KVY +DVG  Q+  +L+++++VI  E+ NFR +    L  D+   D   +D+SFIS+  +   +  L     + + L+KPQFE+G+ KIG        +   + I+        L  +  G   SPI G    N EYL +L
  S:     6 KQRLDALLVAKGLCESRALAQRLIRAGEVKVNQQLVDKPGTLVTMDVAVELAQRPPYVSRGGEKLAKALTEFAIDVTGRICLDGGISTGGFTDCLLQRGATKVYGVDVGYGQVAWKLRQDDRVILRERANFRYLTPQDLYGDQPWPDLGVMDLSFISLTKVMAPLWSLLAPPREVVLLVKPQFEVGREKIGKKGVVRDAQAQAEAIDQVWRSGQSLGWQFNGLTFSPITGPAG-NVEYLLWL 246
>gi|124515821|gb|EAY57330.1| putative rRNA methylase [Leptospirillum sp. Group II UBA] (251 aa)
Score = 324, Expect = 2.0e-28, Identities = 81/236 (34%), Positives = 134/236 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEY--LFYL 240
           RLD  ++ + +A SR  A +LI + +V + G I+    ++    D V +L  +    YVSR A KL  A+ +F +D+  +  +D+G+STGGFTQVLLE    KV+++DVG  QL+++L+++ +V+S E  N R        D    +  D+SFIS++ + + +  L       + L KPQFE G  +    G  +    H+K+++ +I  +  L  +  G + SPI G +K N EY  LF++
  S:     3 RLDQLVLQKGWASSREKASELIVSGRVQVKG-IVRLKPSVQASYDDVTLLAPDSGIVYVSRGAMKLSGALAYFGLDVRGRTVVDLGASTGGFTQVLLEAGAGKVHAVDVGNAQLDDKLRRDPRVVSREGVNVRWPGDWFPTDPPGGVVADLSFISLSKVADTVLCLLSAGGFFLPLFKPQFEAGPHLVGKGGIVRDRGLHRKLLSKYIREMMALGARVQGIMPSPITG-RKGNQEYFVLFWI 242
>gi|159904124|ref|YP_001551468.1| rRNA methyltransferase [Prochlorococcus marinus str. MIT 9211] >gi|159889300|gb|ABX09514.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. MIT 9211] (271 aa)
Score = 323, Expect = 2.3e-28, Identities = 85/239 (35%), Positives = 140/239 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKIDFITI-DVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           QKIRLD++L+N+   +SR  AQ LI   KV  + G+I+ K    V    K+ +   +++VSR   KL A ++ F I ++ +I +D G STGGFT  LL++   +VY IDVG  Q+   L+ +++V+  E+TN R ++   +   KD++  + + D+SFIS+ L+   IK  L   +  ++ L+KPQFE+G+ ++G          H ++++N ++F         G + SPI G    N EYL +L
  S:     3 QKIRLDLHLLNKGLVQSRQQAQRLIRAGKVRDMTGKILDKPGQEVFGESKLLVENPKRFVSRGGEKLLAGLQAFPIKIDGRICLDGGISTGGFTDCLLQHGASRVYGIDVGYGQIAWSLRNDSRVVLRERTNLRNLKPEDLYGPKDRLPNLAVADLSFISLRLVLPAIKNLLSEKDNDALLLVKPQFEIGRNRVGKGGVVKDINAHIEVLSNIVDFSVAEGWIPKGIVASPITGPAG-NHEYLLWL 247
>gi|186457154|ref|ZP_02967466.1| hemolysin A [bacterium Ellin514] >gi|184206790|gb|EDU03837.1| hemolysin A [bacterium Ellin514] (252 aa)
Score = 323, Expect = 2.4e-28, Identities = 78/208 (37%), Positives = 118/208 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI---DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED---HKKIINNFIEFLS 212
           RLD  LV      SR  A+  I   +V IN Q   K +  V + D + +   +KYVSR   K++ A++HF +++    AID+G+STGGFT  LL+N   KVY++DVG  QL  +L+++++V+ +E+TN RE+  +         D I ID SFIS++ I      L   +   +AL+KPQFE GK     KG     D   H +++    +F+S
  S:     5 RLDQALVERGLCESREKARRAIMAGQVTINQQPAKKPSDRVKQGDNIALASGDKYVSRGGLKMEHALKHFALNVAGLTAIDLGASTGGFTDCLLQNGAAKVYAVDVGHGQLAWKLRQDHRVVVMEKTNARELTPARFPAPFSLADLIVIDCSFISLSKILPVAIALLRPSANIVALIKPQFEAGKA-EADKGKGVITDPAIHARVLRELEQFVS 217
>gi|111017953|ref|YP_700925.1| hemolysin [Rhodococcus sp. RHA1] >gi|110817483|gb|ABG92767.1| possible hemolysin [Rhodococcus sp. RHA1] (324 aa)
Score = 323, Expect = 2.6e-28, Identities = 80/239 (33%), Positives = 135/239 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNE---LDKVEILEEEKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++ R+D  LV    ARSR  AQ+LI + +V+I+G   +K  T +     L  VE+  E  + SR A+KL  A+E F    +++  K  +D G+STGGFT VLL +  ++V ++DVG  QL  +L+ +++V  +++TN R I++  I   +D +  D+SFIS+ L+         +    I ++KPQFE+GK  +G+       E     + +  +  + L ++ +G + SP+ G    N EY  +L
  S:    51 RRARVDAELVRRGLARSREHAQELIASGRVLISGAAATKPATAIEAGTPLRVVEVDNEVSWASRGAHKLLGALEAFGPRGLEVEAKRCLDAGASTGGFTDVLLHHGAREVVAVDVGYGQLVWRLQSDDRVHVIDRTNVRSIDAEQIGGPVDLVVADLSFISLKLVLPAFVGCVADGADLIPMVKPQFEVGKDHVGSGGVVRDPELRVAAVLDVAKTAASLGLRTVGAVASPLPGPSG-NVEYFLWL 295
>gi|109645428|ref|ZP_01369348.1| hemolysin A [Desulfitobacterium hafniense DCB-2] >gi|109643377|gb|EAT52930.1| hemolysin A [Desulfitobacterium hafniense DCB-2] (269 aa)
Score = 323, Expect = 2.7e-28, Identities = 82/243 (33%), Positives = 137/243 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD  LV    + SR  A+  I    V   G+ + K    + E   +E+  +   YVSR   KL+ A++ F +     +  DIG+STGGFT   L+N  ++VY+IDVG  QL+ +L+ +++V+ +E+ N R +E   + +++DF+  DV+FIS+  IF  + ++   + + I L+KPQFE G++    KG  K  + H++++ + +E      +K  G   SPI+G +  N EYL +L  + E
  S:     5 KERLDSLLVKRGLSPSREKAKATIMAGLVYSQGRRLDKPGLELAEDTLLEVKGDLIPYVSRGGLKLEKALKVFPVSFAEAVVADIGASTGGFTDCALQNGAQRVYAIDVGYGQLDWKLRTDSRVVCMERVNARYLEGDSLPEQVDFVVSDVAFISVTKIFPAMLKILKEDGQIITLIKPQFEAGREHIGKKGVVKDPQVHQEVLVHVLEEAEKNGLKVKGLDFSPIRGPEG-NIEYLAWLNREQE 248
>gi|89895093|ref|YP_518580.1| hypothetical protein DSY2347 [Desulfitobacterium hafniense Y51] >gi|89334541|dbj|BAE84136.1| hypothetical protein [Desulfitobacterium hafniense Y51] (274 aa)
Score = 322, Expect = 2.8e-28, Identities = 82/243 (33%), Positives = 137/243 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           K RLD  LV    + SR  A+  I    V   G+ + K    + E   +E+  +   YVSR   KL+ A++ F +     +  DIG+STGGFT   L+N  ++VY+IDVG  QL+ +L+ +++V+ +E+ N R +E   + +++DF+  DV+FIS+  IF  + ++   + + I L+KPQFE G++    KG  K  + H++++ + +E      +K  G   SPI+G +  N EYL +L  + E
  S:    10 KERLDSLLVKRGLSPSREKAKATIMAGLVYSQGRRLDKPGLELAEDTLLEVKGDLIPYVSRGGLKLEKALKVFPVSFAEAVVADIGASTGGFTDCALQNGAQRVYAIDVGYGQLDWKLRTDSRVVCMERVNARYLEGDSLPEQVDFVVSDVAFISVTKIFPAMLKILKEDGQIITLIKPQFEAGREHIGKKGVVKDPQVHQEVLVHVLEEAEKNGLKVKGLDFSPIRGPEG-NIEYLAWLNREQE 253
>gi|148559255|ref|YP_001258457.1| hemolysin A [Brucella ovis ATCC 25840] >gi|148370512|gb|ABQ60491.1| hemolysin A [Brucella ovis ATCC 25840] (253 aa)
Score = 322, Expect = 2.9e-28, Identities = 90/234 (38%), Positives = 130/234 (55%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV   +  +R  A+D I    V ++G+ I+K   +V     + + +    YVSRAA KL AA++HF++++  + A+DIG+STGGFTQVLLE     V +IDVG +QL+E L+ + +V S E  N R +E + L    +D I  DVSFIS+ L       L         L+KPQFE G+    K G  +  A  E   + + +++E  S    + LG   SPI+G    N EYL 
  S:    11 RLDQLLVERGFFATRSRARDAIQRGTVKVDGRPITKPGQMVVRDAALAVDDPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVLLERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFISLRLALPPALALVEKGAICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKSWLETQS--GWRALGLCPSPIEGGDG-NREYLL 247
>gi|110633093|ref|YP_673301.1| hemolysin A [Mesorhizobium sp. BNC1] >gi|110284077|gb|ABG62136.1| hemolysin A [Mesorhizobium sp. BNC1] (252 aa)
Score = 322, Expect = 3.4e-28, Identities = 84/227 (37%), Positives = 128/227 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDH-KKIINNFIEFLSILNIKNLGYIV-----SPIKGA 229
           ++RLD  LV   +  SR  A+D +    V + GQ + K   L     ++ + +   +YVSRAA KL   ++ F +D +  +A+DIGSSTGGFTQVLLE     V +IDVGT Q++ +L+++ +V  LE  N R +   +I   + +F+  DVSFIS+ L      E+       + L+KPQFE G++     G  +  D  ++I  N  E+LS+    N G+ V     SPI+G 
  S:     9 RLRLDQLLVERGFFESRARARDAVLRGTVQVAGQTVKKPGQLFPADAQITVEDPARRYVSRAALKLVHGLDAFGLDPHGALALDIGSSTGGFTQVLLERGAAHVTAIDVGTGQMDARLREDPRVACLEGINARYLTLGMIGGRRPNFLVSDVSFISLKLALPPALEMAEKGAWGLFLVKPQFEAGREAIGKGGLLREPDKAEEIARNIAEWLSM----NEGWRVIGLEPSPIEGG 239
>gi|126657190|ref|ZP_01728356.1| hypothetical protein CY0110_24716 [Cyanothece sp. CCY0110] >gi|126621461|gb|EAZ92172.1| hypothetical protein CY0110_24716 [Cyanothece sp. CCY0110] (260 aa)
Score = 321, Expect = 4.1e-28, Identities = 83/230 (36%), Positives = 123/230 (53%)
  Q:    11 VNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +  N+  SR  AQ  I   +V +N +II K  T V     +E+ ++  YVSR   KL+ A++ F I + ++I +D G STGGFT  LL+   K+VY +DVG  Q+   L+++ +VI  E+TNFR +    +     K D   +DVSFIS+  +   +  L     + I L+KPQFE+G+     KG  +   DH + I   ++          G  VSPI G    NTEYL +L
  S:     1 MERNFCSSRQQAQRCIRAGEVKVNQRIIDKPGTEVKITADIELKQKPPYVSRGGLKLEKALKLFKIPVEDRICLDGGISTGGFTDCLLQVGAKQVYGVDVGYGQVAWSLRQDQRVILKERTNFRYLTPEELYQGNPKADLGVMDVSFISLIKVLEPLWNLLQEPREVILLIKPQFEVGRSRVGKKGVVRDPHDHTQAIYQVLQTAYTFGWFCCGLTVSPITGPAG-NTEYLAWL 233
>gi|148253963|ref|YP_001238548.1| putative rRNA methylase [Bradyrhizobium sp. BTAi1] >gi|146406136|gb|ABQ34642.1| putative rRNA methylase [Bradyrhizobium sp. BTAi1] (245 aa)
Score = 321, Expect = 4.2e-28, Identities = 73/234 (31%), Positives = 121/234 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    V  N + ++K++  V     ++      +VSR   KL AA+EH+ I++   + +D+G+STGGFT+VLL +    V+++DVG +QL+  L+ +++++S+EQT+ R  E   +  + D + ID SFIS+  +      L  +    +AL+KPQFE   K G          H+ + ++   F + L   ++    S IKG    N E+  
  S:     7 RADVLLVERGLFESRARAQAAIEAGLVFANDKQVAKASETVPADASLQAEPAHPWVSRGGVKLAAALEHYGIEVEEHVCLDVGASTGGFTEVLLAHGAALVFAVDVGRDQLHPSLRNHSRIVSMEQTDIRSYEGKRLPQRPDVVVIDCSFISLKSVLPVALSLAASPMSLLALIKPQFEAQGKHGKGGIIKDAAVHQAVCDDVAAFAAALGCSDIEIFPSCIKGGDG-NAEFFL 239
>gi|63852194|dbj|BAD98446.1| rRNA methylase [Desulfovibrio vulgaris] (240 aa)
Score = 321, Expect = 4.2e-28, Identities = 72/188 (38%), Positives = 111/188 (59%)
  Q:    50 KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK-IINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYL 237
           + E+   E++VSR AYKL  AIE+F +D+   + +D G+STGGFT  LL++   +VYS+DVG NQL+E+L+ + +V+S E TN R     LI + +D +  DVSFIS+ L+     +      + +AL+KPQFE+G    T KG  +    ++  ++  + +    L +   G + S I G K  N EYL
  S:    47 RFELFGRERFVSRGAYKLLTAIEYFGLDVTGFVCLDAGASTGGFTDCLLQHGAARVYSVDVGHNQLHERLRADARVVSHEHTNLRTAPPELIPEPVDLVVADVSFISLTLVLAPCLQWLKPGGRVVALVKPQFEVGPG-QTEKGVVRDPALRQAAVDKVVAYCRDALGLDLEGVVPSAITGPKG-NQEYL 234
>gi|47458915|ref|YP_015777.1| putative rRNA methylase [Mycoplasma mobile 163K] >gi|47458243|gb|AAT27566.1| putative rRNA methylase [Mycoplasma mobile 163K] (241 aa)
Score = 321, Expect = 4.3e-28, Identities = 99/233 (42%), Positives = 140/233 (60%)
  Q:    11 VNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNI--DLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLS----ILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           V E +  +   A  LI N ++++N +II+  N L  + D++ +  +++YVSR AYKL  AIE FN+  ++ NKI +DIGSSTGGF +VLL+   +KV+++DVGTNQL+  L+ N KVIS E TN ++I  +L  +KI+ +T DVSFIS   +F  +  L       I L+KPQFE       T G    E H  IIN  I + S    + +IK        IKG K +NTEY+   E K
  S:     9 VIEKFDFTNSKASLLIRNKQIIVNKKIIADPNFLTIKDDEILLNNKKEYVSRGAYKLLDAIEEFNLKKEIKNKIVLDIGSSTGGFIEVLLKYGAEKVFALDVGTNQLDYSLRINPKVISKENTNLKQISKNLFSEKIELVTCDVSFISSKEVFKVLNFLD-KGVNLILLIKPQFEANSSDVLTGGIVNKEIHNDIINKVINYGSESFLLKSIKE-----CKIKGKKSKNTEYISLFERK 241
>gi|72162433|ref|YP_290090.1| hemolysin A [Thermobifida fusca YX] >gi|71916165|gb|AAZ56067.1| hemolysin A [Thermobifida fusca YX] (266 aa)
Score = 321, Expect = 4.5e-28, Identities = 81/239 (33%), Positives = 129/239 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE----EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++ RLD  LV   +ARSR  A +LI   +V + G + +K+ T V  +D+  ++E    E  YVSR AYKL  A++ F +D+  +  +D G+STGGFT VLL      V ++DVG  QL   L+ + +V  LE+ N RE+    + + + D +  D+SFIS+ L+   +     ++   + L+KPQFE+G++    KG  +  E     + +       L +   G   SP+ G    N EY  +L
  S:     3 RRSRLDAELVRRGHARSRAHAAELIAAGRVRVAGTLATKAATQVG-VDQAIVVEQADDEPVYVSRGAYKLIGALDAFAVDVTGRRCLDAGASTGGFTDVLLRRGAAHVVAVDVGYGQLAWSLRSDPRVTVLERQNVRELTPDQVGEPRPDLVVADLSFISLRLVLAPLLACAASDADFVLLVKPQFEVGRERVGAKGVVRDPEARASAVRDVAAHAWTLGLGVCGVTASPLPGPSG-NVEYFLWL 245
>gi|116495117|ref|YP_806851.1| rRNA methylase [Lactobacillus casei ATCC 334] >gi|191638623|ref|YP_001987789.1| Hemolysin A [Lactobacillus casei] >gi|116105267|gb|ABJ70409.1| Predicted rRNA methylase [Lactobacillus casei ATCC 334] >gi|190712925|emb|CAQ66931.1| Hemolysin A [Lactobacillus casei BL23] (276 aa)
Score = 321, Expect = 4.7e-28, Identities = 88/241 (36%), Positives = 138/241 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDK--VEIL---------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD-KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           ++K R+D+ LV +    SR  A+      + V+ G++  ++N     LDK  V+I          ++  YVSR   KL  A++ FNIDL +K  +DIG+STGGFT V L+N  K  Y++DVG NQL  +L+++ +V  +E+ NFR  +     D  ++F   DVSFIS+ LI   +K +      ++AL+KPQFE G   +G        + H+ ++   ++F        LG   SPIKG +  N E+L +L+
  S:     4 IKKERVDVLLVEQGLFESREQAK------RSVMAGEVYDQNN---QRLDKPGVKIAGDAILHVKGKKMPYVSRGGLKLAKALKVFNIDLKDKTVLDIGASTGGFTDVALQNGAKMSYALDVGYNQLAWKLREDPRVKVMERVNFRYSKPEDFTDGPVEFAMTDVSFISLKLILPPLKAILIPGGHAVALIKPQFEAGPANVGKHGIVRDPQVHRDVLKMIVDFALEAGYDVLGLDYSPIKGGEG-NIEFLIHLQ 247
>gi|116511682|ref|YP_808898.1| hypothetical protein LACR_0928 [Lactococcus lactis subsp. cremoris SK11] >gi|116107336|gb|ABJ72476.1| Predicted rRNA methylase [Lactococcus lactis subsp. cremoris SK11] (268 aa)
Score = 321, Expect = 4.7e-28, Identities = 88/238 (36%), Positives = 137/238 (57%)
  Q:     3 KIRLDIYLVNENYARSR-----GVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFRE-IESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K R+D+   N+    +R     GV   L+ +SK   +G+   K    +++  ++ +  E+ +YVSR   KL+ A++ FNI +  K  +DIGSSTGGFT V+L+N  K VY++DVGTNQL  +++ + +V+ +EQ NFR  + S   + +  F +IDVSFIS+ LI   + E+     +  AL+KPQFE G+ ++G        + HK  I   +   + L     G   SPIKG    N E+L +L
  S:     2 KERIDVLATNQGLFETREQAKRGVMAGLVVDSK---SGERYDKPGQKIDDGTELRLKGEKLRYVSRGGLKLEKALKEFNIKIEGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNALLSDFEQGRPAFTSIDVSFISLELILPPLYEILEEGGEVAALIKPQFEAGREQVGKNGIIRDPKVHKMTIEKVLAAATRLKFSIKGLTFSPIKGGAG-NVEFLVHL 243
>gi|56751203|ref|YP_171904.1| hemolysin-like protein [Synechococcus elongatus PCC 6301] >gi|81299130|ref|YP_399338.1| hemolysin A [Synechococcus elongatus PCC 7942] >gi|56686162|dbj|BAD79384.1| hemolysin-like protein [Synechococcus elongatus PCC 6301] >gi|81168011|gb|ABB56351.1| hemolysin A [Synechococcus elongatus PCC 7942] (272 aa)
Score = 321, Expect = 4.8e-28, Identities = 86/240 (35%), Positives = 128/240 (53%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI--KDKI--DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD  LV      SR  AQ LI   +V +   I+ K  +LV E   +E+  +  YVSR   KL  A+  F I L+++I +D G STGGFT  LL+    KVY IDVG  Q++ +++ + +V+  E+TN R ++ + +   D +  D    D+SFIS+  +   + +L  +  + I L+KPQFE+G+ K+G        +DH   I   +E    L     G   SP+ G    N EYL +L
  S:     1 MAKHRLDALLVERGLCPSRQQAQRLIRAGEVRVAQAIVDKPGSLVAEDAVIEVAAKPPYVSRGGEKLAKALATFPIALSDRICLDAGISTGGFTDCLLQAGASKVYGIDVGYGQVDWKIRTDPRVLLRERTNIRNLQPTDLYGSDDVWPDLAVADLSFISLTKVLLTLGQLLRSPRELILLVKPQFEVGREKVGKGGVVRDRKDHVTAIAQVLESAQGLGWHGQGLTWSPLLGPAG-NVEYLLWL 244
>gi|163853708|ref|YP_001641751.1| hemolysin A [Methylobacterium extorquens PA1] >gi|163665313|gb|ABY32680.1| hemolysin A [Methylobacterium extorquens PA1] (250 aa)
Score = 320, Expect = 4.9e-28, Identities = 78/236 (33%), Positives = 123/236 (52%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +++R D +LV   + RSR  A+  I    V  +G+++++ + LV    ++E      YVSR   KL AA++ F +D      +D+G+STGGFT VLL      ++++DVG +QL+  L+ + +V SLE T+ R +    I+      TIDVSFI + L+   +     +     AL+KPQFE G+ ++G        E H ++       L  L     G I SPI+G    N E+L
  S:     4 ERLRADRFLVERGHFRSRAQARAAIEAGLVSADGRLVTRPSDLVEAGARIEASAPHPYVSRGGLKLAAALDAFGLDPAGLPCLDVGASTGGFTDVLLRRGAAHIHAVDVGRDQLDAALRADPRVTSLEGTDIRALSPGAIQPAPQLATIDVSFIGLRLVLPAVAAQLADEAAIAALIKPQFEAGRERVGRGGIVRDAEVHAEVCEGVRAVLVGLGFTVSGPIPSPIEGGDG-NREFL 239
>gi|89094264|ref|ZP_01167206.1| probable hemolysin [Oceanospirillum sp. MED92] >gi|89081519|gb|EAR60749.1| probable hemolysin [Oceanospirillum sp. MED92] (253 aa)
Score = 320, Expect = 4.9e-28, Identities = 93/239 (38%), Positives = 134/239 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVI----NGQIISKSNTLVNELD--KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-----IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           R D+ LV   +A+SR  AQ +I N++V        Q +SK    +      K+E  + +++VSR A KL+AA+E   +D  NK+AID+G STGGFT  LL+  V KV  I+VG +QL E+L+++++V   E  N RE+ S L +        D   +DVSFIS   I   +  L   N   I L+KPQFE+GK+     G  K       + + IE   + L ++   YI SPIKG    N E+L   + K
  S:     3 RADLLLVELGFAQSRTHAQRMIKNNQVTAFFKGRWQCLSKPGIKLESSTEFKIEQADIDRFVSRGAVKLQAALELNIVDPANKVAIDVGQSTGGFTDCLLQAGVAKVVGIEVGHDQLAEKLREDSRVTCYEGMNARELPSDLSQAHTEGRGFDLAVMDVSFISQTKILPSLAPLIAPNGYLITLVKPQFEVGKEGIGRGGIVKDTSLYPEVQSLIEKCCLSLELEPDTYIPSPIKGGDG-NQEFLLIAKKK 252
>gi|15672840|ref|NP_267014.1| hypothetical protein L81441 [Lactococcus lactis subsp. lactis Il1403] >gi|12723786|gb|AAK04956.1|AE006320_5 conserved hypothetical protein [Lactococcus lactis subsp. lactis Il1403] (243 aa)
Score = 320, Expect = 5.9e-28, Identities = 74/186 (39%), Positives = 116/186 (62%)
  Q:    55 EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFRE-IESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           E+ +YVSR   KL+ A++ F++++N K  +DIGSSTGGFT V+L+N  K VY++DVGTNQL  +++ + +V+ +EQ NFR  + +   + +  F +IDVSFIS++LI   + E+   N +  AL+KPQFE G+ ++G        + H+  I   ++  + L     G   SPIKG    N E+L +L
  S:    32 EKLRYVSRGGLKLEKALKEFHLEINGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNAVLADFEQGRPSFTSIDVSFISLDLILPPLYEILEKNGEVAALIKPQFEAGREQVGKNGIIRDPKVHQMTIEKVLKTATQLGFSVKGLTFSPIKGGAG-NVEFLVHL 218
>gi|157964686|ref|YP_001499510.1| hemolysin A [Rickettsia massiliae MTU5] >gi|157844462|gb|ABV84963.1| Hemolysin A [Rickettsia massiliae MTU5] (257 aa)
Score = 319, Expect = 6.4e-28, Identities = 95/237 (40%), Positives = 130/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK--YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+ + +     +A+ LI   KV    + + K    VN  D    ++  K  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE     ++++DVG  +L+ +L+ N  +  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K    H+K+ +   ++L    N K  G I SPI GAK  N E+L
  S:     7 MTKIRLDEYLLQKGFVTDITIARSLIIQGKVHNRHEQLIKPGIQVNINDTDIKVKRPKHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKATLIFAVDVGYGELHPKLRDNPHIKVLEKTNARYLTDKQIITKPDLIVCDASFISLTTILPTALNLVKEDCMLIALIKPQFEVEKHEVEQGGIIKNPLLHQKVCDKIKDWLEKEHNFKIFGIIASPILGAKG-NQEFL 246
>gi|192289447|ref|YP_001990052.1| hemolysin A [Rhodopseudomonas palustris TIE-1] >gi|192283196|gb|ACE99576.1| hemolysin A [Rhodopseudomonas palustris TIE-1] (246 aa)
Score = 319, Expect = 6.7e-28, Identities = 77/234 (32%), Positives = 129/234 (55%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKV-EILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    VV +G+ ++K +  +  LD V E      +VSR   KL  A+E + I++ + + +D+GSSTGGFT+VLL +    V+++DVG +QL+  L+ + K++S+E+T+ R++E + +  + D + ID SFIS+  +      L  +    +AL+KPQFE   K G  +  AK   H+ + ++ + F + L  +++    S I G    N E+  
  S:    12 RADVVLVERGLFDSRARAQAAIEAGLVVADGKPVTKVSEPI-ALDAVLEAQPAHPWVSRGGVKLAGALERYLIEIEDHVCLDVGSSTGGFTEVLLAHGAALVFAVDVGRDQLHASLRGHPKIVSMEETDIRKLEGTRLPQRPDVVVIDASFISLKQVLPAALSLAASPMSLLALIKPQFEAPSKRGIVRD-AKV--HRAVCDDAVAFAASLGCRDIEVFASSIAGGDG-NVEFFL 241
>gi|182678784|ref|YP_001832930.1| hemolysin A [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634667|gb|ACB95441.1| hemolysin A [Beijerinckia indica subsp. indica ATCC 9039] (256 aa)
Score = 319, Expect = 6.8e-28, Identities = 82/233 (35%), Positives = 121/233 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           R D  LV      SR  AQ+ I    V + G+++ K++ +++    +E      +VSR   KL A IE F +D  N++ +DIG+STGGFT VLL +  KKV +I+VG  QL+E + KN +V S E  + R++           IT D SFIS++L+   I  L  ++   I L+KPQFE G+  G          H ++     E ++ L  +  G I SPI G    N E+L
  S:    19 RADRVLVEHGLFESRAKAQEAIAAGLVRVEGEVLHKASQMIDADHYIEASAPYPWVSRGGVKLAAGIEAFGVDPRNRLCLDIGASTGGFTHVLLSHGAKKVIAIEVGHGQLHETIAKNPRVDSREGVDARDLRPQDFPILPSLITCDASFISLHLLLPAILALGDDDAFFIGLIKPQFEAGR--GHKSIIRDGAIHARVCAEVEEHVAKLGWQKEGIIPSPITGTDG-NQEFL 248
>gi|171323378|ref|ZP_02911898.1| hemolysin A [Geobacillus sp. WCH70] >gi|171090572|gb|EDT36865.1| hemolysin A [Geobacillus sp. WCH70] (277 aa)
Score = 319, Expect = 6.8e-28, Identities = 88/245 (35%), Positives = 141/245 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS-LIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K RLD+ LV      +R  A+      + ++ G + S    L    +KV +        +   YVSR   KL+ A+  F++ + +KI +DIG+STGGFT   L++  K  Y++DVG NQL  +L+++++V+ +E+TNFR +      K    F TIDVSFIS+ LI   +K +       IAL+KPQFE GK+    KG  +  + H++++ + I+F      ++ NL Y  SPI G    N E+L +L ++ +K
  S:     4 KKERLDVLLVQRGLIETREKAK------RAIMAGLVYSNEVRLDKPGEKVPVDIPLAIKGDVLPYVSRGGLKLEKALRTFDVTVQDKIILDIGASTGGFTDCALQHGAKLSYAVDVGYNQLAWKLRQDDRVVVMERTNFRYVTPDYFTKGLPQFATIDVSFISLKLILPVLKTVLVPESDVIALVKPQFEAGKEKVGKKGIVRDPNVHEEVLTSIIDFALCEGFDVMNLSY--SPITGGDG-NIEFLLHLRFQGDK 250
>gi|39934027|ref|NP_946303.1| hemolysin A [Rhodopseudomonas palustris CGA009] >gi|39647875|emb|CAE26394.1| putative hemolysin [Rhodopseudomonas palustris CGA009] (246 aa)
Score = 319, Expect = 7.3e-28, Identities = 77/234 (32%), Positives = 128/234 (54%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKV-EILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    VV +G+ + K +  +  LD V E      +VSR   KL  A+E + I++ N + +D+GSS+GGFT+VLL +    V+++DVG +QL+  L+ + K++S+E+T+ R++E + +  + D + ID SFIS+  +      L  +    +AL+KPQFE   K G  +  AK   H+ + ++ + F + L  +++    S I G    N E+  
  S:    12 RADVVLVERGLFDSRARAQAAIEAGLVVADGKPVMKVSEPI-ALDAVLEAQPAHPWVSRGGVKLAGALERYPIEIENHVCLDVGSSSGGFTEVLLAHGAALVFAVDVGRDQLHASLRGHPKIVSMEETDIRKLEGTRLPQRPDVVVIDASFISLKQVLPAALSLAASPMSLLALIKPQFEAPSKRGIVRD-AKV--HRAVCDDAVAFAASLGCRDIEVFASSIAGGDG-NVEFFL 241
>gi|157825879|ref|YP_001493599.1| hemolysin A [Rickettsia akari str. Hartford] >gi|157799837|gb|ABV75091.1| Hemolysin A [Rickettsia akari str. Hartford] (247 aa)
Score = 319, Expect = 8.1e-28, Identities = 97/243 (39%), Positives = 135/243 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELD---KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           M KIRLD YL+ + +     +A+ LI   KV    + + K    VN  D   KV+ L +  YVSR A KL AA+++F ID  N + IDIGSSTGGFT+VLLE   K ++++DVG  +L+ +L+ N ++  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K T  H+K+ +   ++L    N      I SPI G+K  N E+L    +K
  S:     1 MTKIRLDEYLLQKGFVTDITIARSLIIQGKVHNKHEQLIKPGIQVNINDSDIKVK-LPQHNYVSRGALKLIAALDYFKIDPENLVCIDIGSSTGGFTEVLLERKAKLIFAVDVGYGELHPKLRDNPQIKVLEKTNARYLSDKQITIKPDLIVCDASFISLTTILPTSLSLAKEDCMLIALIKPQFEVEKHEVEQGGIIKNTFLHQKVCDKIKDWLEQEHNFNMFDIIESPILGSKG-NKEFLIAGHFK 246
>gi|123966876|ref|YP_001011957.1| rRNA methyltransferase [Prochlorococcus marinus str. MIT 9515] >gi|123201242|gb|ABM72850.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. MIT 9515] (270 aa)
Score = 319, Expect = 8.2e-28, Identities = 93/240 (38%), Positives = 136/240 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI-------ESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNW-KSIALLKPQFELGKKIGTTKGFA-KTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++K RLD+YL+++    +R  AQ LI   KV  ING+I  K    V    +  I  E ++VSR   KL  A +  NI++  ++ ID G STGGFT  LL+   K VY IDVG  Q   +++KN KVI  E++N R +       E SL+    +F+  D+SFIS+NL+F  I  L + ++ + I L+KPQFE+GK   +  G   K E H + I + +     L     G + SP+ G    N EYL ++
  S:     2 IKKSRLDLYLLSQGLCETRQKAQGLILAGKVKDINGKIFDKPGQQVITGTEFIIESEAQFVSRGGEKLLEAFKKLNINVKGRVCIDAGISTGGFTDCLLQQGAKMVYGIDVGYGQTAWEIRKNPKVILFERSNIRNLKPLDIYSEESLLP---NFVVADLSFISLNLVFEPINNLLFGDFIEGIFLIKPQFEVGKDRVSKGGVVRKAEYHIEAIESVLNTAEKLQWNIKGLVASPLVGPAG-NHEYLAWM 247
>gi|116872797|ref|YP_849578.1| hemolysin A [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741675|emb|CAK20799.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (274 aa)
Score = 319, Expect = 8.2e-28, Identities = 81/246 (32%), Positives = 137/246 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI-ESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R DI LV +    +R  A+  I    V    + + K    +    ++++  ++  YVSR   KL+ A++ F+ D+ +K+ +DIG+STGGFT   L+N  K  Y++DVG NQL  +L+ + +V  +E+TNFR + E+   +   DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H  ++ N ++F        +G   SPI G +  N E++ +L++  E+
  S:     3 IKKERADILLVEQGLFETREKAKRAIMAGIVYRKEERVDKPGEKIPVDSELQVKGKQMPYVSRGGLKLEKALQIFDFDVKDKLMLDIGASTGGFTDCALQNGAKHSYALDVGYNQLAWKLRNDERVTVMERTNFRHVTEADFTEGLADFATIDVSFISLKLILPVLRTVLVVGGDVMTLIKPQFEAGREQVGKKGIVRDPAVHAAVVENIVQFALDNGYDLMGLDFSPITGGEG-NIEFIAHLKWTGEE 250
>gi|163726242|ref|ZP_02133757.1| hemolysin A [Desulfatibacillum alkenivorans AK-01] >gi|161400452|gb|EDQ24705.1| hemolysin A [Desulfatibacillum alkenivorans AK-01] (245 aa)
Score = 318, Expect = 9.8e-28, Identities = 80/239 (33%), Positives = 131/239 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD  +     A SR  AQ LI + +V+++     K+  +++    + +  ++  YVSR   KL+ A+E   + +     ID+G+STGGFT  LL+    +V ++DVG  Q   +L+++ +V+ +E+TN R      +  K +   IDVSFIS+ ++   + EL   + + I ++KPQFE+GK    K G  K  AK   H K++ +   F   L ++ +G   SPI G K  N E+ F L
  S:     3 KKQRLDTLITELGLAPSRTRAQALILSGQVLVDDVPQDKAGAMISPEANITVRGQDMPYVSRGGLKLEGALEQLGLSVQGLDCIDVGASTGGFTDCLLQRGASRVIAVDVGYGQFAWKLRQDARVVVMERTNIRHTVPEDLPWKPELAVIDVSFISLKIVIPVLLELMAQHCRIIPMVKPQFEVGKGEVGKNGVVKDPAK---HAKVLEDMEAFFKGLGLECIGPAPSPILGPKG-NKEFFFLL 242
>gi|33241066|ref|NP_876008.1| rRNA methylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33238595|gb|AAQ00661.1| Predicted rRNA methylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (270 aa)
Score = 318, Expect = 1.1e-27, Identities = 87/239 (36%), Positives = 135/239 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----FITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +K RLD++L+ +  A SR  AQ LI   KV    G I+ K    V++  ++ +    ++VSR   KL AA+  F I+++ +I ID G STGGFT  LL+     VY IDVG  Q+   L+ +++V+  E+TN R ++ S +    D        D+SFIS+ ++   IK  L+ +  +++ L+KPQFE+G +++G        + H   +N  I+F    + K  G I SPIKG    N EYL +L
  S:     3 KKNRLDVHLLTKGLAPSREQAQKLIRAGKVRDAVGNILDKPGQEVSKELEIIVQSSPRFVSRGGEKLDAALTQFPIEVSKRICIDAGISTGGFTDCLLKRGASLVYGIDVGYGQIAWTLRNDSRVVLRERTNIRYLKHSDLYGPSDPLPSLAVADLSFISLRIVLPAIKSLLQKSKQEALLLVKPQFEVGPERVGKGGVVRDAQSHMDALNAIIDFSRSKDWKTKGAIASPIKGPAG-NHEYLLWL 247
>gi|47076772|dbj|BAD18315.1| unknown conserved protein [Geobacillus stearothermophilus] (282 aa)
Score = 317, Expect = 1.1e-27, Identities = 86/245 (35%), Positives = 127/245 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           +K RLD+ LV    A +R  A+  I    V  N   + K    V     +E+      YVSR   KL+ A+  F I +  KI +DIG+STGGFT   L++  K  Y++DVG NQL  +L+++ +V+ +E+TNFR     L    + +   IDVSFIS+ LI   +K +       IAL+KPQFE GK+    KG  +    H+ ++ + ++F        L    SPI G    N E+L +  Y  E+
  S:     4 KKERLDVLLVERGLAETREKAKRAIMAGLVYSNDIRLDKPGEKVPTDIPLEVKGNPLPYVSRGGLKLEKALREFQISVKGKIVLDIGASTGGFTDCALQHGAKLSYAVDVGYNQLAWKLRQDERVVVMERTNFRYATPDLFTKGLPEVAVIDVSFISLRLILPVVKTVIVPGGDVIALVKPQFEAGKEKVGKKGIVRDPAVHRDVLESIVQFACAERFDVLHLSYSPITGGDG-NIEFLLHAVYSGEE 250
>gi|79835462|gb|ABB52091.1| rRNA methylase [Arthrospira platensis] (222 aa)
Score = 317, Expect = 1.3e-27, Identities = 75/195 (38%), Positives = 116/195 (59%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFI--------TIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT 197
           K RLD  LV+ + + SR  AQ LI   +V++N Q++ K  T V+    +++     YVSR   KL  A++ F I++ ++I ID G STGGFT  LL+   K+VY IDVG  Q++ +L+ +++VI  E+TNFR +    +  + D+          +DVSFIS+  I   + EL     + + L+KPQFE+GK     KG  ++
  S:     2 KQRLDTLLVDRHLSESRQQAQRLIRAGEVMVNRQVVDKPGTEVDISATIDVKVRSPYVSRGGEKLAEALDKFAINVTDRICIDGGISTGGFTDCLLQRGAKQVYGIDVGYGQVDWRLRNDSRVILRERTNFRYLTREQLYHQEDYTKNSFADLGVVDVSFISLTKILPALWELLQPPREVVLLVKPQFEVGKGRVGKKGVVRS 204
>gi|171742791|ref|ZP_02918598.1| hypothetical protein BIFDEN_01905 [Bifidobacterium dentium ATCC 27678] >gi|171278405|gb|EDT46066.1| hypothetical protein BIFDEN_01905 [Bifidobacterium dentium ATCC 27678] (252 aa)
Score = 316, Expect = 1.6e-27, Identities = 81/236 (34%), Positives = 132/236 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNID----LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFY 239
           +RLD+ L++   + SR  AQ LI   KV +NG ++SK++  V++ D +     + YVSR AYKL  A + F  D          +DIG+STGGF  VLL +   +V ++DVG  QL+ ++  + ++I +   N R++E   +  + + I  DVSFIS+  +   I  +  ++ + + L+KPQFE+GK      G  ++E   ++ + N I       L+++  G   SPI+G    N EYL Y
  S:    10 VRLDLALLDRGLSDSRSKAQRLIVQGKVSVNGVVVSKASAKVSDDDVIAADRGDDYVSRGAYKLVGAFDLFFKDGLRPPKGLRCLDIGASTGGFCDVLLRHGAAQVIALDVGHGQLDPKIANDGRIIEMSGVNIRDVEVGDLPFRPEMIVSDVSFISLTYVIPVIARIAADDAQIVLLVKPQFEVGKGNLGKNGIVESEKLREQALRNVIACAKSNGLDVRATG--PSPIEGMHG-NVEYLLY 249
>gi|52080959|ref|YP_079750.1| putative hemolysin A YqxC [Bacillus licheniformis ATCC 14580] >gi|52786335|ref|YP_092164.1| YqxC [Bacillus licheniformis ATCC 14580] >gi|52004170|gb|AAU24112.1| putative hemolysin A YqxC [Bacillus licheniformis ATCC 14580] >gi|52348837|gb|AAU41471.1| YqxC [Bacillus licheniformis DSM 13] (281 aa)
Score = 316, Expect = 1.6e-27, Identities = 83/244 (34%), Positives = 129/244 (52%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +K RLD+ LV      +R  A+  I    V  N   + K    V+    + +     KYVSR   KL+ A++ F + +  K+ IDIGSSTGGFT   L+N     Y++DVG NQL  +L+++ +V+ +E+TNFR    +   + + +F T+DVSFIS+ +I   +K +       IAL+KPQFE G++    KG  +    HK ++++   F +           SPI G    N E+L +L +  E
  S:     4 KKERLDVLLVERGLMETREKAKRAIMAGIVYTNENRLDKPGEKVDRTIPLTVKGNPLKYVSRGGLKLEKALKEFQLSVQGKLMIDIGSSTGGFTDCALQNGALCSYAVDVGYNQLAWKLRQDERVVVMERTNFRYCTPADFTEGLPEFATVDVSFISLKIILPVLKNILVPGSDCIALVKPQFEAGRESVGKKGIVRDPLVHKAVLDDISRFAAREGYDCRNASFSPITGGDG-NIEFLLHLHWDGE 249
>gi|116618695|ref|YP_819066.1| rRNA methylase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097542|gb|ABJ62693.1| Predicted rRNA methylase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (278 aa)
Score = 316, Expect = 1.7e-27, Identities = 93/245 (37%), Positives = 149/245 (60%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNEL-DKVEIL-------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           ++K R+D+ LV +   +SR  A+      + V+ GQI+  +   +++  +K+ +        E+ KYVSR   KL+ A+  F+I + NK  +DIGSSTGGFT V L+N  K VY++DVGTNQL  +L+ +++V  +E TNFR  + +  K  + +F TIDVSFIS+ LI   +  +   +   +AL+KPQFE G++ +G       T  HK+++    + +     +I +L Y  SPIKG +  N E+L  L+  N+
  S:     3 IEKERVDVLLVQQGLFQSREQAK------RAVMAGQILGNNEERLDKAGEKIPVTTELHFKGEQLKYVSRGGLKLEKALNDFDITVENKTVLDIGSSTGGFTDVSLQNGAKLVYALDVGTNQLAWKLRNDDRVKVMENTNFRYSKLADFKYGQPEFATIDVSFISLGLILPALANIITMSGNVVALIKPQFEAGRENVGKNGIIKDTAVHKQVLQKVTQMMVTDGFSITDLTY--SPIKGGQG-NIEFLAVLKRSNQ 250
>gi|114776789|ref|ZP_01451832.1| Hemolysin A [Mariprofundus ferrooxydans PV-1] >gi|114552875|gb|EAU55306.1| Hemolysin A [Mariprofundus ferrooxydans PV-1] (251 aa)
