>gi|26553604|ref|NP_757538.1| hypothetical protein MYPE1510 [Mycoplasma penetrans HF-2] >gi|26453610|dbj|BAC43942.1| hypothetical protein [Mycoplasma penetrans HF-2] (254 aa)
Score = 1264, Expect = 2.0e-137, Identities = 254/254 (100%), Positives = 254/254 (100%)
  Q:     1 MKKFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAMLKEYVILF 254
           MKKFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAMLKEYVILF
  S:     1 MKKFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAMLKEYVILF 254
>gi|190613598|pdb|3BPB|A Chain A, Crystal Structure Of The Dimethylarginine Dimethylaminohydrolase H162g Adduct With S-Methyl-L- Thiocitrulline >gi|190613599|pdb|3BPB|B Chain B, Crystal Structure Of The Dimethylarginine Dimethylaminohydrolase H162g Adduct With S-Methyl-L- Thiocitrulline (254 aa)
Score = 212, Expect = 2.0e-15, Identities = 65/240 (27%), Positives = 109/240 (45%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLP---SLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQI 243
           F + I RTP++S    +  +     D+ + +++H      L+   + +  LP      D +    +    + T RC I+          +   +   + RFYP  K+  I+ PG + + DI+ V   F++  S  TN EG  Q I  +   G     +   +   L+  L Y+  NNLL    +    EF  FN + +P EES A   +WVNE +I+P      +E +  L  YRV+ + T  + +I
  S:     2 FKHIIARTPARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVF---VEDPVLCTSRCAIITRPGAESRRGETEIIEETVQRFYP-GKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESYAANCIWVNERVIMPAGYPRTREKIARLG-YRVIEVDTSEYRKI 243
>gi|15596392|ref|NP_249886.1| hypothetical protein PA1195 [Pseudomonas aeruginosa PAO1] >gi|116049143|ref|YP_792055.1| hypothetical protein PA14_48840 [Pseudomonas aeruginosa UCBPP-PA14] >gi|194550547|ref|YP_002085574.1| hypothetical protein PA2G_00179 [Pseudomonas aeruginosa 2192] >gi|9947121|gb|AAG04584.1|AE004549_11 hypothetical protein PA1195 [Pseudomonas aeruginosa PAO1] >gi|115584364|gb|ABJ10379.1| putative dimethylarginine dimethylaminohydrolase [Pseudomonas aeruginosa UCBPP-PA14] >gi|126192940|gb|EAZ57003.1| hypothetical protein PA2G_00179 [Pseudomonas aeruginosa 2192] (254 aa)
Score = 211, Expect = 2.4e-15, Identities = 65/240 (27%), Positives = 109/240 (45%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLP---SLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQI 243
           F + I RTP++S    +  +     D+ + +++H      L+   + +  LP      D +    +    + T RC I+          +   +   + RFYP  K+  I+ PG + + DI+ V   F++  S  TN EG  Q I  +   G     +   +   L+  L Y+  NNLL    +    EF  FN + +P EES A   +WVNE +I+P      +E +  L  YRV+ + T  + +I
  S:     2 FKHIIARTPARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVF---VEDPVLCTSRCAIITRPGAESRRGETEIIEETVQRFYP-GKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLHLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESYAANCIWVNERVIMPAGYPRTREKIARLG-YRVIEVDTSEYRKI 243
>gi|15825887|pdb|1H70|A Chain A, Ddah From Pseudomonas Aeruginosa. C249s Mutant Complexed With Citrulline (255 aa)
Score = 211, Expect = 2.6e-15, Identities = 66/251 (26%), Positives = 112/251 (44%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLP---SLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAMLKEYVILF 254
           F + I RTP++S    +  +     D+ + +++H      L+   + +  LP      D +    +    + T RC I+          +   +   + RFYP  K+  I+ PG + + DI+ V   F++  S  TN EG  Q I  +   G     +   +   L+  L Y+  NNLL    +    EF  FN + +P EES A   +WVNE +I+P      +E +  L  YRV+ + T  + +I   +    + F
  S:     3 FKHIIARTPARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVF---VEDPVLCTSRCAIITRPGAESRRGETEIIEETVQRFYP-GKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLHLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESYAANCIWVNERVIMPAGYPRTREKIARLG-YRVIEVDTSEYRKIDGGVSSMSLRF 255
>gi|107100644|ref|ZP_01364562.1| hypothetical protein PaerPA_01001670 [Pseudomonas aeruginosa PACS2] >gi|194545313|ref|YP_002080341.1| hypothetical protein PACG_00168 [Pseudomonas aeruginosa C3719] >gi|126166259|gb|EAZ51770.1| hypothetical protein PACG_00168 [Pseudomonas aeruginosa C3719] (254 aa)