Score = 316, Expect = 1.7e-27, Identities = 81/237 (34%), Positives = 133/237 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSIL-NIKNLGYIVSPIKGAKKENTEYLF 238
           +KIRLD  L +     +  +A+  I    V ++GQ   K+     E   +E+ E   YVSR   KL  A++ F       + +D G+STGGFT VLL+    +VY++DVG  QL+ +L+ + +VI+LE+T+ R+++++LI + +D + ID SFIS+  +       LK   W  +AL+KPQFE+  K    +G  + ++++ + I    + +  L + + +G   SPI G K  N EYL 
  S:     5 KKIRLDQLLFDRGLTDTLDIARRHIMAGLVYVDGQKADKAGMTWREDADIEVREVLPYVSRGGLKLAGALDFFPFQAKGAVCMDAGASTGGFTDVLLQQGALRVYAVDVGHGQLHYRLQHDERVINLEKTHVRKLDNTLIPEPVDALVIDTSFISLTRVLPCCWPFLKPGGW-CVALIKPQFEVEPK-HLDRGVVRDDEYRQQAIKRVCDMVITLPDAEVVGITESPIHGPKG-NVEYLL 241
>gi|170016840|ref|YP_001727759.1| hemolysin A [Leuconostoc citreum KM20] >gi|169803697|gb|ACA82315.1| Hemolysin A [Leuconostoc citreum KM20] (280 aa)
Score = 315, Expect = 1.8e-27, Identities = 89/240 (37%), Positives = 139/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNEL-DKVEIL-------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++K R+DI LV +    SR  A+      + V+ G+I+  +   +++   K+ +        E+ KYVSR   KL+ A+  F+I + +K+ +DIGSSTGGFT V L+N  K VY++DVGTNQL  +L+ + +V  +E TNFR  + +  K  +  F TIDVSFIS+ LI   + ++  +    +AL+KPQFE G++     G  K    HK ++   ++ +        G   SPIKG +  N E+L  L
  S:     4 VEKERVDILLVQQGLFDSREQAK------RAVMAGEILGDNEERLDKAGQKIPVTTELHFKGEKLKYVSRGGLKLEKALNDFDISVADKVVLDIGSSTGGFTDVALQNGAKLVYALDVGTNQLAWKLRSDERVKVMENTNFRYSQLNDFKFGQPQFATIDVSFISLGLILPPLSQIITSGGHVVALIKPQFEAGREHVGKNGIIKDPHVHKHVLQKTVQMMLAEGFSIKGLTYSPIKGGQG-NIEFLAIL 246
>gi|195970192|ref|NP_384985.2| hypothetical protein SMc00973 [Sinorhizobium meliloti 1021] >gi|187904153|emb|CAC45451.2| Probable hemolysin [Sinorhizobium meliloti 1021] (251 aa)
Score = 315, Expect = 2.2e-27, Identities = 81/235 (34%), Positives = 130/235 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           IRLD  L+N     SR  A+D I    V ++G+ ++K  +   +   + I +  + YVSRAA KL AA++HF +D + +  +D+G+STGGFT+VLL+     V ++DVG  Q++ ++ ++ +V ++E  N R +    I ++ I FI  DVSFIS+ L       L       I L+KPQFE G+   +  G  K  +    +   +E   +  +  ++LG I SPI G    N+E+L 
  S:     9 IRLDQLLLNRGLVASRARARDAIQRGTVKVDGRTVTKPASTFAQGVTLTIDDPAQDYVSRAALKLVAALDHFGLDPSEQTCLDVGASTGGFTEVLLKRGAAHVVAVDVGHGQIHPRVAEDPRVTNIEGLNARSMTRGDIDERAITFIVSDVSFISLKLALPPALGLAEPGACCILLVKPQFEAGRDAISKAGLLKDPESAPAVAAELERWLVEDMGWRSLGLIPSPIAGGDG-NSEFLL 246
>gi|27377760|ref|NP_769289.1| hypothetical protein bll2649 [Bradyrhizobium japonicum USDA 110] >gi|27350905|dbj|BAC47914.1| bll2649 [Bradyrhizobium japonicum USDA 110] (245 aa)
Score = 315, Expect = 2.2e-27, Identities = 75/234 (32%), Positives = 121/234 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R DI LV      SR  A+  I    V  + + ++K +  + E   ++      YVSR   KL  A+E + I++ + + +D+G+STGGFT+VLL N    V++IDVGT+QL+  L+ + K++S+E+T+ R  E   +  + D + IDVSFIS+  +      L       +AL+KPQFE  +K            H++I ++   F + L   ++    SPI G    N E+  
  S:     8 RADILLVERGLFESRARARAAIEAGLVTADDKQVTKPSETIAEDAVIQAEPAHPYVSRGGVKLAGALERYPIEIEDHVCLDVGASTGGFTEVLLANGASLVFAIDVGTSQLHPSLRDHPKIVSMEETDIRAYEGRRLPARPDVVVIDVSFISLKAVLPVALSLAAAPMSLLALIKPQFEAERKHNKKGIIRDAAVHQQICDDIAAFAASLGCTDIAVFPSPITGGDG-NIEFFL 240
>gi|157803620|ref|YP_001492169.1| tyrosyl-tRNA synthetase [Rickettsia canadensis str. McKiel] >gi|157784883|gb|ABV73384.1| tyrosyl-tRNA synthetase [Rickettsia canadensis str. McKiel] (284 aa)
Score = 314, Expect = 2.9e-27, Identities = 99/235 (42%), Positives = 132/235 (56%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELD---KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYL 237
           KIRLD YL+ + +     +AQ LI   KV    + + K    VN  D   KV+ L +  YVSR A KL AA+++F I   N + IDIGSSTGGFTQVLLE   K ++++DVG  +L+ +L+ N ++  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G  K    H+K+ N   ++L    N K  G I SPI GAK  N E+L
  S:    34 KIRLDEYLLQKGFVTDITIAQSLIIQGKVHNKYEQLIKPGIQVNINDTNIKVK-LPKHNYVSRGALKLIAALDYFKITTENLVCIDIGSSTGGFTQVLLERKAKLIFAVDVGYGELHPKLRNNLQIKVLEKTNARYLTDKQITMKPDLIVCDASFISLTTILPTSLNLAKEDCMLIALIKPQFEVKKHEVEKGGIIKNSILHRKVCNKIKDWLVKEHNFKIFGIIDSPILGAKG-NKEFL 271
>gi|168808519|ref|ZP_02829578.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 2] (247 aa)
Score = 314, Expect = 3.0e-27, Identities = 91/236 (38%), Positives = 134/236 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTT-KGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD YL N N   +R  A DLI    V +N   I K + LV E D V+I   E  +VS+  YKL   I+  N+ + + I  D+GSSTGGFT   L+   KKVY+IDVG + L+  LK + K+++ E+TN + ++ S   +++D I  D+SFIS+  IF  I+++       + L+KPQFELGK I    KG  K ++ +++ IN  I   +    K      + I   KK+N EY+ +L
  S:     4 RLDHYLKNTNQCETRSKAIDLIKRGFVFVNNLQILKPSFLVQENDFVDIKNNENNFVSKGGYKLFKIIQELNLKIKDFIIADLGSSTGGFTDCCLQLGAKKVYAIDVGVDLLHPSLKNHPKIVNYEKTNVKNLDKSYFLEELDLIVGDLSFISLEQIFPTIEKISSCKTLLLLLIKPQFELGKDIANKYKGIIKNKNLQQLAINKIINLANNYGFKYKHLTPTDIFDQKKQNQEYMIFL 242
>gi|146319307|ref|YP_001199019.1| rRNA methylase [Streptococcus suis 05ZYH33] >gi|146321510|ref|YP_001201221.1| rRNA methylase [Streptococcus suis 98HAH33] >gi|145690113|gb|ABP90619.1| Predicted rRNA methylase [Streptococcus suis 05ZYH33] >gi|145692316|gb|ABP92821.1| Predicted rRNA methylase [Streptococcus suis 98HAH33] (273 aa)
Score = 314, Expect = 3.0e-27, Identities = 87/241 (36%), Positives = 144/241 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKV--VINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K R+D+    +    +R  A+  +    V  VING+   K    ++E  ++++  E+ KYVSR   KL+ A++ F++ +  +  IDIG+STGGFT V+L+   K+VY++DVGTNQL  +L+++ +VIS+EQ NFR  E    +  +  F +IDVSFIS++LI   +  +     + +AL+KPQFE G++     G  K +  H K++    +    +  ++K L +  SP++G    N E+L +LE
  S:     1 MAKERVDVLAFKQGLFETREQAKRGVMAGLVISVINGERYDKPGEKIDEGIELKLKGEKLKYVSRGGLKLEKALQVFHLSVEGQTTIDIGASTGGFTDVMLQAGAKQVYAVDVGTNQLAWKLRQDERVISMEQYNFRYAELGDFELGQPSFASIDVSFISLSLILPALHRILAEGGQVVALVKPQFEAGREQIGKNGIVKDKSVHLKVLEEVTKMAVETGFSVKALSF--SPVQGGHG-NIEFLAHLE 245
>gi|167975818|ref|ZP_02558095.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659828|gb|EDX53208.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (247 aa)
Score = 314, Expect = 3.0e-27, Identities = 91/237 (38%), Positives = 135/237 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTT-KGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           RLD YL N N   +R  A DLI    V +N   I K + LV E D V+I   E  +VS+  YKL   I+  N+ + + I  D+GSSTGGFT   L+   KKVY+IDVG + L+  LK + K+++ E+TN + ++ S   +++D I  D+SFIS+  IF  I+++       + L+KPQFELGK I    KG  K ++ +++ IN  I   +    K      + I   KK+N EY+ +L+
  S:     4 RLDHYLKNTNQCETRSKAIDLIKRGFVFVNNLQILKPSFLVQENDFVDIKNNENNFVSKGGYKLFKIIQELNLKIKDFIIADLGSSTGGFTDCCLQLGAKKVYAIDVGVDLLHPNLKNHTKIVNYEKTNVKNLDKSYFLEELDLIVGDLSFISLEQIFPTIEKISSCKTLLLLLIKPQFELGKDIANKYKGIIKNKNLQQLAINKIINLANNYGFKYKHLTPTDIFDQKKQNQEYMIFLQ 243
>gi|81096217|ref|ZP_00874565.1| Hemolysin A [Streptococcus suis 89/1591] >gi|80977704|gb|EAP41239.1| Hemolysin A [Streptococcus suis 89/1591] (273 aa)
Score = 313, Expect = 3.2e-27, Identities = 87/241 (36%), Positives = 144/241 (59%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKV--VINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K R+D+    +    +R  A+  +    V  VING+   K    ++E  ++++  E+ KYVSR   KL+ A++ F + +  +  IDIG+STGGFT V+L+   K+VY++DVGTNQL  +L+++ +VIS+EQ NFR  E    +  +  F +IDVSFIS++LI   +  +     + +AL+KPQFE G++     G  K +  H K++ +  +    +  ++K L +  SP++G    N E+L +LE
  S:     1 MAKERVDVLAFKQGLFETREQAKRGVMAGLVISVINGERYDKPGEKIDEGIELKLKGEKLKYVSRGGLKLEKALQVFQLSVEGQTTIDIGASTGGFTDVMLQAGAKQVYAVDVGTNQLAWKLRQDERVISMEQYNFRYAELGDFELGQPSFASIDVSFISLSLILPALHRILAEGGQVVALVKPQFEAGREQIGKNGIVKDKSIHLKVLEDVTKMAVETGFSVKALSF--SPVQGGHG-NIEFLAHLE 245
>gi|187250461|ref|YP_001874943.1| hemolysin A [Elusimicrobium minutum Pei191] >gi|186970621|gb|ACC97606.1| hemolysin A [Elusimicrobium minutum Pei191] (258 aa)
Score = 313, Expect = 3.3e-27, Identities = 83/240 (34%), Positives = 135/240 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKI-INNFIEFLS-----ILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +K RLD+ L+ + + +SR  AQ  I   +V++NG +   ++  +   D + + E+   YVSR   KL+ A++ F I++N KI  DIG +TGGF+   L+   KKVY +DVG  QL  ++      I   +TN R + + +  DK +   +DVSFIS+ +I   + +          L+KPQFEL  K     G  KTE+++++ I +  +F +       N ++L  I SPIKG    N EYL++++
  S:     7 KKPRLDMELIAQGFFKSRTRAQASIMAGEVLVNGTVEYGADRKIKPEDIITLKEKSCPYVSRGGLKLEHALKEFKIEVNGKICADIGVATGGFSHCFLKLGAKKVYGVDVGKGQLASEVAAYKNFIFKNETNARFMSADMFDDKFEVAAVDVSFISLKMILEPLLKCMSAEAHLAVLIKPQFELTPK-QVPGGIVKTEENRQLAIKSVRDFFNENLAKKYNAQSLDLIESPIKGTHG-NIEYLWHIK 251
>gi|108804292|ref|YP_644229.1| hemolysin A [Rubrobacter xylanophilus DSM 9941] >gi|108765535|gb|ABG04417.1| hemolysin A [Rubrobacter xylanophilus DSM 9941] (265 aa)
Score = 313, Expect = 3.3e-27, Identities = 72/236 (30%), Positives = 132/236 (55%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    A +R  AQ +I   +V +  ++++K+       ++V ++  E+ +VSR   KL AA+E F +++  ++ +D G+STGGFT VLL    +++ ++DVG  QL+ +L+++ +V  +E+TN R + +  +    + +  D+SFIS+ L  + +     +  +++ L+KPQFE+G +  +  G  +  E   + I    E    L    +G + SP+ G +  N EYL +L
  S:     6 RLDAILVERGLAETRSRAQAMILAGRVRVGDRVVTKAGFRPAPGEEVRLVAPERPFVSRGGEKLAAALERFGVEVEGRLCLDAGASTGGFTDVLLRRGARRIIAVDVGYGQLDWRLREDPRVEVMERTNVRHLGAKDLPFAPELVVADLSFISVVLALSGLLRSAGSVREAVVLVKPQFEVGPERVSRGGVVRDPEARAEAILRAAEGFGRLGFGAVGVMESPVAGRRSGNREYLLHL 243
>gi|167941562|ref|ZP_02528637.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 8] >gi|167959946|ref|ZP_02547015.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972860|ref|ZP_02555137.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167973717|ref|ZP_02555994.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167987904|ref|ZP_02569575.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168338300|ref|ZP_02694915.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 10] >gi|168362933|ref|ZP_02696107.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195867814|ref|ZP_03079814.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903186|gb|EDT49475.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209242|gb|EDU06285.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019160|gb|EDU57200.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997981|gb|EDU67078.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660511|gb|EDX53768.1| ribosomal RNA large subunit methyltransferase J [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (247 aa)
Score = 313, Expect = 3.5e-27, Identities = 91/237 (38%), Positives = 135/237 (56%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTT-KGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           RLD YL N N   +R  A DLI    V +N   I K + LV E D V+I   E  +VS+  YKL   I+  N+ + + I  D+GSSTGGFT   L+   KKVY+IDVG + L+  LK + K+++ E+TN + ++ S   +++D I  D+SFIS+  IF  I+++       + L+KPQFELGK I    KG  K ++ +++ IN  I   +    K      + I   KK+N EY+ +L+
  S:     4 RLDHYLKNTNQCETRSKAIDLIKRGFVFVNNLQILKPSFLVQENDFVDIKNNENNFVSKGGYKLFKIIQELNLKIKDFIIADLGSSTGGFTDCCLQLGAKKVYAIDVGVDLLHPNLKNHPKIVNYEKTNVKNLDKSYFLEELDLIVGDLSFISLEQIFPTIEKISSCKTLLLLLIKPQFELGKDIANKYKGIIKNKNLQQLAINKIINLANNYGFKYKHLTPTDIFDQKKQNQEYMIFLQ 243
>gi|153196144|ref|ZP_01940552.1| hemolysin A [Listeria monocytogenes 10403S] >gi|127634426|gb|EBA23812.1| hemolysin A [Listeria monocytogenes 10403S] (274 aa)
Score = 313, Expect = 3.7e-27, Identities = 79/246 (32%), Positives = 141/246 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-------YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R DI LV +    +R  A+      + ++ G +  K   +    +K+ I  E +       YVSR   KL+ A++ F+ ++ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ +++V  +E+TNFR ++ +   + + DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H+ ++ + ++F        +G   SPI G +  N E++ +L++  E+
  S:     3 IKKERADILLVEQGLFETREKAK------RAIMAGIVYRKEERVDKPGEKIPIDSELQVKGKQMPYVSRGGLKLEKALQVFDFEVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDDRVTVMERTNFRHVKPADFAEGLADFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIRDPAVHESVVEHIVQFALDNGYDMMGLDFSPITGGEG-NIEFIAHLKWTGEE 250
>gi|118579586|ref|YP_900836.1| hemolysin A [Pelobacter propionicus DSM 2379] >gi|118502296|gb|ABK98778.1| hemolysin A [Pelobacter propionicus DSM 2379] (367 aa)
Score = 313, Expect = 3.8e-27, Identities = 78/237 (32%), Positives = 127/237 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           RLD  ++    A SR  AQ LI   +V+++  +  K+   V    ++ +  E   +VSR   KL+ A++ F +D++  +A+D+G+STGGFT  LL+    +V+++DVG  QL  +L+K+ +V+S+E+TN R +    +    D   ID SFIS+  +      L     + IAL+KPQFE+G+ ++G          H + +    +    L +   G   SPI GA   N E+L  LE
  S:     6 RLDKLVLERGLAPSREKAQALIMAGQVIVDDHVADKAGQQVAVDAEIRVRGETLPFVSRGGLKLRRALDEFAVDVSGLVALDVGASTGGFTDCLLQAGAARVFAVDVGYGQLAWKLQKDPRVVSMERTNIRHLMPEQLDGVPDLAVIDASFISLAKVLPATVGLIRPGGRIIALIKPQFEVGRGQVGKGGIVRDPAAHGRAVEGVRQVALELGLTVAGLCDSPITGADG-NREFLILLE 243
>gi|170077101|ref|YP_001733739.1| hemolysin A [Synechococcus sp. PCC 7002] >gi|169884770|gb|ACA98483.1| hemolysin A [Synechococcus sp. PCC 7002] (285 aa)
Score = 313, Expect = 3.8e-27, Identities = 82/240 (34%), Positives = 126/240 (52%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI----KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M K RLD+ LV      SR  AQ +I   +V +  QI+ K  TLV     +E+  +  +VSR   KL  AI HF I + ++I +D G STGGFT  LL+   ++VY IDVG  Q+  +++++ ++I  E+TNFR +    +      +     +D+SFIS+  +   +  L     + I L+KPQFE+G+ ++G        +   + I + +E    L     G   SPI G    N EYL +L
  S:     1 MAKQRLDLLLVERKLCESRQQAQRVIRAGEVKVKQQIVDKPGTLVPADVDIEVQAKPPFVSRGGEKLAKAIAHFQITVKDRICLDGGISTGGFTDCLLQAGAQQVYGIDVGYGQVAWKIRQDPRLILRERTNFRHLTPGDLYPESTKRPTLGVMDLSFISLTKVLPTLWSLLDEPKEVILLVKPQFEVGRAQVGKNGVVRDPQAQAQAIFSVLEAAQKLGWHPQGLTYSPITGPAG-NVEYLLWL 244
>gi|86606220|ref|YP_474983.1| hemolysin A [Synechococcus sp. JA-3-3Ab] >gi|86554762|gb|ABC99720.1| hemolysin A [Synechococcus sp. JA-3-3Ab] (275 aa)
Score = 313, Expect = 4.0e-27, Identities = 79/238 (33%), Positives = 130/238 (54%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKI------DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++RLD +LV   Y  SR  AQ  I   +V +NG    K+ T V+    V I  +  +VSR   KL+ A++ F I +  +I +D G STGGFT  LL+   ++VY +DVG  QL   L+ + +VI  E+TN R ++ + L   ++      D   +D+SFIS+  + + + +L  +  +++ L+KPQFE G+     +G  +    H +++   ++       +  GY  SPI G+   N EY  +L
  S:     4 RVRLDTWLVERGYFSSRQQAQRAILAGEVFLNGVRAEKAGTWVSGDPVVHIQAKSAFVSRGGEKLQGALQAFPIQVQGRICLDAGISTGGFTDCLLQRGAQRVYGVDVGYGQLAWSLRTDPRVILRERTNLRYLQPADLYGTEVPTPNWPDLAVVDLSFISLTKVLDPLWKLLRSPREALLLVKPQFEAGRGQVGKRGVVRDPAIHARVLQTVMQAAVSRGWRVQGYTWSPITGSAG-NIEYWLWL 248
>gi|167957172|ref|ZP_02544246.1| Hemolysin A [candidate division TM7 single-cell isolate TM7c] (199 aa)
Score = 313, Expect = 4.1e-27, Identities = 75/194 (38%), Positives = 117/194 (60%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWK-SIALLKPQFELGKKIGTTKGFAK 196
           K RLD Y+V      SR  A++ I   +V +NG++I K   +V+ +DKV +   E+YVSRA  KL +   +F+++  +K+ +DIGSSTGGFT   L +  + VY++DVGT+QL+  L+ N+++   E+T+ R+    +  + ID I  DVSFIS+  I   I +   N     +A++KPQFE G+   T +G  K
  S:     2 KQRLDRYIVENRLTNSRSQAENYIRLGRVTVNGEVIKKCGFIVSTVDKVVLNIPEQYVSRAGLKLASVSNNFHLNFTDKVVLDIGSSTGGFTDYALRHGARMVYAVDVGTDQLHPSLRGNDQIKLYEKTDIRDF---IPPETIDIILADVSFISLREILPHITKTAMNKKTLLVAMVKPQFEAGRN-QTNRGVVK 192
>gi|157164345|ref|YP_001467145.1| ribosomal RNA large subunit methyltransferase J [Campylobacter concisus 13826] >gi|112801416|gb|EAT98760.1| ribosomal RNA large subunit methyltransferase J [Campylobacter concisus 13826] (237 aa)
Score = 312, Expect = 4.1e-27, Identities = 82/175 (46%), Positives = 109/175 (62%)
  Q:    18 SRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTK 192
           SR  A +LI   KV+ING+I +K ++ V+E  K+ +L+E  YV R A KLK+ +E    DL  K A+DIGSSTGGF Q+LLE  VK V  +DVGT+QL+  L+ + +V   E+T+ RE   +  ++K D IT DVSFIS+  I   I EL   N   I L KPQFE+G  I   K
  S:    14 SRNKASELIKGGKVLINGEICTKVSSEVSEA-KISLLDE-IYVGRGALKLKSFLEAMKFDLAGKNALDIGSSTGGFMQILLERGVKSVTGVDVGTDQLDASLRSDERVKIYEKTDVREFAKTH-QNKFDLITCDVSFISLAEILPAICELASENSLIITLFKPQFEVGVGIKRNK 185
>gi|88855477|ref|ZP_01130141.1| hemolysin [marine actinobacterium PHSC20C1] >gi|88815384|gb|EAR25242.1| hemolysin [marine actinobacterium PHSC20C1] (264 aa)
Score = 312, Expect = 4.5e-27, Identities = 85/240 (35%), Positives = 136/240 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIES------SLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK---KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M  +RLD  L     ARSR  A  LI ++ V ++G  + K++T V++  ++E+ E + YVSRAA+KL AA++ F ID    +A+D+G+STGGFTQVLLE   ++V ++DVG  QL + ++ + +V ++E+ N R + +      S   +    +  D+SFIS+  +   +          + L+KPQFE+G+   + G   G A  ++    I   +     L +   G I SPI G    N EYL +L
  S:     1 MASMRLDAALAARGLARSRTHAAKLIADNLVTVSGVAVPKASTPVSDEHEIEVAETDHYVSRAAHKLVAALDSFGIDATGTLALDVGASTGGFTQVLLERGAREVIALDVGHGQLVDVIRSDARVRTIERENARYLTAESLAVLSGTSETPTLVVSDLSFISLRTVLPALHASVGETADFVLLVKPQFEVGRTNIREGIVHGAALRDE---AIMGVLWAAWDLGLGTAGVIPSPIAG-NAGNREYLVWL 245
>gi|163790195|ref|ZP_02184628.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Carnobacterium sp. AT7] >gi|159874470|gb|EDP68541.1| putative cell adhesion protein (contact hemolysin TlyA-related) [Carnobacterium sp. AT7] (275 aa)
Score = 312, Expect = 4.7e-27, Identities = 82/245 (33%), Positives = 144/245 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL----EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           M+K R+DI LV +    S   A+  +   +V  + +   + +T+  +L     L    +  +YVSR  +KL+ A++ FN+ + +K+ +DIGSSTGGFT   L++  K  Y++DVGTNQL  +L+++++V+ +EQTNFR  +     K + +  +IDVSFIS+ LI   +K +  +    +AL+KPQFE  ++    KG    +  H++++ + + F   +    L    SPI G +  N E+L +L++ ++
  S:     1 MKKERVDILLVEQGLVESIEKAKSAVMAGQVYTSKE--ERIDTVGEKLSSDTQLHLKGKHSRYVSRGGFKLEKAMKVFNVSITDKVMLDIGSSTGGFTDAALQHGAKLSYALDVGTNQLAWKLRQDSRVVVMEQTNFRYCKPEDFSKGRPNLSSIDVSFISLRLILPVLKNIIASGGDVLALIKPQFEAHREDVGEKGIVSDQRVHEQVLTDMLSFAISIGYDVLNLTFSPITGGEG-NIEFLAHLKWNDK 248
>gi|87200682|ref|YP_497939.1| hemolysin A [Novosphingobium aromaticivorans DSM 12444] >gi|87136363|gb|ABD27105.1| hemolysin A [Novosphingobium aromaticivorans DSM 12444] (251 aa)
Score = 312, Expect = 4.8e-27, Identities = 82/236 (34%), Positives = 127/236 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +KIR+D  LV      SR  AQ LI    V      I+K+   +     +++   +  +VSR   KL  AIEHF +D     A+DIGSSTGGFT VLL+N  + V+++D GTNQL  +L+++ +V  LEQT+ R +  + I     ++  D SFIS+  +      L     + +AL+KPQFE+GK ++G        + H+++ +    +L     +  G + SPI G +  N E+L
  S:     9 KKIRVDQLLVERGLVESRARAQALILAGLVFSGETKIAKAGQPIPADAALDVRGRDHPWVSRGGIKLAHAIEHFGLDPAGVTAMDIGSSTGGFTDVLLQNGAEHVFAVDSGTNQLAWKLRQDPRVTVLEQTSARILTPAHIDRPATWVVCDASFISLRKVLEVPLALATRPTRLVALIKPQFEVGKAEVGKGGVVRDPQLHQRVCDEVRAWLEGDGWEVQGIVQSPITGPEG-NVEFL 245
>gi|169828968|ref|YP_001699126.1| hypothetical protein Bsph_3508 [Lysinibacillus sphaericus C3-41] >gi|168993456|gb|ACA40996.1| Hypothetical yqxC protein [Lysinibacillus sphaericus C3-41] (272 aa)
Score = 312, Expect = 4.9e-27, Identities = 86/238 (36%), Positives = 138/238 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYL 240
           K R+DI LV      +R  A+  I    V  N   I K+   +     +++   + KYVSR   KL+ A++ F++ +  K+ +DIGSSTGGFT   L++  +  Y++DVG+NQL  +++ + +V  +E+TNFR   ++ + + + DF TIDVSFIS++LI   +K L       +AL+KPQFE GK     KG  +    KK+    +E  + +  + +G++V     SPI G +  N E+LF+L
  S:     6 KERVDILLVERGLCETREKAKRSIMAGLVFSNEIRIDKAGEKIAIDSPLQVKGSDLKYVSRGGLKLEKALQIFDMSVEGKLMLDIGSSTGGFTDCALQHGARHCYALDVGSNQLAWKIRSDERVTVMEKTNFRYTTAADLSEGLPDFATIDVSFISLSLILPVLKTLLLPGGDVMALVKPQFEAGKDKVGKKGIVRD---KKVHLEVLEKTAAMATE-VGFVVKDASYSPITGGEG-NIEFLFHL 245
>gi|163698768|ref|ZP_02117630.1| hemolysin A [Methylobacterium nodulans ORS 2060] >gi|162435194|gb|EDQ45776.1| hemolysin A [Methylobacterium nodulans ORS 2060] (250 aa)
Score = 312, Expect = 5.0e-27, Identities = 82/236 (34%), Positives = 124/236 (52%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +++R D  LV   +  SR  AQ  I    V  +G+ + +++ L+    ++       YVSR   KL AA++ F ID      +D+G+STGGFT VLL     +VY++DVG  QL+ +L    ++ISLE T+ R IE+         + IDVSFIS+ LI   +  L   + + +AL+KPQFE G++     G  + E   +++     E L  L     G I SPI+G    N E+L
  S:     4 ERVRADRLLVEAGHFESRARAQAAIAAGLVRADGEPVRRASDLIPRAARLSAEAPHPYVSRGGLKLAAALDAFGIDPAGLTCLDLGASTGGFTDVLLRRGAARVYAVDVGRGQLHPRLAGAPRIISLEATDARAIEAWRFAAPPSLVVIDVSFISLRLILPTLPPLVAPDARLVALIKPQFEAGRERVGRGGLVRDEAVQQEVCEGIRELLDSLGFTVAGLIPSPIEGGDG-NREFL 239
>gi|150395716|ref|YP_001326183.1| hemolysin A [Sinorhizobium medicae WSM419] >gi|150027231|gb|ABR59348.1| hemolysin A [Sinorhizobium medicae WSM419] (251 aa)
Score = 312, Expect = 5.0e-27, Identities = 79/235 (33%), Positives = 130/235 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           IRLD  L+N     SR  A+D I    V ++G+ ++K ++   E   + I +  + YVSRAA KL  A++HF +D + +  +D+G+STGGFT+VLL+     V ++DVG  Q++ ++ ++ +V ++E  N R +    I ++ + FI  DVSFIS+ L       L       + L+KPQFE G+   +  G  K  +    +   +E   +  +  ++LG I SPI G    N+E+L 
  S:     9 IRLDQLLLNRGLVASRARARDAIQRGTVKVDGRTVTKPSSTFAEGVTLAIDDPAQDYVSRAALKLLTALDHFGLDPSEQTCLDVGASTGGFTEVLLKRGAAHVVAVDVGHGQIHPRVAEDPRVTNIEGLNARSMTRDDIGERAVTFIVSDVSFISLKLALPPALGLAEPGACCVLLVKPQFEAGRDAISKAGLLKDPESAPAVAAELERWLVDDMGWRSLGLIPSPIAGGDG-NSEFLL 246
>gi|146339199|ref|YP_001204247.1| putative rRNA methylase [Bradyrhizobium sp. ORS278] >gi|146192005|emb|CAL76010.1| putative rRNA methylase [Bradyrhizobium sp. ORS278] (249 aa)
Score = 312, Expect = 5.2e-27, Identities = 73/234 (31%), Positives = 118/234 (50%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R DI LV      SR  AQ  I    V  N + ++K++  +     V+      +VSR   KL AA+E + I++ + + +D+G+STGGFT+ LL N    V+++DVG +QL+  L+ + K++S+EQT+ R  E   +  + D + ID SFIS+  +      L  +    +AL+KPQFE     G          H+ + ++   F + L   ++    S IKG    N E+  
  S:    11 RADILLVERGLFESRARAQAAIEAGLVFANDKQVAKASETIPIDAVVQAEPAHPWVSRGGVKLAAALERYGIEVEDHVCLDVGASTGGFTEALLANGAALVFAVDVGRDQLHPSLRDHPKIVSMEQTDIRSYEGKRLPQRPDIVVIDCSFISLKAVLPVALTLAASPMSLLALIKPQFEAKGAHGKGGIIKDAAVHRAVCDDIAAFAASLGCSDIEIFPSSIKGGDG-NAEFFL 243
>gi|16803406|ref|NP_464891.1| hypothetical protein lmo1366 [Listeria monocytogenes EGD-e] >gi|47095949|ref|ZP_00233552.1| hemolysin A [Listeria monocytogenes str. 1/2a F6854] >gi|153174471|ref|ZP_01929972.1| hemolysin A [Listeria monocytogenes FSL N3-165] >gi|153183726|ref|ZP_01934543.1| hemolysin A [Listeria monocytogenes J0161] >gi|153190762|ref|ZP_01938125.1| hemolysin A [Listeria monocytogenes J2818] >gi|16410782|emb|CAC99444.1| lmo1366 [Listeria monocytogenes] >gi|47015695|gb|EAL06625.1| hemolysin A [Listeria monocytogenes str. 1/2a F6854] >gi|126943378|gb|EBA21099.1| hemolysin A [Listeria monocytogenes J0161] >gi|127765746|gb|EBA26091.1| hemolysin A [Listeria monocytogenes J2818] >gi|133730075|gb|EBA31773.1| hemolysin A [Listeria monocytogenes FSL N3-165] (274 aa)
Score = 311, Expect = 5.5e-27, Identities = 79/246 (32%), Positives = 141/246 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-------YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R DI LV +    +R  A+      + ++ G +  K   +    +K+ I  E +       YVSR   KL+ A++ F+ ++ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ +++V  +E+TNFR ++ +   + + DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H+ ++ + ++F        +G   SPI G +  N E++ +L++  E+
  S:     3 IKKERADILLVEQGLFETREKAK------RAIMAGIVYRKEERVDKPGEKIPIDSELQVKGKQMPYVSRGGLKLEKALQVFDFEVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDDRVTVMERTNFRHVKPADFAEGLADFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIRDPAVHESVVEHIVQFALDNGYDLMGLDYSPITGGEG-NIEFIAHLKWTGEE 250
>gi|94497230|ref|ZP_01303802.1| hemolysin A [Sphingomonas sp. SKA58] >gi|94423335|gb|EAT08364.1| hemolysin A [Sphingomonas sp. SKA58] (245 aa)
Score = 311, Expect = 6.0e-27, Identities = 81/239 (33%), Positives = 126/239 (52%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           M K+R D  LV+   A SR  AQ LI    V +  + + K+   V     +++   +  +VSR   KL  A+E F ID+   +A+D+GSSTGGFT VLL +   KVY++D GTNQL  +L+ +++VI  EQT+ R +  + I + +D I  D SFIS+  +  K           +AL+KPQFE  + ++G          H ++     ++++       G   SPI G +  N E+L +
  S:     1 MAKVRADQLLVDAGLAESRARAQALILAGLVYLGDRKVEKAGQQVPADAALDLRGRDHPWVSRGGIKLAHALEAFAIDVTGFVAMDVGSSTGGFTDVLLTHGAAKVYAVDSGTNQLAWKLRSDDRVIVHEQTSARILTDAHIPEPVDIIVCDASFISLAKVLEKPIGFARPGAHLVALIKPQFEARREEVGKNGVVRDPAIHDRVCMEVQDWVASQGWTVAGLTQSPITGPQG-NIEFLLH 240
>gi|119025929|ref|YP_909774.1| hemolysin-like protein [Bifidobacterium adolescentis ATCC 15703] >gi|118765513|dbj|BAF39692.1| hemolysin-like protein with S4 domain [Bifidobacterium adolescentis ATCC 15703] (251 aa)
Score = 311, Expect = 6.0e-27, Identities = 82/236 (34%), Positives = 123/236 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNI----DLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNL-GYIVSPIKGAKKENTEYLFY 239
           +RLDI LV      SR  AQ LI + KV +NG + SK++  V   D ++    + YVSR AYKL  A + F+            +DIG+STGGF  VLL      V ++DVG  QL+ ++  N ++I +   N R++E+  +  +   I  DVSFIS+  +   I  +       + L+KPQFE+GK      G  ++E  +K   + +   +  N  ++    VSPI+G    N EYL Y
  S:     9 VRLDIALVERGVTDSRSKAQRLIESGKVRVNGTVASKASLKVTAADTLDADLGDDYVSRGAYKLVGAFDMFSQTGLRSAEGLDCLDIGASTGGFCDVLLRRGAAHVIALDVGHGQLDPRIAGNERIIEMSGVNIRDVEADDLPYRPSMIVSDVSFISLTYVIPVIARIAAPGAHVVLLVKPQFEVGKGNLGKNGIVESETLRKQALDTVTACAKANGLDVRATAVSPIEGTHG-NIEYLLY 248
>gi|157692925|ref|YP_001487387.1| hemolysin A [Bacillus pumilus SAFR-032] >gi|157681683|gb|ABV62827.1| hemolysin A [Bacillus pumilus SAFR-032] (284 aa)
Score = 310, Expect = 7.2e-27, Identities = 85/240 (35%), Positives = 135/240 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +K RLD+ LV +    +R  A+  I    V  N   + K    +     + +     KYVSR   KL+ A++ F++ +  K+ IDIGSSTGGFT   L+N   K Y++DVG NQL  +L+++++VI +E+TNFR    +   D + +  +IDVSFIS+ LI   +K +       IAL+KPQFE G+++   KG  +    H  ++    EF +    ++K++ +  SPI G    N E+L +L+
  S:     4 KKERLDVLLVEQGLMETREKAKRAIMAGIVYSNENRLDKPGEKIARDTPLTVKGNPLKYVSRGGLKLEKALKEFDLTVEGKLLIDIGSSTGGFTDCALQNGAVKSYAVDVGYNQLAWKLRQDDRVIVMERTNFRHSVPADFTDGLPEVASIDVSFISLKLILPALKHILVPGGDCIALVKPQFEAGRELVGKKGIVREPSVHLGVLEEMNEFAAKEGYDVKDVSF--SPITGGDG-NIEFLLHLK 245
>gi|86751559|ref|YP_488055.1| hemolysin A [Rhodopseudomonas palustris HaA2] >gi|86574587|gb|ABD09144.1| hemolysin A [Rhodopseudomonas palustris HaA2] (246 aa)
Score = 310, Expect = 7.2e-27, Identities = 72/234 (30%), Positives = 122/234 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    V  +G+ ++K +  +     ++      +VSR   KL  A+E + I + + + +D+G+STGGFT+VLL +    V+++DVG +QL+  L+ + +++S+E T+ R +E   +  + D + ID SFIS+ L+      L       +AL+KPQFE+  K G  +     E H+ +I++   F + L   ++    SPI G    N E+  
  S:    12 RADVVLVERGLFESRARAQAAIEAGLVFADGKQVTKVSEQIPLDAALDAQPAHPWVSRGGVKLAGALERYPIAIEDHVCLDVGASTGGFTEVLLADGAALVFAVDVGRDQLHPSLRGHPRIVSMEATDIRSLEGKRLPQRPDVVVIDASFISLKLVLPAALSLAAAPMSLLALIKPQFEVPSKHGIVR---DAEAHRAVIDDITAFAASLGCTDIAVFASPIAGGDG-NIEFFL 241
>gi|182704003|ref|ZP_02956416.1| hemolysin A [Methylocella silvestris BL2] >gi|172066870|gb|EDT52993.1| hemolysin A [Methylocella silvestris BL2] (255 aa)
Score = 310, Expect = 7.2e-27, Identities = 81/233 (34%), Positives = 122/233 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           R D+ LV      SR  AQ+ I    V I+G+ ++K +  +     +E      +VSR   KL AA++ F  D      +DIG+STGGF  VLL      + ++DVG  QL+  +  + +VIS E T+ R +E++ +     FITIDVSFIS+ L+   +  L   + K +AL+KPQFE G +   TKG  +    H ++       ++ L  +  G I SPI+G    N E+L
  S:    19 RADLALVARGLFESRAKAQEAIAAGLVRIDGKTVTKPSQTLAAEAHIEAEAPYPWVSRGGVKLAAALDAFGYDPRGLACLDIGASTGGFANVLLSRGALSLVAVDVGHGQLHSAIASDPRVISREDTDARSLEAASLPAAPQFITIDVSFISLALVLPPLTALAAESAKLVALIKPQFEAG-RFHVTKGLVRDPAVHAEVCARVKRLVASLGWRIDGLIPSPIEGGDG-NREFL 250
>gi|15604410|ref|NP_220927.1| hemolysin (tlyA) [Rickettsia prowazekii str. Madrid E] >gi|3861104|emb|CAA15004.1| HEMOLYSIN (tlyA) [Rickettsia prowazekii] (251 aa)
Score = 310, Expect = 7.2e-27, Identities = 95/237 (40%), Positives = 130/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELD---KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKI---INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+ +       +A+ LI   KV    + + KS   VN  D   KV+ L +  YVSR A KL  A+++F ID  N + IDIGSSTGGFT+VL E   + ++++DVG  +L+ +L+ N ++  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K      G       H+K+   I N++E      I   G I SPI G K  N E+L
  S:     1 MTKIRLDEYLLQKGLVTDIAIARSLIIQGKVHNKHEKLIKSGIKVNRHDPDIKVK-LPQHNYVSRGALKLITALDYFKIDPQNLVCIDIGSSTGGFTEVLFERKAELIFAVDVGYGELHSKLRFNPQIKVLEKTNARYLTDKQITTKPDLIVCDASFISLTTILPTPLNLAKEDCILIALIKPQFEVKKNEVENGGIITNPLLHQKVCDKIKNWLEQEHHFQI--FGIIASPILGTKG-NKEFL 240
>gi|124522051|ref|ZP_01696806.1| hemolysin A [Bacillus coagulans 36D1] >gi|124496345|gb|EAY43948.1| hemolysin A [Bacillus coagulans 36D1] (274 aa)
Score = 310, Expect = 7.5e-27, Identities = 86/240 (35%), Positives = 141/240 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVIN-------GQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K R+D+ LV      +R  A+  +    V  N       G+ I+    L+ + D +       YVSR   KL+ A++ F +++ +KI +DIG+STGGFT   L++  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +      K   +F +IDVSFIS++LI   +K L       +AL+KPQFE G++    KG  K ++ H+++I   I+       +++NL +  SPI G +  N E+L +L
  S:     1 MKKERVDVLLVERGLIETREKAKRAVMAGLVFSNETRLDKPGEKIAADAPLIVKGDPL------PYVSRGGLKLEKALKVFGLNVKDKIVLDIGASTGGFTDCALQHGAKMSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPQDFTKGIPEFASIDVSFISLSLILPVLKTLLAPLSDVVALIKPQFEAGREQVGKKGIVKDKNVHREVIEKIIQLALRENFSVENLSF--SPITGGEG-NIEFLIHL 242
>gi|168265875|ref|ZP_02687840.1| hemolysin A [Listeria monocytogenes FSL J2-071] (246 aa)
Score = 310, Expect = 8.2e-27, Identities = 68/188 (36%), Positives = 113/188 (60%)
  Q:    59 YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           YVSR   KL+ A++ F+ D+ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ +++V  +E+TNFR +  +   + + DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H  ++ N ++F        +G   SPI G +  N E++ +L++  E+
  S:    34 YVSRGGLKLEKALQVFDFDVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDDRVTVMERTNFRHVTPADFSEGLADFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIRDPAVHTSVVENIVQFALDNGYDLMGLDFSPITGGEG-NIEFIAHLKWTGEE 222
>gi|23501338|ref|NP_697465.1| hemolysin A [Brucella suis 1330] >gi|62289422|ref|YP_221215.1| TlyA, hemolysin A [Brucella abortus bv. 1 str. 9-941] >gi|82699349|ref|YP_413923.1| cell division protein FtsJ:RNA-binding S4:hemolysin A [Brucella melitensis biovar Abortus 2308] >gi|161618409|ref|YP_001592296.1| hemolysin A [Brucella canis ATCC 23365] >gi|189023673|ref|YP_001934441.1| Cell division protein FtsJ [Brucella abortus S19] >gi|23347229|gb|AAN29380.1| hemolysin A [Brucella suis 1330] >gi|62195554|gb|AAX73854.1| TlyA, hemolysin A [Brucella abortus biovar 1 str. 9-941] >gi|82615450|emb|CAJ10419.1| Cell division protein FtsJ:RNA-binding S4:Hemolysin A [Brucella melitensis biovar Abortus 2308] >gi|161335220|gb|ABX61525.1| hemolysin A [Brucella canis ATCC 23365] >gi|189019245|gb|ACD71967.1| Cell division protein FtsJ [Brucella abortus S19] (253 aa)
Score = 310, Expect = 8.2e-27, Identities = 89/234 (38%), Positives = 130/234 (55%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV   +  +R  A+D I    V ++G+ I+K   +V     + + +    YVSRAA KL AA++HF++++  + A+DIG+STGGFTQVLLE     V +IDVG +QL+E L+ + +V S E  N R +E + L    +D I  DVSFIS+ L       L         L+KPQFE G+    K G  +  A  E   + + +++E  +    + LG   SPI+G    N EYL 
  S:    11 RLDQLLVERGFFATRSRARDAIQRGTVKVDGRPITKPGQMVVRDAALAVDDPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVLLERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFISLRLALPPALALAEKGAICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKSWLE--TQPGWRALGLCPSPIEGGDG-NREYLL 247
>gi|114569403|ref|YP_756083.1| hemolysin A [Maricaulis maris MCS10] >gi|114339865|gb|ABI65145.1| hemolysin A [Maricaulis maris MCS10] (244 aa)
Score = 309, Expect = 9.9e-27, Identities = 84/234 (35%), Positives = 131/234 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +R D+YLV   +  +R  AQ  I   KV +NG  +SK +  +   D  +I+ E    +VSRAA KL A ++ F +D  +++ +D+GSSTGGFT+VLL    + VY++DVG +QL+  L+ + +V SLE T+ R +   +  +    +  D SFIS+  +  +   L       IAL+KPQFE+GK    K G  K  +  +D    +   +E L   ++  +  + SPI+G    N EYL
  S:     1 MRADLYLVEHGHFDTRARAQAAIAAGKVSVNGIKVSKPSQKI--ADGAQIIAEAAHPWVSRAALKLVAGLDGFGVDPADRVCLDVGSSTGGFTEVLLSRGARHVYAVDVGRDQLHASLQADRRVTSLEATDARSLAGEMFSEPPSLVVCDASFISLLKVIARPLALSAATSDLIALVKPQFEVGKALIGKGGLVKSDSARDDAVAAVRAGLEGLEGFSVHAV--MESPIEGGDG-NREYL 235
>gi|86157525|ref|YP_464310.1| hemolysin A [Anaeromyxobacter dehalogenans 2CP-C] >gi|85774036|gb|ABC80873.1| hemolysin A [Anaeromyxobacter dehalogenans 2CP-C] (246 aa)
Score = 308, Expect = 1.2e-26, Identities = 77/240 (32%), Positives = 138/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE---EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M++ R+D+ LV    A SR  AQ L+    VV+    + K   LV+    + + +    ++YVSR A KL+ A++ F +D   +   D+G+STGGFT +LL+    KVY++DVG  QL+ +L+ + +V+  E+ N R++ +  + ++++ +  D+SFIS+ LI   +K +     +++ L+KPQFE+GK      G  + +  ++   + I   ++ L  + +G+  SPI+G    N E+L  L
  S:     1 MKRERIDVLLVARGLAESRTRAQALVMAGAVVVGEARVDKPGQLVDPEAPIRLKDGAAPQRYVSRGALKLEKALDAFPVDPRGRTCADLGASTGGFTDLLLQRGAAKVYAVDVGYGQLHPRLRADARVVVRERENARQLTAETLGERVELVVGDLSFISLRLILPAVKAILRPGGQAVLLVKPQFEVGKGEVGKGGVVRDDGKRRAALDGIAAAAVELGFEVMGHAESPIEGPAG-NREWLLAL 243
>gi|167212217|ref|ZP_02282524.1| hypothetical protein LmonL_11941 [Listeria monocytogenes LO28] (313 aa)
Score = 308, Expect = 1.5e-26, Identities = 79/246 (32%), Positives = 141/246 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-------YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R DI LV +    +R  A+      + ++ G +  K   +    +K+ I  E +       YVSR   KL+ A++ F+ ++ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ +++V  +E+TNFR ++ +   + + DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H+ ++ + ++F        +G   SPI G +  N E++ +L++  E+
  S:    42 IKKERADILLVEQGLFETREKAK------RAIMAGIVYRKEERVDKPGEKIPIDSELQVKGKQMPYVSRGGLKLEKALQVFDFEVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDDRVTVMERTNFRHVKPADFAEGLADFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIRDPAVHESVVEHIVQFALDNGYDLMGLDYSPITGGEG-NIEFIAHLKWTGEE 289
>gi|148323142|gb|EDK88392.1| possible rRNA methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (266 aa)
Score = 307, Expect = 1.8e-26, Identities = 102/242 (42%), Positives = 150/242 (61%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK----YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           K+RLD YLV   Y  +  +A+  I    ++IN Q I K   +++ LDK++ +  ++    YVSR   KL+ AI  FN+D  +KI +DIG+STGGFT   L+N  K VY+IDVGTNQL+ +L+ +++V S+E  +  ++E + ++D ID I +D+SFISI  +  KIKEL  +N  +I L+KPQFE  ++    KG   + + HK++IN  IE   I  +      VSPI+G K  N EYL     KN
  S:     8 KMRLDEYLVENEYFENLEIAKRQIMVGNIIINEQKIDKPGEVIS-LDKIKSIRIKEKDIPYVSRGGLKLEKAINVFNLDFKDKIVLDIGASTGGFTDCSLQNGAKFVYAIDVGTNQLDWKLRNDSRVKSIENKHINDLEKNDLQDDIDIIVMDISFISIKKVLYKIKELLKDNGFAIFLIKPQFE-AERNEINKGIVDSLNVHKRVINEVIEEAKINQLFLENLTVSPIRGTKG-NIEYLAKFSNKN 251
>gi|145224093|ref|YP_001134771.1| hemolysin A [Mycobacterium gilvum PYR-GCK] >gi|145216579|gb|ABP45983.1| hemolysin A [Mycobacterium gilvum PYR-GCK] (268 aa)
Score = 307, Expect = 1.8e-26, Identities = 75/242 (30%), Positives = 131/242 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDK--VEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           ++ R+D  LV    ARSR  A +LI+  KV ++G   +K  T V+      VE  +E+ +VSR A+KL  A++ F + +  +  +D G+STGGFT+VLL  +V++V ++DVG  QL   ++ + +V  +E+TN R++ +  I   +D +  D+SFIS+  +   +          + ++KPQFE+GK ++G     +  +     + +     + LN   +    SP+ G    N EY  +L  +
  S:     3 RRARVDAELVRRGLARSRQQAAELISAGKVRVDGMPAAKPATAVSVTANLSVEAGDEDSWVSRGAHKLIGALDVFGLTVAGRRCLDAGASTGGFTEVLLSRDVREVVAVDVGYGQLAWSVRTDPRVTVMERTNVRDLTAEAIGGPVDLVVADLSFISLATVLPALAACASPGADIVPMVKPQFEVGKDRVGAGGVVSDPQLRVDAVLSVARRAASLNWHAVAVTASPLPGPAG-NVEYFLHLRAR 246
>gi|19704541|ref|NP_604103.1| hemolysin [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714827|gb|AAL95402.1| Hemolysin [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (266 aa)
Score = 307, Expect = 2.0e-26, Identities = 103/242 (42%), Positives = 146/242 (60%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL----EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           K+RLD YLV   Y  +  +A+  I    V++N + I K   ++  LDKV+ +    ++  YVSR   KL+ AI+ F++D  +KI +DIG+STGGFT   L+N  K VY++DVGTNQL+ +L+ + +V S+E  +   +E S +KD ID I +D+SFISI  +  KIKEL   N  +I L+KPQFE  K+    KG     + HK++IN  +E   I  +      VSPIKG K  N EYL     KN
  S:     8 KMRLDEYLVENKYFENLEIAKRQIMVGNVIVNERKIDKPGEII-LLDKVKSIRIKEKDSPYVSRGGLKLEKAIKVFDLDFKDKIILDIGASTGGFTDCSLQNGAKFVYAVDVGTNQLDWKLRNDCRVKSIENKHINNLEKSDLKDDIDIIVMDISFISIKKVLYKIKELSKENGFAIFLIKPQFE-AKRNEIEKGIVDDFNVHKRVINEVVEEAKIHQLFLENLTVSPIKGTKG-NIEYLAKFSKKN 251
>gi|158521672|ref|YP_001529542.1| hemolysin A [Desulfococcus oleovorans Hxd3] >gi|158510498|gb|ABW67465.1| hemolysin A [Desulfococcus oleovorans Hxd3] (252 aa)
Score = 307, Expect = 2.0e-26, Identities = 77/244 (31%), Positives = 134/244 (54%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEY--LFYLEY-KNEK 246
           K RLD  LV +  A +R  AQ +I    V+++     K+   V     +   +   YVSR   KL+  ++ F +D+  K+ +D+G+STGGFT  LL    ++V+++DVG  QL  +L+++ +V+ +E+TN R + +  +   +D +TID SFIS+ ++   +          +AL+KPQFE+GK      G  +    H++++++   +     +     +VSPI G K  N E+  LF L++ KN +
  S:     6 KKRLDQLLVEKGLAPTRQKAQAMIMAGAVLVDDHPADKAGVQVPVTAAIVTRDACPYVSRGGLKLEGGLDAFGLDVTGKVCLDVGASTGGFTDCLLTRGARRVFAVDVGYGQLAWKLRQDPRVVVIERTNIRHMAADALPCPVDLVTIDASFISLKIVMPAVVGFMKPEAVILALIKPQFEVGKGKVGKGGVVRDPGQHREVLDDLCRWAKTQGLWCADAVVSPITGPKG-NVEFFNLFGLDFSKNTR 252
>gi|51473737|ref|YP_067494.1| hemolysin [Rickettsia typhi str. Wilmington] >gi|51460049|gb|AAU04012.1| hemolysin [Rickettsia typhi str. Wilmington] (251 aa)
Score = 306, Expect = 2.2e-26, Identities = 89/237 (37%), Positives = 130/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEI--------LEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYL 237
           M KIRLD YL+       +G+  D+     ++I G++ +K   L+    KV I        L +  YVSR A KL  A+++F I+  N + IDIGSSTGGFT+VL E     ++++DVG   L+ +L+ N ++  LE+TN R +    I  K D I  D SFIS+  I      L   +   IAL+KPQFE+ K     +G  K    H+K+ +   ++L    + +  G I SPI G K  N E+L
  S:     1 MTKIRLDEYLLQ------KGLVTDITIARSLIIQGKVHNKHEQLIKSGMKVNIHDQDIKVKLPQHNYVSRGALKLITALDYFKIEPTNLVCIDIGSSTGGFTEVLFERKAALIFAVDVGYGALHSKLRYNPQIKVLEKTNARYLTDKQITTKPDLIVCDASFISLTTILPTPLNLAKEDCMLIALIKPQFEVKKNEVENRGIIKNPLLHQKVCDKIKDWLEQEHHFQIFGIIESPILGTKG-NKEFL 240
>gi|188584014|ref|YP_001927459.1| hemolysin A [Methylobacterium populi BJ001] >gi|179347512|gb|ACB82924.1| hemolysin A [Methylobacterium populi BJ001] (249 aa)
Score = 306, Expect = 2.2e-26, Identities = 78/236 (33%), Positives = 121/236 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +++R D +LV   + RSR  A+  I    V  +G ++++ + L+    ++E      YVSR   KL AA++ F +D      +D+G+STGGFT VLL      V+++DVG +QL+  L+ + +V SLE T+ R +    I+      TIDVSFI + L+   +           AL+KPQFE G+ ++G        E H ++       L  L     G I SPI+G    N E+L
  S:     4 ERLRADRFLVEHGHFRSRAQARAAIEAGLVRADGSLVTRPSDLIGAGARIEASAPHPYVSRGGLKLAAALDAFGLDPAGLRCLDVGASTGGFTDVLLRRGAAHVHAVDVGRDQLDAALRADPRVTSLEGTDIRTLAPGAIEPAPRLATIDVSFIGLRLVLPAVAAQLAGEAALAALIKPQFEAGRERVGRGGIVRDAEVHAEVCEGVRAVLVGLGFTVSGPIPSPIEGGDG-NREFL 239
>gi|152967093|ref|YP_001362877.1| hemolysin A [Kineococcus radiotolerans SRS30216] >gi|151361610|gb|ABS04613.1| hemolysin A [Kineococcus radiotolerans SRS30216] (270 aa)
Score = 306, Expect = 2.2e-26, Identities = 65/186 (34%), Positives = 109/186 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL---EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           ++++RLD  LV    ARSR  A +L+T  +V + G   +K  T V+    + +    EE++YVSR A+KL  A++ F +D+  +  +D G+STGGFT VLL      V ++DVG  Q+   L+ + +V  LE+TN R +E   +  +   +  D+SFIS+ L+   +      + + + ++KPQFE+G+
  S:     3 VRRLRLDAELVRRGLARSREHATELVTAGRVRVAGATAAKPATQVDVAAAILVEDAGEEDEYVSRGAHKLVGALDAFGVDVTGRRCLDAGASTGGFTDVLLRRGAAHVVAVDVGYGQIAWSLRTDERVTVLERTNVRTLEPEQVSPEPSLVVADLSFISLTLVLPALVRCVTPDAEHVLMVKPQFEVGR 191
>gi|15611407|ref|NP_223058.1| putative hemolysin [Helicobacter pylori J99] >gi|4154865|gb|AAD05917.1| putative hemolysin [Helicobacter pylori J99] (235 aa)
Score = 306, Expect = 2.3e-26, Identities = 82/240 (34%), Positives = 130/240 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +RLD  L N++ A SR  A+ L+   +V++N  ++SK + +V E D++E++    +VSRA  KL A +E   ID   K+ +D+G+S GGF+QV L    KKV  +DVG  QL+E LK + ++   E+ + R  ++    +KID    DVSFIS+  I   I  L   + + + L KPQFE+G+ I   K      D + I+N    F + L  K+   +       K +N    F++ +K
  S:     1 MRLDYALFNQHLANSREKAKALVLKKQVLVNKMVVSKPSFIVKEGDQIELIAPNLFVSRAGEKLGAFLEDHFIDFKEKVVLDVGASKGGFSQVALLKGAKKVLCVDVGKMQLDESLKNDQRIECYEECDIRGFKTP---EKIDLALCDVSFISLYCILEAILPL---SGEFLTLFKPQFEVGRTIKRNKK-GVVMDKEAILNALENFKNHLKTKDFQILTIQESLVKGKNGNVEFFIHFK 233
>gi|17228401|ref|NP_484949.1| hypothetical protein all0906 [Nostoc sp. PCC 7120] >gi|17130252|dbj|BAB72863.1| all0906 [Nostoc sp. PCC 7120] (242 aa)
Score = 306, Expect = 2.6e-26, Identities = 81/215 (37%), Positives = 116/215 (53%)
  Q:    31 VVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           + +N QII K  T V+   +V+I E  ++VSR   KL   +E F I +N ++ +D G STGGFT  LL+   K VY IDVG  Q +  L+ N +VI  E+TN R+++   +    D I D   +DVSFIS+  I   + +L     +++ L+KPQFE+GK     KG  +   D    I    +    L  K  G   SPI G    N EYL +L  ++E
  S:     1 MTVNEQIIDKPGTEVDVAAQVKIKERSRFVSRGGEKLAKGLELFAISVNGRVCLDGGISTGGFTDCLLQAGAKLVYGIDVGYGQTDWGLRNNPQVILRERTNLRQLQPKDLYGDGDAIPDLAVVDVSFISLTKILPALWQLTQPPREAVLLVKPQFEVGKSRVGKKGVVRDPHDQADAIFQVWQAAEKLGWKYKGLTWSPITGPAG-NIEYLLWLNMESE 219
>gi|46907592|ref|YP_013981.1| hemolysin A [Listeria monocytogenes str. 4b F2365] >gi|47093753|ref|ZP_00231503.1| hemolysin A [Listeria monocytogenes str. 4b H7858] >gi|153166753|ref|ZP_01927257.1| hemolysin A [Listeria monocytogenes FSL N1-017] >gi|153202205|ref|ZP_01943834.1| hemolysin A [Listeria monocytogenes HPB2262] >gi|167014639|ref|ZP_02277172.1| hemolysin A [Listeria monocytogenes FSL J1-194] >gi|167453985|ref|ZP_02320208.1| hemolysin A [Listeria monocytogenes FSL J2-064] >gi|46880860|gb|AAT04158.1| hemolysin A [Listeria monocytogenes str. 4b F2365] >gi|47017874|gb|EAL08657.1| hemolysin A [Listeria monocytogenes str. 4b H7858] >gi|133727377|gb|EBA29075.1| hemolysin A [Listeria monocytogenes FSL N1-017] >gi|133735488|gb|EBA37186.1| hemolysin A [Listeria monocytogenes HPB2262] (274 aa)
Score = 306, Expect = 2.6e-26, Identities = 78/242 (32%), Positives = 138/242 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-------YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEY 242
           ++K R DI LV +    +R  A+      + ++ G +  K   +    +K+ I  E +       YVSR   KL+ A++ F+ ++ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ +++V  +E+TNFR +  +   + + DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H+ ++ + ++F        +G   SPI G +  N E++ +L++
  S:     3 IKKERADILLVEQGLFETREKAK------RAIMAGIVYRKEERVDKPGEKIPIDSELQVKGKQMPYVSRGGLKLEKALQVFDFEVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDDRVTVMERTNFRHVTPADFSEGLADFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIRDPAVHESVVEHIVQFALDNGYDLMGLDFSPITGGEG-NIEFIAHLKW 246
>gi|114326886|ref|YP_744043.1| hemolysin [Granulibacter bethesdensis CGDNIH1] >gi|114315060|gb|ABI61120.1| hemolysin [Granulibacter bethesdensis CGDNIH1] (246 aa)
Score = 305, Expect = 2.7e-26, Identities = 79/237 (33%), Positives = 130/237 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYL 237
           M K R D  LV      SR  AQ +I    V    + I+K+  ++ E   +E+  ++  +VSR   KL   +EHF +    +I +D+G+STGGFT VLL +   KV+++DVG  QL  +L+ +++V+ LE+TN R +   SL  D+I+ +  D SFI +  +     E+      ++AL+KPQFE G++    KG  +     + +   I+  + ++ + + LG   SPI G +  N E+L
  S:     1 MAKKRADQLLVERGLTESRSRAQAVIMAGLVFSQERRIAKAGDMLPEEAPLELRGQDHPWVSRGGLKLAHGLEHFGLSPQGRICLDVGASTGGFTDVLLTHGALKVHAVDVGHGQLAWKLRSDDRVVVLEKTNARHLTPDSLGSDRIEVVVCDASFIGLRTVLPASLEMVAPGGWAVALIKPQFEAGREAIGAKGVVRDPAVHEAVCGMIQDWWQALPDWRVLGIEPSPITGPEG-NREFL 240
>gi|117924354|ref|YP_864971.1| hemolysin A [Magnetococcus sp. MC-1] >gi|117608110|gb|ABK43565.1| hemolysin A [Magnetococcus sp. MC-1] (251 aa)
Score = 305, Expect = 2.9e-26, Identities = 81/238 (34%), Positives = 123/238 (51%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFA-KTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD  L+    A S   A  LI   +V++  + + K    V E   + +    K   + SR   KL A ++ F ID    + +DIG+STGGFT +LL+    K+Y++DVG  QL  +L ++ +VI+LE+TN RE+   LI + ID +  DVSFIS++        L       + L+KPQFE  +    T G        ++ +     +L+    + +G+  SPIKG K  N EYL + 
  S:     7 KQRLDHLLIQLGLANSPAQALGLIMTGQVLVEDRPMFKPGEAVPESAAIRLKNSTKSRQWASRGGDKLVAGLDLFQIDPQGMVGLDIGASTGGFTDLLLQRGAAKIYAVDVGHGQLAWRLVQDARVINLERTNARELSPQLIPEPIDILVSDVSFISLSKALPAPLSLLKPGGLGVVLVKPQFEAPRAAVATGGVVLDLAVQQQCVARIAHWLTAQGCRVVGHTPSPIKGPKG-NQEYLLHF 247
>gi|51246266|ref|YP_066150.1| hemolysin A [Desulfotalea psychrophila LSv54] >gi|50877303|emb|CAG37143.1| related to hemolysin A [Desulfotalea psychrophila LSv54] (242 aa)
Score = 305, Expect = 3.4e-26, Identities = 81/238 (34%), Positives = 135/238 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKS-IALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           M+KIRLD  L+  N A S   A+  I   +V++N +   K+         V + ++  YVSR  +KL+ A+ +F+IDL  K+  DIG+S+GGFT  LL+++V KV+++DV   QL+ +++++++V+ LE+ N R +    + ++I+   +D SFISI  +   +  L        IAL+KPQFEL K +           H++ I+   +F++ L ++  G   SPI G K  N E+L 
  S:     1 MKKIRLDQLLLELNLAPSLEKARAYIGAGQVLVNDEPADKAGMTYPCQSAVRLRKKCPYVSRGGFKLEQALNYFSIDLAGKVCADIGASSGGFTDCLLQHDVGKVFAVDVAYGQLDWKIRQDDRVVVLERFNARNLLPESLGEEINLAVMDTSFISITKLIPALLPLFAKGCVDIIALIKPQFELPKGLIGNGVVRDPALHQQAIDKIKDFVAELGLQTAGITPSPILGPKG-NREFLL 238
>gi|158424732|ref|YP_001526024.1| hemolysin A [Azorhizobium caulinodans ORS 571] >gi|158331621|dbj|BAF89106.1| hemolysin A [Azorhizobium caulinodans ORS 571] (274 aa)
Score = 304, Expect = 3.6e-26, Identities = 79/236 (33%), Positives = 119/236 (50%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           + R+D  LV      SR  AQ  +   +V +NG +  K    V+E  ++E  +   YVSR   KL+A ++ F  ++  K A+D+GSSTGGFT VLL      V ++DVG +Q + +L+   +V   E T+ R +E + + + +D I  DVSFIS+ L+              +AL+KPQFE G      KG  K    H+ +       +  L  + LG   SPI+G    N E+L 
  S:    35 RARIDKLLVERGLFDSRARAQAAVLAGQVSVNGAVAKKPGQEVDEDAQIEARDLHPYVSRGGLKLEAGLDAFGFEVKGKRALDVGSSTGGFTDVLLTRGAASVVAVDVGHDQFHPRLRGRPEVRLFEGTDIRRLEPAQVGEPVDLIVSDVSFISLALVLPPALAFAAEQAALVALVKPQFEAGPA-HVRKGVVKDAAIHEAVCARVRGEVEGLGWRVLGLAPSPIEGGDG-NREFLL 269
>gi|57241144|ref|ZP_00369091.1| hemolysin A [Campylobacter lari RM2100] >gi|57018065|gb|EAL54840.1| hemolysin A [Campylobacter lari RM2100] (241 aa)
Score = 304, Expect = 3.8e-26, Identities = 99/241 (41%), Positives = 149/241 (61%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQI------ISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTK-GFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLEYKN 244
           +R D++ V++    SR  A +LI N ++++N +       I   N L +E  K+ +L E  YVSRAAYKLK  ++++ +++ +KI +DIGSSTGGF Q+LL+N  K++Y++DVG+NQL+E LK+N+++I  E T+ R+ +S +   K D I+ DVSFIS++ +   I +L   +   I L KPQFE+GK I   K G  K E    +  N  E        NLG+I+     S +KG  KE     FY   KN
  S:     2 MRYDVF-VSQKLNISRNKACELIENEQILLNDEFKKTSFKIISENPLEDESLKLTLLNE-FYVSRAAYKLKDFLQNYALEIKDKICLDIGSSTGGFVQILLQNQAKQIYALDVGSNQLHESLKENDEIIICENTDLRKFKSDI---KFDLISCDVSFISLSHLLFYIDKLAKKD--IILLFKPQFEVGKNIKRDKNGVVKDEKAIAMAKNKFE----KECANLGWILQYHQQSSLKG--KEGNVEFFYAYRKN 241
>gi|126653067|ref|ZP_01725202.1| hypothetical protein BB14905_10380 [Bacillus sp. B14905] >gi|126590168|gb|EAZ84292.1| hypothetical protein BB14905_10380 [Bacillus sp. B14905] (272 aa)
Score = 304, Expect = 4.0e-26, Identities = 85/238 (35%), Positives = 138/238 (57%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYL 240
           K R+DI LV      +R  A+  I    V  N   I K+   +     +++   + KYVSR   KL+ A++ F++ +  K+ +DIGSSTGGFT   L++  +  Y++DVG+NQL  +++ + +V  +E+TNFR   ++ + + + DF TIDVSFIS++LI   +K +       +AL+KPQFE GK     KG  +    KK+    +E  + +  + +G++V     SPI G +  N E+LF+L
  S:     6 KERVDILLVERGLCETREKAKRSIMAGLVFSNEIRIDKAGEKIAIDAPLQVKGSDLKYVSRGGLKLEKALQIFDMSVEGKLMLDIGSSTGGFTDCALQHGARHGYALDVGSNQLAWKIRSDERVTVMEKTNFRYTTAADLSEGLPDFATIDVSFISLSLILPVLKTVLLPGGDVMALVKPQFEAGKDKVGKKGIVRD---KKVHLEVLEKTAAMATE-IGFVVKDASYSPITGGEG-NIEFLFHL 245
>gi|153004004|ref|YP_001378329.1| hemolysin A [Anaeromyxobacter sp. Fw109-5] >gi|152027577|gb|ABS25345.1| hemolysin A [Anaeromyxobacter sp. Fw109-5] (252 aa)
Score = 304, Expect = 4.2e-26, Identities = 64/181 (35%), Positives = 108/181 (59%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE---EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQF 182
           ++ R+D+ LV    A SR  AQ L+    VV+    + K   LV+    V + E    ++YVSR A KL+ A++ F +D   KI  D+G+STGGFT VLL+    +VY++DVG  QL+ +L+ + +V+  E+ N R + +  +  +++ +T D+SFIS+ L+   ++ +      ++ L+KPQF
  S:     4 RRQRIDVVLVARGLAESRAKAQALVMAGAVVVGEARVDKPGALVDADAPVRLKEGAAPQRYVSRGALKLEKALDVFPVDPAGKICADLGASTGGFTDVLLQRGAARVYAVDVGYGQLHPKLRGDPRVVVRERENARALTAEALGTRVELVTGDLSFISLRLVLPAVRSILRPGGHAVLLVKPQF 187
>gi|90422659|ref|YP_531029.1| hemolysin A [Rhodopseudomonas palustris BisB18] >gi|90104673|gb|ABD86710.1| hemolysin A [Rhodopseudomonas palustris BisB18] (246 aa)
Score = 303, Expect = 4.6e-26, Identities = 70/237 (29%), Positives = 125/237 (52%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           +K R D+ LV      SR  AQ  I    V  +G+++ K++  V    +++      YVSR   KL  A+E + I++   + +D+G+STGGF++VLL+N  + V+++DVG  QL+  L  +  ++S+E T+ R ++   +  + D + ID SFIS+  +     +L  +    +AL+KPQFE  +K  + +G  K  + H+ + ++   + + L    +    S I G    N E+  
  S:     5 RKKRADVLLVERGLFESRARAQAAIEAGLVFADGKLVGKASEGVAADAELQAAPAHPYVSRGGVKLAGALERYPIEIEGHVCLDVGASTGGFSEVLLQNGARLVFAVDVGHGQLHASLHGHPNLVSMEGTDIRSLQGMRLPARPDVVVIDASFISLKAVLPAALDLAASPMWLLALIKPQFEAARK-HSKRGIIKDANVHQAVCDDIAAYAASLGCSEIAVFPSSIAGGDG-NIEFFL 240
>gi|16800471|ref|NP_470739.1| hypothetical protein lin1403 [Listeria innocua Clip11262] >gi|16413876|emb|CAC96634.1| lin1403 [Listeria innocua] (274 aa)
Score = 303, Expect = 5.0e-26, Identities = 78/246 (31%), Positives = 136/246 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++K R DI LV +    +R  A+  I    V    + + K    +    ++++  ++  YVSR   KL+ A++ FN D+ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ + +V  +E+TNFR +  +   + + +F TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +    H+ ++ N   F        +G   SPI G +  N E++ +L++  ++
  S:     3 IKKERADILLVEQGLFETREKAKRAIMAGIVYRKEERVDKPGEKIPADSELQVKGKQMPYVSRGGLKLEKALQVFNFDVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDERVTVMERTNFRHVTPADFTEGLAEFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIRDPAVHEAVVENIALFALDNGYDLMGLDFSPITGGEG-NIEFIAHLKWTGKE 250
>gi|94968074|ref|YP_590122.1| hemolysin A [Acidobacteria bacterium Ellin345] >gi|94550124|gb|ABF40048.1| hemolysin A [Acidobacteria bacterium Ellin345] (252 aa)
Score = 303, Expect = 5.2e-26, Identities = 79/239 (33%), Positives = 132/239 (55%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI------DFITIDVSFISINLIFNKI----KELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K+RLD  LV      SR  AQ +I   +V++N Q + K+   V +   + +L ++ +YV R   KL+ A++H+NI++  +  +DIG+STGGFT   L++    V ++D G  Q++ +L+ + +V  LE TN R +    +++        D   +DVSFIS  L+   +    ++      + + L+KPQFE+G+ KIG           +  +    E ++ L  + L  I SPI GA+  N E+L Y E
  S:     2 KVRLDKLLVERALVPSRERAQAMILAGRVLVNEQKVEKAGANVEDDSAIRLLGDDLRYVGRGGLKLERALQHWNIEVRGRTCMDIGASTGGFTDCFLQHGAAHVIAVDTGFGQIDAKLRADERVHLLELTNARYLTREQVEEVAPGRVLPDIAAMDVSFISATLVLPAVIAVLRDAPSERKQLVVLVKPQFEVGREKIGKGGIVRDAAAQQLALEKVKECVAELRGRGLDTIESPILGAEG-NREFLLYAE 251
>gi|56964226|ref|YP_175957.1| rRNA methylase [Bacillus clausii KSM-K16] >gi|56910469|dbj|BAD64996.1| rRNA methylase [Bacillus clausii KSM-K16] (270 aa)
Score = 303, Expect = 5.4e-26, Identities = 85/239 (35%), Positives = 133/239 (55%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-------EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEF-LSI-LNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           K RLD+ LV      +R  A+      + ++ G + S S  L     KV +        E+  YVSR   KL+ A++ F+  +  K+ +DIG+STGGFT   L++  + +Y++DVG NQL  +++++ +V  +E+ NFR    S   + I  F TIDVSFIS+ L+   +  +        AL+KPQFE GK     KG  +    H+++I +   F  SI  ++ NL Y  SPI G +  N E+L +L+
  S:     4 KERLDVLLVERGLCETREKAK------RTIMAGLVYSDSERLDKPGMKVAVDMPLRIKGEQMPYVSRGGLKLEKALQTFDFPIAGKVGLDIGASTGGFTDCALQHGAEHMYAVDVGYNQLAWKIRQDERVTVMERMNFRHAVPSDFGNGIPQFATIDVSFISLRLMLPPLFAIIATGGDVCALIKPQFEAGKDQVGKKGIVRDPAIHEQVIESIAAFSCSIGFDVVNLSY--SPITGGEG-NIEFLIHLQ 244
>gi|109947356|ref|YP_664584.1| hemolysin [Helicobacter acinonychis str. Sheeba] >gi|109714577|emb|CAJ99585.1| hemolysin [Helicobacter acinonychis str. Sheeba] (235 aa)
Score = 302, Expect = 6.1e-26, Identities = 83/240 (34%), Positives = 136/240 (56%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +RLD  L +++   SR  A+ LI  ++V++N  +ISK + +V E DK+E++    ++SRA  KL A +E++ ID   K+ +D+G+S GGF+++ L    KKV  +DVG  QL+E LKK+ +V   E+ + R  +++   +KID +  DVSFIS+  I   I  L   + + + L KPQFE+G+KI   K      D + I+N    F + L  K+   +       K +N    F++ +K
  S:     1 MRLDYALFDQHLVSSREKAKVLILKNQVLVNKIVISKPSFMVKENDKIELVATNLFISRAGEKLGAFLENYLIDFKEKVVLDVGASKGGFSEMALLKGAKKVLCVDVGKMQLDENLKKDKRVECYEECDIRAFKTT---EKIDLVLCDVSFISLYCILEAILPL---SHEFLVLFKPQFEVGRKIKRNKK-GVVVDKEAILNALENFKNHLKTKDFQILKIQESLVKGKNGNVEFFIHFK 233
>gi|113953905|ref|YP_731529.1| hemolysin A [Synechococcus sp. CC9311] >gi|113881256|gb|ABI46214.1| hemolysin A [Synechococcus sp. CC9311] (272 aa)
Score = 302, Expect = 6.9e-26, Identities = 86/240 (35%), Positives = 139/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVIN-GQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKIDFITI-DVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++K RLD++++    A SR  AQ LI   KV  + GQ++ K    V  L  +E++ E+  ++VSR   KL AA+E F + +  +  +D G STGGFT  LL++   +VY IDVG  Q    L+ + +V+  E+TN R + ++ +   +D++  + + DVSFIS++L+   I+  LK    +++ L+KPQFE+G+ ++G          H+  I + I     L    LG + SPI G    N EYL +L
  S:     2 VRKQRLDLHMLTLGLAASRQQAQQLIRAGKVRDHRGQLLDKPGQTV--LIDLELIVEQPPRFVSRGGEKLLAALEAFPVSVEGRTCLDGGISTGGFTDCLLQHGAHRVYGIDVGYGQTAWSLRIDERVVLRERTNLRRLTATELYGPEDELPTLAVADVSFISLSLVLPAIRALLKPQGSEALVLVKPQFEVGRDRVGKGGVVRDGLAHRDAIASVIASAHSLGWNALGVVGSPITGPAG-NHEYLLWL 247
>gi|148557362|ref|YP_001264944.1| hemolysin A [Sphingomonas wittichii RW1] >gi|148502552|gb|ABQ70806.1| hemolysin A [Sphingomonas wittichii RW1] (252 aa)
Score = 302, Expect = 7.0e-26, Identities = 77/234 (32%), Positives = 118/234 (50%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +R D  LV+     SR  AQ LI    V    + I K+   +     +E+   +  +VSR   KL   +EHF   +   +AID+GSSTGGFT VLL    ++VY++D GTNQL  +L+ + +V+  EQTN R + S  + + +D I  D SFIS+  +              +AL+KPQFE G+ ++G          H+++      ++     +  G   SPI G +  N E+L
  S:     5 VRADQLLVDRGLVESRSRAQALILAGLVFSGERKIEKAGQPIKPDAAIEVRGRDHPWVSRGGIKLAHGLEHFGWSVEGAVAIDVGSSTGGFTDVLLNGGARRVYAVDSGTNQLAWKLRNDPRVVVHEQTNARFLTSEHVPEPVDVIVCDASFISLAKVLAAPLGFARPGAHLVALIKPQFEAGREEVGKGGVVRDPAVHERVCAQVAAWIEGQGWQVAGVTASPITGPEG-NVEFL 239
>gi|108562786|ref|YP_627102.1| hemolysin [Helicobacter pylori HPAG1] >gi|107836559|gb|ABF84428.1| hemolysin [Helicobacter pylori HPAG1] (235 aa)
Score = 302, Expect = 7.0e-26, Identities = 80/240 (33%), Positives = 132/240 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +RLD  L N++   SR  A+ L+  ++V++N  ++SK + ++ E D++E++    +VSRA  KL A +E   ID   K+ +D+G+S GGF+QV L    KKV  +DVG  QL+E LK++ ++   E+ + R  ++    + ID    DVSFIS+  I   I  L   + + +AL KPQFE+G++I   K      D + I+N    F + L  K+   +       K +N    F++ +K
  S:     1 MRLDYALFNQHLVSSREKAKALVLKNQVLVNKMVVSKPSFIIKEGDQIELIAPNPFVSRAGEKLGAFLEEHFIDFKEKVVLDVGASKGGFSQVALLKGAKKVLCVDVGKMQLDESLKQDKRIECYEECDIRGFKTP---ETIDLALCDVSFISLYCILEAILPL---SDEFLALFKPQFEVGREIKRNKK-GVVMDKEAILNALENFKNHLKTKDFQILEIQESLVKGKNGNVEFFIHFK 233
>gi|17987780|ref|NP_540414.1| hemolysin [Brucella melitensis 16M] >gi|17983504|gb|AAL52678.1| HEMOLYSIN [Brucella melitensis 16M] (253 aa)
Score = 302, Expect = 7.2e-26, Identities = 88/234 (37%), Positives = 129/234 (55%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV   +  +R  A+D I    V ++G+ I+K   +V     + + +    YVSRAA KL AA++HF++++  + A+DIG+STGGFTQVLLE     V +IDVG +QL+E L+ + +V S E  N R +E + L    +D I  DVSFIS+ L       L         L+KP FE G+    K G  +  A  E   + + +++E  +    + LG   SPI+G    N EYL 
  S:    11 RLDQLLVERGFFATRSRARDAIQRGTVKVDGRPITKPGQMVVRDAALAVDDPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVLLERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFISLRLALPPALALAEKGAICALLVKPLFEAGREAIGKGGILRDPAYGERMAQELKSWLE--TQPGWRALGLCPSPIEGGDG-NREYLL 247
>gi|85717531|ref|ZP_01048476.1| hemolysin A [Nitrobacter sp. Nb-311A] >gi|85695648|gb|EAQ33561.1| hemolysin A [Nitrobacter sp. Nb-311A] (251 aa)
Score = 302, Expect = 7.2e-26, Identities = 74/234 (31%), Positives = 118/234 (50%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    V  +G+ ++K +  ++    +E      YVSR   KL  A+  + I + N + +D+G+STGGFT+VLL      V+++DVG +QL+  L+ + +V+S+E T+ R +E   +  + D + +D SFIS+  I      L       +AL+KPQFE   +    KG  +    H+ + N+   F + L   N+    SPI G    N E+  
  S:    14 RADVLLVERGLFESRARAQAAIQAGFVTADGKAVTKISETIDVNAAIEAQPAHPYVSRGGVKLAGALARYPIGIENHVCLDVGASTGGFTEVLLNEGASLVFAVDVGRDQLHPSLRNHPRVVSMESTDIRSLEGKRLPQRPDMVVMDASFISLKAILPVTLALAAAPMHLLALIKPQFE-APRTAIKKGIVRDAAVHRAVCNDIAAFAATLGCSNIEIFPSPITGGDG-NIEFFL 246
>gi|184201185|ref|YP_001855392.1| hypothetical protein KRH_15390 [Kocuria rhizophila DC2201] >gi|183581415|dbj|BAG29886.1| hypothetical protein [Kocuria rhizophila DC2201] (255 aa)
Score = 301, Expect = 9.1e-26, Identities = 72/198 (36%), Positives = 116/198 (58%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEI--LEEEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK 202
           RLD  L +   ARSR VA   I + KV +NG  ++K++T V+E D+VE+    E++Y SRAA+KL  A+E F ++D   +  +D G+STGGFT VLL    ++V ++DVG +QL  QL+ + +V   E  N R ++++ I    +    D+SFIS+ L+   +          + ++KPQFE+G    +  G   +E  ++
  S:     4 RLDRALTDRGLARSRTVAAGWIRDGKVSVNGAPVTKASTPVSEQDRVEVETSPEDEYASRAAHKLVGALECFSDVDPAGRRCLDAGASTGGFTDVLLRRGAREVVAVDVGHDQLVPQLRADPRVHVHEGLNVRYLDAAEIGGPAELTVCDLSFISLTLVVPTLAGATVPGGDLLLMVKPQFEVGVHNLSRTGVVTSERARQ 204
>gi|116492588|ref|YP_804323.1| rRNA methylase [Pediococcus pentosaceus ATCC 25745] >gi|116102738|gb|ABJ67881.1| Predicted rRNA methylase [Pediococcus pentosaceus ATCC 25745] (272 aa)
Score = 301, Expect = 9.8e-26, Identities = 83/241 (34%), Positives = 142/241 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSI--LNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           M K R+D+ LV +    +R  A+  +   +++  N + + K    ++   K+ +  +   YVSR   KL+ A++ F +D+     +DIGSSTGGFT V+L+N  K  Y++DVGTNQL  +L+++ +V+ +E TNFR  +     + + +F +IDVSFIS+ LI   +K +   +   ++L+KPQFE G++     G  +    H++++ N +   +    N+K L +  SPIKG +  N E+L +LE
  S:     1 MAKERVDVLLVEQGLFDTREKAKRAVMAGEILGDNEERLDKPGVKIDPSVKLHLKGKPMPYVSRGGLKLEKALKVFGLDVKGLTVLDIGSSTGGFTDVMLQNGAKLSYALDVGTNQLVWKLREDPRVVVMENTNFRYSKLEDFTEGQPEFASIDVSFISLKLILPALKNIIKTHGSVVSLIKPQFEAGRENVGKHGIVRDRKVHEEVLKNVLAMANAEGFNVKGLDF--SPIKGGEG-NIEFLAWLE 244
>gi|23099331|ref|NP_692797.1| hemolysin [Oceanobacillus iheyensis HTE831] >gi|22777560|dbj|BAC13832.1| hemolysin [Oceanobacillus iheyensis HTE831] (269 aa)
Score = 300, Expect = 1.1e-25, Identities = 79/244 (32%), Positives = 139/244 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           +K R D  LV      +   A+  I    V      I K  T+++    + + +++  YV R   KL+ A++ F++D+++K+ +D+GSSTGGFT   L++   K Y+IDVG NQL+ +L+ +++VI +E+TNF+++   L+   + +F++IDVSFIS+  IF  + ++   N   IAL+KPQFE  ++    KG  +    H ++++  + +        L    SPI G +  N E+L +L ++ E
  S:     3 KKKRADELLVERELVENIDKARRSIMAGIVFTENDRIDKPGTIISVETPLRVKQKDNPYVGRGGKKLEKALQEFDVDVSDKLFMDVGSSTGGFTDCALQHGAIKSYAIDVGYNQLDWKLRNDHRVIVMERTNFKDVTPELLNHGLPNFVSIDVSFISLKHIFPVLNKILQPNSDIIALIKPQFEAKREQVGEKGIIRDPAVHHEVLDKVMMYARESGFSLLNLTYSPITGTEG-NIEFLVHLGWEKE 248
>gi|163795881|ref|ZP_02189845.1| Predicted rRNA methylase [alpha proteobacterium BAL199] >gi|159178914|gb|EDP63450.1| Predicted rRNA methylase [alpha proteobacterium BAL199] (250 aa)
Score = 300, Expect = 1.1e-25, Identities = 81/235 (34%), Positives = 126/235 (53%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLS------ILNIKNLGYIVSPIKGAKKENTEYL 237
           K RLD  LV+     SR  AQ L+    V    + + K+   V E   +++  ++  +VSR   KL  A+E F ID    +A+D+G+STGGFT VLL N   KVY++DVG  QL  +L+ + +V+ LE+TN R + +  + + ID +  D SFIS+  +      L     +  AL+KPQFE G+ ++G        E H+ +  +   +L       + + +  G   SPI G +  N E+L
  S:     2 KRRLDQLLVDRGLVESRSRAQALVMAGLVFSGERKLEKAGLQVAEDIALDVRGQDHPWVSRGGLKLAHALEEFAIDPTGFVALDVGASTGGFTDVLLTNGAVKVYAVDVGHGQLAWKLRSDPRVVVLEKTNARHLTAEQVPEPIDMVVCDASFISLRTVLPAPLALARVGARLAALIKPQFEAGREQVGKGGVVRDPEVHEAVCADIRRWLDGASGGVMSDWRVDGITRSPITGPEG-NVEFL 243
>gi|116071316|ref|ZP_01468585.1| Hemolysin A [Synechococcus sp. BL107] >gi|116066721|gb|EAU72478.1| Hemolysin A [Synechococcus sp. BL107] (267 aa)
Score = 299, Expect = 1.3e-25, Identities = 80/238 (33%), Positives = 127/238 (53%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVIN-GQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----FITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ LV      SR  AQ LI   KV    G ++ K    V +  ++++    ++VSR   KL A +E F + ++ +I +D G STGGFT  LL++  K+VY IDVG  Q    L+ +++V+  E+TN R ++   +  + D        DVSFIS+ LI   ++  L+ +  +++ L+KPQFE+G+ ++G          H   I   +     L+    G + SPI G    N EY+ +L
  S:     4 KQRLDLELVARGLVASRQQAQQLIRAGKVRDGVGTVLDKPGHDVKDSLQLQVEHPPRFVSRGGEKLLAGLEAFPVAVDERICLDGGISTGGFTDCLLQHGAKRVYGIDVGYGQTAWSLRTDDRVVLRERTNLRHLQPEALYGEADPWPTLAVTDVSFISLRLILPALRRLLRGSEAEALVLVKPQFEVGRDRVGRGGVVRDPAAHCDAIGTVVAAAQTLDWHPQGIVASPITGPAG-NHEYVLWL 247
>gi|15608832|ref|NP_216210.1| cytotoxin/hemolysin TlyA [Mycobacterium tuberculosis H37Rv] >gi|15841151|ref|NP_336188.1| cytotoxin/hemolysin [Mycobacterium tuberculosis CDC1551] >gi|31792880|ref|NP_855373.1| cytotoxin [Mycobacterium bovis AF2122/97] >gi|121637601|ref|YP_977824.1| cytotoxin/hemolysin TlyA [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148661491|ref|YP_001283014.1| cytotoxin/hemolysin [Mycobacterium tuberculosis H37Ra] >gi|148822900|ref|YP_001287654.1| cytotoxin|haemolysin tlyA [Mycobacterium tuberculosis F11] >gi|167969188|ref|ZP_02551465.1| cytotoxin|haemolysin tlyA [Mycobacterium tuberculosis H37Ra] >gi|194543941|ref|YP_002078970.1| cytotoxin|haemolysin tlyA [Mycobacterium tuberculosis C] >gi|2326737|emb|CAB10951.1| CYTOTOXIN|HAEMOLYSIN HOMOLOGUE TLYA [Mycobacterium tuberculosis H37Rv] >gi|2370317|emb|CAA66941.1| cytotoxin /haemolysin homologue [Mycobacterium tuberculosis] >gi|13881370|gb|AAK46002.1| cytotoxin/hemolysin [Mycobacterium tuberculosis CDC1551] >gi|31618470|emb|CAD96388.1| CYTOTOXIN|HAEMOLYSIN HOMOLOGUE TLYA [Mycobacterium bovis AF2122/97] >gi|121493248|emb|CAL71719.1| Cytotoxin|haemolysin homologue tlyA [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600948|gb|EAY59958.1| cytotoxin|haemolysin tlyA [Mycobacterium tuberculosis C] >gi|134150047|gb|EBA42092.1| cytotoxin|haemolysin tlyA [Mycobacterium tuberculosis str. Haarlem] >gi|148505643|gb|ABQ73452.1| cytotoxin/hemolysin [Mycobacterium tuberculosis H37Ra] >gi|148721427|gb|ABR06052.1| cytotoxin|haemolysin tlyA [Mycobacterium tuberculosis F11] (268 aa)
Score = 299, Expect = 1.5e-25, Identities = 78/245 (31%), Positives = 127/245 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++ R+D  LV    ARSR  A +LI   KV I+G    K  T V++   + ++   E  +VSR A+KL  A+E F I +  +  +D G+STGGFT+VLL+     V + DVG  QL   L+ + +V+ LE+TN R +    I  ++D +  D+SFIS+  +   +      +   + L+KPQFE+GK ++G        +   + +         L   ++G   SP+ G    N EY  +L  + ++
  S:     3 RRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSG-NVEYFLWLRTQTDR 249
>gi|162456596|ref|YP_001618963.1| hypothetical protein sce8313 [Sorangium cellulosum 'So ce 56'] >gi|161167178|emb|CAN98483.1| unnamed protein product [Sorangium cellulosum 'So ce 56'] (252 aa)
Score = 298, Expect = 1.8e-25, Identities = 68/187 (36%), Positives = 106/187 (56%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHF---NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           M ++R D  LV    A SR  AQ LI   KV    + I K  TL+ E  +V +    ++VSR   KL+ A+  F    +D+  K  +D+G+STGGFT  LL+    +V+++DVG  QL  +L+ + +V   ++ N RE++       ID + +D SFISI+ + + I  L   +   +AL+KPQFE G++
  S:     1 MTRVRADALLVARKLAGSRTEAQALIMAGKVTSGPRRIDKPGTLLPEDAEVHVASGPRFVSRGGEKLEHALAAFAAHGLDVAGKTCVDVGASTGGFTDCLLQRGAARVFAVDVGYGQLAAKLRADARVEVRDRVNARELQREDFDVPIDLVVVDASFISISRLIDAIARLLPPSGDLVALIKPQFEAGRE 190
>gi|15827705|ref|NP_301968.1| cytotoxin/hemolysin [Mycobacterium leprae TN] >gi|2065225|emb|CAB08287.1| hypothetical protein MLC1351.14c [Mycobacterium leprae] >gi|13093256|emb|CAC31739.1| cytotoxin/hemolysin [Mycobacterium leprae] (269 aa)
Score = 298, Expect = 1.8e-25, Identities = 65/185 (35%), Positives = 109/185 (58%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           +++R+D+ LV    ARSR  A  LI+  KV I+G    K +T V     + + +  E  +VSR A+KL  A++ F I +  +  +D G+STGGFT+VLL+    +V ++DVG  QL   ++ + +VI +E+TN  ++   LI   +D +  D+SFIS+  + + +      +   + ++KPQFE+GK
  S:     3 RRVRVDVELVRRGLARSRQQAAKLISAGKVSIDGLPAVKPSTAVAITTVLTVADDGERSWVSRGAHKLMGALDTFGIPVAGRCCLDAGASTGGFTEVLLDRGAAEVVAVDVGYGQLAWSVRCDPRVIVVERTNVHDLSPELIGGPVDLVVADLSFISLATVLSALAGCALPSADIVPMVKPQFEVGK 189
>gi|188527169|ref|YP_001909856.1| hemolysin [Helicobacter pylori Shi470] >gi|188143409|gb|ACD47826.1| hemolysin [Helicobacter pylori Shi470] (235 aa)
Score = 298, Expect = 2.0e-25, Identities = 80/240 (33%), Positives = 131/240 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +RLD  L N++   SR  A+ L+  ++V++N  ++SK + +V E DK+E++    +VSRA  KL A +E   +D   K+ +D+G+S GGF++V L    KKV  +DVG  QL+E L+ + ++   E+ + RE ++    + ID +  DVSFIS+  I   I  L   + + +AL KPQFE+G+     K      D K I+N    F + L  K+   +       K +N    F++ +K
  S:     1 MRLDYALFNQHLVNSREKAKALVLKNQVLVNKMVVSKPSFIVKEGDKIELIATNLFVSRAGEKLAAFLETHFVDFKEKVVLDVGASKGGFSEVALLKGAKKVLCVDVGKMQLDENLRNDTRIECHEECDIREFKTP---ETIDLVLCDVSFISLYCILEAILPL---SDEFLALFKPQFEVGRATKRNKK-GVVVDKKAILNALENFKNHLKTKDFQILKIQESLVKGKNGNVEFFIHFK 233
>gi|29375564|ref|NP_814718.1| hemolysin A [Enterococcus faecalis V583] >gi|29343025|gb|AAO80788.1| hemolysin A [Enterococcus faecalis V583] (271 aa)
Score = 297, Expect = 2.6e-25, Identities = 86/240 (35%), Positives = 137/240 (57%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN---ELDKVEILEEEK-----YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFL--SILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K R+D+   N+    +R  A+      + V+ G + +  N  ++   E   VE     K     YVSR   KL+ A+  F I++  K  +DIGSSTGGFT V L+N  +  Y++DVG NQL  +++++ +V+ +E+TNFR  +     + + D  TIDVSFIS+ LI   + ++       +AL+KPQFE GK+    KG  +  E H+ ++     F   +  ++KNL +  SPI G +  N E+L +L
  S:     1 MKKERVDVLAFNQGLFETREKAK------RSVMAGLVYNDKNERLDKPGEKISVETPLHTKGQVMPYVSRGGLKLEKALNVFAINVQGKTMLDIGSSTGGFTDVALQNGARLSYALDVGYNQLAWKIRQDERVVVMERTNFRYSKPEDFTEGVPDIATIDVSFISLRLILPPLHDILKKGGSVVALIKPQFEAGKEFVGKKGIVRDPETHQMVVEEITRFAMNNGYDVKNLDF--SPITGGEG-NIEFLAHL 243
>gi|34499756|ref|NP_903971.1| hemolysin [Chromobacterium violaceum ATCC 12472] >gi|34105607|gb|AAQ61961.1| probable hemolysin [Chromobacterium violaceum ATCC 12472] (248 aa)
Score = 297, Expect = 2.7e-25, Identities = 74/236 (31%), Positives = 135/236 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-----DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE-FLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           IR+DI LV +  A SR  AQ+L+   +V   G +++K +         +I+ +E  +YVSR   K++ A++   +++    A+D+G STGGFT  LL+   ++V  +DVG +QL+ +++++ +V   E  N R ++ + +      D  D +  DVSFIS++L+      L     + ++L+KPQFE+G++  +  G  + E    ++ + I+  L+  N++ L +  SPIKG    N E+  +
  S:     2 IRVDILLVEQGLAASRTAAQNLVAAGRVSCRGAVVAKPSQKFPADAAFDIVADEADRYVSRGGLKMRGALDAAGLEIAGWTALDVGQSTGGFTDCLLQAGARRVVGVDVGHDQLHPRMREDARVRYFEGVNARALDRAALLAANDGDGFDLMVCDVSFISLSLVLPSALPLLKPGGRLLSLVKPQFEVGREGLSKGGIVRDETLYPLVRDKIDRVLAEQNMQTLAWFDSPIKGGDG-NREFFVH 244
>gi|78779941|ref|YP_398053.1| hemolysin A [Prochlorococcus marinus str. MIT 9312] >gi|78713440|gb|ABB50617.1| hemolysin A [Prochlorococcus marinus str. MIT 9312] (270 aa)
Score = 296, Expect = 3.2e-25, Identities = 93/245 (37%), Positives = 137/245 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI----DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL--NIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           ++K RLD+YL+N+    +R  AQ LI   KV  ING+++ K    V    +  I  E  +VSR   KL  A +   I + +KI +D G STGGFT  LL+   K VY IDVG  Q   +++ N KVI  E+TN R+++ + +  +     +F+  D+SFIS+ L+F  I   L+ +  + I L+KPQFE+GK   +  G  +    H + I   I        NIKNL  I SP+ G    N EYL ++  ++E
  S:     2 IKKSRLDLYLLNKGLCETRQKAQGLILAGKVRDINGKVLDKPGQQVLIGSEFFIDSEPMFVSRGGEKLLEAFKKLEIKVKDKICLDAGISTGGFTDCLLQQGAKLVYGIDVGYGQTAWKIRNNPKVILFERTNIRKLKPNDLLSRSNELPNFVVADLSFISLKLVFKSIGNLLEGDCIEGIFLIKPQFEVGKDKVSKGGVVRNPKFHTEAIEAVIYAAENFQWNIKNL--IASPLVGPAG-NHEYLAWMCLRSE 252
>gi|33862020|ref|NP_893581.1| rRNA methyltransferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33634238|emb|CAE19923.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (270 aa)
Score = 296, Expect = 3.3e-25, Identities = 91/240 (37%), Positives = 133/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI-------ESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNW-KSIALLKPQFELGKKIGTTKGFA-KTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++K RLD+YL+ +    +R  AQ LI   KV  ING+I  K    V    +  I  E ++VSR   KL  A +   I++ +++ ID G STGGFT  LL+   K VY IDVG  Q   +L+KN KV   E++N R +       E SL+    +F+ +D+SFIS+ L+   I  L   ++ + I L+KPQFE+GK   +  G   K E H + I + I   + L     G + SP+ G    N EYL ++
  S:     2 IKKSRLDLYLIYKGLCETRQKAQGLILAGKVKDINGKIFDKPGQQVLIGTEFIIESEPQFVSRGGEKLLEAFKKLKINVKDRVCIDAGISTGGFTDCLLQQGAKMVYGIDVGYGQTAWKLRKNPKVKLFERSNIRNLKPLDIYSEESLLP---NFVVVDLSFISLKLVLQPINNLLSGDFIEGIFLIKPQFEVGKDRVSKGGVVRKAEYHIEAIESVINAANQLQWNIQGLVASPLVGPAG-NHEYLAWM 247
>gi|85374499|ref|YP_458561.1| hemolysin HlyA [Erythrobacter litoralis HTCC2594] >gi|84787582|gb|ABC63764.1| Hemolysin HlyA [Erythrobacter litoralis HTCC2594] (247 aa)
Score = 296, Expect = 3.5e-25, Identities = 80/235 (34%), Positives = 127/235 (54%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQI-ISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           K R+D  LV    A SR  AQ L+  + +V +G+  I+K    + E   VE+   +  +VSR   KL  A+EHF +D     A+D+GSSTGGFT VLL+N    V ++D GTNQL  +L+++ +V  +EQT+ R +   +I     ++  D SFI +  +      L     + +AL+KPQFE+G+ ++G          H ++ ++   +L   +    G + SPI G +  N E+L
  S:     4 KQRIDQLLVARGLAESRTRAQALVM-AGIVFSGETKIAKPGQQLPEDAPVEVRGRDHPWVSRGGLKLAHALEHFELDPAGVTAMDVGSSTGGFTDVLLKNGAAHVIAVDSGTNQLAWKLRQDERVSVMEQTSARILTREMIPQPYSWVVCDASFIGLAKVLEVPLALAETQCQLVALIKPQFEVGRDEVGKGGVVRDPSLHARVCDDVRGWLEGESWHVKGIVESPITGPEG-NVEFL 239
>gi|33863749|ref|NP_895309.1| rRNA methyltransferase [Prochlorococcus marinus str. MIT 9313] >gi|33635332|emb|CAE21657.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. MIT 9313] (267 aa)
Score = 296, Expect = 3.7e-25, Identities = 80/239 (33%), Positives = 136/239 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVI-NGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKIDFITI-DVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
            K RLD+ L+ +  A SR  AQ LI   KV   NGQ++ K    V++  ++++ +  ++VSR   KL  A+  F +++  ++ +D G STGGFT  LL++   +VY IDVG  Q    L+ +++V+  E+TN R +    +   ++ +  + + D++FIS+ L+   IK+ LK ++ +++ L+KPQFE+G+ ++G          H   + + I+    L     G I SPI G    N EYL +L
  S:     3 HKQRLDLQLLMKGLASSRHQAQQLIRAGKVRDGNGQLLDKPGHEVSQELELQVEQPPRFVSRGGEKLLGALREFPLNVEGRVCLDGGISTGGFTDCLLQHGAARVYGIDVGYGQTAWNLRNDSRVVLRERTNLRTLSPDQLYGAEEPLPSLAVADLAFISLRLVLPAIKKLLKPDHSEAVLLVKPQFEVGRERVGKGGVVRDALAHVDALKSVIDTSRSLGWWPKGLIASPITGPAG-NHEYLLWL 247
>gi|163842717|ref|YP_001627121.1| hemolysin A [Brucella suis ATCC 23445] >gi|163673440|gb|ABY37551.1| hemolysin A [Brucella suis ATCC 23445] (238 aa)
Score = 295, Expect = 3.8e-25, Identities = 85/229 (37%), Positives = 127/229 (55%)
  Q:    10 LVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           +V   +  +R  A+D I    V ++G+ I+K   +V     + + +    YVSRAA KL AA++HF++++  + A+DIG+STGGFTQVLLE     V +IDVG +QL+E L+ + +V S E  N R +E + L    +D I  DVSFIS+ L       L         L+KPQFE G+    K G  +  A  E   + + +++E  +    + LG   SPI+G    N EYL 
  S:     1 MVERGFFATRSRARDAIQRGTVKVDGRPITKPGQMVVRDAALAVDDPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVLLERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFISLRLALPPALALAEKGAICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKSWLE--TQPGWRALGLCPSPIEGGDG-NREYLL 232
>gi|154248083|ref|YP_001419041.1| hemolysin A [Xanthobacter autotrophicus Py2] >gi|154162168|gb|ABS69384.1| hemolysin A [Xanthobacter autotrophicus Py2] (266 aa)
Score = 295, Expect = 4.0e-25, Identities = 78/235 (33%), Positives = 125/235 (53%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           ++R+D  LV      SR  AQ  +    V ++G +++K +  V    ++E  +   +VSR A KL A ++ F ID   K+A+D+G+STGGFT+VLL    +KVY++DVG +Q + +L    +V  +E T+ R +      + +D + +DVSFIS+ L+              +AL+KPQFE G+     KG  +    H+         ++ L  + LG I SPI+G    N E+L
  S:    23 RMRIDRLLVERGLFESRARAQAALAAGLVRVDGVVVAKPSAEVAADARIEAADVHDFVSRGALKLTAGLDAFGIDPAGKVALDVGASTGGFTEVLLRRGARKVYAVDVGRDQFHPRLAARPEVHLMEGTDIRALSRDAAPEPVDLVVVDVSFISLALVLPAALAFAGKEAHLVALVKPQFEAGRA-NVRKGVVRDAAVHEACCTRVEGEIAALGWRLLGRIASPIEGGDG-NREFL 256
>gi|166368024|ref|YP_001660297.1| hemolysin-like protein [Microcystis aeruginosa NIES-843] >gi|166090397|dbj|BAG05105.1| hemolysin-like protein [Microcystis aeruginosa NIES-843] (238 aa)
Score = 295, Expect = 4.3e-25, Identities = 74/208 (35%), Positives = 114/208 (54%)
  Q:    33 INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +N QII K  T ++    +E+ ++  Y+SR   KL  A+E F ID+  +I +D G STGGFT  LL+   K+VY +DVG  Q+   L+++ +VI LE+TNFR +    +   +   D   +D+SFIS+  +   +  L     ++I L+KPQFE+G++    KG  +  +D    I   ++    L     G   SPI G    N EYL +L
  S:     3 VNHQIIDKPATEIDPEAAIEVKQKLPYLSRGGEKLAKALELFAIDVRERICLDGGISTGGFTDCLLQKGAKRVYGVDVGYGQVAWSLRQDERVILLERTNFRYLTPEKLYGQEKPADLAVMDLSFISLTKVLPTLWTLLNPPREAILLVKPQFEVGREKVGKKGVVRDHQDQAGAIFQVLQAAEALGWFYRGLTWSPITGPAG-NVEYLLWL 213
>gi|92116387|ref|YP_576116.1| hemolysin A [Nitrobacter hamburgensis X14] >gi|91799281|gb|ABE61656.1| hemolysin A [Nitrobacter hamburgensis X14] (251 aa)
Score = 295, Expect = 4.9e-25, Identities = 73/238 (30%), Positives = 119/238 (50%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           + + R D+ LV      SR  AQ  I    V  NG++++K +  +     +       YVSR   KL  A+E + I++ N + +D+G+STGGFT+VLL      V+++DVG +QL+  L+ + +V+S+E T+ R  E   +  + D + +D SFIS+  I      L       +AL+KPQFE   +    KG  +    H+ + ++   F + L    +    SPI G    N E+  
  S:    10 LARKRADVLLVERGLFESRARAQAAIEAGLVTANGKVVTKVSETIPVDATLTAQPAHPYVSRGGVKLAGALERYPIEIENHVCLDVGASTGGFTEVLLAGGAGLVFAVDVGRDQLHPSLRGHPRVVSMESTDIRSFEGKRLPQRPDVVVMDASFISLKAILPVALALAAAPMHLLALIKPQFE-APRAAIKKGIVRDAAVHRAVCDDIAAFAATLGCTEIDVFPSPITGGDG-NIEFFL 246
>gi|118617311|ref|YP_905643.1| cytotoxin/hemolysin, TlyA [Mycobacterium ulcerans Agy99] >gi|7340781|emb|CAB83047.1| putative haemolysin [Mycobacterium ulcerans] >gi|118569421|gb|ABL04172.1| cytotoxin/hemolysin, TlyA [Mycobacterium ulcerans Agy99] (281 aa)
Score = 294, Expect = 5.9e-25, Identities = 77/245 (31%), Positives = 128/245 (52%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++ R+D  LV    ARSR  A +LI+  KV I+G    K  T V     + +    E  +VSR A+KL  A++ F ID++ +  +D G+STGGFT+VLL+    +V + DVG  QL   L+ + +VI +E+TN R++  + I  ++D +  D+SFIS+  +   +      +   + ++KPQFE+GK ++G              + +       L    +G   SP+ G    N EY  +L  + ++
  S:     3 RRTRVDAELVRRGLARSRQQAAELISAGKVRIDGLPAVKPATAVAATAALTVAADSERGWVSRGAHKLIGALDAFGIDVHGRRCLDAGASTGGFTEVLLDRGAAEVVAADVGYGQLAWSLRTDPRVIVIERTNVRDLSPAAIGGQVDLVVADLSFISLTTVLPALAACALPHADIVPMVKPQFEVGKGQVGAGGVVQDPALRAGAVLSVARRAGELGWHTVGVTASPLPGPSG-NVEYFLWLRAQTDR 249
>gi|91070167|gb|ABE11088.1| FtsJ cell division protein:S4 domain:Hemolysin A [uncultured Prochlorococcus marinus clone HF10-11D6] (270 aa)
Score = 293, Expect = 6.7e-25, Identities = 93/245 (37%), Positives = 136/245 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI----DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL--NIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           ++K RLD+YL+N+    +R  AQ LI   KV  ING+++ K    V    +  I     +VSR   KL  A +   I + +KI ID G STGGFT  LL+   K VY IDVG  Q   +++ N KVI  E+TN R ++ + +  +     +F+  D+SFIS+ L+F  I   L+ +  + I L+KPQFE+GK+  +  G  +    H + I + I        NIKNL  I SP+ G    N EYL ++   N+
  S:     2 IKKTRLDLYLLNKGLCETRQKAQGLILAGKVRDINGKVLDKPGQQVLIGSEFFIDSAPMFVSRGGEKLLEAFKKLEIKVKDKICIDAGISTGGFTDCLLQQGAKLVYGIDVGYGQTAWKIRNNPKVILFERTNIRNLKPNDLLSRSNELPNFVVADLSFISLKLVFKSIGNLLEGDCIEGIFLIKPQFEVGKEKVSKGGVVRNPKFHTEAIESVIYAAKNFQWNIKNL--IASPLVGPAG-NHEYLAWMTLGNQ 252
>gi|103485540|ref|YP_615101.1| hemolysin A [Sphingopyxis alaskensis RB2256] >gi|98975617|gb|ABF51768.1| hemolysin A [Sphingopyxis alaskensis RB2256] (246 aa)
Score = 293, Expect = 7.2e-25, Identities = 75/237 (31%), Positives = 122/237 (51%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           M K+R D  LV+   A SR  AQ LI      +  + I K+   +     + +   +  +VSR   KL  A+ H   D+   +AID+GSSTGGFT VLL     +VY++D GTNQL  +L+++++VI  EQT+ R + +  I + +  +  D SFI+++ +            + +AL+KPQFE  +     KG  +    H ++  +   +L+      +  + SPI G +  N E+L
  S:     1 MAKVRADQLLVDRGLAESRTRAQALILAGLAFVGDRKIDKAGQQIAADAALSVKGRDHPWVSRGGIKLDHALSHLGWDVTGAVAIDVGSSTGGFTDVLLSRGAARVYAVDSGTNQLAWKLRQDDRVIVHEQTSARILTAKHIPEPVSLVVCDASFIALSKVLPVPMSFTGPGARLVALIKPQFEAERHEVGKKGVVRDVAVHARVCADVRAWLTGKGWDVVDLVESPITGPEG-NVEFL 238
>gi|157414065|ref|YP_001484931.1| rRNA methylase [Prochlorococcus marinus str. MIT 9215] >gi|157388640|gb|ABV51345.1| Predicted rRNA methylase [Prochlorococcus marinus str. MIT 9215] (270 aa)
Score = 293, Expect = 7.7e-25, Identities = 94/240 (39%), Positives = 134/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI----DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL--NIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++K RLD+YL+N+    +R  AQ LI   KV  ING++  K    V    +  I  E  +VSR   KL  A +   I + +KI ID G STGGFT  LL++  K VY IDVG  Q   +++ N KVI  E+TN R ++ + +  K     +F+  D+SFIS+ L+F  I   L+ +  + I L+KPQFE+GK   +  G  +    H + I + I        NIKNL  I SP+ G    N EYL ++
  S:     2 IKKSRLDLYLLNKGLCETRQKAQGLILAGKVRDINGKVFDKPGQQVLIGSEFFIDSEPMFVSRGGEKLLEAFKKLEIKVKDKICIDAGISTGGFTDCLLQHGAKLVYGIDVGYGQTAWKIRNNPKVILFERTNIRNLKPNDLLSKSNELPNFVVADLSFISLKLVFKSIGNLLEGDCIEGIFLIKPQFEVGKDKVSKGGVVRNPKFHTEAIQSVIFAAKNFQWNIKNL--IASPLVGPAG-NHEYLAWM 247
>gi|15645700|ref|NP_207877.1| hemolysin (tly) [Helicobacter pylori 26695] >gi|2314234|gb|AAD08129.1| hemolysin (tly) [Helicobacter pylori 26695] (235 aa)
Score = 292, Expect = 9.3e-25, Identities = 79/240 (32%), Positives = 132/240 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +RLD  L +++   SR  A+ L+  ++V++N  ++SK + +V E DK+E++ E+ +VSRA  KL A +E   +D   K+ +D+G+S GGF+QV L    K+V  +DVG  QL+E LK++ ++   E+ + R  ++    + ID    DVSFIS+  I   I  L   + + + L KPQFE+G+ I   K      D + I+N    F + L  K+   +       K +N    F++ +K
  S:     1 MRLDYALFSQHLVNSREKAKALVLKNQVLVNKMVVSKPSFIVKENDKIELIAEKLFVSRAGEKLGAFLETHFVDFKGKVVLDVGASKGGFSQVALLKGAKRVLCVDVGKMQLDESLKQDKRIECYEECDIRGFKTP---ETIDLALCDVSFISLYYILEAILPL---SDEFLTLFKPQFEVGRGIKRNKK-GVVVDKEAILNALENFKNHLKTKDFQILKIQESLVKGKNGNVEFFIHFK 233
>gi|152992058|ref|YP_001357779.1| hemolysin A [Sulfurovum sp. NBC37-1] >gi|151423919|dbj|BAF71422.1| hemolysin A [Sulfurovum sp. NBC37-1] (237 aa)
Score = 292, Expect = 1.0e-24, Identities = 71/185 (38%), Positives = 110/185 (59%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKI 188
           +RLD YLV E Y  SR  A + I   +V ++G+  +K +  ++    VE+ + + YVSRAA KL++ +    +++  K A+DIGSSTGGF Q++LEN V  +  +DVG +QL+  ++ + +V   E+T+ R+  +   +   + IT DVSFISI  I N I  L       I L KPQFE+G+ +
  S:     1 MRLDKYLVEEGYFESRNRALEAIKAGQVTVDGKK-AKPSVKIDTNSYVEVADAKFYVSRAARKLESFLSEHPVEIQGKSALDIGSSTGGFAQIVLENGVASLTCVDVGKDQLHFSIRSDERVSVHEETDIRDFNT---EKPFEMITCDVSFISILQIMNDIDRLVEKGADIIILYKPQFEVGRDV 181
>gi|68535941|ref|YP_250646.1| hypothetical protein jk0864 [Corynebacterium jeikeium K411] >gi|68263540|emb|CAI37028.1| hypothetical protein [Corynebacterium jeikeium K411] (283 aa)
Score = 292, Expect = 1.0e-24, Identities = 75/236 (31%), Positives = 126/236 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLV--NELDKVEILEEEKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  AQ++I   +V +NG +  K  + V  N   KV   E++++ SR A+KL  A+E F    + +  K  +D G+STGGFT V L+    KV ++DVG  QL  +L+ +++V  +++TN R +    +  ++D +  D+SFISI L+   +          + ++KPQFE+GK      G  ++ + +  +   +   ++   +     + SP+ G    N EY  +L
  S:    10 RLDAELVARKIARSREHAQEMIKAGRVTVNGMLAKKPASGVDGNVSIKVAESEDDRWASRGAHKLLGALEAFEPQGLSVEGKTVLDAGASTGGFTDVCLDRGAAKVKAVDVGYGQLIWRLQNDDRVDVMDRTNVRTLTPEDLGGQVDLMVGDLSFISIRLVLPALSACVKEGGDLLPMVKPQFEVGKDRLGHGGVVRSPELRAEVTREVAVEAMKYGLSTKAVVASPLPGPSG-NVEYFLWL 250
>gi|163839564|ref|YP_001623969.1| hemolysin A [Renibacterium salmoninarum ATCC 33209] >gi|162953040|gb|ABY22555.1| hemolysin A [Renibacterium salmoninarum ATCC 33209] (281 aa)
Score = 292, Expect = 1.0e-24, Identities = 73/236 (30%), Positives = 127/236 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  L+     RSR  A  LI+   V I+  +  K++  ++    + + E    +YVSRAA+KL+ A+  F  ID N K  +D G+STGGFTQVLLE+   +V ++DVG +QL  +++ + +V   E  N R+++++ I         D+SFIS+ L+   + +        + ++KPQFE+G+ ++  T   +   + ++ + +         ++  G   SP+ G +  N EY  +L
  S:     3 RLDQELLARGLVRSRTQAAQLISEGAVSIDSVVARKASQPISAEQTLSVQEGGANRYVSRAAHKLRGALAEFPQIDPNGKRCLDAGASTGGFTQVLLESGATEVVAVDVGHDQLVSEIRDDPRVRVFEGLNVRDLDAADIGGPAALTVADLSFISLTLVVGPLAQATLAGGDLLLMVKPQFEVGRERLAKTGVVSSDHERRRAVASVATSALKAGLELRGLATSPLAG-QDGNIEYFLWL 241
>gi|183982514|ref|YP_001850805.1| cytotoxin/hemolysin, TlyA [Mycobacterium marinum M] >gi|183175840|gb|ACC40950.1| cytotoxin/hemolysin, TlyA [Mycobacterium marinum M] (281 aa)
Score = 292, Expect = 1.1e-24, Identities = 77/245 (31%), Positives = 127/245 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           ++ R+D  LV    ARSR  A +LI+  KV I+G    K  T V     + +    E  +VSR A+KL  A++ F ID++ +  +D G+STGGFT VLL+    +V + DVG  QL   L+ + +VI +E+TN R++  + I  ++D +  D+SFIS+  +   +      +   + ++KPQFE+GK ++G              + +       L    +G   SP+ G    N EY  +L  + ++
  S:     3 RRTRVDAELVRRGLARSRQQAAELISAGKVRIDGLPAVKPATAVAATAALTVAADSERGWVSRGAHKLIGALDAFGIDVHGRRCLDAGASTGGFTDVLLDRGAAEVVAADVGYGQLAWSLRTDPRVIVIERTNVRDLSPAAIGGQVDLVVADLSFISLTTVLPALAACALPHADIVPMVKPQFEVGKGQVGAGGVVQDPALRAGAVLSVARRAGELGWHTVGVTASPLPGPSG-NVEYFLWLRAQTDR 249
>gi|154488635|ref|ZP_02029484.1| hypothetical protein BIFADO_01942 [Bifidobacterium adolescentis L2-32] >gi|154082772|gb|EDN81817.1| hypothetical protein BIFADO_01942 [Bifidobacterium adolescentis L2-32] (238 aa)
Score = 292, Expect = 1.1e-24, Identities = 74/222 (33%), Positives = 123/222 (55%)
  Q:    18 SRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIA-----IDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           SR  AQ LI + KV +NG  ++K++  V   D +     + YVSR AYKL  A E F  D+  + A     +DIG+STGGF  VLL N+  +V ++DVG  QL+ ++  ++++I +   N R++ +  +  + + I  DVSFIS+  +   I  +     + + L+KPQFE+GK      G  ++++  ++ +++ +       +      VSPI+G    N EYL Y
  S:     9 SRSKAQRLIADGKVSVNGVTVTKASAKVGGDDVIAADRGDGYVSRGAYKLVGAFERF-ADVGLRSAQGLRCLDIGASTGGFCDVLLRNDAAQVIALDVGHGQLDPKIAHDDRIIEMSGVNIRDVYAEDLPYRPEMIVSDVSFISLTYVIPVIARIAAPQAQIVLLVKPQFEVGKGNLGKNGIVESQELREQALSSVVACAERNGLDVRATTVSPIEGTHG-NIEYLLY 234
>gi|83311999|ref|YP_422263.1| rRNA methylase [Magnetospirillum magneticum AMB-1] >gi|82946840|dbj|BAE51704.1| Predicted rRNA methylase [Magnetospirillum magneticum AMB-1] (473 aa)
Score = 291, Expect = 1.1e-24, Identities = 66/181 (36%), Positives = 101/181 (55%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFE 183
           K R+D  LV      SR  AQ L+    V    + + K  T + E   +E+  ++  +VSR   KL  A+E F +D  +K+AID+G+STGGFT VLL +   +VY++DVG  QL  +L+ +++V+ LE+TN R + +  I + +D +  D SFI +  +      L        AL+KPQFE
  S:   222 KKRVDQLLVERGLVESRSKAQALVMAGLVYSGDRRVDKPGTAMAEDCALELKGQDHPWVSRGGLKLAKALETFGLDPRDKVAIDVGASTGGFTDVLLAHGAARVYAVDVGHGQLAWKLRSDSRVVVLERTNARHLTAEQIPEPVDMVVCDASFIGLETVLPAALSLARPGAWVAALIKPQFE 403
>gi|126696992|ref|YP_001091878.1| rRNA methyltransferase [Prochlorococcus marinus str. MIT 9301] >gi|126544035|gb|ABO18277.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. MIT 9301] (270 aa)
Score = 291, Expect = 1.2e-24, Identities = 95/245 (38%), Positives = 137/245 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI----DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGKKIGTTKGFAK-----TEDHKKII---NNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           ++K RLD+YL+      +R  AQ LI   KV  ING++  K    V    +  I  E  +VSR   KL  A +   I + +KI ID G STGGFT  LL+   K VY IDVG  Q   +++ N KVI  E+TN R ++ + +  +     +F+  D+SFIS+ L+F  +   L+ +  + I L+KPQFE+GK   +  G  +     TE  + +I   NNF       NIKNL  I SP+ G    N EYL ++  ++E
  S:     2 IKKSRLDLYLLKSGLCETRQKAQGLILAGKVRDINGKVWDKPGQQVLIGSEFFIDSEPMFVSRGGEKLLEAFKKLEIKVKDKICIDAGISTGGFTDCLLQQGAKLVYGIDVGYGQTAWKIRNNPKVILFERTNIRNLKPNDLLSRSNELPNFVVADLSFISLKLVFKSLSNLLEGDCIEGIFLIKPQFEVGKDKVSKGGVVRNPKFHTEAIESVICAANNF-----HWNIKNL--IASPLVGPAG-NHEYLAWMSLRSE 252
>gi|167358939|ref|ZP_02293587.1| hemolysin A [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074219|gb|EDR78047.1| hemolysin A [Rhizobium leguminosarum bv. trifolii WSM1325] (261 aa)
Score = 291, Expect = 1.4e-24, Identities = 83/234 (35%), Positives = 125/234 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV+     SR  A+D +    V I GQ+++K+  L      +EI +  + YVSRAA KL AA++HF +D      +D+G+STGGFT+VLL+     V +IDVG  Q++ ++  + +V + E  N R + +  I     FI  DVSFI++ L      E+      ++ L+KPQFE G++     G  K       +   +E  F+  +  K+LG I SPI G    N E+L 
  S:    21 RLDQLLVSLGLFASRSRARDAVQRGTVKIGGQVVTKAGALFGADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRISGDPRVTNREGLNARNLTADDIDHPSTFIVSDVSFITLKLALAPALEIAEPGAVAVLLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFVEDMGWKSLGLIPSPISGGDG-NQEFLL 256
>gi|149193898|ref|ZP_01870996.1| Hemolysin A [Caminibacter mediatlanticus TB-2] >gi|149135851|gb|EDM24329.1| Hemolysin A [Caminibacter mediatlanticus TB-2] (238 aa)
Score = 291, Expect = 1.4e-24, Identities = 94/237 (39%), Positives = 140/237 (59%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKG--FAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +RLD  LV  +   +R  A++LI N KV +N +II K +  + + DK+EIL++  YVSRAA+KLK  +  +NI    K  +D+G+STGGF++V LE   KKV  +DVG+NQL+ ++K+N KV + E T+ R+ + +   +K D +  DVSFIS+  I + I   K+     I L KPQFE+G ++   K       E  KK   NF +    L  K L    S I+G K+ N EY+++ 
  S:     1 MRLDEALVKRDLVETRSKAKELIKNEKVKVNDKIIKKPSFEIKDNDKIEILQK-VYVSRAAWKLKNYLNKYNISFKEKSVLDVGASTGGFSEVSLEKGAKKVVCVDVGSNQLHPKIKENMKVENFENTDIRDFKYN---EKFDIVVSDVSFISLLKIIDVID--KFAKSDIILLFKPQFEVGIEVKRDKRGVVLDKEAIKKARENFEKETQKLGWKLLRSEESSIRG-KEGNIEYIYHF 232
>gi|116250744|ref|YP_766582.1| putative FtsJ cell division/haemolysin-like protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115255392|emb|CAK06467.1| putative FtsJ cell division/haemolysin-like protein [Rhizobium leguminosarum bv. viciae 3841] (248 aa)
Score = 291, Expect = 1.4e-24, Identities = 82/234 (35%), Positives = 126/234 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV+     SR  A+D +    V I GQ+++K+  L +    +EI +  + YVSRAA KL AA++HF +D      +D+G+STGGFT+VLL+     V +IDVG  Q++ ++  + +V + E  N R + +  +     FI  DVSFI++ L      E+      ++ L+KPQFE G++     G  K       +   +E  F+  +  K+LG I SPI G    N E+L 
  S:     8 RLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFSADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRISGDPRVTNKEGLNARNLTADDVDHPATFIVSDVSFITLRLALAPALEIAEPGAVAVLLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFVEDMGWKSLGLIPSPISGGDG-NQEFLL 243
>gi|25028102|ref|NP_738156.1| hypothetical protein CE1546 [Corynebacterium efficiens YS-314] >gi|23493386|dbj|BAC18356.1| putative membrane protein [Corynebacterium efficiens YS-314] (274 aa)
Score = 290, Expect = 1.6e-24, Identities = 80/236 (33%), Positives = 125/236 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN-ELD-KVEILEEEKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  A ++I + +V + G +  K  T+V  E+  +VE    E + SR A+KL  A+E F    +D+  + A+D G+STGGFT VLL     +V ++DVG  QL  +L+ +++V  +++TN R +         D +  D+SFIS+ L    I          + ++KPQFE+GK ++G+       E   ++     EF   L +   G + SP+ G    N EY  +L
  S:     6 RLDAELVRRKIARSREHAVEMIRDRRVFVQGMLALKPATVVEPEVSIRVEDSVTEDWASRGAHKLIGALEVFEPQGLDVTGRRALDAGASTGGFTDVLLRRGAAEVVAVDVGYGQLIWRLQNDDRVRVVDRTNIRYMTLEDTGGPCDLMVGDLSFISLKLTLPAIVACLSEGADLLPMVKPQFEVGKDRLGSGGVVRSPELRAEVTREVAEFAHTLGLSLKGVVASPLPGPSG-NVEYFLWL 246
>gi|123969198|ref|YP_001010056.1| rRNA methyltransferase [Prochlorococcus marinus str. AS9601] >gi|123199308|gb|ABM70949.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. AS9601] (270 aa)
Score = 290, Expect = 1.6e-24, Identities = 93/240 (38%), Positives = 134/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI----DFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL--NIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++K RLD+YL+N+    +R  AQ LI   KV  ING+++ K    V    +  I  E  +VSR   KL  A +   I + +KI ID G STGGFT  LL+   K VY IDVG  Q   +++ N KVI  E+TN R ++ + +  +     +F+  D+SFIS+ L+F  I   L+ +  + I L+KPQFE+GK   +  G  +    H + I + I        NIKNL  I SP+ G    N EYL ++
  S:     2 IKKSRLDLYLLNKGLCETRQKAQGLILAGKVRDINGKVLDKPGQQVLIGSEFFIDSEPMFVSRGGEKLLEAFKKLEIKVKDKICIDAGISTGGFTDCLLQQGAKLVYGIDVGYGQTAWKIRNNPKVILFERTNIRNLKPNDLLSRSNELPNFVVADLSFISLKLVFKSIGNLLEGDCIEGIFLIKPQFEVGKDKVSKGGVVRNPKFHIEAIESVIYSAKNFQWNIKNL--IASPLVGPAG-NHEYLAWM 247
>gi|120404265|ref|YP_954094.1| hemolysin A [Mycobacterium vanbaalenii PYR-1] >gi|119957083|gb|ABM14088.1| hemolysin A [Mycobacterium vanbaalenii PYR-1] (269 aa)
Score = 290, Expect = 1.6e-24, Identities = 74/239 (30%), Positives = 127/239 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDK--VEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++ R+D  LV    ARSR  A +LI   +V I+G   +K  T V+      VE  + + +VSR A+KL  A++ F + +  +  +D G+STGGFT+VLL+   ++V ++DVG  QL   L+ + +V  +++TN RE+    I   +D +  D+SFIS+  +   +      +   + ++KPQFE+GK ++G     +      + + +     + LN   +    SP+ G    N EY  +L
  S:     3 RRARVDAELVRRGLARSRQQAAELIGAGRVRIDGMPAAKPATAVSLTANLTVEGGDADSWVSRGAHKLIGALDAFGLSVRARRCLDAGASTGGFTEVLLDREAREVVAVDVGYGQLAWSLRTDPRVTVMDRTNVRELTPEAIGGPVDLVVADLSFISLATVLPALTACASPDADIVPMVKPQFEVGKDRVGPGGVVSDPLLRAEAVLSVARRAAELNWHAVAVTASPLPGPAG-NVEYFIHL 243
>gi|194476670|ref|YP_002048849.1| Hemolysin A [Paulinella chromatophora] >gi|171191677|gb|ACB42639.1| Hemolysin A [Paulinella chromatophora] (279 aa)
Score = 290, Expect = 1.8e-24, Identities = 85/245 (34%), Positives = 138/245 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVIN-GQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS---LIKDKI-DFITIDVSFISINLIFNKIKEL-KWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL---EYKNEK 246
           +K RLD++L+      SR  AQ LI    V  + GQ++ K +  V+  D + ++E   ++VSR   KL AA++ F+I    ++ +D G STGGF+  L +N   ++Y +DVG  Q   +L+ +++++  E+TN R ++     L  D + D   +DVSFIS+ LI   +K L  + + ++I L+KPQFE+GK ++G      +   H + I   I        + +  + SPI G    N EYL +L   EYK  K
  S:     3 RKQRLDVHLLQLGLVNSRQQAQQLIRAGNVRDSYGQLLDKPSLEVSS-DMIPLVEYPPRFVSRGGEKLDAALKAFSILTQGRVCLDGGISTGGFSDCLFQNGASRIYGVDVGYGQTAWKLRNDSRLVLKERTNLRNLKVKDLYLDSDPLPDLAVVDVSFISLVLILPALKRLILYPSAEAIVLIKPQFEVGKEQVGKGGVVREAASHVEAIKRVIAAALTEKWQVIDIVASPITGPAG-NHEYLLWLSGPEYKGRK 256
>gi|116327488|ref|YP_797208.1| rRNA methylase/hemolysin-tylA [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331898|ref|YP_801616.1| rRNA methylase/hemolysin-tylA [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116120232|gb|ABJ78275.1| rRNA methylase/Hemolysin-tylA [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125587|gb|ABJ76858.1| rRNA methylase/Hemolysin-tylA [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (259 aa)
Score = 290, Expect = 1.8e-24, Identities = 88/238 (36%), Positives = 142/238 (59%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----------FITIDVSFISINLIFNKIKELKWNNW----KSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           +KIRLD+ L+    A S   ++ LI +  V++N Q I+K      +  +++IL    +YVSR AYKL  A E F + ++ K+ +D+G+STGGFTQVLLE    KV++ DVG  QL E+L+ +  VI  ++ + + + SS I+ + +           I  D+SFIS+  +F   ++L+   +    + I L+KPQFE  KK   TKG  +    + +I+ +   +L     K +G ++     SPI+G +  N E L Y
  S:     4 EKIRLDVLLLERGLADSPEKSRSLILSGSVLVNEQKITKVGLKFPKDSEIKILNVIREYVSRGAYKLLRAFEIFPLQVDGKLCVDLGASTGGFTQVLLEKGAWKVFACDVGYGQLAEKLRNHPSVIVKDRFHLKRLSSSEIEWETNRFQAPHPESIVIVTDLSFISLRSVFPVFRKLREEKYIPKLECITLIKPQFESDKK-DLTKGILRDPKIRIRIVRSLCGYLK----KEIGGVILGLEWSPIEG-RSGNKEILLY 256
>gi|86608551|ref|YP_477313.1| hemolysin A [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557093|gb|ABD02050.1| hemolysin A [Synechococcus sp. JA-2-3B'a(2-13)] (275 aa)
Score = 290, Expect = 1.8e-24, Identities = 76/239 (31%), Positives = 122/239 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI-------KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +++RLD +LV   Y  SR  AQ  I   +V +NG    K  T V+    V++     +VSR   KL+ A++ F + +  +I +D G STGGFT  LL+   ++VY +DVG  QL   L+ + +VI  E+ N R ++   +       +   D   +D+SFIS+  +   +  L     +++ L+KPQFE G+     KG  +    H +++   +        +  GY  SPI G    N EY  +L
  S:     3 KRVRLDSWLVERGYFSSRQQAQRSILAGEVFLNGVRAEKPGTWVSGDPAVQVQSGPAFVSRGGEKLQGALQTFPVQVQGRICLDAGISTGGFTDCLLKRGAQRVYGVDVGYGQLAWSLRTDARVILKERANLRHLQPEDLYGSEAPPQSWPDLAVVDLSFISLTKVLAPLWNLLRFPREALLLVKPQFEAGRDQVGKKGVVRDPVVHARVLETVMRSAVAQGWQVQGYTWSPITGPAG-NIEYWLWL 248
>gi|148261635|ref|YP_001235762.1| hemolysin A [Acidiphilium cryptum JF-5] >gi|146403316|gb|ABQ31843.1| hemolysin A [Acidiphilium cryptum JF-5] (247 aa)
Score = 290, Expect = 1.9e-24, Identities = 78/237 (32%), Positives = 124/237 (52%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIE-FLSILNIKNLGYIVSPIKGAKKENTEYL 237
           M + R D+ LV   +  SR  AQ+ I    V   G+ I K   LV + + + + +    +VSR A KL AA++HF +   N+  +DIG+STGGFT+VLL      V+++DVG  Q+   L+ + +V   E  N R++ ++ I   +  +  DVSFI +  +      L   +  ++AL+KPQFE G +     G  +    H+++     + F  I   + LG I SPI+G    N E+L
  S:     1 MARGRADLALVARGHFASRARAQEAIRRGLVSAGGRTIGKPGELVGDDEALSVADAGAAWVSRGALKLIAALDHFGLSPENRTCLDIGASTGGFTEVLLARGAALVHAVDVGHGQMAPALRDDARVRLHEGVNARDLSAAGIPGGLGAVVCDVSFIGLRKVLPAGLALCGKDAFAVALIKPQFEAGPEAVGKGGIVRDPAVHERVCGEIGDWFAQIPGWRGLGIIPSPIEGGDG-NREFL 239
>gi|91978766|ref|YP_571425.1| hemolysin A [Rhodopseudomonas palustris BisB5] >gi|91685222|gb|ABE41524.1| hemolysin A [Rhodopseudomonas palustris BisB5] (246 aa)
Score = 289, Expect = 2.0e-24, Identities = 64/191 (33%), Positives = 102/191 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFA 195
           R D+ LV      SR  AQ  I    V  +G+ ++K +  +     ++      +VSR   KL  A+E + I++ + + +D+G+STGGFT VLL N    V+++DVG  QL+  L+ + K++S+E T+ R ++   +  + D + ID SFIS+ LI      L       +AL+KPQFE   K G  +  A
  S:    12 RADVVLVERGLFESRARAQAAIEAGLVFADGKPVTKVSEPIALDAALDAQPAHPWVSRGGVKLAGALERYPIEIEDHVCLDVGASTGGFTDVLLANGAALVFAVDVGRAQLHPSLRGHPKIVSMEATDIRSLDGKRLPQRPDVVVIDASFISLKLILPTALTLAAAPMSLLALIKPQFEAPSKHGIVRDAA 202
>gi|182414187|ref|YP_001819253.1| hemolysin A [Opitutus terrae PB90-1] >gi|177841401|gb|ACB75653.1| hemolysin A [Opitutus terrae PB90-1] (258 aa)
Score = 289, Expect = 2.2e-24, Identities = 78/242 (32%), Positives = 134/242 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS-LIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNI---KNLGYIVSPIKGAKKENTEYLFYLEYK 243
           +KIRLD  LV    A SR  A+ LI + +V+   + + K     +   ++ + +  ++VSR   KL AA+ HF +DL+    +D+G+STGGFT   L+     V  +DVG  QL+ +L+ + +V +LE+ N R + ++ L + + D I +D+SFIS+  +   +  L   +   IAL+KPQFE GK ++   +G  +    ++     +   ++ N+   + +G + SPI GA   N E+L  L  +
  S:     5 KKIRLDELLVLRELAESRAQAKALIMSGRVLHGTERLEKPGKEYSTEIELIVEQPPRFVSRGGEKLSAALAHFALDLHGAHVLDVGASTGGFTDCALQAGAADVVCVDVGRAQLHARLRADPRVTNLEKINARFLTAADLPRSEFDAIVMDLSFISLTAVLPAVWPLLRGDGTLIALVKPQFEAGKSEVDKGRGVIRDPVVQEATLARVREFALTNLPAAQLIGTVDSPITGADG-NREFLLGLRKR 250
>gi|124022176|ref|YP_001016483.1| rRNA methyltransferase [Prochlorococcus marinus str. MIT 9303] >gi|123962462|gb|ABM77218.1| FtsJ cell division protein:S4 domain:Hemolysin A [Prochlorococcus marinus str. MIT 9303] (267 aa)
Score = 289, Expect = 2.2e-24, Identities = 80/239 (33%), Positives = 134/239 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVI-NGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI---KDKIDFITI-DVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
            K RLD+ L+ +  A SR  AQ LI   KV   NGQ++ K    V++  ++++ +  ++VSR   KL  A+  F +++  ++ +D G STGGFT  LL++   +VY IDVG  Q    L+ + +V+  E+TN R +    +   ++ +  + + D++FIS+ L+   IK+ LK +  +++ L+KPQFE+G+ ++G          H   + + I+    L     G I SPI G    N EYL +L
  S:     3 HKQRLDLQLLMKGLASSRHQAQQLIRAGKVRDGNGQLLDKPGHEVSQELELQVEQPPRFVSRGGEKLLGALLEFPLNVEGRVCLDGGISTGGFTDCLLQHGAARVYGIDVGYGQTAWDLRNDPRVVLRERTNLRTLSPDQLYGAEEPLPSLAVADLAFISLRLVLPAIKKLLKPDQSEAVLLVKPQFEVGRERVGKGGVVRDALAHVDALQSVIDTSRSLGWWPKGLIASPITGPAG-NHEYLLWL 247
>gi|149198600|ref|ZP_01875644.1| hemolysin A [Lentisphaera araneosa HTCC2155] >gi|149138315|gb|EDM26724.1| hemolysin A [Lentisphaera araneosa HTCC2155] (247 aa)
Score = 289, Expect = 2.4e-24, Identities = 79/237 (33%), Positives = 127/237 (53%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELD-KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKI---GTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           ++K R D  L+ +    S   A+ LI    V      I +  T    +D ++ +     YVSR A+KLK +++ F  DL  K+ +D+G+STGGFT ++L    K+VY+ID GTNQL+ +L+ + +VI  E  N + I    I +++D +T DVSFIS+  I +       +   +  L+KPQFEL K +   G  +  A  +     + +F +    L+ + +  I SP+ G K  N E+L
  S:     4 IKKKRADQLLIEQGLVESAEEAKKLILLGLVRSRADHIVRKTTETYPVDSEMSVDRPSPYVSRGAFKLKTSLKKFAPDLTEKVGMDVGASTGGFTDLMLSFGAKRVYTIDSGTNQLHYKLRSDERVICRENFNAKNISEKEIPEEVDLMTCDVSFISVTRILHAAASCLKSQALAFILVKPQFELSKDLVGDGVVRDNALRQQALSKVCDFCK--DELSWELIDQIDSPLAGPKG-NVEFL 241
>gi|167455387|ref|ZP_02321609.1| hemolysin A [Anaeromyxobacter dehalogenans 2CP-1] >gi|167418072|gb|EDR84771.1| hemolysin A [Anaeromyxobacter dehalogenans 2CP-1] (249 aa)
Score = 288, Expect = 2.6e-24, Identities = 63/181 (34%), Positives = 108/181 (59%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE---EEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQF 182
           ++ R+D+ LV    A SR  AQ L+    VV+      K   LV+    + + +    ++YVSR A KL+ A+E F  +D   +   D+G+STGGFT +LL+    KVY++DVG  QL+ +L+ + +V+  E+ N R++ S  + ++++ +  D+SFIS+ LI   +K +     +++ L+KPQF
  S:     4 KRERIDVLLVARGLAESRTRAQALVMAGAVVVGEARADKPGQLVDPEAPIRLKDGAAPQRYVSRGALKLEKALEVFPAVDPRGRTCADLGASTGGFTDLLLQRGAAKVYAVDVGYGQLHPRLRADPRVVVRERENARQLTSEALGERVELVVGDLSFISLRLILPAVKAILLPGGQAVLLVKPQF 188
>gi|87119530|ref|ZP_01075427.1| Hemolysin A [Marinomonas sp. MED121] >gi|86165006|gb|EAQ66274.1| Hemolysin A [Marinomonas sp. MED121] (254 aa)
Score = 288, Expect = 3.1e-24, Identities = 93/236 (39%), Positives = 133/236 (56%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVI--NGQ--IISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS-----LIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLG-----YIVSPIKGAKKENTEYLFY 239
           IR+D  L  +   +SR  AQ  I  +KV I  NGQ  I +K++  V +  +V++     ++YVSR A KL+ A++H  +D++N   +D+G STGGFT   L+   KKV  I+VG +QL+ +LK+N  VI +E  N R +        L     D I +DVSFIS   I      L       I L+KPQFE+GK+     G  K     K ++   E ++ L I++LG     YI S IKG    N EYL +
  S:     2 IRIDQLLTQKQLCKSRAQAQAFIKGNKVSILLNGQWQIANKASLKVVQDTEVKLTLDASDRYVSRGALKLEGALKHSKLDISNFNVLDVGQSTGGFTDCALQAGAKKVVGIEVGHDQLDSRLKENPNVICIEGVNARNLSKQDLGVHLPDTGFDLIVMDVSFISQTKILQNFPALLKQGGHLITLIKPQFEVGKQAIGKGGIVKD---LKAVSELEEKMTKL-IQDLGFTLHCYIESTIKGGDG-NQEYLVW 248
>gi|15901067|ref|NP_345671.1| hemolysin A, putative [Streptococcus pneumoniae TIGR4] >gi|14972684|gb|AAK75311.1| putative hemolysin A [Streptococcus pneumoniae TIGR4] (198 aa)
Score = 288, Expect = 3.2e-24, Identities = 67/173 (38%), Positives = 107/173 (61%)
  Q:    74 FNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNEK 246
           F++ ++    IDIG+STGGFT V+L+N+ K V+++DVGTNQL  +L+++ +V+S+EQ NFR  E +  + +  F +IDVSFIS++LI   +  +  +  + +AL+KPQFE G+ +IG        + H+ ++ +       +    LG   SPI+G    N E+L YL  K EK
  S:     4 FDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKVHQNVLESVTAMAVEVGFSVLGLDFSPIQGGHG-NIEFLAYL--KKEK 174
>gi|13476217|ref|NP_107787.1| hemolysin-like protein [Mesorhizobium loti MAFF303099] >gi|14026977|dbj|BAB53573.1| hemolysin-like protein [Mesorhizobium loti MAFF303099] (254 aa)
Score = 287, Expect = 4.1e-24, Identities = 84/234 (35%), Positives = 127/234 (54%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESS-LIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTE-DHKKIINNFIEFL-SILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV      SR  A+D +    V ++G +  K    V+    V I +  + YVSRAA KL   ++HF++D   + A+DIG+STGGFTQVLLE     V +IDVG  Q++  + K+ +V  +E  N R++ ++ L     DFI  DVSFIS+ L       L      ++ L+KPQFE G++     G  K   D  ++     ++L ++   ++LG  +SPI+G    N E+L 
  S:    12 RLDDLLVQRGLFASRSRARDAVERGTVTVDGVMARKPGQNVSPQCLVAIDDPAQGYVSRAALKLIGGLDHFSLDPAGREALDIGASTGGFTQVLLERGASHVIAIDVGHGQMHPDVGKDPRVTVVEGLNARDLTAADLAGRNPDFIVSDVSFISLRLALPPALALAKPGAAAVFLVKPQFEAGREAIGKGGLLKDPFDAARVAGLLQDWLDAVPGWRSLGLHLSPIEGGDG-NREFLL 248
>gi|118589267|ref|ZP_01546673.1| hemolysin-like protein [Stappia aggregata IAM 12614] >gi|118437967|gb|EAV44602.1| hemolysin-like protein [Stappia aggregata IAM 12614] (246 aa)
Score = 286, Expect = 4.2e-24, Identities = 86/239 (35%), Positives = 123/239 (51%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK-YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-SPIKGAKKENTEYLFY 239
           M K RLD +LV+     SR  A+D I    V ++G   +K     +    + + +    YVSRAA KL   ++ F +D   +I +DIG+STGGFTQVLLE    KV++IDVG  QL+E LK + KV + +  N R++    L  D    +  DVSFIS+ L       L     + + L+KPQFE GK      G    E  ++   +   +L  +     G +V SP+KG    N E+L Y
  S:     1 MSKQRLDQHLVDTGVFPSRARARDAILRGTVSVDGLPCTKPAQKTSADASITVEDPAAGYVSRAALKLIEGLDRFGVDPAGRICLDIGASTGGFTQVLLERGADKVHAIDVGHGQLHESLKTHPKVAARDGLNARDLTLEDLGGDAPALLVSDVSFISLKLALPPALALAAPGAEGVFLVKPQFEAGKDNIGKGGLVDPEIAEETAKSLQVWLGTMPGWQAGDLVPSPVKGGDG-NAEWLLY 241
>gi|86741846|ref|YP_482246.1| hemolysin A [Frankia sp. CcI3] >gi|86568708|gb|ABD12517.1| hemolysin A [Frankia sp. CcI3] (291 aa)
Score = 286, Expect = 4.2e-24, Identities = 78/239 (32%), Positives = 133/239 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNID---------------------LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++ RLD  LV    ARSR  A   IT  +V++ G   +K+ T+V+    + +   ++  Y SR A+KL  A E F +                      +  +  +D+G+STGGFT VLL      V ++DVG  QL  +L+ + +V  L++TN R +  + I D++D +  D+SFIS+ L+   ++     +   + L+KPQFE+G+ ++G       T  H + +++     ++L++   G   SP+ G    N EYL +L
  S:     3 RRTRLDSELVRRGLARSREQAVAAITAGRVLVGGIPATKAATVVDGSTSIAVTKGDDPGYASRGAHKLLGAFEAFGVPAPGPEPGPGAEIPRSTGPTLVVAGRRCLDVGASTGGFTDVLLRYGAGTVVAVDVGYGQLLWRLRCDPRVRVLDRTNARNLTPAEIGDRVDLVVGDLSFISLALVLPALRACAVPDADFVLLVKPQFEVGRERLGPGGVVRDTALHAEAVHDVAASAAMLDLGVRGVTASPLPGPAG-NVEYLLWL 264
>gi|78184053|ref|YP_376488.1| hemolysin A [Synechococcus sp. CC9902] >gi|78168347|gb|ABB25444.1| Hemolysin A [Synechococcus sp. CC9902] (281 aa)
Score = 286, Expect = 4.5e-24, Identities = 80/238 (33%), Positives = 125/238 (52%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVIN-GQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----FITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ LV      SR  AQ LI   KV    G ++ K    V +  ++++    ++VSR   KL A +  F I +  +I +D G STGGFT  LL++  K+VY +DVG  Q    L+ +++V+  E+TN R ++   +  + D        DVSFIS+ LI   ++  L  ++ +++ L+KPQFE+G+ ++G          H   I   I     L+    G + SPI G    N EY+ +L
  S:    18 KQRLDLELVARGLVASRQQAQQLIRAGKVRDGAGTVLDKPGHDVKDTLQLQVEHPPRFVSRGGEKLLAGLAAFPISVQERICLDGGISTGGFTDCLLQHGAKRVYGVDVGYGQTAWSLRTDDRVVLRERTNLRHLQPEALYGEADPWPTLAVTDVSFISLRLILPALRRLLHGSDAEALVLVKPQFEVGRDRVGRGGVVRDPVAHCDAIEMVITAAEELDWFAQGIVASPITGPAG-NHEYVLWL 261
>gi|62424869|ref|ZP_00380009.1| COG1189: Predicted rRNA methylase [Brevibacterium linens BL2] (267 aa)
Score = 286, Expect = 4.9e-24, Identities = 66/198 (33%), Positives = 115/198 (58%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNID-LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK 202
           RLD  LV      +R  A   I   +V +NG  +SK + +V++ D++ + E + +V+R+A+KL  A+E F+ID +    A+D G+STGGFTQVLL     +V+++DVG +Q +  L+++ ++   E  N RE++ S +  ++D +  DVSFIS+ L+   +  +     + + ++KPQFEL +      G   T   ++
  S:     3 RLDRELVERELIATRSRAAREIAAGRVSVNGHTVSKPSQVVSDSDELSVTEPDPWVARSAHKLLGALESFSIDDVTGLTALDAGASTGGFTQVLLHRGAAEVWAVDVGHDQFDAGLREDPRIHVREGLNLRELDDSDVP-QVDLVVADVSFISLRLLLAPLLAVIRPTGELLLMVKPQFELARGALDKHGVVATATKRR 200
>gi|115523087|ref|YP_779998.1| hemolysin A [Rhodopseudomonas palustris BisA53] >gi|115517034|gb|ABJ05018.1| hemolysin A [Rhodopseudomonas palustris BisA53] (246 aa)
Score = 286, Expect = 5.1e-24, Identities = 71/234 (30%), Positives = 118/234 (50%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    V  +G+ I+KS+  +     ++  +   YVSR   KL  A+  + I +   + +D+G+STGGFT+VLL      V+++DVG +QL+  L+ + K+IS+EQT+ R++E   +  + D + ID SFIS+  +      L       +AL+KPQFE   +          + H+ + ++   F + L   ++    S I+G    N E+  
  S:     7 RADVALVERGLFESRARAQAAIEAGLVFADGRKITKSSEPIAADAVIQAEQAYPYVSRGGVKLAGALARYPIAIEGYVCLDVGASTGGFTEVLLAEGASLVFAVDVGRDQLHPSLRGHPKIISMEQTDIRDLEGKRLPARPDVVVIDASFISLKTVLPAALALAAAPMSLLALIKPQFEAQGRHNKRGIIKDAKVHRAVCDDIASFAASLGCTDITVFPSSIEGGDG-NIEFFL 239
>gi|34557002|ref|NP_906817.1| putative hemolysin [Wolinella succinogenes DSM 1740] >gi|34482717|emb|CAE09717.1| PUTATIVE HEMOLYSIN [Wolinella succinogenes] (236 aa)
Score = 286, Expect = 5.2e-24, Identities = 66/184 (35%), Positives = 108/184 (58%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIE-HFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           +RLD YL  E+   SR  A+ LI   +++++G+  SK +  V E   +E+L   +YV RAA KL+  +E H  I L  +  +DIGSSTGGF QV L+     V  +DVG +QL ++L++++++   E  + R+ +     +  +++  DVSFIS++ +   I  L      +I L KPQFE+G++
  S:     1 MRLDAYLAKESLVPSREKARALILEGQILVDGKAASKPSMEVMEGVSIELLSPSRYVGRAALKLQGFLESHPEISLKGERVLDIGSSTGGFAQVALQAGALSVTCVDVGRDQLAKELREDSRIALFEGMDIRDFQD----EPFNWVLCDVSFISLSKVLPDIHRLCAQG--AILLFKPQFEVGRE 179
>gi|57168173|ref|ZP_00367312.1| hemolysin (tly) [Campylobacter coli RM2228] >gi|57020547|gb|EAL57216.1| hemolysin (tly) [Campylobacter coli RM2228] (249 aa)
Score = 286, Expect = 5.3e-24, Identities = 97/240 (40%), Positives = 145/240 (60%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKS----NTLVNEL-DKVEILEEEK---------YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFYLEYK 243
           +R DI+ V +    SR  A +LI N ++++N +    S    N L N++ D+ E+L  ++         YVSRAA+KLK  +E+ NI++ NK  +DIGSSTGGF Q+LLE+   KV ++DVG NQL+  L+ + ++  +E T+ R  +S   + K DFIT DVSFIS+  + + I  L   +   + L KPQFE+GK+    K     +D K +     EF +      LG+I+     S IKG K+ N EY +Y   K
  S:     1 MRYDIF-VAKRLNLSRNKALELIENEEILLNSKPYKASFDVQNLLKNKIADQEELLNSKELNLELLGELYVSRAAFKLKYFLENHNINIANKTCLDIGSSTGGFVQILLEHKALKVSALDVGDNQLHPSLRDDKRIEIIENTDLRTFKS---EQKFDFITCDVSFISLAYLLSYIDNLALKD--IVLLFKPQFEVGKQAKRDKK-GVLKDEKAVFKAMREFENA--CARLGWILQCCEESKIKG-KEGNIEYFYYYTKK 249
>gi|37522750|ref|NP_926127.1| hypothetical protein gll3181 [Gloeobacter violaceus PCC 7421] >gi|35213752|dbj|BAC91122.1| gll3181 [Gloeobacter violaceus PCC 7421] (272 aa)
Score = 285, Expect = 6.0e-24, Identities = 76/238 (31%), Positives = 119/238 (50%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK----IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++RLD  LV    A SR  AQ LI   +V + G+   K  +L     +V +     +VSR   KL  A+  F++ +  ++ +D G STGGF   LL+    +VY IDVG  Q+  +L+ + +V+  E+TN R +  + +        D  T D+SFIS+ L+   I +L     + + L+KPQFE G+ ++G          H+++I +       L     G   SPI G    N EY  +L
  S:     7 RLRLDQILVERGLAESRQKAQALIRAGQVRVGGERFDKPGSLCPVDSEVSVAAGSPFVSRGGEKLTGALARFDVHIEGRVCLDGGISTGGFADCLLQRGAARVYGIDVGYGQVAWKLRTDPRVVLKERTNLRHLRPAELYGPGDPWPDLATADLSFISLKLVLGPIWQLLLVPREVLLLVKPQFEAGRERVGKNGVVRDPAVHREVIADVWSVSQALGWGFRGLCPSPITGPAG-NREYWLWL 248
>gi|118469022|ref|YP_888048.1| hemolysin A [Mycobacterium smegmatis str. MC2 155] >gi|118170309|gb|ABK71205.1| hemolysin A [Mycobacterium smegmatis str. MC2 155] (269 aa)
Score = 285, Expect = 6.6e-24, Identities = 65/185 (35%), Positives = 105/185 (56%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           ++ R+D  LV    ARSR  A +LI   +V I+G   +K  T V+    + ++E  E  +VSR A+KL  A++ F + +  +  +D G+STGGFT+VLL+    +V + DVG  QL   L+ + +V  LE+TN R++    I   +  I  D+SFIS+  +   +      +   + ++KPQFE+GK
  S:     3 RRARVDAELVRRGLARSRQQAAELIGAGRVRIDGMPAAKPATAVSVDANLTVIESDERTWVSRGAHKLIGALDAFGLSVEGRRCLDAGASTGGFTEVLLDRGAAEVVAADVGYGQLAWSLRSDPRVHVLERTNVRDLTPEAIGGPVQMIVADLSFISLATVLPALTACAVRDADIVPMVKPQFEVGK 189
>gi|16125573|ref|NP_420137.1| hemolysin A [Caulobacter crescentus CB15] >gi|13422669|gb|AAK23305.1| hemolysin A [Caulobacter crescentus CB15] (243 aa)
Score = 285, Expect = 7.0e-24, Identities = 71/232 (30%), Positives = 118/232 (50%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDH-KKIINNFIEFLSILNIKNLGYIVSPIKGAKKE 232
           M + R+D  LV+     SR  A+  I   +V + G++++K +  V++  +V       +V R A KL  A++ + I +  ++AID+G+STGGFT+VLL      V+++DVG +QL+  L+ +++V  L   + R ++   I      I  DVSFIS+         L     + +AL+KPQFE G++     G  K  D   ++    + FL        G   SPI G + +
  S:     1 MARKRIDQLLVDRGVFDSRAKARAAIEAGRVSVAGRVVAKPSEQVDDNAEVAAEAAHPWVGRGALKLVHALDTWPIAVEGRVAIDVGASTGGFTEVLLSRGAAFVFAVDVGRDQLHPSLRASDRVADLSGVDARSLDDDRIAQPPGLIVSDVSFISLTKALPAALHLATRGAELVALIKPQFEAGREHVGKGGLVKDPDVIARVEREIVAFLEAAGWSVRGLAESPITGGEGQ 233
>gi|114798580|ref|YP_759545.1| hemolysin A [Hyphomonas neptunium ATCC 15444] >gi|114738754|gb|ABI76879.1| hemolysin A [Hyphomonas neptunium ATCC 15444] (249 aa)
Score = 284, Expect = 7.5e-24, Identities = 80/237 (33%), Positives = 126/237 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDH--KKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           ++ R D  L+   +  SR  AQ  I   +V  +GQ+I K + +++    +E      YVSR   KL  A++ F+ID+  K+ +D+G+STGGFT VLL+     V +IDVG  QL+ ++  + +V + E  N R++  + +K   + I  D+SF+S++ +      L   +   IAL KPQFE+G +    KG   T+    ++ +  F  FLS         I SPI+G    N EYLF
  S:     8 ERDRADKVLLALGHFESRAGAQAAIAAGRVKADGQVIRKPSEMISRSAAIEAEAAHPYVSRGGLKLVHALDVFSIDVAGKVCLDLGASTGGFTDVLLQKGAAHVTAIDVGHGQLHPKIAADPRVTAHEGLNARDLSPNHMKSAPEIIVCDLSFVSLHKVLPVPLSLATPDAALIALFKPQFEVGPE-NVGKGGIVTDQTAVEQALGAFPAFLSGCGWLAQAPIPSPIEGGDG-NREYLF 244
>gi|149918794|ref|ZP_01907281.1| rRNA methylase-like protein [Plesiocystis pacifica SIR-1] >gi|149820395|gb|EDM79811.1| rRNA methylase-like protein [Plesiocystis pacifica SIR-1] (267 aa)
Score = 284, Expect = 7.6e-24, Identities = 70/238 (29%), Positives = 123/238 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK----YVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEY 242
           R+D  LV      SR  AQ LI   +VV+    + K+  +V+    + +         +VSR   KL  A++HF ++ +  ++ +D+G+STGGFT  LL+    +VY+IDVG  QL  +L ++ +V+ +++ N RE+E   I + ++    D SFIS+  +   +  +   + + + L+KPQFE+G+ ++G              +         L    LG + S I G ++ N E+L  L +
  S:    10 RIDKLLVERGICDSRSRAQALILAGEVVVGDHAVDKAGAMVDVEAPIRLKSGSAALNPFVSRGGLKLDGALKHFGDVPVTGRVCVDVGASTGGFTDCLLQRGAARVYAIDVGYGQLAWKLSQDPRVVVMDRQNIRELEPGQIPEPVELAVADCSFISLTKVLPHLPPILAPSAQLVVLVKPQFEVGRERVGKGGIVRDAAARADALREVEAHARGLGFSTLGSVPSTITG-REGNQEWLLRLRW 252
>gi|75674830|ref|YP_317251.1| hemolysin A [Nitrobacter winogradskyi Nb-255] >gi|74419700|gb|ABA03899.1| hemolysin A [Nitrobacter winogradskyi Nb-255] (251 aa)
Score = 283, Expect = 1.1e-23, Identities = 71/234 (30%), Positives = 120/234 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      SR  AQ  I    V  +G+ ++K +  V+    +E      YVSR   KL  A+  + +++ + + +D+G+STGGFT+VLL      V+++DVG +QL+  L+ + +V+S+E T+ R +E   +  + + + +D SFIS+  I      L       +AL+KPQFE   +    KG  +    H+ + ++   F S L   ++    SPI+G    N E+  
  S:    14 RADVLLVERGLFESRARAQAAIEAGFVTADGKPVTKVSEAVDVSAAIEAQPAHPYVSRGGVKLAGALAAYPVEIEDHVCLDVGASTGGFTEVLLSEGAALVFAVDVGHDQLHPSLRGDPRVVSMESTDIRSLEGKRLPQRPNVVVMDASFISLKAILPAALALAAAQMHLLALIKPQFE-APRAAIRKGIVRDAAVHRAVCDDIAAFASTLGCSHIEIFPSPIRGGDG-NIEFFL 246
>gi|54023964|ref|YP_118206.1| putative cytotoxin/hemolysin [Nocardia farcinica IFM 10152] >gi|54015472|dbj|BAD56842.1| putative cytotoxin/hemolysin [Nocardia farcinica IFM 10152] (273 aa)
Score = 283, Expect = 1.1e-23, Identities = 75/239 (31%), Positives = 128/239 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE---EEKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILN-IKNLGYIVSPIKGAKKENTEYLFYL 240
           ++ R+D  LV    ARSR  A +LI   +V+I G + SK  T V     + + E   E ++ SR A+KL  A+E F    + +  K  +D G+STGGFT VLL    ++V ++DVG  QL  +L+ + +V   ++TN R +   LI+  ++ +  D+SFIS+ L+   +          + ++KPQFE+GK+   + G  +    +      +   +  + ++ +G + SP+ G    N EY  +L
  S:     3 RRARVDAELVRRGLARSREHAVELIGAGRVLIAGTVASKPATAVEPGTPLVVREQPDEVQWASRGAHKLLGALERFERAGLRVAGKRCLDAGASTGGFTDVLLSREAREVVAVDVGYGQLVWRLRTDERVRVFDRTNVRTLTPELIEGAVELVVGDLSFISLGLVLPALASCCAEGADLLPMVKPQFEVGKERVGSGGVVRDPALRAEAVCGVAAAAAEHGLRTVGAVASPLPGPSG-NVEYFLWL 247
>gi|56552202|ref|YP_163041.1| rRNA methylase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543776|gb|AAV89930.1| predicted rRNA methylase [Zymomonas mobilis subsp. mobilis ZM4] (249 aa)
Score = 283, Expect = 1.1e-23, Identities = 79/241 (32%), Positives = 129/241 (53%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           ++K R+D  LV      S  +AQ LI   +V    + I K+  L+  +D    L+ +   +VSR   KL   +++F   ++N I +D+GSSTGGFT VLL++   +VY++D GTNQ+  +L+++++VI  EQ + R + +  I + +D +  DVSFISI  +            + +AL+KPQFE  K+     G  +  E  +++ +    +L  L    +G   SPI G    N E+L   E
  S:     5 IKKKRVDQQLVEREMVDSLALAQALIMAGEVWNKDRRIEKAGQLL-PIDAPLHLKGKGHPWVSRGGIKLAHGLKYFGWTVDNAIGLDVGSSTGGFTDVLLQSGADRVYAVDSGTNQMAWKLRQDDRVILYEQLSARLLTTDHIPEDVDIVVCDVSFISITKLLEIPLSFAKKGGRLLALVKPQFEARKEEVEKGGIVRDPEVRQRVCSEVKTWLEGLGWHVIGLEKSPITG-HDGNVEFLLAAE 246
>gi|162147643|ref|YP_001602104.1| putative hemolysin A [Gluconacetobacter diazotrophicus PAl 5] >gi|187596041|ref|ZP_02982304.1| hemolysin A [Gluconacetobacter diazotrophicus PAl 5] >gi|161786220|emb|CAP55802.1| putative hemolysin A [Gluconacetobacter diazotrophicus PAl 5] >gi|187491875|gb|EDU29813.1| hemolysin A [Gluconacetobacter diazotrophicus PAl 5] (246 aa)
Score = 283, Expect = 1.2e-23, Identities = 78/237 (32%), Positives = 121/237 (51%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSIL-NIKNLGYIVSPIKGAKKENTEYL 237
           M K R D  LV+     SR  AQ LI    V    + ++K+   + E   + +  ++  +VSR   KL  A+ HF +     I +D+G+STGGFT VLL +   K+Y++DVG  QL  +L+ + +V  LE+ N R ++++ I D ID +  D SFI +  +      L      ++AL+KPQFE G+     KG  +    H  +     ++ S +     LG   SPI G +  N E+L
  S:     1 MAKQRADQMLVDRGLVESRTRAQALILAGLVFSGDRRVAKAGDQLPEDAPLRLKGQDHPWVSRGGIKLAHALAHFGLSPEGGICLDVGASTGGFTDVLLTHGAAKIYAVDVGHGQLAWKLRSDPRVTVLEKCNARALDATTIPDPIDVLVCDASFIGLRTVLPAGLALCRPGAGAVALIKPQFEAGRDAVGPKGVVRDPAIHDAVCATIRDWWSAMPGWTVLGIEPSPITGPEG-NREFL 239
>gi|190890624|ref|YP_001977166.1| hemolysin protein [Rhizobium etli CIAT 652] >gi|190695903|gb|ACE89988.1| hemolysin protein [Rhizobium etli CIAT 652] (248 aa)
Score = 283, Expect = 1.2e-23, Identities = 83/234 (35%), Positives = 125/234 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV+     SR  A+D +    V I GQ+++K+  L+++   + I +  + YVSRAA KL AA+EHF +D      +DIG+STGGFT+VLL+     V +IDVG  Q++ ++  + +V + E  N R + +  I     FI  DVSFIS+ L      ++      ++ L+KPQFE G++     G  K       +   +E  F   +   +LG I SPI G    N E+L 
  S:     8 RLDQLLVSRGLFASRSRARDAVQRGTVRIGGQLVTKAGALISDDADIAIDDPAQDYVSRAALKLAAALEHFRLDPAGHHCLDIGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRISGDPRVTNREGLNARNLTAEDIGQPASFIVSDVSFISLKLALAPALDIAEPGSIAVLLVKPQFEAGREAIGKGGLLKDPSSAPAVAAELERWFTEDMGWNSLGLIPSPIAGGDG-NQEFLL 243
>gi|116670077|ref|YP_831010.1| hemolysin A [Arthrobacter sp. FB24] >gi|116610186|gb|ABK02910.1| hemolysin A [Arthrobacter sp. FB24] (270 aa)
Score = 282, Expect = 1.5e-23, Identities = 75/239 (31%), Positives = 122/239 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           RLD  LV    ARSR  A  LI   KV   G +++K++  V++L  +++ +  ++ YVSRA +KL  A+E F  +    K  +D G+STGGFT+VLL      V ++DVG  QL  QL+ + +V   E  N R +    I         D+SFIS+ L+   +          + ++KPQFE+GK ++G T       + +  +    +      ++  G   SP+ G +  N EY  +++ +
  S:     3 RLDQMLVARGLARSRTHAARLIAEGKVSSEGTVLAKASAQVDDLTPLDVADDGQDTYVSRAGHKLAGALEAFPEVIAEGKRCLDAGASTGGFTEVLLRRGADHVVAVDVGHGQLVPQLRDDPRVSVHEGLNVRYMTPEEIGGPAALTVADLSFISLTLVLEPLAACTEPGGDLVLMVKPQFEIGKDRLGRTGVVNSGRERRMAVEKVAQAALDAGLELRGLAASPLPG-QDGNVEYFLWIKRR 244
>gi|46202619|ref|ZP_00208590.1| COG1189: Predicted rRNA methylase [Magnetospirillum magnetotacticum MS-1] (255 aa)
Score = 282, Expect = 1.6e-23, Identities = 65/181 (35%), Positives = 100/181 (55%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFE 183
           K R+D  LV+     SR  AQ L+    V    + + K  T + E   +E+  ++  +VSR   KL  A+E F +D ++K+A+D+G+STGGFT VLL     +VY++DVG  QL  +L+ + +V+ LE+TN R +    I + +D +  D SFI +  +      L        AL+KPQFE
  S:     4 KKRVDQLLVDRGLVESRSKAQALVMAGLVYSGDRRVDKPGTNMAEDCALELKGQDHPWVSRGGLKLAKALEAFALDPSDKVAVDVGASTGGFTDVLLTYGAARVYAVDVGHGQLAWKLRSDPRVVVLERTNARHLTQEQIPEPVDMVVCDASFIGLETVLPAALALARPGAWVAALIKPQFE 185
>gi|19552628|ref|NP_600630.1| rRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|62390296|ref|YP_225698.1| rRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|145295546|ref|YP_001138367.1| hypothetical protein cgR_1473 [Corynebacterium glutamicum R] >gi|21324180|dbj|BAB98805.1| Predicted rRNA methylases [Corynebacterium glutamicum ATCC 13032] >gi|41325633|emb|CAF21422.1| Predicted rRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|140845466|dbj|BAF54465.1| hypothetical protein [Corynebacterium glutamicum R] (273 aa)
Score = 281, Expect = 1.6e-23, Identities = 74/236 (31%), Positives = 126/236 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  A ++I   +V + G +  K  T+V     + + E+  E + SR A+KL  A+E F    + +  +  +D G+STGGFT VLL     +V ++DVG  QL  +L+ +++V  +++TN R +       + D +  D+SFIS+ L    I ++  +    + ++KPQFE+GK ++G+       E   ++  +  +F + L +     + SP+ G    N EY  +L
  S:     6 RLDAELVRRKIARSREHAVEMIRGRRVFVAGMLALKPATVVEPEVSIRVEEDASEDWASRGAHKLLGALESFEPLGLKVKGRRVLDAGASTGGFTDVLLRREASEVVAVDVGYGQLIWRLQNDDRVRVVDRTNIRYMTLEDTGGECDMMVGDLSFISLKLTLPAIAKVLSDGADLLPMVKPQFEVGKDRLGSGGVVRSPELRAEVTADVAKFAATLGLSLKHVVASPLPGPSG-NVEYFLWL 246
>gi|116073707|ref|ZP_01470969.1| Hemolysin A [Synechococcus sp. RS9916] >gi|116069012|gb|EAU74764.1| Hemolysin A [Synechococcus sp. RS9916] (297 aa)
Score = 281, Expect = 1.9e-23, Identities = 81/239 (33%), Positives = 122/239 (51%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVIN-GQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI----KDKIDFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
            K RLD +L+      +R  AQ LI   KV    GQ++ K    V     V + +  ++VSR   KL  A+E F I +  ++ +D G STGGFT  LL++   +VY IDVG  Q    L+ + +V+  E+TN R +    +      + D    DVSFIS+ L+   ++  L   + +++ L+KPQFE+GK ++G          H   I + +E    L     G + SPI G    N EYL +L
  S:    14 HKTRLDQHLLTLGLVPTRQQAQQLIRAGKVRDGCGQLLDKPGQQVAPDLAVRVEQPPRFVSRGGEKLLGALEVFPIQVEGRVCLDGGISTGGFTDCLLQHGASRVYGIDVGYGQTAWSLRTDPRVVLKERTNLRRLTPEELYGPNDPRPDLAVADVSFISLRLVMPAMQALLTTESSEALLLVKPQFEVGKERVGKGGVVRDPAAHCDAIRDVLESAGSLGWTAYGLVGSPITGPAG-NHEYLLWL 258
>gi|167053440|ref|ZP_02279838.1| hypothetical protein LmonF_13715 [Listeria monocytogenes FSL F2-515] (152 aa)
Score = 280, Expect = 2.4e-23, Identities = 55/138 (39%), Positives = 90/138 (65%)
  Q:    59 YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK 196
           YVSR   KL+ A++ F+ ++ +K+ +DIG+STGGFT   L+N  +  Y++DVG NQL  +L+ +++V  +E+TNFR ++ +   + + DF TIDVSFIS+ LI   ++ +       + L+KPQFE G++    KG  +
  S:     3 YVSRGGLKLEKALQVFDFEVKDKLMLDIGASTGGFTDCALQNGARHSYALDVGYNQLAWKLRNDDRVTVMERTNFRHVKPADFAEGLADFATIDVSFISLKLILPVLRTVLVTGGDVMTLIKPQFEAGREQVGKKGIIR 141
>gi|152990876|ref|YP_001356598.1| hemolysin A [Nitratiruptor sp. SB155-2] >gi|151422737|dbj|BAF70241.1| hemolysin A [Nitratiruptor sp. SB155-2] (234 aa)
Score = 280, Expect = 2.4e-23, Identities = 87/235 (37%), Positives = 134/235 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEI-LEEEKYVSRAAYKLKAAIEHFNID-LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGY-----IVSPIKGAKKENTEYLF 238
           +RLD YL  + +  SR  A +LI    V ++G++++K +    EL K E+ ++ + YVSRAAYKLK  ++  +   + +   +D+G+STGGFTQ+L E   KKV ++DVG+ QL+  +K    VI +  T+ R  E     D  D +T DVSFIS+  I + I  L  +    I L KPQFE+GK++   K     +D K I     +F      K LG+      +S ++G K+ N E+L+
  S:     1 MRLDKYLYQKGFTSSRNKAAELIREGLVSVDGKVVTKPSF---ELQKGEVSIKAKPYVSRAAYKLKHFLDTIDASFIKDAEVLDVGASTGGFTQILCEYGAKKVIALDVGSGQLHPTIKSKQNVIDMSNTDIRTFE----HDPFDIVTCDVSFISVLKIVHHIDRL--SKKYIIILFKPQFEVGKEVKRDKR-GVVQDQKAIEKAMRQFEK--KTKELGWQLVQRKISLVEG-KEGNREWLY 229
>gi|83593952|ref|YP_427704.1| hemolysin A [Rhodospirillum rubrum ATCC 11170] >gi|83576866|gb|ABC23417.1| Hemolysin A [Rhodospirillum rubrum ATCC 11170] (264 aa)
Score = 280, Expect = 2.7e-23, Identities = 74/235 (31%), Positives = 120/235 (51%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSIL-NIKNLGYIVSPIKGAKKENTEYL 237
           K+RLD  LV+     SR  AQ +I    V    + + K+   V     +++  +   +VSR   KL   ++ F         +D+G+STGGFT VLL     KVY++DVG  QL  +L+ + +VI LE+TN R ++++LI + +  +  D SFI +  +              +AL+KPQFE+G+ ++G          H ++     ++L+ L     +G   SPIKG +  N E+L
  S:    20 KLRLDQLLVDRGLVESRAKAQAVILAGLVFSGERRLEKAGAPVAADLAIDVRGQPHPWVSRGGMKLDKGLDSFGFSAEGLTCLDVGASTGGFTDVLLTRGAAKVYAVDVGYGQLAHKLRTDERVIVLERTNARHLDATLIPEPVGAVVCDASFIGLRTVLPAALGRAAPGAFLVALIKPQFEVGRERVGKGGVVRDPALHAEVCTTITDWLAALPGWSVVGLTESPIKGPEG-NIEFL 256
>gi|163766322|ref|ZP_02173348.1| hemolysin A [Anaeromyxobacter sp. K] >gi|196171418|gb|ACG72391.1| hemolysin A [Anaeromyxobacter sp. K] (240 aa)
Score = 279, Expect = 2.8e-23, Identities = 62/175 (35%), Positives = 104/175 (59%)
  Q:     8 IYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE---EEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQF 182
           + LV    A SR  AQ L+    VV+    + K   LV+    + + +    ++YVSR A KL+ A+E F  +D   +   D+G+STGGFT +LL+    KVY+IDVG  QL+ +L+ + +V+  E+ N R++ S  + ++++ +  D+SFIS+ LI   +K +     +++ L+KPQF
  S:     1 MLLVARGLAESRTRAQALVMAGAVVVGEARVDKPGQLVDPEAPIRLKDGAAPQRYVSRGALKLEKALEVFPAVDPRGRTCADLGASTGGFTDLLLQRGAAKVYAIDVGYGQLHPRLRADPRVVVRERENARQLTSEALGERVELVVGDLSFISLRLILPAVKAILLPGGRAVLLVKPQF 179
>gi|83645390|ref|YP_433825.1| rRNA methylase [Hahella chejuensis KCTC 2396] >gi|83633433|gb|ABC29400.1| predicted rRNA methylase [Hahella chejuensis KCTC 2396] (269 aa)
Score = 279, Expect = 2.9e-23, Identities = 71/193 (36%), Positives = 112/193 (58%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVIN-----GQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-----DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKG 193
           +Q  R+D  LV++ Y RSR  A++LI+  K+++        +   S T+++++ K++IL+ E  +YVSR   KL  AI     +   K  +D+G STGGFT   L+     V  ++VG  QL + L+ + +V   E  N +EI  SL++        DF  +D+SFIS  L+   +  L  N+   I+L+KPQFE+G   G  KG
  S:    13 VQASRIDKLLVDQGYCRSRNQARELISLGKIMLQVGAGWEAVTKPSQTVLSDV-KIKILDNELQEYVSRGGLKLAGAIAQVGAEFKGKTVLDVGQSTGGFTDCALKQGAALVVGVEVGHGQLTQSLRDHPQVRVFEGINAKEIPLSLLELTDDGAGYDFAVMDLSFISQTLVLKSVAALLANDGALISLVKPQFEVGPA-GLGKG 215
>gi|22299000|ref|NP_682247.1| hemolysin-like protein [Thermosynechococcus elongatus BP-1] >gi|22295182|dbj|BAC09009.1| hemolysin-like protein [Thermosynechococcus elongatus BP-1] (262 aa)
Score = 279, Expect = 3.0e-23, Identities = 80/236 (33%), Positives = 126/236 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKD---KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +K RLD  LV  +   SR  AQ  I    V +N   I K  TLV     +++  +  YVSR   KL  A+  F + + +++ +D G STGGFT  LL+   + VY IDVG  Q++ +L+++ ++I  E+TN R +  + L  D   + D   +DVSFIS+  +   + EL     + IAL+KPQFE+G+ ++G        +  ++ ++  I   + L  +  G   SPI G    N E+L
  S:     4 RKQRLDSLLVERHLCESRQQAQRWIRAGAVHVNHIPIDKPGTLVAVDATIQVKAKPAYVSRGGEKLAHALGVFPVVVRDRVCLDGGISTGGFTDCLLQAGAQLVYGIDVGYGQVDWKLRQDPRLILRERTNLRYLTPADLYTDDGPRPDLGVVDVSFISLTKVLPALWELLLPPRELIALIKPQFEVGRDRLGKNGVVRDAKARQEAVDQVITAAAALGWQCYGVTPSPILGPAG-NQEFL 243
>gi|117928454|ref|YP_873005.1| hemolysin A [Acidothermus cellulolyticus 11B] >gi|117648917|gb|ABK53019.1| hemolysin A [Acidothermus cellulolyticus 11B] (267 aa)
Score = 279, Expect = 3.0e-23, Identities = 74/236 (31%), Positives = 124/236 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL-EEEKYVSRAAYKLKAAIEHF---NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  A DL+ +  V++ G+   K  T V+  D + +   + +Y SR   KL   +  F    + +  +  +D G+STGGFT VLLE+   +V+++DVG  QL   L+ + +V  LE+TN R I  + +  + +D +  D+SFIS+ L+   +  +   +   + L+KPQFE+G+ ++G        +     I    +    L +  +  + SP++G    N EY  +L
  S:     6 RLDRELVRRGLARSRSEAADLVASGAVLVAGRPAMKPATAVSPQDSLTLRSRQHRYASRGGEKLAPVLAGFIARGLAVAARRCVDAGASTGGFTSVLLEHGAAEVFAVDVGYGQLAWSLRNDPRVRVLERTNIRSITLAHVDGRPVDLVVGDLSFISLTLVLPALVGIARPDADFVLLVKPQFEVGRDQVGAGGVVRAPQARAAAIRKVTDAAHGLGLGTIAAVPSPLRGPAG-NREYFVWL 246
>gi|41207547|gb|AAR99641.1| YiiB [Lactococcus lactis subsp. cremoris] (199 aa)
Score = 278, Expect = 3.7e-23, Identities = 69/173 (39%), Positives = 103/173 (59%)
  Q:    68 KAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFRE-IESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           + A++ FNI +  K  +DIGSSTGGFT V+L+N  K VY++DVGTNQL  +++ + +V+ +EQ NFR  + S   + +  F +IDVSFIS+ LI   + E+     +  AL+KPQFE G+ ++G        + HK  I   +   + L +   G   SPIKG    N E+L +L
  S:     1 EKALKEFNIKIEGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNALLSDFEQGRPAFTSIDVSFISLELILPPLYEILEEGGEVAALIKPQFEAGREQVGKNGIIRDPKVHKMPIEKVLAAATRLGLSIKGLTFSPIKGGAG-NVEFLVHL 174
>gi|467142|gb|AAA50906.1| u0247a [Mycobacterium leprae] (268 aa)
Score = 276, Expect = 6.1e-23, Identities = 62/185 (33%), Positives = 107/185 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           +++R+D+ LV    ARSR  A  LI+  KV I+G    K +T V     + + ++ E+     A+KL  A++ F I +  +  +D G+STGGFT+VLL+    +V ++DVG  QL   ++ + +VI +E+TN  ++   LI   +D +  D+SFIS+  + + +      +   + ++KPQFE+GK
  S:     3 RRVRVDVELVRRGLARSRQQAAKLISAGKVSIDGLPAVKPSTAVAITTVLTVADDGERSWVCGAHKLMGALDTFGIPVAGRCCLDAGASTGGFTEVLLDRGAAEVVAVDVGYGQLAWSVRCDPRVIVVERTNVHDLSPELIGGPVDLVVADLSFISLATVLSALAGCALPSADIVPMVKPQFEVGK 188
>gi|23465615|ref|NP_696218.1| hemolysin-like protein [Bifidobacterium longum NCC2705] >gi|23326286|gb|AAN24854.1| hemolysin-like protein with S4 domain found in bacteria and plants [Bifidobacterium longum NCC2705] (280 aa)
Score = 276, Expect = 6.1e-23, Identities = 78/235 (33%), Positives = 121/235 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNE-LDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIA-------IDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           RLD+ LV      SR  AQ LI    V ++G+ I+K + +V     ++ + + + YVSR AYKL  A E F     N +        +DIG+STGGFT VLL     KV ++DVG  QL+ ++  +  VI +   N RE+E+  +  +   I  DVSFIS+  +   I  +     + + L+KPQFE+G+  +G           ++ +++ +       +  +    SPI G    N EYL Y
  S:    37 RLDMMLVASGLVESRAKAQRLIKAGHVRVDGETITKPSFMVKAGHSELAVDKGDDYVSRGAYKLLGAFETF---AGNGLTGPEGLECLDIGASTGGFTDVLLRGGAAKVVALDVGHGQLDPRIANDEHVIEMSGVNIREVEADDLPYRPAMIVSDVSFISLTYVIPVIARIAAPGAQIVLLVKPQFEVGRAGLGKNGIVEDPALRERALHDVVACAEQHGLDVVATADSPIIGTHG-NEEYLLY 276
>gi|169629445|ref|YP_001703094.1| cytotoxin/hemolysin TlyA [Mycobacterium abscessus] >gi|169241412|emb|CAM62440.1| Cytotoxin/haemolysin homologue TlyA [Mycobacterium abscessus] (268 aa)
Score = 275, Expect = 8.1e-23, Identities = 68/192 (35%), Positives = 110/192 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK 196
           R+D  LV    ARSR  A +LI   +V I+G    K+ T V     + +  E  +++VSR A+KL  A+E F    + +  K  +D G+STGGFT+VLL +  ++V + DVG  QL   L+ +++V  L++TN R +  +LI      I  D+SFIS+ L+ + +      +   + ++KPQFE+GK++    G  +
  S:     6 RVDAELVRRGLARSRQQAAELIEAGRVRIDGIPAVKAATAVPATASLVVQGEAGDRWVSRGAHKLLGALEVFGPQGLSVEGKRCLDAGASTGGFTEVLLRSGAREVVAADVGYGQLAWSLQSDDRVTVLDRTNVRTLTPALIGGTAQLIVSDLSFISLALVLDALIACAGPDADILPMVKPQFEVGKELVGAGGVVR 202
>gi|46191091|ref|ZP_00206673.1| COG1189: Predicted rRNA methylase [Bifidobacterium longum DJO10A] >gi|189439661|ref|YP_001954742.1| Putative rRNA methylase [Bifidobacterium longum DJO10A] >gi|189428096|gb|ACD98244.1| Putative rRNA methylase [Bifidobacterium longum DJO10A] (257 aa)
Score = 275, Expect = 9.2e-23, Identities = 78/235 (33%), Positives = 121/235 (51%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNE-LDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIA-------IDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           RLD+ LV      SR  AQ LI    V ++G+ I+K + +V     ++ + + + YVSR AYKL  A E F     N +        +DIG+STGGFT VLL     KV ++DVG  QL+ ++  +  VI +   N RE+E+  +  +   I  DVSFIS+  +   I  +     + + L+KPQFE+G+  +G           ++ +++ +       +  +    SPI G    N EYL Y
  S:    14 RLDMMLVASGLVESRAKAQRLIKAGHVRVDGETITKPSFMVKAGHSELAVDKGDDYVSRGAYKLLGAFETF---AGNGLTGPEGLECLDIGASTGGFTDVLLRGGAAKVVALDVGHGQLDPRIANDEHVIEMSGVNIREVEADDLPYRPVMIVSDVSFISLTYVIPVIARIAAPGAQIVLLVKPQFEVGRAGLGKNGIVEDPALRERALHDVVACAEQHGLDVVATADSPIIGTHG-NEEYLLY 253
>gi|38233770|ref|NP_939537.1| putative cytotoxin/hemolysin [Corynebacterium diphtheriae NCTC 13129] >gi|38200031|emb|CAE49703.1| Putative cytotoxin/hemolysin [Corynebacterium diphtheriae] (273 aa)
Score = 275, Expect = 1.0e-22, Identities = 72/237 (30%), Positives = 124/237 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           RLD  LV    ARSR  A ++I + +V + G +  K  T V     + + +   + + SR A+KL  A+  F    ++++ + A+D G+STGGFT VLL  +  +V ++DVG  QL  +L+ + +V  L++TN R +   +     D +  D+SFIS+ L    I     +    + ++KPQFE+GK ++G        +   ++  +   F   L +  +  + SP+ G    N EY  +L+
  S:     6 RLDAELVRRKIARSREQAVEMIKDGRVHVQGFVAKKPATQVTPEASIRVEDAGLDDWASRGAHKLLGALAEFKSKGLNVSGRRALDAGASTGGFTDVLLRESASEVVAVDVGYGQLIWRLQNDARVKVLDRTNIRNLSLEITDGPCDLMVGDLSFISLKLTLPAIAACMSDGADLLPMVKPQFEVGKERLGHGGVVRDPKLRAEVTEDIALFAQQLGLSFVDVVASPLPGPSG-NVEYFLWLK 247
>gi|42521830|ref|NP_967210.1| hemolysin [Bdellovibrio bacteriovorus HD100] >gi|39574360|emb|CAE77864.1| hemolysin [Bdellovibrio bacteriovorus HD100] (258 aa)
Score = 274, Expect = 1.1e-22, Identities = 83/237 (35%), Positives = 129/237 (54%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVI--NGQ--IISKSNTLVNELD------KVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFRE------IESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           +K+RLD+YLV +  A+SR  AQ+LI   +V +  N Q  I+ K++  V  LD      +VE     ++VSR   KL+ A+    + +     +D+G STGGFT  LL+    +V  +DVG  Q++  L  N ++  +E  N R       +  +  K+K D + +DVSFISI+LI  ++          ++L+KPQFE+G       G  K    +K++     E  S    K L Y  SPI+G    N  ++F
  S:     3 EKLRLDLYLVEKGLAQSRTHAQELIEAGQVFLFENSQKRILKKASFAV--LDSHHGKIEVEAGPANRFVSRGGLKLEGALAQAGVFVQGLKVLDVGISTGGFTDCLLQKGAAQVLGVDVGHGQVHSSLLSNPRLTVIEGINARNLSREEAVNQATPKEKFDLVVMDVSFISISLIVPELAHFLKTEGCLLSLVKPQFEVGVDGLAKGGIVKDVSLYKEVETRIKELCSQNGFKVLDYFPSPIQGKDGNNEFFVF 254
>gi|78213715|ref|YP_382494.1| hemolysin A [Synechococcus sp. CC9605] >gi|78198174|gb|ABB35939.1| hemolysin A [Synechococcus sp. CC9605] (268 aa)
Score = 273, Expect = 1.4e-22, Identities = 76/238 (31%), Positives = 122/238 (51%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVI-NGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----FITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ L+      SR  AQ LI   KV   +G ++ K  T V    ++ + +  ++VSR   KL   +  F + +  ++ +D G STGGFT  LL++   +VY +DVG  Q    L+ + +V+  E+TN R ++   +    D        DVSFIS+ LI   ++  L+     ++ L+KPQFE+GK ++G          H+  I + I   +    +  G + SPI G    N EY+ +L
  S:     4 KQRLDLELLTRGLVSSRQQAQQLIRAGKVRDGSGNLLDKPGTEVTPERELVVEQPPRFVSRGGEKLLEGLRAFPVPVKERVCLDGGISTGGFTDCLLQHGASRVYGVDVGYGQTAWSLRTDERVVLRERTNLRHLQPDDLYGAGDPWPSLAVTDVSFISLRLILPALRRLLRGPETDALVLVKPQFEVGKSRVGKGGVVRDPAAHRDAIESVIAAAAESGWQPQGLVASPITGPAG-NHEYVLWL 247
>gi|172040777|ref|YP_001800491.1| hypothetical protein cu1097 [Corynebacterium urealyticum DSM 7109] >gi|171852081|emb|CAQ05057.1| hypothetical protein [Corynebacterium urealyticum DSM 7109] (262 aa)
Score = 273, Expect = 1.6e-22, Identities = 72/225 (32%), Positives = 116/225 (51%)
  Q:    16 ARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSI-LNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ARSR  AQ +I   +V +NG +  K  T VN    + + E  E+ + SR A+KL  A+  F    + L  K  +D G+STGGFT V L+    +V ++DVG  QL  +L+ + +V  +++TN R +    I    D +  D+SFISI L+   I E        + ++KPQFE+GK      G  ++ + +  +   +   ++   +     + SP+ G    N EY  +L
  S:     6 ARSREQAQKMIKEGRVQVNGMLAQKPATGVNAEVSIRVAESEEDHWASRGAHKLLGALAAFEPQGLSLEGKRVLDAGASTGGFTDVALDRGASEVLAVDVGYGQLIWRLQNDPRVTVMDRTNVRTLTPEAIGGPADVMVGDLSFISIKLVLPAIAECMAEGADLLPMVKPQFEVGKNRLGPGGVVRSPELRAEVTLDVAREALKYGLSTKAVVASPLPGPSG-NVEYFLWL 235
>gi|177673388|ref|ZP_02945755.1| hemolysin A [Micrococcus luteus NCTC 2665] >gi|172070322|gb|EDT56385.1| hemolysin A [Micrococcus luteus NCTC 2665] (280 aa)
Score = 273, Expect = 1.7e-22, Identities = 63/198 (31%), Positives = 113/198 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK 202
           R D+ L     ARSR     LI   +V+++G+ + +    V     + + +   +YVSRAA+KL +A+E F ++ +  + A+D G+STGGFTQVLLE   ++V ++DVG +QL   ++ + +V+  E  N R++ +  I   +D +  D+SFIS+ L+   +  +     + + ++KPQFE+G++     G     D ++
  S:     6 RADVVLAARGLARSRTEGAALIRAGQVLLDGRPVRRPADRVAADATLRLRDPGPRYVSRAAHKLVSALEAFPDVGVAGRRALDAGASTGGFTQVLLERGAERVAAVDVGHDQLAPPVRADPRVLVREGLNVRDLTAEDIDGPVDLVVSDLSFISLRLVLAPLAGVCRPGAELLLMVKPQFEVGRRALPRSGVVTDPDARR 205
>gi|170781652|ref|YP_001709984.1| hypothetical protein CMS_1246 [Clavibacter michiganensis subsp. sepedonicus] >gi|169156220|emb|CAQ01362.1| conserved hypothetical protein [Clavibacter michiganensis subsp. sepedonicus] (290 aa)
Score = 273, Expect = 1.7e-22, Identities = 77/237 (32%), Positives = 128/237 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE---------SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +RLD  L     ARSR  A  LI +  V ++G+ + K++  V     VE+   + YVSR A+KL  A++ F  +++  ++A+D+G+STGGFTQVLLE   ++V ++DVG  QL+  ++++ +V  +E  N R++            L  +    +  D+SFIS+ L+   I     +    + L+KPQFE+G+  G  +G       +   +   +     L +   G + SPI G    N EYL + 
  S:    24 LRLDAALPALGLARSRTHAARLIVDGLVTVDGRGVVKASFRVMPGSVVEVAGTDAYVSRGAHKLIGALDAFPEVEVAGRLALDVGASTGGFTQVLLERGARRVIALDVGHGQLDPLIREDPRVDVVEGFNVRDLTPESLAGVTPDDLAGEAPALVVGDLSFISLGLVLPAIARTAADGADVVLLIKPQFEVGRT-GIREGIVHDAGLRDDAVMRVLWAAWDLGLGTAGLVSSPIVGGAG-NHEYLAWF 269
>gi|57241998|ref|ZP_00369938.1| hemolysin (tly) [Campylobacter upsaliensis RM3195] >gi|57017190|gb|EAL53971.1| hemolysin (tly) [Campylobacter upsaliensis RM3195] (236 aa)
Score = 272, Expect = 1.8e-22, Identities = 80/184 (43%), Positives = 110/184 (59%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           +R DI+ V +    SR  A +LI N K+ +NG  +  S  L NE D    LE   E YV RAA KLK  +   ++ L     +DIGSSTGGF QVLL+  VK + ++DVG NQL++ L+ + +V SLE  + RE +S   ++K D IT DVSFIS+  + + I  L   +   I L KPQFE+GK+
  S:     1 MRYDIF-VAKRLKISRNKALELIENKKITLNGNFLKPSFEL-NETDGELNLELLSEIYVGRAALKLKGFLAQLSLGLEGLNCLDIGSSTGGFVQVLLQKGVKNIVALDVGNNQLHQSLRHDARVKSLEGVDLREFKS---EEKFDLITCDVSFISLLNLLSYIDSLAKRD--IILLFKPQFEVGKE 179
>gi|90420129|ref|ZP_01228037.1| hemolysin A [Aurantimonas sp. SI85-9A1] >gi|90335463|gb|EAS49213.1| hemolysin A [Aurantimonas sp. SI85-9A1] (254 aa)
Score = 272, Expect = 1.9e-22, Identities = 76/241 (31%), Positives = 128/241 (53%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           + ++RLD+ + +   A SR  A+D I    V ++GQ ++K +  V    ++ + +    YVSRA  KL+AA++ F I +  ++A+D+G+STGGFT+ LL   V  V SIDVG  Q++ ++  + +V ++E  N R++    I  +  D +  DVSFI++ L      EL       + L+KPQFE G++     G  +  D   ++   +     +  + +  G   SPI G    N E+L   E
  S:     9 LSRVRLDVLVSDRGLAASRARARDAIMRGHVKVDGQTVTKPSLNVPPESEITLDDPAADYVSRAGLKLEAALDQFAIPVEGRMAVDLGASTGGFTEALLRRGVAHVVSIDVGHGQMHPRIAADPRVTAIEGLNARDLTREDIGGRAFDLLVADVSFITLRLALPPALELAEPGTTGVFLVKPQFEAGREAIAKNGLLRDPDSAPLVAEAVRDWLAAQPDWQVKGLAPSPIPGGDG-NHEFLLIAE 252
>gi|69244724|ref|ZP_00602988.1| Hemolysin A [Enterococcus faecium DO] >gi|68196315|gb|EAN10744.1| Hemolysin A [Enterococcus faecium DO] (272 aa)
Score = 272, Expect = 1.9e-22, Identities = 77/240 (32%), Positives = 134/240 (55%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNEL-DKVEILEEEK-------YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT-EDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M+K R+D+  V +    +R  A+      + V+ G I ++ N   ++  +K+ +  E +       YVSR   KL+ A++ F++ +  K  +DIG+STGGFT   L+N  K  Y++DVG NQL  +++++ +V+ +E+ NFR  +       I +   IDVSFIS+ L+   +  +     + IAL+KPQFE G++     G  +  + H+K++ + + F +      L    SPI G +  N E+L +L
  S:     1 MEKERVDVLAVKQGLFETREQAK------RSVMAGLIYNEKNERFDKPGEKIPVSSELRVKGKKLPYVSRGGLKLEKALKAFDLSVEGKTLLDIGASTGGFTDAALQNGAKMSYALDVGYNQLAWKIRQDPRVVVMERVNFRYAKPEDFTLGIPEVAVIDVSFISLKLMLPPLHAILKEEGEVIALIKPQFEAGREAVGKNGIVRDPQTHQKVLEDILSFAAQGGYDVLELSYSPITGGEG-NIEFLAHL 243
>gi|152997489|ref|YP_001342324.1| hemolysin A [Marinomonas sp. MWYL1] >gi|150838413|gb|ABR72389.1| hemolysin A [Marinomonas sp. MWYL1] (252 aa)
Score = 272, Expect = 1.9e-22, Identities = 76/236 (32%), Positives = 129/236 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVING-----QIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-----IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKII-NNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +R+D+ L  +  A+SR  AQ  I+  ++         ++   S  L ++++   I +E +KYVSR A KL+ A+ H  +++   + +DIG STGGF+   +++    V  ++VG +QL+ +L+ +  +I LE  N R +    + +       D I +DVSFIS   I  ++  L       I L+KPQFE+GK+     G  K +   K++  +  +F+  L  +   YI SPIKG    N E+L +
  S:     2 LRIDLILTEQGLAKSRSQAQTFISEGRISYKQNEKWIKVTKPSLKLPSDIELNVISDEADKYVSRGALKLEGALLHTKLNIEGFLVLDIGQSTGGFSDCAIQHGAAHVVGVEVGHDQLDPRLRNHQNIICLEGINARNLSVEDLNEHFPEHGFDLIVMDVSFISQTKILPQLPNLLSKTGHLITLVKPQFEVGKEFIGKGGIVKDKQRVKLLEQDMQDFVKRLGFEVKCYIESPIKGGDG-NQEFLLW 248
>gi|170750218|ref|YP_001756478.1| hemolysin A [Methylobacterium radiotolerans JCM 2831] >gi|170656740|gb|ACB25795.1| hemolysin A [Methylobacterium radiotolerans JCM 2831] (263 aa)
Score = 272, Expect = 2.1e-22, Identities = 77/233 (33%), Positives = 123/233 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           R D+YLV   +  SR  AQ  I    V ++G+ +++ +  +    +VE   E  Y SR   KL AA++ F +D   ++A+D+G+STGGFT VLL    + V+++DVG  QL+ +L  + +V + E T+ R + +  +    D  ++DVSFI + L+   +  L       +AL+KPQFE G+ ++G          H ++     E L  L    LG I SP+ G    N E+L
  S:    25 RADLYLVAHGHFESRARAQAAIRAGLVRVDGRPLARPSDSIAPGARVEAEPEHPYASRGGLKLAAALDAFGVDPAGRVALDVGASTGGFTDVLLARGARHVHALDVGRGQLHPRLAGDPRVTNREGTDIRGLGADTLVPPPDLASVDVSFIGLRLVLPVLPGLLRPASAIVALIKPQFEAGRARVGRGGLVRDPAVHAEVCAAVRETLEGLGATILGLIDSPVPGGDG-NAEFL 257
>gi|51511899|gb|AAT70031.1| putative hemolysin [Propionibacterium acnes] >gi|51511901|gb|AAT70032.1| putative hemolysin [Propionibacterium acnes] >gi|51511907|gb|AAT70035.1| putative hemolysin [Propionibacterium acnes] >gi|51511913|gb|AAT70038.1| putative hemolysin [Propionibacterium acnes] >gi|51511915|gb|AAT70039.1| putative hemolysin [Propionibacterium acnes] >gi|51511919|gb|AAT70041.1| putative hemolysin [Propionibacterium acnes] (258 aa)
Score = 272, Expect = 2.2e-22, Identities = 67/184 (36%), Positives = 115/184 (62%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-----DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           +RLD  LV    ARSR +A  L+   +V +N  +++K    V+  D V + +EE +VSRAA+KL  A++   + + +++ +D G+STGGFTQV+L    K V+++DVG +Q++  L+ + +VI  E  N R+++ + +      + +D +  DVSFIS+ +I   I  +   +   + L+KPQFE+G+K
  S:    14 VRLDQALVEAGLARSRTLATRLVREGRVTVNRVVVTKPAMKVSTTD-VLVADEEVWVSRAAHKLLGALDILGVQVPSRV-LDAGASTGGFTQVVLSRGAKLVHAVDVGHDQMSPMLRNDPRVIVHEGLNLRDLQPADLAVDGVIEPVDLVVGDVSFISLTMILEPISAVVSPDGLMLLLVKPQFEVGRK 200
>gi|154149382|ref|YP_001406576.1| ribosomal RNA large subunit methyltransferase J [Campylobacter hominis ATCC BAA-381] >gi|153805391|gb|ABS52398.1| ribosomal RNA large subunit methyltransferase J [Campylobacter hominis ATCC BAA-381] (245 aa)
Score = 271, Expect = 2.6e-22, Identities = 82/186 (44%), Positives = 117/186 (62%)
  Q:    18 SRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNI---------DLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKI 203
           SR  A  LI   K+++NG+I +K++  ++  D +++++E  YV R A KLK+ ++             ++NN   +DIGSSTGGF Q+LL+N  K V ++DVGT+QL E LK + +V   E T+ R  ES   K K DF+T DVSFIS+NLI  +I  LK +    I L KPQFE+GK+    K     +D KKI
  S:    14 SRNQASALIEAEKILLNGEICAKNSFEISGGD-IDVIDE-IYVGRGALKLKSFLKSIKKATFGAKIFDEINNATCLDIGSSTGGFVQILLQNGAKSVVALDVGTSQLAEILKNDERVEVYENTDIRSFES---KIKFDFVTCDVSFISLNLIIERI--LKLSKKYVIILFKPQFEVGKEAKRDKK-GVVKDEKKI 200
>gi|71905826|ref|YP_283413.1| hemolysin A [Dechloromonas aromatica RCB] >gi|71845447|gb|AAZ44943.1| Hemolysin A [Dechloromonas aromatica RCB] (273 aa)
Score = 271, Expect = 2.6e-22, Identities = 77/237 (32%), Positives = 121/237 (51%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI-----KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG-KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +R D  LV +  A SR  AQ +I + +V   G  ISK    + E   + +    E  YVSR   KL  A+    + +  K+ +D+G STGGFT  LL+   K V  +DVG  QL+ QL+ ++ V ++E  N R + ++ +     +   + I  DVSFIS+ L+  ++  L   +   + L+KPQFE+G   IG          +K +   F    + L +K   ++ SPI G    N E+  +L
  S:    28 LRADALLVAQKLAPSRTAAQWMIKSGRVSWAGGAISKPALELPEDTPLTVTADPEAHYVSRGGNKLAGALSETGLTVAGKVCLDVGQSTGGFTDCLLQAGAKHVVGVDVGHGQLHSQLRHDSAVTAIEGVNCRALTAADLGKAFPESGFELIVGDVSFISMTLVLPQLPALLAEHGDLLLLVKPQFEVGPDNIGKGGIVRDIALYKDVETKFRTCAASLGLKVRAWLDSPITGGDG-NREFFIWL 271
>gi|148273167|ref|YP_001222728.1| hypothetical protein CMM_1986 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831097|emb|CAN02042.1| unnamed protein product [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (292 aa)
Score = 271, Expect = 2.8e-22, Identities = 77/237 (32%), Positives = 129/237 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE---------SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +RLD  L     ARSR  A  LI +  V ++G+ + K++  V     VE+   + YVSR A+KL  A++ F  + +  ++A+D+G+STGGFTQVLLE   ++V ++DVG  QL+  ++++ +V  +E  N R++          + L  ++   +  D+SFIS+ L+   I     +    + L+KPQFE+G+  G  +G       +   +   +     L +   G + SPI G    N EYL + 
  S:    26 LRLDAALPALGLARSRTHAARLIADGLVTVDGRGVVKASFRVMPGSVVEVAGSDAYVSRGAHKLIGALDAFPGVAVAGRLALDVGASTGGFTQVLLERGARRVVALDVGHGQLDPLIREDPRVDVVEGFNVRDLTPESLAGVTPADLAGERPGLVVGDLSFISLGLVLPAIACTAADGADVVLLIKPQFEVGRT-GIREGIVHDPGLRDDAVMRVLWAAWDLGLGTAGLVSSPIVGGAG-NHEYLAWF 271
>gi|87301271|ref|ZP_01084112.1| Hemolysin A [Synechococcus sp. WH 5701] >gi|87284239|gb|EAQ76192.1| Hemolysin A [Synechococcus sp. WH 5701] (273 aa)
Score = 270, Expect = 3.4e-22, Identities = 79/238 (33%), Positives = 126/238 (52%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK----IDFITIDVSFISINLIFNKIKE-LKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD +LV    A SR  AQ LI   +V    +++ K    V      E+ +  ++VSR   KL AA+E F + +  ++ +D G STGGF+  LL++  ++VY IDVG  Q    L+ + +V+  E+TN R +    +        D    DVSFIS+ L+   ++  L+ +  +++ L+KPQFE+G+ ++G          H + I   I   + L++   G I SP+ G    N EYL +L
  S:     4 KQRLDQHLVALGLAASRQQAQQLIRAGRVRSGDRVLDKPGQEVAPELVPEVEQPPRFVSRGGEKLVAALETFPLQVQGRVCLDGGISTGGFSDCLLQHGAERVYGIDVGYGQTAWSLRTDPRVVLRERTNLRRLTPEQLYGPDDPWPDLAVADVSFISLALVLPALRALLRPSGAEAVLLVKPQFEVGRERVGKGGVVRDPVAHAEAITAVIAAAAALDLWPWGLIASPLTGPAG-NHEYLLWL 246
>gi|32266018|ref|NP_860050.1| hypothetical protein HH0519 [Helicobacter hepaticus ATCC 51449] >gi|32262067|gb|AAP77116.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] (241 aa)
Score = 270, Expect = 3.5e-22, Identities = 80/237 (33%), Positives = 126/237 (53%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNID-------LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIG-TTKGFAKTEDHKKI-INNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           RLDIYL  +    SR  AQ+ I +  V +NG+++ KS+  +   D+V+I  +   + RA YKL+   E            L  K A+DIGSSTGGF QVLL   V ++  +DVG NQL++ ++ + +V   E+ + RE E     +  D +  DVSFIS+  +    + L   + + I L KPQFE+G+      KG  K +    I + +F  ++     + L +    I   K+ N E+  Y++
  S:     3 RLDIYL--KTLLSSRTKAQEAIESGCVRVNGKVVYKSSLPLKSSDEVDIDTQGLLLGRAGYKLRGFFEELVCKGLWEEGYLVGKRALDIGSSTGGFAQVLLNFGVSEIVCVDVGKNQLHQNMRDDERVRVFEECDVREFEPC---EYFDIVVCDVSFISLYKLMESFERLV--SAECIWLFKPQFEVGRAAKRDKKGVLKDKTLAHIALADFCAYVQTRGFRIL-HTSQSILSGKEGNEEFFVYVQ 240
>gi|169178555|ref|ZP_02839910.1| hemolysin A [Arthrobacter chlorophenolicus A6] >gi|169013625|gb|EDS60230.1| hemolysin A [Arthrobacter chlorophenolicus A6] (271 aa)
Score = 269, Expect = 4.1e-22, Identities = 78/240 (32%), Positives = 125/240 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDK--VEILEEEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNL-GYIVSPIKGAKKENTEYLFYLEYK 243
           +RLD  LV    ARSR  A  LI   KV   G++++K++  V+E     VE  +++ Y SRA +KL  A++ F  +    K  +D G+STGGFT VLL      V ++DVG  QL   L+ + +V   E  N R +    I         D+SFIS+ L+   +          + ++KPQFE+GK ++G T G   +E  +++  + +   ++    +L G  VSP+ G +  N EY  ++  +
  S:     3 VRLDQALVARGLARSRTHAAALIAEGKVSSGGKVLAKASLQVDEGRDLAVEHDDQDTYASRAGHKLAGALDAFPGVTARGKRCLDAGASTGGFTDVLLRRGAAHVVAVDVGHGQLVPHLRSDPRVAVHEGMNVRYMVPEDIGGPAALTVADLSFISLTLVVQALAACTEPGGDLVLMVKPQFEIGKDRLGRT-GVVTSERERRLAVHKVAMAALDAGLDLHGLAVSPLPG-QDGNVEYFLWIRRR 245
>gi|114706809|ref|ZP_01439709.1| hemolysin-like protein [Fulvimarina pelagi HTCC2506] >gi|114537757|gb|EAU40881.1| hemolysin-like protein [Fulvimarina pelagi HTCC2506] (266 aa)
Score = 269, Expect = 4.4e-22, Identities = 77/235 (32%), Positives = 126/235 (53%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK-IGTTKGFAKTEDHKKIINNFIEFLSILNIKNL-GYIVSPIKGAKKENTEYLF 238
           +RLD  LV      +R  A D I    V ++G+   K++ ++    K EI  ++    YVSRAA KL A ++ F I+      +DIG+STGGF+QVLL+     V ++DVG +Q++E L+   ++ ++E  N R++ +  +   + + + +DVSFIS+ L      EL  +    + L+KPQFE G++ IG      + E  + +     ++L      N  G + SPI G    N E+L 
  S:    20 LRLDQALVARGLMPTRSRALDAIKRGGVTVDGRPARKASLMIAA--KAEIAVDDPAAGYVSRAALKLIAGLDAFAIEPAGLDCLDIGASTGGFSQVLLQRGAAHVTAVDVGHDQMHESLRNKPRLTAIEGLNARDLTADDLNGHMPNLLVVDVSFISLTLALPPALELAESGALGLFLVKPQFEAGREAIGKGGLLKEPETAQAVAQGVADWLDAQPGWNTDGLVASPIAGGDG-NREFLL 257
>gi|148240372|ref|YP_001225759.1| rRNA methylase [Synechococcus sp. WH 7803] >gi|147848911|emb|CAK24462.1| Predicted rRNA methylase [Synechococcus sp. WH 7803] (277 aa)
Score = 269, Expect = 4.5e-22, Identities = 79/225 (35%), Positives = 119/225 (52%)
  Q:    16 ARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----FITIDVSFISINLIFNKIKEL--------KWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           A SR  AQ LI   KV   +GQ + K    V E   V + +  ++VSR   KL  A++ F I++  ++ +D G STGGFT  LL++   +VY IDVG  Q    L+ + +V+  E+TN R +    +  + D        DVSFIS+ L+   +  L        +    +++ L+KPQFE+G+ ++G          H+  I + I     LN K  G + SPI G    N EYL +L
  S:    17 AASRQQAQQLIRAGKVRDRHGQRLEKPGFEVTEDTVVRVEQPPRFVSRGGEKLLGALQAFPIEVEGRVCVDGGISTGGFTDCLLQHGATRVYGIDVGYGQTAWSLRTDERVVLKERTNLRRLTPEELFAEGDSRPTLAVADVSFISLQLVLPALSGLLQLDQQGERCCGCEAVLLVKPQFEVGRERVGKGGVVRDPAAHRDAIASVIAAGRALNWKARGLVGSPITGPAG-NHEYLLWL 254
>gi|42560658|ref|NP_975109.1| hemolysin A [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492154|emb|CAE76751.1| hemolysin A [Mycoplasma mycoides subsp. mycoides SC str. PG1] (149 aa)
Score = 268, Expect = 6.2e-22, Identities = 67/132 (50%), Positives = 90/132 (68%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE-KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR 134
           K+RLD Y+   N  +SR  A++ I N +V +N   I K + LV+  D +EI   + +YVSRA  KLK AI  +NIDL NKI +DIG+STGGFTQ  L+NN   VY++DVGT+QL++ L  N KVI++ Q NFR
  S:     2 KLRLDEYIYKNNLTQSRNKAKEHILNKEVYVNNIAIMKPSFLVDSNDLIEIRSTKLEYVSRAYEKLKKAINKWNIDLTNKICLDIGASTGGFTQCCLDNNANLVYAVDVGTDQLHQSLLNNLKVINMSQYNFR 134
>gi|154174617|ref|YP_001408017.1| ribosomal RNA large subunit methyltransferase J [Campylobacter curvus 525.92] >gi|112803325|gb|EAU00669.1| ribosomal RNA large subunit methyltransferase J [Campylobacter curvus 525.92] (237 aa)
Score = 268, Expect = 6.3e-22, Identities = 70/189 (37%), Positives = 107/189 (56%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTK 192
           +R DIY  N     SR  A +LI   K++++ +I  K +           L +E YV R A KLK+ ++  N +++ K A+DIGSSTGGF Q+LL+N    V  +DVG++QL+E+L+ + +V   E T+ RE  ++      + IT DV+FIS+  I + I +   +    I L KPQFE+GK+    K
  S:     1 MRFDIYAANA-LNISRNKAAELIKAGKIMLDSKICDKPSFECESHSHDVALLDEIYVGRGAMKLKSFLDGQNFEISGKDALDIGSSTGGFMQILLQNGANSVVGVDVGSDQLDEKLRSDTRVEIYENTDIREFAATA---GFELITCDVAFISVIEILDAICKNAKSGALIIVLFKPQFEVGKEAKRNK 185
>gi|41407499|ref|NP_960335.1| TlyA [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41395852|gb|AAS03718.1| TlyA [Mycobacterium avium subsp. paratuberculosis K-10] (269 aa)
Score = 267, Expect = 7.7e-22, Identities = 65/185 (35%), Positives = 103/185 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           ++ R+D  LV    ARSR  A +LI   KV I+G    K  T V     + +    E  +VSR A+KL  A++ F I +  +  +D G+STGGFT+VLL+    +V ++DVG  QL   L+ + +V+ +E+TN R++    I    D +  D+SFIS+  +   +      +   + ++KPQFE+GK
  S:     3 RRARVDAELVRRGLARSRQQAAELIGAGKVSIDGMPARKPGTAVAVTAALTVAADGERGWVSRGAHKLLGALDAFEIAVAGRRCLDAGASTGGFTEVLLDRGAAEVVAVDVGYGQLAWSLRSDARVVVVERTNVRDLTPEAIGGPADLVVADLSFISLCTVLPALAGCAAPHADIVPMVKPQFEVGK 189
>gi|119716706|ref|YP_923671.1| hemolysin A [Nocardioides sp. JS614] >gi|119537367|gb|ABL81984.1| hemolysin A [Nocardioides sp. JS614] (279 aa)
Score = 267, Expect = 7.7e-22, Identities = 63/185 (34%), Positives = 107/185 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           +++RLD  LV    ARSR  A +LI   +V + G + +K  T V     + +L++     YVSR  +KL  A+  F    + +  +  +D G+STGGFT VLL +   +V ++DVG  QL  +L+++ +V   ++ N RE+    I  ++D +  D+SFIS+ L+ + +  +   +     ++KPQFE+GK
  S:     4 RRLRLDAELVRRGLARSREHASELIGQGRVKVTGAVATKPATGVTTDVAIVVLDDPDRPDYVSRGGHKLAGALAVFEPAGLVVAGRRCLDAGASTGGFTDVLLRHGASQVVAVDVGYGQLAWRLRQDERVSVHDRVNVRELVPETIGGRVDLVVGDLSFISLALVLDALLGVTEPDGDLALMVKPQFEVGK 194
>gi|182439506|ref|YP_001827225.1| putative rRNA methylase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178468022|dbj|BAG22542.1| putative rRNA methylase [Streptomyces griseus subsp. griseus NBRC 13350] (271 aa)
Score = 266, Expect = 1.0e-21, Identities = 73/236 (30%), Positives = 119/236 (50%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  A  LI   +V +     +K  T V     + + +++    YVSR  +KL  A+  F    + +  + A+D G+STGGFT VLL    ++V ++DVG  QL   L+ + +V+  ++TN RE+    I  + +D +  D+SFI + L+   +      +   + ++KPQFE+GK ++G+       E   + +         L +   G   SP+ G    N EY  +L
  S:     8 RLDAELVRRKLARSREHASQLIAAGRVTVGRTTATKPATQVETAAAIVVTQDDDDPDYVSRGGHKLAGALAAFGPLGLTVRGRRALDAGASTGGFTDVLLRAGARQVVAVDVGYGQLAWSLQSDERVVVKDRTNVRELTLEAIDGEAVDLVVGDLSFIPLGLVLPALARCAAPDADLVLMVKPQFEVGKERLGSGGVVRSPELRAEAVREVARRAWGLGLGVQGVTASPLPGPSG-NVEYFLWL 250
>gi|90023556|ref|YP_529383.1| regulatory protein, DeoR [Saccharophagus degradans 2-40] >gi|89953156|gb|ABD83171.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Saccharophagus degradans 2-40] (262 aa)
Score = 265, Expect = 1.2e-21, Identities = 80/234 (34%), Positives = 122/234 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKV--VINGQIISKSNTLVNELDKVEIL----EEEKYVSRAAYKLKAAIEHFNIDL-NNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD----KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R+D  +V+     SR  A+ LI   KV  V+ G++              EI+    EE+ +VSRAA KL+A ++    +     IA+D+G STGGFT+ LL   V+ V  ++VG +QL+  L+ N +V+ LE  N R ++   +K+      D   +DVSFIS  LI   +  +       ++L+KPQFE+GK      G  K    H+++          L  + L YI SPI G    N E++ 
  S:    10 RIDAVMVSRGLVDSRSQAKRLIDAGKVSVVVAGEMEIARKAAAKVFADAEIVIEKTEEDTFVSRAALKLQAGLDLLPSEFCQGVIALDVGQSTGGFTECLLRRGVQLVVGLEVGHDQLSPSLRNNPQVVCLEGVNARYLDDVPLKEYAPHGFDIAVMDVSFISQTLILPALAPVLKQGGLLVSLVKPQFEVGKAAVGKGGIVKDASLHEQVKIKIEACAQQLGFELLHYIPSPITGGDG-NHEFIL 254
>gi|118462925|ref|YP_882261.1| hemolysin A [Mycobacterium avium 104] >gi|118164212|gb|ABK65109.1| hemolysin A [Mycobacterium avium 104] (269 aa)
Score = 264, Expect = 1.5e-21, Identities = 64/185 (34%), Positives = 103/185 (55%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           ++ R+D  LV    ARSR  A +LI   +V I+G    K  T V     + +    E  +VSR A+KL  A++ F I +  +  +D G+STGGFT+VLL+    +V ++DVG  QL   L+ + +V+ +E+TN R++    I    D +  D+SFIS+  +   +      +   + ++KPQFE+GK
  S:     3 RRARVDAELVRRGLARSRQQAAELIGAGRVSIDGMPARKPGTAVAVTAALTVAADGERGWVSRGAHKLLGALDAFEIAVAGRRCLDAGASTGGFTEVLLDRGAAEVVAVDVGYGQLAWSLRSDARVVVVERTNVRDLTPEAIGGPADLVVADLSFISLCTVLPALAGCAAPHADIVPMVKPQFEVGK 189
>gi|84496710|ref|ZP_00995564.1| putative membrane protein [Janibacter sp. HTCC2649] >gi|84383478|gb|EAP99359.1| putative membrane protein [Janibacter sp. HTCC2649] (259 aa)
Score = 264, Expect = 1.7e-21, Identities = 71/225 (31%), Positives = 121/225 (53%)
  Q:    16 ARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAI---EHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK-IINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ARSRG A++LI    V   G++  K+ T  ++   +E+  +  ++V RAA+KL  A+   E   +  + +  +D+G+STGGFTQVLL      V ++DVG +QL  +L+ + +V     T+ R++    +    D +  D+SFIS+ L+   +  L       + L+KPQFE+G+   +  G      H++  + + +       +   G I SPI G +  NTEYL ++
  S:     6 ARSRGEARELIEAGLVTAAGKVARKAATPADDASPIEVSSDGPRWVGRAAHKLDHALATWEPEGLAASGRSCLDVGASTGGFTQVLLARGASHVVALDVGRDQLVAELQADPRVTERSGTSIRDVGPDDL-GTFDLVVGDLSFISLTLVLEPMALLTDPGADVVLLVKPQFEVGRGRLSKNGIVIDPRHRRQALKDVVAAAQAAGLGIQGLIRSPIHGGEG-NTEYLLWV 233
>gi|33865018|ref|NP_896577.1| hemolysin-like protein [Synechococcus sp. WH 8102] >gi|33638702|emb|CAE06997.1| hemolysin-like protein [Synechococcus sp. WH 8102] (271 aa)
Score = 263, Expect = 2.1e-21, Identities = 77/238 (32%), Positives = 122/238 (51%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVIN-GQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID----FITIDVSFISINLIFNKIKELKWNNW----KSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           K RLD+ L++     SR  AQ LI   KV    G ++ K  T V    ++ + +  ++VSR   KL A ++ F I    ++ +D G STGGFT  LL++   +VY +DVG  Q    L+ + +V+  E+TN R ++   +    D        DVSFIS+ L+   ++ L         +++ L+KPQFE+GK ++G          H+  I   +   + L     G + SPI G    N EY+ +L
  S:     4 KQRLDLELLSRGLVVSRQQAQQLIRAGKVRDGAGTLLDKPGTEVAAALELRVEQPPRFVSRGGEKLLAGLKAFPIATEGRVCLDGGISTGGFTDCLLQHGASRVYGVDVGYGQTAWSLRTDERVVLRERTNLRHLQPEQLYGAEDPWPSLAVTDVSFISLRLVLPALRRLLQPAGGLCPEALVLVKPQFEVGKDRVGKGGVVRDPVAHRDAIELVMAAAAELGWYPQGIVASPITGPAG-NHEYVLWL 250
>gi|29833038|ref|NP_827672.1| rRNA methylase [Streptomyces avermitilis MA-4680] >gi|29610159|dbj|BAC74207.1| putative cytotoxin/hemolysin [Streptomyces avermitilis MA-4680] (271 aa)
Score = 263, Expect = 2.2e-21, Identities = 75/236 (31%), Positives = 118/236 (50%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHF---NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  A  LI   +V +   + +KS T V     + + +++    YVSR  +KL  A+  F    + +  + A+D G+STGGFT VLL   V  V ++DVG  QL   L+ + +V   ++TN RE+    I  + +D +  D+SFI + L+   +          + ++KPQFE+GK ++G+       E   + +         L +   G   SP+ G    N EY  +L
  S:     8 RLDAELVRRKLARSREHAGQLIAAGRVTVGKTLATKSATQVETAAAILVTQDDSDPDYVSRGGHKLAGALAAFVPQGLTVEGRRALDAGASTGGFTDVLLRAGVAHVVAVDVGYGQLAWSLQSDERVTVKDRTNVRELTLEAIDGEPVDLVVGDLSFIPLGLVLPALVRCTAPGADLVMMVKPQFEVGKERLGSGGVVRSPELRAEAVRGVAGRAWELGLGVKGVTASPLPGPSG-NVEYFLWL 250
>gi|153952064|ref|YP_001398173.1| hemolysin A [Campylobacter jejuni subsp. doylei 269.97] >gi|152939510|gb|ABS44251.1| hemolysin A [Campylobacter jejuni subsp. doylei 269.97] (253 aa)
Score = 263, Expect = 2.3e-21, Identities = 92/231 (39%), Positives = 138/231 (59%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           + +++    SR  A +LI N +V++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E  +I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG+NQL+  L+ N KVI  E T+ R  +S   ++K + IT DVSFIS+  +   I  L     + I L KPQFE+GK I   K     +D K I+   ++F        LG+++     S IKG K+ N EY +Y
  S:     5 FFISKRLNISRNKALELIENEEVLLNGKNFKASCDVKNFLENLKKAQDLNPEDVLLADELKLDLLSEIYVSRAALKLKNFLEENDIEVKHKNCLDIGSSTGGFVQILLENKALKITALDVGSNQLHPSLRTNEKVILHENTDLRAFKS---EEKFELITCDVSFISLVNLLYYINNLALK--EMILLFKPQFEVGKNIKRDKK-GVLKDDKAILKARMDFEKA--CAKLGWLLKNTQKSSIKG-KEGNVEYFYY 249
>gi|50842878|ref|YP_056105.1| putative cytotoxin/hemolysin [Propionibacterium acnes KPA171202] >gi|50840480|gb|AAT83147.1| putative cytotoxin/hemolysin [Propionibacterium acnes KPA171202] >gi|51511903|gb|AAT70033.1| putative hemolysin [Propionibacterium acnes] >gi|51511905|gb|AAT70034.1| putative hemolysin [Propionibacterium acnes] >gi|51511909|gb|AAT70036.1| putative hemolysin [Propionibacterium acnes] >gi|51511921|gb|AAT70042.1| putative hemolysin [Propionibacterium acnes] >gi|51511923|gb|AAT70043.1| putative hemolysin [Propionibacterium acnes] >gi|51511925|gb|AAT70044.1| putative hemolysin [Propionibacterium acnes] >gi|51511927|gb|AAT70045.1| putative hemolysin [Propionibacterium acnes] >gi|51511929|gb|AAT70046.1| putative hemolysin [Propionibacterium acnes] >gi|51511931|gb|AAT70047.1| putative hemolysin [Propionibacterium acnes] >gi|51511933|gb|AAT70048.1| putative hemolysin [Propionibacterium acnes] (258 aa)
Score = 262, Expect = 2.7e-21, Identities = 65/184 (35%), Positives = 114/184 (61%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-----DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           +RLD  LV    ARSR +A  L+   +V +N  +++K    V+  D V + +EE +VSR A+KL  A++   + + +++ +D G+STGGFTQV+L    K V+++DVG +Q++  L+ + +VI  E  N R+++ + +      + +D +  DVSFIS+ +I   +  +   +   + L+KPQFE+G+K
  S:    14 VRLDQALVEAGLARSRTLATRLVREGRVTVNRVVVTKPAMKVSTAD-VLVADEEVWVSRGAHKLLGALDILGVQVPSRV-LDAGASTGGFTQVVLSRGAKLVHAVDVGHDQMSPVLRNDPRVIVHEGLNLRDLQPADLAVDGVVEPVDLVVGDVSFISLTMILEPMSAVVSPDGLMLLLVKPQFEVGRK 200
>gi|51511897|gb|AAT70030.1| putative hemolysin [Propionibacterium acnes] >gi|51511911|gb|AAT70037.1| putative hemolysin [Propionibacterium acnes] >gi|51511917|gb|AAT70040.1| putative hemolysin [Propionibacterium acnes] >gi|51511935|gb|AAT70049.1| putative hemolysin [Propionibacterium acnes] >gi|51593081|gb|AAS93795.1| putative hemolysin [Propionibacterium acnes] (258 aa)
Score = 262, Expect = 2.7e-21, Identities = 65/184 (35%), Positives = 114/184 (61%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-----DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           +RLD  LV    ARSR +A  L+   +V +N  +++K    V+  D V + +EE +VSR A+KL  A++   + + +++ +D G+STGGFTQV+L    K V+++DVG +Q++  L+ + +VI  E  N R+++ + +      + +D +  DVSFIS+ +I   +  +   +   + L+KPQFE+G+K
  S:    14 VRLDQALVEAGLARSRTLATRLVREGRVTVNRVVVTKPAMKVSTAD-VLVADEEVWVSRGAHKLLGALDILGVQVPSRV-LDAGASTGGFTQVVLSRGAKLVHAVDVGHDQMSPVLRNDPRVIVHEGLNLRDLQPADLAVDGVVEPVDLVVGDVSFISLTMILEPMSAVVSPDGLMLLLVKPQFEVGRK 200
>gi|119961881|ref|YP_947415.1| hemolysin A [Arthrobacter aurescens TC1] >gi|119948740|gb|ABM07651.1| hemolysin A [Arthrobacter aurescens TC1] (270 aa)
Score = 261, Expect = 3.7e-21, Identities = 70/195 (35%), Positives = 106/195 (54%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVN---ELDKVEILEEEKYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED 199
           RLD  LV    ARSR  A  LI++ KV   G ++ K+   V+   ELD VE   E+ Y SRA +KL  A++ F  + ++ K  +D G+STGGFT VLL     +V ++DVG  QL   L+++ +V   E  N R +    I         D+SFIS+ L+   + +        + ++KPQFE+GK+  +  G   +E+
  S:     3 RLDQELVTRGLARSRTHAAKLISDGKVSSGGHVLVKAAHQVDARTELD-VEAHLEDIYASRAGHKLAGALKVFPGVVVSGKRCLDAGASTGGFTDVLLRQGAAQVVAVDVGHGQLVPHLREDPRVEVHEGLNVRYMTPEEIGGPAKLTVADLSFISLTLVVGPLAQCTEPGGDLVLMVKPQFEVGKERLSRTGVVSSEN 200
>gi|163763738|ref|ZP_02170798.1| deoxyxylulose-5-phosphate synthase [Bacillus selenitireducens MLS10] >gi|160355563|gb|EDP82216.1| deoxyxylulose-5-phosphate synthase [Bacillus selenitireducens MLS10] (185 aa)
Score = 261, Expect = 3.7e-21, Identities = 59/157 (37%), Positives = 93/157 (59%)
  Q:    84 IDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +DIGSSTGGFT   L+N  + VY++DVG NQL  +L+++ +V  +E+TNFR  +       K DF T DVSFISI L+   ++ +   N   + L+KPQFE G+     KG  +    H++++++  +F   L     G   SP++G +  N E+L ++
  S:     2 LDIGSSTGGFTDCALQNGAEHVYALDVGYNQLAWKLRQDERVTVMERTNFRYAKPEDFTGAKPDFATFDVSFISIRLLLPVLQTIIQPNSGIMTLVKPQFEAGRDEVGKKGIIRDRHIHERVLSDLTDFSESLGYTIEGLAPSPVRGGEG-NIEFLMHM 159
>gi|50954393|ref|YP_061681.1| hemolysin [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950875|gb|AAT88576.1| hemolysin [Leifsonia xyli subsp. xyli str. CTCB07] (257 aa)
Score = 261, Expect = 4.2e-21, Identities = 67/227 (29%), Positives = 121/227 (53%)
  Q:    17 RSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD------KIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYK 243
           RSR  A  +I    V ++G+ + +++  V     + +   ++YVSR A+KL AA++ F + +  + A+D G+STGGF+QVLLE     V ++DVG  QL+  L    ++ S E  N R +      D      ++  +  D+SFIS+  +   ++ +  ++   + L+KPQFE+G+  G  +G  +     ++ +   +     + +   G I SPI G++  N E+L  L  +
  S:    10 RSRSRAAAVIAEGLVTVDGKPVIRTSARVGPGQALAVAGADRYVSRGAHKLLAALDAFGVPVAGRTALDAGASTGGFSQVLLERGAGTVVALDVGHGQLSPVLAGEGRLRSFEGVNVRALTPERFADLLGRPVRLGLVVADLSFISLTQVLPALRAVAEDDADFVLLVKPQFEVGRS-GIREGVVRDAGLQEEALTGVLWSGHDVGLGVAGVIRSPIVGSRG-NAEFLVRLTVR 241
>gi|92113572|ref|YP_573500.1| hemolysin A [Chromohalobacter salexigens DSM 3043] >gi|91796662|gb|ABE58801.1| hemolysin A [Chromohalobacter salexigens DSM 3043] (253 aa)
Score = 260, Expect = 4.5e-21, Identities = 64/181 (35%), Positives = 104/181 (57%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVI----NGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE----SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG 185
           RLD  LV + +ARSR  AQ LI + +V +      ++++K    + +  +  + E  EE+YVSRA  KL+  +E  N+  +    +D+G STGGFT   +     +V  I+VG +QL   L+++ +V  LE  N R +      +L  + +    +DVSFIS  LI  ++  +     + I+L+KPQFE+G
  S:     3 RLDQLLVIQGWARSRTRAQRLIRHGRVTLVSTQTPRVLTKPGETLPDTSRFAVAEDPEERYVSRAGLKLEGVLEALNVRFDGMTVLDVGQSTGGFTDCAMRFGAARVVGIEVGHDQLAPTLREDARVTCLEGVNARALPRERLDALAPEGLHAAVMDVSFISQTLILPELAAVLAPGGQLISLVKPQFEVG 193
>gi|148925947|ref|ZP_01809634.1| putative haemolysin [Campylobacter jejuni subsp. jejuni CG8486] >gi|145844933|gb|EDK22037.1| putative haemolysin [Campylobacter jejuni subsp. jejuni CG8486] (251 aa)
Score = 259, Expect = 6.3e-21, Identities = 89/232 (38%), Positives = 138/232 (59%)
  Q:     8 IYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           I+ V++    SR  A +LI N ++++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E  +I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG+NQL+  L+ N K+I  E T+ R  +S   ++K + +T DVSFIS+  +   +  L     + I L KPQFE+GK I   K     +D + I+   ++F        LG+ +     S IKG K+ N EY +Y
  S:     2 IFFVSKRLNISRNKALELIENEEILLNGKSFKASFDVKNFLENLKKTQDLNPEDILLANELKLDLLSEIYVSRAALKLKKFLEENDIEIKHKNCLDIGSSTGGFVQILLENQALKITALDVGSNQLHPSLRANEKIILHENTDLRAFKS---EEKFELVTCDVSFISLINLLYYVDNLALK--EIILLFKPQFEVGKNIKRDKK-GVLKDDRAILKARMDFEK--ECAKLGWFLKNTQKSSIKG-KEGNVEYFYY 247
>gi|45656188|ref|YP_000274.1| hemolysin A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|45599422|gb|AAS68911.1| hemolysin A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (259 aa)
Score = 259, Expect = 6.3e-21, Identities = 85/238 (35%), Positives = 137/238 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK----------DKIDFITIDVSFISINLIFNKIKELKWN----NWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           +KIRLD+ L    +A S   A+ LI +  V++N Q I+K      +  ++ IL    +YVSR  YKL  A E F + ++ K+ ID+G+STGGFTQVLLE    KV++ DVG  QL E+L+ ++ VI  ++ + + + +  I            +   I +D+SFIS+  +F  I++L+        + ++L+KPQFE  +     KG  K    + +I+ +   +L     K +G  V     SPI+G +  N E L +
  S:     4 EKIRLDVLLFERGFADSLEKAKSLILSGSVLVNEQKITKVGFKFPKDSEIRILNIIPEYVSRGVYKLLKAFEVFPLQVDGKLCIDLGASTGGFTQVLLEKGAWKVFACDVGYGQLAEKLRNHSSVIVKDRFHLKNLSALEIDWENNRFQTPHPEAIVIVMDLSFISLRSVFPVIQKLRKEKDIPKLECVSLIKPQFEANRN-DLVKGILKDSKIRFQIVLSLCRYLK----KEIGGFVLGLEWSPIEG-RDGNKEILLF 256
>gi|57238216|ref|YP_178703.1| hemolysin A [Campylobacter jejuni RM1221] >gi|86151550|ref|ZP_01069764.1| hemolysin A [Campylobacter jejuni subsp. jejuni 260.94] >gi|57167020|gb|AAW35799.1| hemolysin A [Campylobacter jejuni RM1221] >gi|85841179|gb|EAQ58427.1| hemolysin A [Campylobacter jejuni subsp. jejuni 260.94] (253 aa)
Score = 259, Expect = 6.5e-21, Identities = 89/231 (38%), Positives = 138/231 (59%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           + V++    SR  A +LI N ++++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E  +I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG+NQL+  L+ N K+I  E T+ R  +S   ++K + +T DVSFIS+  +   +  L     + I L KPQFE+GK I   K     +D K I+   ++F        LG+++     S IKG K+ N EY +Y
  S:     5 FFVSKRLNISRNKALELIENEEILLNGKSFKASFDVKNFLENLKKTQDLNPEDILLANELKLDLLSEIYVSRAALKLKKFLEENDIEIKHKNCLDIGSSTGGFVQILLENQALKITALDVGSNQLHPSLRANEKIILHENTDLRAFKS---EEKFELVTCDVSFISLINLLYYVDNLALK--EIILLFKPQFEVGKNIKRDKK-GVLKDDKAILKARMDFEK--ECAKLGWLLKNTQKSSIKG-KEGNVEYFYY 249
>gi|118475632|ref|YP_892269.1| ribosomal RNA large subunit methyltransferase J [Campylobacter fetus subsp. fetus 82-40] >gi|118414858|gb|ABK83278.1| ribosomal RNA large subunit methyltransferase J [Campylobacter fetus subsp. fetus 82-40] (233 aa)
Score = 258, Expect = 7.6e-21, Identities = 82/202 (40%), Positives = 115/202 (56%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIG-TTKGFAKTEDHKKIIN 205
           +R D++ V+     SR  A +LI +  + +N  +I K +  V   ++V +  +  YVSRAA KLK  +        N  A+D+GSSTGGF Q+LLEN VK V ++DVG+ QL+  L+ + +VI  E T+ R+  SS    K D +T+DVSFISI  I N I  L   +   I L KPQFE+G     + KG  K    KK+IN
  S:     1 MRADVF-VSATLGISRNQASELIKSKNITLNENMIDKPSLEVKGDERV-VANDNIYVSRAALKLKGFLGELKPCFLNLNALDVGSSTGGFVQILLENGVKSVTALDVGSAQLSTVLRNDKRVIVQENTDIRKFNSS----KFDLVTVDVSFISILQILNDIDRLAKRD--IILLFKPQFEVGANAKRSKKGVVKD---KKLIN 192
>gi|15791948|ref|NP_281771.1| hemolysin A [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149939|ref|ZP_01068168.1| hemolysin A [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88596996|ref|ZP_01100232.1| hemolysin A [Campylobacter jejuni subsp. jejuni 84-25] >gi|85839757|gb|EAQ57017.1| hemolysin A [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88190685|gb|EAQ94658.1| hemolysin A [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359945|emb|CAL34734.1| putative haemolysin [Campylobacter jejuni subsp. jejuni NCTC 11168] (253 aa)
Score = 258, Expect = 8.1e-21, Identities = 90/231 (38%), Positives = 138/231 (59%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           + V++    SR  A +LI N ++++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E  +I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG+NQL+  L+ N K+I  E T+ R  +S   ++K + +T DVSFIS+  +   I  L     + I L KPQFE+GK I   K     +D K I+   ++F        LG+++     S IKG K+ N EY +Y
  S:     5 FFVSKRLNISRNKALELIENEEILLNGKSFKASFDVKNFLENLKKTQDLNPEDILLANELKLDLLSEIYVSRAALKLKKFLEENDIEIKHKNCLDIGSSTGGFVQILLENQALKITALDVGSNQLHPSLRVNEKIILHENTDLRAFKS---EEKFELVTCDVSFISLINLLYYIDNLALK--EIILLFKPQFEVGKNIKRDKK-GVLKDDKAILKARMDFEKA--CAKLGWLLKNTQKSSIKG-KEGNVEYFYY 249
>gi|157414870|ref|YP_001482126.1| hemolysin A [Campylobacter jejuni subsp. jejuni 81116] >gi|157385834|gb|ABV52149.1| hemolysin A [Campylobacter jejuni subsp. jejuni 81116] (253 aa)
Score = 258, Expect = 9.2e-21, Identities = 92/231 (39%), Positives = 137/231 (59%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           + V++    SR  A +LI N +V++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E  +I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG NQL+  L+ N K+I  E T+ R  +S   ++K + IT DVSFIS+  +   I  L     + I L KPQFE+GK I   K     +D K I+   ++F        LG+++     S IKG K+ N EY +Y
  S:     5 FFVSKRLNISRNKALELIENEEVLLNGKSFKASFDVKNFLENLKKTQDLNPEDILLTDGLKLDLLSEIYVSRAALKLKNFLEENDIEIKHKNCLDIGSSTGGFVQILLENQALKITALDVGNNQLHLSLRTNEKIILHENTDLRAFKS---EEKFELITCDVSFISLINLLYYIDNLALK--EIILLFKPQFEVGKNIKRDKK-GVLKDDKAILKARMDFEK--ECAKLGWLLKNTQKSSIKG-KEGNVEYFYY 249
>gi|86356557|ref|YP_468449.1| hemolysin protein [Rhizobium etli CFN 42] >gi|86280659|gb|ABC89722.1| hemolysin protein [Rhizobium etli CFN 42] (248 aa)
Score = 258, Expect = 9.6e-21, Identities = 83/234 (35%), Positives = 123/234 (52%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILE-EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           RLD  LV+     SR  A+D +    V I GQ+++K+  L  +   + I +  + YVSRAA KL AA++ F +D      +DIG+STGGFT+VLL+     V +IDVG  Q++ ++  + +V + E  N R + +  I     FI  DVSFIS+ L      +L      ++ L+KPQFE G++     G  K       + + +E  F   +   +LG I SPI G    N EYL 
  S:     8 RLDQLLVSRGLFASRSRARDAVQRGTVRIGGQLVTKAGALFRDDADIAIDDPAQDYVSRAALKLAAALDQFRLDPAGHHCLDIGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRISADPRVTNREGVNARNLTADDIGQPATFIVSDVSFISLKLALAPALDLAAPGAVAVLLVKPQFEAGREAIGKGGLLKDPASAPAVASELERWFTEDMGWNSLGLIPSPISGGDG-NREYLL 243
>gi|145594454|ref|YP_001158751.1| hemolysin A [Salinispora tropica CNB-440] >gi|145303791|gb|ABP54373.1| hemolysin A [Salinispora tropica CNB-440] (281 aa)
Score = 257, Expect = 1.1e-20, Identities = 63/185 (34%), Positives = 99/185 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE---KYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK 186
           ++ RLD  LV    ARSR  A  L+   +V + G    K   LVN  D + +   +   +YVSR  +KL  A+  F    +    +  +D G+STGGFT VLL  +  +V ++DVG  QL   L+ + +V   E+TN R + ++ I   +D    D+SFIS+ L+   +      +     ++KPQFE+G+
  S:     3 RRTRLDAELVRRGLARSREQAAALVEAGRVQLRGVPARKVAALVNPADPLLVTGADPALEYVSRGGHKLAGALASFGPGGLTAAGRRCLDAGASTGGFTDVLLRADAAEVVAVDVGYGQLAWPLRNDERVRVFERTNVRTLTAAAIDGPVDLTVADLSFISLRLVLPALAACTRPDGDLALMVKPQFEVGR 193
>gi|121612817|ref|YP_001000289.1| hemolysin A [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005241|ref|ZP_02270999.1| hemolysin A [Campylobacter jejuni subsp. jejuni 81-176] >gi|87250195|gb|EAQ73153.1| hemolysin A [Campylobacter jejuni subsp. jejuni 81-176] (253 aa)
Score = 257, Expect = 1.3e-20, Identities = 92/231 (39%), Positives = 136/231 (58%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           + V++    SR  A +LI N +V++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E   I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG NQL+  L+ N K+I  E T+ R  +S   ++K + IT DVSFIS+  +   I  L     + I L KPQFE+GK I   K     +D K I+   ++F        LG+++     S IKG K+ N EY +Y
  S:     5 FFVSKRLNISRNKALELIENEEVLLNGKSFKASFDVKNFLENLKKTQDLNPEDILLTDGLKLDLLSEIYVSRAALKLKNFLEENGIEIKHKNCLDIGSSTGGFVQILLENQALKITALDVGNNQLHLSLRTNEKIILHENTDLRTFKS---EEKFELITCDVSFISLINLLYYIDNLALK--EIILLFKPQFEVGKNIKRDKK-GVLKDDKAILKARMDFEKA--CAKLGWLLKNTQKSSIKG-KEGNVEYFYY 249
>gi|24213027|ref|NP_710508.1| hemolysin [Leptospira interrogans serovar Lai str. 56601] >gi|24193714|gb|AAN47526.1|AE011220_13 hemolysin [Leptospira interrogans serovar Lai str. 56601] (276 aa)
Score = 256, Expect = 1.3e-20, Identities = 84/238 (35%), Positives = 137/238 (57%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK----------DKIDFITIDVSFISINLIFNKIKELKWN----NWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           +KIRLD+ L    +A S   A+ LI +  V++N Q ++K      +  ++ IL    +YVSR  YKL  A E F + ++ K+ ID+G+STGGFTQVLLE    KV++ DVG  QL E+L+ ++ VI  ++ + + + +  I            +   I +D+SFIS+  +F  I++L+        + ++L+KPQFE  +     KG  K    + +I+ +   +L     K +G  V     SPI+G +  N E L +
  S:    21 EKIRLDVLLFERGFADSLEKAKSLILSGSVLVNEQKVTKVGFKFPKDSEIRILNIIPEYVSRGVYKLLKAFEVFPLQVDGKLCIDLGASTGGFTQVLLEKGAWKVFACDVGYGQLAEKLRNHSSVIVKDRFHLKNLSALEIDWENNRFQTPHPEAIVIVMDLSFISLRSVFPVIQKLRKEKDIPKLECVSLIKPQFEANRN-DLVKGILKDSKIRFQIVLSLCRYLK----KEIGGFVLGLEWSPIEG-RDGNKEILLF 273
>gi|18389423|dbj|BAB84188.1| TlyA homolog [Micrococcus luteus] (230 aa)
Score = 255, Expect = 2.0e-20, Identities = 52/145 (35%), Positives = 90/145 (62%)
  Q:    58 KYVSRAAYKLKAAIEHF-NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKK 202
           +YVSRAA+KL +A+E F ++ +  + A+D G+STGGFTQVLLE   ++V ++DVG NQL   ++ + +V+  E  N R++ +  I   +D +  D+SFIS+ L+   +  +     + + ++KPQFE+G++     G     D ++
  S:    10 RYVSRAAHKLVSALEAFPDVGVAGRRALDAGASTGGFTQVLLERGAERVAAVDVGHNQLAPPVRADPRVLVREGLNIRDLTAEDIDGPVDLVVSDLSFISLRLVLAPLASVCRPGAELLLMVKPQFEVGRRALPRSGVVTDPDARR 155
>gi|21220274|ref|NP_626053.1| hypothetical protein SCO1782 [Streptomyces coelicolor A3(2)] >gi|5738498|emb|CAB52846.1| putative membrane protein [Streptomyces coelicolor A3(2)] (271 aa)
Score = 254, Expect = 2.2e-20, Identities = 72/236 (30%), Positives = 116/236 (49%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEK---YVSRAAYKLKAAIEHF---NIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK-DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           RLD  LV    ARSR  A  LI   +V +   + +K  T V     + +  ++    YVSR  +KL  A+  F    + +  + A+D G+STGGFT VLL      V ++DVG  QL   L+++ +V   ++TN RE+    I  + +D +  D+SFI + L+   +          + ++KPQFE+GK ++G+       +   + +         L +   G   SP+ G    N EY  +L
  S:     8 RLDAELVRRKLARSREHASQLIAAGRVTVGKTVATKPATQVETAAAIVVTADDNDPDYVSRGGHKLAGALAAFVPHGLVVEGRRALDAGASTGGFTDVLLRAGAAHVVAVDVGYGQLAWSLRQDERVTVKDRTNVRELTPEAIDGEPVDLVVGDLSFIPLALVLPALVRCTRPGADLVMMVKPQFEVGKERLGSGGVVRSAQLRAEAVRGVARKAWELGLGVKGVTASPLPGPSG-NVEYFLWL 250
>gi|88807360|ref|ZP_01122872.1| Hemolysin A [Synechococcus sp. WH 7805] >gi|88788574|gb|EAR19729.1| Hemolysin A [Synechococcus sp. WH 7805] (290 aa)
Score = 254, Expect = 2.3e-20, Identities = 79/225 (35%), Positives = 122/225 (54%)
  Q:    16 ARSRGVAQDLITNSKVV-INGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI--ESSLIKD--KIDFITIDVSFISINLIFNKIKEL--------KWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           A SR  AQ LI   KV   +GQ + K    V E   V + +  ++VSR   KL AA+  F +++  ++ +D G STGGFT  LL++  ++VY IDVG  Q    L+ + +V+  E+TN R +  E    +D  +      DVSFIS++L+   +  L        +W    ++ L+KPQFE+G+ ++G          H   I + I   + L+ +  G + SPI G    N EYL +L
  S:    30 AASRQQAQQLIRAGKVRDRHGQRLEKPGFEVAEDMVVRVEQPPRFVSRGGEKLLAALLAFPLEVQGRVCVDGGISTGGFTDCLLQHGARRVYGIDVGYGQTAWSLRTDQRVVLQERTNLRRLIPEQLFAEDDPRPTLAVADVSFISLHLVLPALSGLLQVDDQGDRWCGCDAVLLVKPQFEVGRDRVGKGGVVRDPVAHCDAITHVIAAGNALDWRARGLVGSPITGPAG-NHEYLLWL 267
>gi|171056809|ref|YP_001789158.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Leptothrix cholodnii SP-6] >gi|170774254|gb|ACB32393.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Leptothrix cholodnii SP-6] (302 aa)
Score = 253, Expect = 2.9e-20, Identities = 75/239 (31%), Positives = 124/239 (51%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVING----QIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI-----KDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFI-EFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEY 242
           +R+D  ++++  A +R  AQ LI    V   G     + SK+   V +  +VEI +  E ++VSR   KL+ AI     D+  +  +D+G STGGFT +LL+    KV  +DVG +QL  +L+ + +V+  E  N R++  S       +    FIT DVSFIS+  +   +          +AL+KPQFEL        G  + + + + +   + +      +K   Y  SPI+G    NTE+  ++ +
  S:    45 MRIDQLILHKGLAPTRSAAQRLIERKAVRWLGPKGWTVPSKAGEDVPDEAQVEITDASELRFVSRGGLKLEGAIAKCGFDVRGRTCLDVGQSTGGFTDLLLDKGAVKVVGLDVGRDQLAAKLRGDERVVCYEGINARDVAGSAFAAEWPEASFGFITADVSFISLTHVLPTLFSYLAPGGDLLALVKPQFELQPAQIGKGGIVRNKAYFQDVETRVRQCCRDWPMKVHAYFQSPIEGGNG-NTEFFIWVRH 294
>gi|169181017|ref|ZP_02841657.1| RNA-binding S4 domain protein [Thauera sp. MZ1T] >gi|169011872|gb|EDS58628.1| RNA-binding S4 domain protein [Thauera sp. MZ1T] (285 aa)
Score = 253, Expect = 3.2e-20, Identities = 62/190 (32%), Positives = 108/190 (56%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-----IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKG 193
           +R+D  LV +  A SR  A+ LI   +V   GQ ++K    +    ++ +   + +++VSR A KL+ A+    +D+     +DIG STGGFT  LL+    +V  ++VG +QL+ +L+ + + ++LE  N R+++++ +         D +  D SFIS+ L+  +   L       +AL+KPQFE+G + G  KG
  S:    29 LRVDQLLVAQGLAASRTAARALIEAGRVSHEGQPVAKPALELPPDARLAVTPADSDRFVSRGALKLEGALARSGLDVRGATCLDIGQSTGGFTDCLLQAGAARVVGVEVGHDQLHPRLRADRRCVTLEGINARQLDAAALGGHYPPHGFDLLVCDASFISLALLLPQWAALLAPAGHVLALVKPQFEVGPQ-GLGKG 224
>gi|86153411|ref|ZP_01071615.1| ribosomal RNA large subunit methyltransferase J [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843137|gb|EAQ60348.1| ribosomal RNA large subunit methyltransferase J [Campylobacter jejuni subsp. jejuni HB93-13] (253 aa)
Score = 253, Expect = 3.5e-20, Identities = 88/231 (38%), Positives = 137/231 (59%)
  Q:     9 YLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE------------------EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIV-----SPIKGAKKENTEYLFY 239
           + V++    SR  A +LI N ++++NG+    S  + N L+ ++  ++                  E YVSRAA KLK  +E  +I++ +K  +DIGSSTGGF Q+LLEN   K+ ++DVG+NQL+  L+ N K+I  E T+ R  +S   ++K + +T DVSFIS+  +   +  L     + I L KPQFE+GK I   K     +D K I+   ++F        L +++     S IKG K+ N EY +Y
  S:     5 FFVSKRLNISRNKALELIENEEILLNGKSFKASFDVKNFLENLKKTQDLNPEDILLANELKLDLLSEIYVSRAALKLKKFLEENDIEIKHKNCLDIGSSTGGFVQILLENQALKITALDVGSNQLHPSLRANEKIILHENTDLRAFKS---EEKFELVTCDVSFISLINLLYYVDNLALK--EIILLFKPQFEVGKNIKRDKK-GVLKDDKAILKARMDFEK--ECAKLSWLLKNTQKSSIKG-KEGNVEYFYY 249
>gi|148242995|ref|YP_001228152.1| rRNA methylase [Synechococcus sp. RCC307] >gi|147851305|emb|CAK28799.1| Predicted rRNA methylase [Synechococcus sp. RCC307] (271 aa)
Score = 253, Expect = 3.6e-20, Identities = 75/244 (30%), Positives = 122/244 (50%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLI----KDKIDFITIDVSFISINLIFNKIKELKWN--NWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           ++ RLD+ LV      SR  AQ LI   KV +   ++ K    ++     E+    ++VSR   KL AA+E   + +  +  +D G STGGF+  LL++   ++Y IDVG  Q    L+++ +V+  E+TN R +    +      + D    D+SFIS++ +   ++ L       +++ L+KPQFE+G+ ++G        + H   I         L     G + SPI GA   N EYL +L  K E
  S:     3 RRQRLDLRLVELGLVASRQKAQQLIRAGKVRLGDAVLDKPGHEISLEAVPEVTLPPRFVSRGGEKLAAALEALPVQVEGRCCLDAGISTGGFSDCLLQHGASRIYGIDVGYGQTAWSLRQDPRVVLRERTNLRHLTPEDLYGPGDPQPDLAVADLSFISLSRVLEPMQGLLAGGPQTEAVLLVKPQFEVGRERVGKGGVVRDPKAHADAIALVAAAAEPLQWFPQGLVGSPITGAAG-NHEYLLWLGPKAE 252
>gi|183601729|ref|ZP_02963099.1| possible rRNA methyltransferase [Bifidobacterium animalis subsp. lactis HN019] >gi|183219335|gb|EDT89976.1| possible rRNA methyltransferase [Bifidobacterium animalis subsp. lactis HN019] (262 aa)
Score = 251, Expect = 6.2e-20, Identities = 79/240 (32%), Positives = 118/240 (49%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELD--KVEILEEEKYVSRAAYKLKAAIEHFN----IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK--IGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           M++ RLD+ + N     SR  AQ LI   KV +NG   +K    V       V +  E+ YVSR A KL  A   F       +  K  +DIG+STGGF  VLL     +V ++DVG  QL+ ++  + +VI +   N R +    +  + D I  DVSFIS+  +   I E+     + + L+KPQFE+G+K  +G           ++ +           ++ +    SPI+G    N EYL YL
  S:    11 MREERLDVVVANAT-GESRSKAQRLIKTGKVHVNGHPQTKPAYAVQPESTISVHMAMEDDYVSRGALKLLGAFNAFAPAGFTSVEGKHCLDIGASTGGFCDVLLRRGAAQVIALDVGHGQLDPRIADDPRVIEMSGVNMRYVGVDDLPYRPDVIVSDVSFISLTYLMAAIAEVAAPAAQIVLLVKPQFEVGQKGRLGKNGIVTDPSLREQALERVERCAREHGLQVVASAPSPIEGTHG-NAEYLLYL 256
>gi|116754873|ref|YP_843991.1| RNA-binding S4 domain-containing protein [Methanosaeta thermophila PT] >gi|116666324|gb|ABK15351.1| RNA-binding S4 domain protein [Methanosaeta thermophila PT] (238 aa)
Score = 250, Expect = 7.1e-20, Identities = 68/237 (28%), Positives = 125/237 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNK---VISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKE--NTEYLFYL 240
           +RLDIYLV    A SR  A  LI + KV++NG +  K +  V   D+VEI+E  +YVSR  YK++A  +  + ++     +D+G S GGF+   L++   +V+ ID+    ++  +  + +      ++  +F E+   L  ++ D  ++DVS +S+  +   +K    ++ + +AL KP +E+        G  +  D ++  ++F ++L     + +    SPI+G  K     EYL+ L
  S:     3 MRLDIYLVE--IAGSRSKAVHLIKSGKVMVNGAVCRKQSYRVKPGDRVEIVEGFRYVSRGGYKIEALFQGRSDEIRGLSVLDVGCSAGGFSDFFLQHGAARVWGIDIAEGCVDPAMLSDPRFRFTGGVDARSFEELVKHLGDERFDLTSVDVSNVSLREVLPNLKRFLKSDGRIVALFKPPYEI-------DGGHRDADVERARSSFEQWLGP-EFEVIHSCPSPIRGGPKNRGTVEYLYLL 234
>gi|159037525|ref|YP_001536778.1| hemolysin A [Salinispora arenicola CNS-205] >gi|157916360|gb|ABV97787.1| hemolysin A [Salinispora arenicola CNS-205] (281 aa)
Score = 249, Expect = 9.1e-20, Identities = 62/186 (33%), Positives = 99/186 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE---KYVSRAAYKLKAAIEHFN---IDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           ++ RLD  LV    ARSR  A  L+   +V + G    K   LV+  D + +   +   +YVSR  +KL  A+  F    +    +  +D G+STGGFT VLL  +  +V ++DVG  QL   L+ + +V   E+TN R +    I   +D    D+SFIS+ L+   +      +   + ++KPQFE+G++
  S:     3 RRTRLDAELVRRGLARSREQAAALVEAGRVQLRGIPARKVAALVDPADPLLVTGADPSLEYVSRGGHKLAGALASFGPGGLAAAGRRCLDAGASTGGFTDVLLRADAAEVVAVDVGYGQLAWPLRNDERVRVFERTNVRSLTPGDIDGLVDLTVADLSFISLRLVLPALAACTRPDGDLVLMVKPQFEVGRE 194
>gi|153891255|ref|ZP_02012283.1| hemolysin A [Opitutaceae bacterium TAV2] >gi|151582665|gb|EDN46190.1| hemolysin A [Opitutaceae bacterium TAV2] (253 aa)
Score = 247, Expect = 1.8e-19, Identities = 59/184 (32%), Positives = 102/184 (55%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKW-----NNWKSIALLKPQFELGK 186
           K+RLD  LV   +  +R  A+ ++ + +V +  + + K          + I +  ++VSR   KL+  IE F++D+     +D+G+STGGFT   L++    V  +DVG  QL+ +L+ + +V ++EQTN R ++   L +   D + +D+SFIS+  +   +    W          +AL+KPQFE GK
  S:     6 KLRLDELLVARGFVETRSQARAIVMSGRVRLGTERLDKPGKTYPADLPLTIDQPPRFVSRGGEKLQGFIEKFSLDVRAAHVLDVGASTGGFTDCALQSGAASVVCVDVGRAQLHTRLRGDPRVTNIEQTNARHLKPGDLPRPAFDAVVMDLSFISLKSVLPAV----WPFVAPGGGVLVALVKPQFEAGK 191
>gi|149928230|ref|ZP_01916474.1| Hemolysin A [Limnobacter sp. MED105] >gi|149823036|gb|EDM82277.1| Hemolysin A [Limnobacter sp. MED105] (266 aa)
Score = 246, Expect = 2.2e-19, Identities = 76/236 (32%), Positives = 124/236 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKV-VINGQI-----ISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI----------DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDH--KKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +R D+ LV +    SR  AQ LI   KV V NG +     + K++  +     +E+++     +VSR   KL  A+E   I+++ +  ID+G STGGFT  LL+     V  IDVG  QL+ +L+ +  V++LE  N  +I +  ++  I          D    D+SFIS+  +   I +L     + + L+KPQFE+G +     G  K  D   +++ N+     + L++    +    +KG    N EY  Y
  S:     1 MRADLALVEKGLCPSRAQAQILIEQGKVQVRNGVVQAPVVVKKASQQIEPFMTLELIDCDAPSFVSRGGLKLHHALETTKIEVHARRCIDLGQSTGGFTDCLLQKGASSVVGIDVGREQLHPRLRGHQAVMALEGINLYKINAGDLEKDIAALKPEFMPFDLAVADLSFISLRKVLPNIAKLMPARCEGLFLVKPQFEVGPENIGKNGLVKNLDDLIEQLENDIKTCCAQLDLTVKDFFQCELKGGDG-NQEYFVY 255
>gi|167646118|ref|YP_001683781.1| hemolysin A [Caulobacter sp. K31] >gi|167348548|gb|ABZ71283.1| hemolysin A [Caulobacter sp. K31] (247 aa)
Score = 245, Expect = 2.4e-19, Identities = 71/234 (30%), Positives = 116/234 (49%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELG----KKIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           R D+ LV      +R  A+  I    +  +G+ ++K + L+ +  K++      +V R A KL  A++ + I+   +IA+D+G+STGGFT+VLLE    +V++ DVG  QL+ +L  + +V  L   + R ++   +      +  DVSFIS+        +L       + L+KPQFE G     K G  K  A   +    ++ F+E  S   IK  G   SPI G   +    L+
  S:     9 RADVLLVETGLFETRAKARAAIEAGLITADGRKVAKPSELLEDTVKLDGRPPHPWVGRGALKLVHALDLWAIEAAGRIALDVGASTGGFTEVLLERGAARVFACDVGREQLHPRLAHHERVTDLSGVDARILDEGYLDATPTLVVSDVSFISVEKCLPVALDLAAPGSDLVCLIKPQFEAGFGRVGKNGIVKDPAVIAECIASVSTFVED-SGWTIK--GVTQSPITGGDGQEEHLLW 243
>gi|158313587|ref|YP_001506095.1| hemolysin A [Frankia sp. EAN1pec] >gi|158108992|gb|ABW11189.1| hemolysin A [Frankia sp. EAN1pec] (329 aa)
Score = 245, Expect = 3.1e-19, Identities = 74/239 (30%), Positives = 127/239 (53%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKV--EILEEEKYVSRAAYKLKAAIEHFNI------DLNN---------------------------KIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAK-TEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           ++IRLD  LV      SR  A + I   +V + G   +K  T+V+    +   + ++  Y SR A+KL  A E F +      DL+                            +  +D G+STGGFT VLL     +V ++DVG  QL  +L+ + +V  L++TN R +    + + ++ +  D+SFIS+ L+   ++     +   + L+KPQFE+G+++  + G  +    H + +   +     L +   G   SP+ G    N EYL +L
  S:     3 RRIRLDAELVRRRLVPSRERAVEAIAAGRVRVGGVTATKPATVVDGATSIVLAVDDDPGYASRGAHKLVGAFEAFGVPAPGTPDLSGGPGQPDVPDRPGSPAAVAGPPALVVAGRRCLDAGASTGGFTDVLLRYGAARVVAVDVGYGQLVWRLRSDPRVRVLDRTNVRNLTPEQVGEPVELVVGDLSFISLVLVLPALRACAAPDADFVLLVKPQFEVGRELLGSGGVVRDVALHARAVRTVVTAAEGLGLGVRGVAASPLPGPAG-NVEYLAWL 276
>gi|154508712|ref|ZP_02044354.1| hypothetical protein ACTODO_01220 [Actinomyces odontolyticus ATCC 17982] >gi|153798346|gb|EDN80766.1| hypothetical protein ACTODO_01220 [Actinomyces odontolyticus ATCC 17982] (275 aa)
Score = 242, Expect = 5.9e-19, Identities = 61/200 (30%), Positives = 109/200 (54%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNID---LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDH 200
           M+  R+D  LV    A+SR  A  +I + +V ++GQI+ K    ++    + + E +  +YVSR A+KL   ++        +  + A+D G+STGGFT VLL      V ++DVG  QL  +L+ + +V   ++TN R ++ + +    + +  D+SFIS+ L+   +      +   + ++KPQFE+GK+     G  +  +H
  S:     1 MKLRRIDSELVRRGLAKSRAAAAQMIEDGRVKLDGQIVLKPARQMDPAQAIVVEESDDPEYVSRGAHKLAGVLDALGDKAPLIEGRRALDAGASTGGFTDVLLRRGAASVVAVDVGYGQLAWKLQSDPRVEVHDRTNVRTLDPASVAPAPELVVGDMSFISLTLVLPALVAAAAPHADFLLMVKPQFEIGKERLGHGGVVRNPEH 205
>gi|49473999|ref|YP_032041.1| hemolysin-like protein [Bartonella quintana str. Toulouse] >gi|49239502|emb|CAF25855.1| Hemolysin-like protein [Bartonella quintana str. Toulouse] (177 aa)
Score = 236, Expect = 2.7e-18, Identities = 55/129 (42%), Positives = 78/129 (60%)
  Q:    59 YVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI-ESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKK 187
           YVS AA KL  A++ F I  +   AIDIG+STGGFTQVLLE     V ++DVG +QL   L  N+ +  LE  N R++ +  L   +I  I  D+SFIS+ L    +  L     +++ L+KPQFE+G++
  S:    24 YVSCAALKLMHALDAFPIVTDKVTAIDIGASTGGFTQVLLERGATHVIAVDVGHHQLGACLAGNSAITLLEGLNVRDLKQKHLGGREIGLIISDISFISLKLALPPVLSLAKKGAQAVLLVKPQFEIGRE 153
>gi|91789970|ref|YP_550922.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Polaromonas sp. JS666] >gi|91699195|gb|ABE46024.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Polaromonas sp. JS666] (332 aa)
Score = 236, Expect = 2.8e-18, Identities = 80/236 (33%), Positives = 133/236 (56%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNS---KVVING--QIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR-----------------------------EIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK----KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +R D++LV   +A +R  AQ LI +    +   +G  + ++K+   V +  ++++L+  E KY+SR   KL+ A++   +D+     +DIG STGGFT  LL++   +V  +DVG  QL+  ++ + +V+ +E  N R                             E E+ L  D  DF+T D+SFIS+ L+   +  L       + L+KPQFEL      K G  +  A  E  +K + +    L  L++K   ++ SPI G    N E+  Y
  S:     1 MRADLFLVEHGFATTRSQAQRLIASGVQWRAEEDGAWKKVAKNGDEVPDGAELQVLDNTEAKYISRGGLKLEGALKSTGVDVTGLRCLDIGQSTGGFTDCLLQHGAAQVVGVDVGHGQLHASMRADPRVVCIEGVNARSMTAMDLIAGPAHEAGADEGGFDDDEAGLEAETPLDAD-FDFLTGDLSFISLTLVLPAVVRLLKPGGDVLMLVKPQFELQPGQIGKGGIVREAALFEFVEKRLRDACIALG-LDVK--AWLASPIDGGDG-NREFFIY 271
>gi|75763308|ref|ZP_00743054.1| Putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489208|gb|EAO52678.1| Putative cell adhesion protein (contact hemolysin TlyA-related) [Bacillus thuringiensis serovar israelensis ATCC 35646] (143 aa)
Score = 235, Expect = 4.0e-18, Identities = 52/136 (38%), Positives = 84/136 (61%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE-EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREI 136
           ++K R+D+ LV      +R  A+  I    V  N   + K    +++  ++ +  +   YVSR  YKL+ A+E F++DL +K+ IDIGSSTGGFT   L+N  K  Y++DVG NQL  +L+++ +V+ +E+TNFR +
  S:     3 VKKERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKISQDTEITVKGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYV 139
>gi|134101754|ref|YP_001107415.1| putative cytotoxin/hemolysin [Saccharopolyspora erythraea NRRL 2338] >gi|133914377|emb|CAM04490.1| putative cytotoxin/hemolysin [Saccharopolyspora erythraea NRRL 2338] (252 aa)
Score = 233, Expect = 6.8e-18, Identities = 64/204 (31%), Positives = 109/204 (53%)
  Q:    37 IISKSNTLVNELDK----VEILEEEKYVSRAAYKLKAAIEHFNID---LNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHK-KIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +  KS T V ELD      E +++  + SR A+KL  A+E F  +   ++ +  +D G+STGGFT VLL    K+V ++DVG  QL  +L+ + +V   ++TN R +    I  +++ +  D+SFIS+ L+   +          + ++KPQFE+GK+   + G  +  D +   +   + F     +   G + SP+ G    N EY  +L
  S:     2 VARKSATAV-ELDAPVLVAEDVDDPGWASRGAHKLLGALEAFEPEGFRVDGRRCLDAGASTGGFTDVLLRRGAKEVVAVDVGYGQLVWKLQTDERVKIHDRTNVRSLTPEEIGGQVELVVADLSFISLKLVLPALIACAAEGADIVPMIKPQFEVGKQRLGSGGVVRDPDLRADAVLEVVRFAENSGLGLRGVVASPLPGPSG-NVEYFAWL 211
>gi|170740614|ref|YP_001769269.1| hemolysin A [Methylobacterium sp. 4-46] >gi|168194888|gb|ACA16835.1| hemolysin A [Methylobacterium sp. 4-46] (250 aa)
Score = 229, Expect = 1.9e-17, Identities = 72/236 (30%), Positives = 119/236 (50%)
  Q:     2 QKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYL 237
           +++R D  LV      SR  AQ  I    V  +G  + +++ L++    +       +VSR   KL+AA++ F +D      +D+G+STGGFT VLL     +VY++DVG  QL+ ++  + +V+S E T+ R +   L         +DVSFIS+ L+   +  L     + +AL+KPQFE G+ ++G            ++     + +  L  +  G I SPI+G    N E+L
  S:     5 ERVRADRLLVEAGLFESRARAQAAIAAGLVRADGAPVRRASDLLSRAAVLGAEAPHPFVSRGGLKLEAALDAFGVDPAGLTCLDLGASTGGFTDVLLRRGAARVYAVDVGRGQLHPRIAADPRVVSHEATDARGLAPDLFAAPPALAVVDVSFISLRLVLPVLPALLAPAARLVALIKPQFEAGRERVGRGGLVRDAAVQAEVCAGIRDLVGALGFRVEGLIPSPIEGGDG-NREFL 240
>gi|168525710|ref|ZP_02719349.1| hemolysin (tlyA) [Borrelia burgdorferi 118a] (263 aa)
Score = 228, Expect = 2.3e-17, Identities = 74/193 (38%), Positives = 109/193 (56%)
  Q:    17 RSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSF-ISINLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE 209
           ++R     LI    + +N         L+N+  K++++E   + +VSR  YKL  A++ F I++ NKI +D+GSSTGGFT  LL+     VYSIDVG NQL+ +L+ + +V  LE+TN  ++     K   +F  +DVSF  SI++  N I +L  N    I L+KPQFE   L   I    G    E  K I+ + IE
  S:    19 KTRKELMILILKGNIYVNSHKEKNPKMLINKTSKIDLVENACQTFVSRGGYKLLEALKDFEIEVKNKICVDVGSSTGGFTDCLLQCGASFVYSIDVGINQLSYKLRIDPRVKVLERTNIFDVTE--FKIVPNFAVVDVSFRSSISICVNLIDKLSDNF--IIVLIKPQFEFKSLNLDIKNFNGVVSGEYLKIILQSVIE 213
>gi|168579528|ref|ZP_02723546.1| hemolysin (tlyA) [Borrelia burgdorferi 72a] >gi|168692144|ref|ZP_02724936.1| hemolysin (tlyA) [Borrelia burgdorferi 94a] >gi|195954990|ref|ZP_03093683.1| hemolysin (tlyA) [Borrelia burgdorferi CA-11.2a] (263 aa)
Score = 228, Expect = 2.3e-17, Identities = 73/185 (39%), Positives = 106/185 (57%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSF-ISINLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE 209
           LI    + +N         L+N+  K++++E   + +VSR  YKL  A++ F I++ NKI +D+GSSTGGFT  LL+     VYSIDVG NQL+ +L+ + +V  LE+TN  ++     K   +F  +DVSF  SI++  N I +L  N    I L+KPQFE   L   I    G    E  K I+ + IE
  S:    27 LILKGNIYVNSHKEKNPKMLINKTSKIDLVENTCQTFVSRGGYKLLEALKDFEIEVKNKICVDVGSSTGGFTDCLLQCGASFVYSIDVGINQLSYKLRIDPRVKVLERTNIFDVTE--FKIVPNFAVVDVSFRSSISICVNLIDKLSDNF--IIVLIKPQFEFKSLNLDIKNFNGVVSGEYLKIILQSVIE 213
>gi|15594851|ref|NP_212640.1| hemolysin (tlyA) [Borrelia burgdorferi B31] >gi|167931498|ref|ZP_02518585.1| hemolysin (tlyA) [Borrelia burgdorferi 156a] >gi|167933813|ref|ZP_02520888.1| hemolysin (tlyA) [Borrelia burgdorferi ZS7] >gi|167943963|ref|ZP_02531037.1| hemolysin (tlyA) [Borrelia burgdorferi Bol26] >gi|2688423|gb|AAC66873.1| hemolysin (tlyA) [Borrelia burgdorferi B31] (263 aa)
Score = 228, Expect = 2.5e-17, Identities = 73/185 (39%), Positives = 106/185 (57%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSF-ISINLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE 209
           LI    + +N         L+N+  K++++E   + +VSR  YKL  A++ F I++ NKI +D+GSSTGGFT  LL+     VYSIDVG NQL+ +L+ + +V  LE+TN  ++     K   +F  +DVSF  SI++  N I +L  N    I L+KPQFE   L   I    G    E  K I+ + IE
  S:    27 LILKGNIYVNSHKEKNPKILINKTSKIDLVENTCQTFVSRGGYKLLEALKDFEIEVKNKICVDVGSSTGGFTDCLLQCGANFVYSIDVGINQLSYKLRIDPRVKVLERTNIFDVTE--FKIVPNFAVVDVSFRSSISICVNLIDKLSDNF--IIVLIKPQFEFKSLNLDIKNFNGVVSGEYLKIILQSVIE 213
>gi|167575519|ref|ZP_02368393.1| hemolysin [Borrelia valaisiana VS116] (263 aa)
Score = 225, Expect = 5.0e-17, Identities = 77/195 (39%), Positives = 113/195 (57%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSF-ISINLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNL 219
           LI    V +N         L+N+  K++++E   + +VSR  YKL  A++ F I++ NKI +D+GSSTGGFT  LL+     VYSIDVG NQL+ +L+ + +V  LE+TN  ++     K   +F  +DVSF  SI++  N I +L  N    I L+KPQFE   L   I    G    +  K I+ N IE  + + L +KN+
  S:    27 LILTGNVYVNSHKEKNPKMLINKTSKIDLVENTCQIFVSRGGYKLLEALKDFEIEVKNKICVDVGSSTGGFTDCLLQCGANFVYSIDVGINQLSYKLRIDPRVKVLERTNIFDVTE--FKIVPNFAVVDVSFRSSISICVNLIDKLSDNF--IIVLIKPQFEFKSLNLDIENFNGIVNEKYLKIILQNVIEKFYKNKLQVKNI 225
>gi|51598761|ref|YP_072949.1| hemolysin [Borrelia garinii PBi] >gi|51573332|gb|AAU07357.1| hemolysin [Borrelia garinii PBi] (239 aa)
Score = 224, Expect = 7.4e-17, Identities = 74/195 (37%), Positives = 113/195 (57%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSF-ISINLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNL 219
           LI    V +N         L+N+  K++++E   + +VSR  YKL  +++ F I++ NKI +D+GSSTGGFT  LL+     VYS+DVG NQL+ +L+ + +V  LE+TN  ++     K   +F  +DVSF  SI++  N I +L  N    I L+KPQFE   L   I    G    +  K I+ + IE  + + L +KN+
  S:     3 LILTGNVYVNSHKEKNPKILINKTSKIDLVENACQTFVSRGGYKLLESLKDFEIEVKNKICVDVGSSTGGFTDCLLQCGANFVYSVDVGINQLSYKLRIDPRVKVLERTNIFDVTE--FKIVPNFAVVDVSFRSSISICVNLIDKLSDNF--IIVLIKPQFEVKSLNLDIKNFNGVVNGDYLKTILQSVIEKFYKNKLQVKNI 201
>gi|119896876|ref|YP_932089.1| hypothetical protein azo0585 [Azoarcus sp. BH72] >gi|119669289|emb|CAL93202.1| conserved hypothetical protein [Azoarcus sp. BH72] (225 aa)
Score = 223, Expect = 1.0e-16, Identities = 66/212 (31%), Positives = 115/212 (54%)
  Q:    34 NGQIISKSNTLVNELDKVEILEE-----EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK-----IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKG--------FAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           NGQI+ K++  +     +E++ +     E+YVSR   KL  A+    +D   ++ +D+G STGGFT  LL+    +V  ++VG  QL+ +L    + I+LE  N R + ++ +           I  D SFIS+ L+  +   L   +   +AL+KPQFE+G + G +KG        +A+ E   +I        + L+++  G+  SPI G    N E+  ++ +  +
  S:     4 NGQILKKASHSLPIDATIELVADPDDAFERYVSRGGLKLAGALAASGLDPAGRVCLDVGQSTGGFTDCLLQAGATRVVGVEVGHGQLHPRLAGEPRCITLEGVNARHLTAADLAGHCPPGGFGLIVCDASFISLTLLLPQWPALLAADGDILALVKPQFEVGPQ-GLSKGGIVRDASRYAEVERKLRIAAA----AAALDVR--GWYDSPITGTDG-NREFFIWMRHAQD 225
>gi|111115335|ref|YP_709953.1| hemolysin [Borrelia afzelii PKo] >gi|167942223|ref|ZP_02529297.1| hemolysin [Borrelia afzelii ACA-1] >gi|110890609|gb|ABH01777.1| hemolysin [Borrelia afzelii PKo] (263 aa)
Score = 222, Expect = 1.4e-16, Identities = 76/195 (38%), Positives = 113/195 (57%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEE--EKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSF-ISINLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNL 219
           LI    V +N         L+N+  K++++E   + +VSR  YKL  A++ F I++ NKI +D+GSSTGGFT  LL+     VYSIDVG NQL+ +L+ + +V  LE+TN  ++    I    +F  +DVSF  SI++  N I +L  N    I L+KPQFE   L   I    G    +  K I+ + IE  + + L +KN+
  S:    27 LILTGNVYVNSHKEKNPKMLINKASKIDLVENTCQIFVSRGGYKLLEALKGFEIEVKNKICVDVGSSTGGFTDCLLQCGANFVYSIDVGINQLSYKLRIDPRVKVLERTNIFDVTEFEIVP--NFAVVDVSFRSSISICVNLIDKLSDNF--IIVLIKPQFEVKSLNLDIKNFNGVVNGKYLKIILQSVIEKFYKNKLQVKNI 225
>gi|187918372|ref|YP_001883935.1| putative cell adhesion protein [Borrelia hermsii DAH] >gi|119861220|gb|AAX17015.1| putative cell adhesion protein [Borrelia hermsii DAH] (263 aa)
Score = 220, Expect = 2.2e-16, Identities = 75/214 (35%), Positives = 124/214 (57%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHK-------KIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLF 238
           LI   +V +N         L+    K++++E +  ++VSR  +KL  ++E F I L +KI ID+G+STGGFT  LL+   K VY++DVG NQL+ +L+ + +V   E+TN  +I+   ++   +   IDVSF S+  I   + + + ++   +AL+KPQFEL       K F    +++       K+I  F +  + L IKN+  +   IKG +K N E++F
  S:    27 LILTGRVYVNSHKERNPKVLLLRNSKIDLVENKSRQFVSRGGFKLFESLETFKITLKDKICIDVGASTGGFTDCLLQEGAKLVYAVDVGFNQLSYKLRVDPRVRVFEKTNIFDIQQFDMQP--NLAVIDVSFRSVVSICADLID-RLSDRLIVALVKPQFELKGLDLDIKDFNGVVENRYLSEILEKVIRKFYD--NNLQIKNILKLT--IKG-RKGNQEFMF 241
>gi|139436932|ref|ZP_01771092.1| Hypothetical protein COLAER_00065 [Collinsella aerofaciens ATCC 25986] >gi|133776579|gb|EBA40399.1| Hypothetical protein COLAER_00065 [Collinsella aerofaciens ATCC 25986] (270 aa)
Score = 220, Expect = 2.5e-16, Identities = 67/239 (28%), Positives = 106/239 (44%)
  Q:     1 MQKIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           M+++RLD  L+++     R  A   +    V   G+ ++     V     + +     YV R   KL+ A++ F I+      +D+G STGGFT  LL+     V S+DVG  Q +  L+++++V   E+TN  ++        ID    DVSF SI  I + +            L+KPQFE    +    G        +  +   IE  +   +  +   VSPI GAK  N E+  Y
  S:     4 MKRVRLDDELISQGICADRADALRTLMAGLVSSGGERLTSPGLKVIPGLPLHVKGRIPYVGRGGLKLEGALDAFGINPTGLACLDVGCSTGGFTDCLLKRGAAAVVSVDVGRAQFDWSLRQDDRVTLHERTNVTQLPELGYAGAIDLAVCDVSFTSIANIIDAVLACLAPTGSFCTLVKPQFEAPAALVGEGGIVTDPAVRRDTLVAAIELFAAKGLFPVDVCVSPIHGAKG-NVEFFLY 242
>gi|121607649|ref|YP_995456.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Verminephrobacter eiseniae EF01-2] >gi|121552289|gb|ABM56438.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Verminephrobacter eiseniae EF01-2] (251 aa)
Score = 218, Expect = 4.0e-16, Identities = 70/236 (29%), Positives = 123/236 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNS-----KVVINGQIISKSNTLVNELDKVEIL--EEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDK--IDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFI-EFLSILNIKNLGYIVSPIKGAKKENTEYLFY 239
           +R D++L+   +A +R  AQ LI +        +   Q ++K+   +    ++ +L   E +Y+SRA  KL+AA+    + +  +  +D+G STGGFT  LL+    +V  +DVG  QL+ QL+ + +V+ +E  N R + +  +      D IT D+SFIS+ L+   +  L   +   + L+KPQFEL        G  +      ++   I +  + L +  L +  SPI+G    N E+  +
  S:     1 MRADVFLLESGHAATRSQAQRLIASGVHWRPSPLSPWQPVAKNGADIPPGAQLHLLGAAEARYLSRAGLKLEAALGALGLCVAARRCLDVGQSTGGFTDCLLQRGAAQVVGVDVGHGQLHPQLRADARVVCVEGLNARTLTAQSLPGPAGFDLITADLSFISLTLVLPALVPLLAADGDLLLLVKPQFELQPGQLGKGGIVRNAALYAVVERRIRDCCAHLALAVLAWCASPIRGGDG-NREFFVH 245
>gi|121603403|ref|YP_980732.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Polaromonas naphthalenivorans CJ2] >gi|120592372|gb|ABM35811.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Polaromonas naphthalenivorans CJ2] (358 aa)
Score = 217, Expect = 4.9e-16, Identities = 76/238 (31%), Positives = 126/238 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITN------------SKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIK----------------------------------------------DKI-DFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTEDHKKIINNFI-EFLSILNIKNLGYIVSPIKGAKKENTEYLFYLE 241
           +R D++LV   +A +R  AQ LI +             KV  NG  I   N  +  LD  E     KY+SR   KL+ A++   +D+     +DIG STGGFT  LL++   +V  +DVG  QL++ L+ + +V+ +E  N R + +  +                                               D + DF+T D+SFIS+ L+   +  L   +   + L+KPQFEL        G  +   H + +   + +  + L ++   ++ SPI G    N E+  + +
  S:     1 MRADLFLVEHGHATTRSQAQRLIASGVHWRVDEAVAWKKVAKNGDEIP-GNAELQVLDTTE----AKYISRGGLKLEGALKSTGLDVTGLRCLDIGQSTGGFTDCLLQHGATQVVGVDVGHGQLHDSLRADERVVCIEGVNARSLTADDLAVHYRRALHISSGSEEDFEDFEDFDDAEESDDGDEADGVDGVDDGGFDPVFDFLTGDLSFISLTLVLPAVVRLLKADGHLLMLVKPQFELQPGQIGKGGIVRDAAHFEFVEKRLRDACAGLGLEVKAWLESPIAGGDG-NREFFIHAQ 292
>gi|89899464|ref|YP_521935.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Rhodoferax ferrireducens T118] >gi|89344201|gb|ABD68404.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Rhodoferax ferrireducens T118] (273 aa)
Score = 214, Expect = 9.5e-16, Identities = 61/181 (33%), Positives = 104/181 (57%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVING---QIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR------------------------EIESSLIK--DKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFEL 184
           +R D  LV    A +R  AQ LI +    + G   + ++K+   +    ++++L   E +YVSR   KL+AA++   + +     +D+G STGGFT  LL++    V  +DVG+ QL+  L+++ +V+ +E+ N R                        E ++ L++   + D I  D+SFIS  L+   +  L       + L+KPQFEL
  S:     1 MRADQLLVQRQLASTRSQAQRLIADGVQWLKGTEWKTVTKNGDEIPLEAELKLLNDAEARYVSRGGLKLEAALKQVGLSVTGLACLDVGQSTGGFTDCLLQHGAASVVGVDVGSAQLHPSLREDPRVLCIEKVNARALVAADLIAAYEESTGAGGQFDVEEGDADLVEFAPEFDLIVADLSFISQTLVLPAVVPLLKCGGTLLTLVKPQFEL 212
>gi|124268471|ref|YP_001022475.1| putative hemolysin [Methylibium petroleiphilum PM1] >gi|124261246|gb|ABM96240.1| putative hemolysin [Methylibium petroleiphilum PM1] (260 aa)
Score = 212, Expect = 1.7e-15, Identities = 62/193 (32%), Positives = 98/193 (50%)
  Q:     5 RLDIYLVNENYARSRGVAQDLITNSKVVINGQI----ISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFR-----EIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKT 197
           R+D  +V    A +R  AQ LI    V     +    + KS   + E  ++ I +  E ++VSRA  KL  A+    + +    A+D+G STGGFT+VLL +    V  +DVG  QL+  L+ + +V  LE  N R      + +++       +  D+SFI +  +   +  L   +   +AL+KPQFEL  K     G  K+
  S:     3 RVDQLIVQRGLAPTRSAAQRLIDRGAVERRAAVDWVRLRKSGEDLPEATELRITDDAELRWVSRAGLKLDGALAQCGLAVTGVTALDVGQSTGGFTEVLLAHGAAHVVGVDVGRGQLHPSLRGHAQVTVLEGINARGLTREALGAAMPAGGFGLVVADLSFIPLTTVLPALVPLLAADGHLLALVKPQFELQPKDIGKGGLVKS 206
>gi|119953295|ref|YP_945504.1| putative cell adhesion protein [Borrelia turicatae 91E135] >gi|119862066|gb|AAX17834.1| putative cell adhesion protein [Borrelia turicatae 91E135] (263 aa)
Score = 212, Expect = 1.7e-15, Identities = 78/220 (35%), Positives = 121/220 (55%)
  Q:    25 LITNSKVVINGQIISKSNTLVNELDKVEILEEE--KYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFIS-INLIFNKIKELKWNNWKSIALLKPQFE---LGKKIGTTKGFAKTEDHKKIINNFIE--FLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKN 244
           LI   +V +N         L+    K+ ++E E  ++VSR  +KL  ++E F I + +KI ID+G+STGGFT  LL+   K VY++DVG NQL+ +L+ + +V   E+TN   I+   I+   +   IDVSF S I++  N I +L  ++   + L+KPQFE   L   I    G        KI+N  I+  + + L IKN   I+      +K N E++F +   N
  S:    27 LILTGRVYVNSHKERNPKVLLLRNSKINLIESESRQFVSRGGHKLFESLETFKITVKDKICIDVGASTGGFTDCLLQEGAKLVYAVDVGFNQLSYKLRVDPRVKVFEKTNIFAIKQFDIQP--NLAVIDVSFRSVISICANLIDKL--SDKLIVVLVKPQFELKGLNLDIKDFNGVVGKRYLSKILNKVIKKFYDNNLQIKN---ILKLATKGRKGNQEFMFLVVKDN 247
>gi|17933342|gb|AAL48251.1|AF451891_1 YqxC [Lactobacillus plantarum subsp. plantarum] (165 aa)
Score = 210, Expect = 3.1e-15, Identities = 49/140 (35%), Positives = 84/140 (60%)
  Q:   106 YSIDVGTNQLNEQLKKNNKVISLEQTNFREIE-SSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           Y++DVG+NQL  +L+++ +V+ +E TNFR  + +   + + +F +IDVSFIS++LI   +  +  N    +AL+KPQFE G++     G  +    H+ ++ + +EF        LG   SPIKG +  N E+L +L+  +E
  S:     1 YALDVGSNQLVWKLRQDPRVVVMEHTNFRYSKLADFTQGQPNFASIDVSFISLHLILPPLHAIIENGGSVVALIKPQFEAGRENVGKHGIVRDPAVHQAVLTDIVEFAQANGYNVLGLDYSPIKGGEG-NIEFLIHLQATDE 141
>gi|120612696|ref|YP_972374.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120591160|gb|ABM34600.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Acidovorax avenae subsp. citrulli AAC00-1] (333 aa)
Score = 194, Expect = 2.4e-13, Identities = 47/140 (33%), Positives = 83/140 (59%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITN------------SKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKD 143
           +R D++LV   +A +R  AQ LI              +KV  NG  I         + +VE+L+  E +Y+SR   KL+ A++   + +  +  +D+G STGGFT  LL++   +V  +DVG  QL+E+L+ + +V+ +E  N R + +  +++
  S:     1 MRADVFLVERGHAATRSQAQRLIAAGVQWRLAAGMAWTKVAKNGDDIPA-------IAEVELLDGAEARYLSRGGLKLEGALQATGLSVAGRRCLDVGQSTGGFTDCLLQHGAAQVIGVDVGHGQLHERLRDDPRVVGVEGLNARSMTAESLQE 147
>gi|121593046|ref|YP_984942.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Acidovorax sp. JS42] >gi|120605126|gb|ABM40866.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Acidovorax sp. JS42] (332 aa)
Score = 192, Expect = 4.2e-13, Identities = 47/143 (32%), Positives = 80/143 (55%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNS-----KVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID 146
           +R D++LV   YA +R  AQ LI           +  Q ++K+   +    +V++L+  E KY+SR   KL+ A+    + +     +D+G STGGFT  LL +   +V  +DVG  QL+E+L+ + +V+ +E  N R +    ++D  D
  S:     1 MRADVFLVEGGYAATRSQAQRLIAAGVQWRLAPTLPWQKVAKNGDDIPAGVEVQLLDAAEAKYLSRGGLKLEGALAATGMQVAGLRCLDVGQSTGGFTDCLLAHGAAQVIGVDVGHGQLHERLRADPRVVCVEGVNARALTPEALQDACD 150
>gi|118053933|ref|ZP_01522475.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Comamonas testosteroni KF-1] >gi|117998727|gb|EAV12889.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Comamonas testosteroni KF-1] (398 aa)
Score = 191, Expect = 4.4e-13, Identities = 51/143 (35%), Positives = 76/143 (53%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITN------------SKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID 146
           +R D++LV   +A +R  AQ LI +             KV  NG  I     L   LD  E     KY+SR   KL+ A+    + +     +D+G STGGFT  LL+    +V  +DVG  QL+E+LK + +V+ +E  N R +   L++   D
  S:     1 MRADVFLVEAGHAATRSQAQRLIASGVEWRLTPLAPWKKVAKNGDDIPAGAEL-QLLDAAE----AKYISRGGLKLEGALAATGLSVKGLRCLDVGQSTGGFTDCLLQAGATQVIGLDVGHGQLHERLKNDERVVCVEGFNARALTPELLEKACD 150
Score = 91, Expect = 1.9e-01, Identities = 30/105 (28%), Positives = 52/105 (49%)
  Q:   141 IKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYLEYKNE 245
           I    DF+T D+SFIS+ L+   + +L   + + + L+KPQFEL   +IG       T  + ++     + L  L +    ++ SPI+G    N E+  + +   E
  S:   229 ITPAFDFVTGDLSFISLTLVLPAVVQLLKPHGQLLMLVKPQFELQPGQIGKGGIVRDTALYAEVEKRIRDCLGDLGLSVRQWLDSPIEGGDG-NHEFFVWAQQGAE 333
>gi|169839654|ref|ZP_02872842.1| Predicted rRNA methylase [candidate division TM7 single-cell isolate TM7a] (99 aa)
Score = 184, Expect = 2.9e-12, Identities = 35/82 (42%), Positives = 58/82 (70%)
  Q:    44 LVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKV 125
           +V+ +DKV +   E+YVSRA  KL +   +F+++  +K+ +DIGSSTGGFT   L +  + VY++DVGT+QL+  L+ N+++
  S:     2 IVSTVDKVVLNIPEQYVSRAGLKLASVSNNFHLNFTDKVVLDIGSSTGGFTDYALRHGARMVYAVDVGTDQLHPSLRGNDQI 83
>gi|111224564|ref|YP_715358.1| hypothetical protein FRAAL5183 [Frankia alni ACN14a] >gi|111152096|emb|CAJ63823.1| conserved hypothetical protein; putative membrane protein [Frankia alni ACN14a] (321 aa)
Score = 184, Expect = 3.1e-12, Identities = 46/157 (29%), Positives = 83/157 (52%)
  Q:    84 IDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFELGK-KIGTTKGFAKTEDHKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +D+G+STGGFT VLL +    V ++DVG  QL  +L+ + +V  L++ N R +  + + + ++ +  D+SFI + L+   ++     +   + L+KPQFE+G+ ++G          H + + +       L +   G   SP+ G    N EYL +L
  S:   136 LDVGASTGGFTDVLLRHGAASVVAVDVGYGQLLWRLRSDPRVRVLDRVNARALTPAEVGEPVELVVGDLSFIPLRLVLPALRSCAAPDADFVLLVKPQFEVGRERLGAGGVVRDPALHAEAVRDVAAVAGGLGLGVRGVTASPLPGPAG-NVEYLLWL 292
>gi|160901349|ref|YP_001566931.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Delftia acidovorans SPH-1] >gi|160366933|gb|ABX38546.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Delftia acidovorans SPH-1] (400 aa)
Score = 173, Expect = 6.1e-11, Identities = 45/143 (31%), Positives = 78/143 (54%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITN------------SKVVINGQIISKSNTLVNELDKVEILE--EEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKID 146
           +R D++LV   +A +R  AQ LI               KV  NG  I     L       ++L+  E +++SR   KL+ A+    + +     +D+G STGGFT  LL+    +V  +DVG  QL+++L+ + +VI +E  N R + +  +++  +
  S:     1 MRADVFLVEAGHAATRSQAQRLIAGGVQWRMTPLTPWKKVAKNGDEIPAGAEL-------QLLDGAEARFISRGGLKLEGALAATKLSVQGLRCLDVGQSTGGFTDCLLQAGAAQVIGVDVGHGQLHDRLRSDVRVICVEGVNARAVTAEGLQESCE 150
Score = 88, Expect = 4.8e-01, Identities = 18/44 (40%), Positives = 28/44 (63%)
  Q:   141 IKDKIDFITIDVSFISINLIFNKIKELKWNNWKSIALLKPQFEL 184
           I  + DF+T D+SFIS+ L+   +  L   + + + L+KPQFEL
  S:   230 ITPQFDFVTGDLSFISLTLVLPAVTRLLKPHGQLLMLVKPQFEL 273
>gi|11499766|ref|NP_071009.1| hypothetical protein AF2184 [Archaeoglobus fulgidus DSM 4304] >gi|2648341|gb|AAB89068.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304] (208 aa)
Score = 156, Expect = 5.9e-09, Identities = 50/161 (31%), Positives = 85/161 (52%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGFTQVLLENNVKKVYSIDVGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKI---DFITIDVSFI-SINLIFNKI 164
           +RLDI LV   +  SR  A++ I    V+++G+ ++K +  V+   ++++L+ E+   R  +KLK   EHFN+   N++ +D+GSS GGF  +      K+VY I+  + +  E L              REIE      K+   D  T D+S +  ++LI N +
  S:     1 MRLDILLVRRGFFSSRSRAKEAIKKGFVLVDGKKVTKPSAEVDFEAEIKVLQPER--PRGYWKLKEIDEHFNLFSGNEVVLDLGSSAGGFL-LYASEKAKEVYGIEY-SREFEEGL--------------REIERQRPNVKVFIADAFTFDISLLPELDLILNDL 147
>gi|87125397|ref|ZP_01081243.1| hemolysin-like protein [Synechococcus sp. RS9917] >gi|86167166|gb|EAQ68427.1| hemolysin-like protein [Synechococcus sp. RS9917] (160 aa)
Score = 125, Expect = 2.5e-05, Identities = 40/131 (30%), Positives = 65/131 (49%)
  Q:   110 VGTNQLNEQLKKNNKVISLEQTNFREIESSLIKDKIDF----ITIDVSFISINLIFNKIKEL-KWNNWKSIALLKPQFELGKKIGTTKGFAKTED-HKKIINNFIEFLSILNIKNLGYIVSPIKGAKKENTEYLFYL 240
           +G  Q    L+ +++VI  E+TN R +    + +  D        DVSFIS+ L+   ++ L +    +++ L+KPQFE+G++     G  +  D H   +   I     L     G + SPI G    N EYL +L
  S:     1 MGYGQTAWSLRTDDRVILRERTNLRRLTPEELFEAADLRPTLAVADVSFISLGLVLPALRGLLQAEGAEAVVLVKPQFEVGRERVGKGGVVRDPDAHVVALQGVIAAAEPLGWSPHGLVASPITGPAG-NHEYLLWL 136
>gi|169838827|ref|ZP_02872015.1| hemolysin A [candidate division TM7 single-cell isolate TM7a] (81 aa)
Score = 119, Expect = 1.0e-04, Identities = 29/77 (37%), Positives = 47/77 (61%)
  Q:     3 KIRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLN 79
           K RLD Y+V      SR  A++ I   +V +NG++I K   +V+ +DKV +   E+YVSRA  KL +   +F+++L+
  S:     2 KQRLDRYIVENRLTNSRSQAENYIRLGRVTVNGEVIKKCGFIVSTVDKVVLNIPEQYVSRAGLKLASVSNNFHLNLH 78
>gi|147921289|ref|YP_684897.1| putative ribosomal RNA methyltransferase [uncultured methanogenic archaeon RC-I] >gi|110620293|emb|CAJ35571.1| putative ribosomal RNA methyltransferase [uncultured methanogenic archaeon RC-I] (216 aa)
Score = 113, Expect = 6.3e-04, Identities = 32/90 (35%), Positives = 46/90 (51%)
  Q:     4 IRLDIYLVNENYARSRGVAQDLITNSKVVINGQIISKSNTLVNELDKVEILEEEKYVSRAAYKLKAAIEHFNIDLNNKIAIDIGSSTGGF 93
           +RLD YLV+E    SR  A+  I    V +NG++++K +  V     +EI EE++      +KLK       I       +DIGSS GGF
  S:     1 MRLDEYLVSEGLIASRSRAKRYIHRGLVKLNGEVVTKPSKQVKPGAIIEIAEEDR--PEGYFKLKGIQNQSGILRPGDRVLDIGSSAGGF 88