Score = 208, Expect = 6.0e-15, Identities = 64/240 (26%), Positives = 109/240 (45%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLP---SLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQI 243
           F + I RTP++S    +  +     D+ + +++H      L+   + +  LP      D +    +    + + RC I+          +   +   + RFYP  K+  I+ PG + + DI+ V   F++  S  TN EG  Q I  +   G     +   +   L+  L Y+  NNLL    +    EF  FN + +P EES A   +WVNE +I+P      +E +  L  YRV+ + T  + +I
  S:     2 FKHIIARTPARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVF---VEDPVLCSSRCAIITRPGAESRRGETEIIEETVQRFYP-GKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLHLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESYAANCIWVNERVIMPAGYPRTREKIARLG-YRVIEVDTSEYRKI 243
>gi|157370636|ref|YP_001478625.1| dimethylargininase [Serratia proteamaculans 568] >gi|157322400|gb|ABV41497.1| Dimethylargininase [Serratia proteamaculans 568] (253 aa)
Score = 200, Expect = 5.0e-14, Identities = 42/104 (40%), Positives = 61/104 (58%)
  Q:   111 GILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           G L   D+L VD+ FFV L++ T++ G+ +F   V P GY V  I  S    L++ +NYV  N LL+ + Y+    F  FN +V+P  ES A   LW+N+T+I P
  S:   110 GHLDGGDVLLVDRQFFVGLTSRTDEAGIGEFAAAVEPYGYRVTAIDVSAGLHLKSIVNYVGRNTLLLTEDYQHHAAFSGFNSIVIPEAESYAGNTLWINDTLITP 214
>gi|77973157|ref|ZP_00828708.1| COG1834: N-Dimethylarginine dimethylaminohydrolase [Yersinia frederiksenii ATCC 33641] (252 aa)
Score = 199, Expect = 6.4e-14, Identities = 43/111 (38%), Positives = 66/111 (59%)
  Q:   104 IFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F +   G L   D+L VDK FF+ L++ T++ G+++F   V   GY+V TI  S    L++ +NYV  N LL+ + Y+    F  FN +V+P  ES A   LW+N+T+I P
  S:   102 VFRMSQRGHLDGGDVLLVDKQFFIGLTSRTDEAGISEFSAAVGRYGYQVTTIEVSAGLHLKSIVNYVGHNTLLLTEDYQHHPAFASFNSIVIPEAESYAGNTLWINDTLITP 213
>gi|152987930|ref|YP_001349537.1| hypothetical protein PSPA7_4183 [Pseudomonas aeruginosa PA7] >gi|150963088|gb|ABR85113.1| hypothetical protein PSPA7_4183 [Pseudomonas aeruginosa PA7] (254 aa)
Score = 198, Expect = 8.0e-14, Identities = 63/240 (26%), Positives = 108/240 (45%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLP---SLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQI 243
           F + I RTP++S    +  +     D  + +++H      L+   + +  LP      D +    +    + T RC I+          +   +   + RFYP  K+  I+ PG + + DI+ V + F++  S  TN EG  Q I  +   G     +   +   L+  L Y+  +NLL    +    EF  FN + +P EE+ A   +WVNE +I+P       E +  L  YRV+ + T  + +I
  S:     2 FKHIIARTPARSLVDGLTSSHLGKPDHAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVF---VEDPVLCTRRCAIITRPGAESRRGETEIIEETIQRFYP-GKVERIEAPGTVEAGDIMMVGEHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLHLKTGLAYLEHDNLLAAGEFVDKPEFQRFNIIEIPEEEAYAANCIWVNERVIMPAGYPRTHEKIARLG-YRVIEVDTSEYRKI 243
>gi|90407408|ref|ZP_01215592.1| hypothetical protein PCNPT3_10193 [Psychromonas sp. CNPT3] >gi|90311439|gb|EAS39540.1| hypothetical protein PCNPT3_10193 [Psychromonas sp. CNPT3] (255 aa)
Score = 198, Expect = 8.0e-14, Identities = 66/240 (27%), Positives = 104/240 (43%)
  Q:     4 FNYAILRTPSQSAQKYIV---DTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQI 243
           F Y I RTP  +    +    + + D    +++H      L+   + +  LP L+D      +    + T+ C I+          +  A+   L RFY  DKI  I+ PG + + DI+ +   F++ LS  TN  G  Q I  +   G     IT  +   L+  L Y+  NNLL    +    EF   N + VP  ES A   +WVN  +I+P+    I E  I    Y V  + T  + ++
  S:     2 FKYIIARTPCSALVNGLSSANEGKPDHALAMQQHLAYLDALRKCDVEILLLPPLEDYADSVFVEDPALCTKHCAIVTRPGAPSRRAEIDAIEPALRRFYSEDKIEHIEAPGTVEAGDIMMIGDVFYIGLSARTNLHGAQQVIAILEKYGLSGHLITLEKVLHLKTGLAYLENNNLLACGEFLTKAEFSHLNIIEVPESESYATNCIWVNNNVIMPSG-YPITEAKIRDLGYNVFCVDTSEYRKV 244
>gi|77979468|ref|ZP_00834886.1| COG1834: N-Dimethylarginine dimethylaminohydrolase [Yersinia intermedia ATCC 29909] (252 aa)
Score = 198, Expect = 8.3e-14, Identities = 42/111 (37%), Positives = 65/111 (58%)
  Q:   104 IFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F +   G L   D+L VDK FF+ L++ T++ G+++F   V   GY V  I  S    L++ +NYV  N LL+ + Y+    F  FN +V+P +ES A   LW+N+T+I P
  S:   102 VFRMSNQGHLDGGDVLLVDKQFFIGLTSRTDEVGISEFTAAVERYGYRVTPIAVSAGLHLKSIVNYVGRNTLLLTEDYQHHPAFSTFNTIVIPEDESYAGNTLWINDTLITP 213
>gi|77956245|ref|ZP_00820364.1| COG1834: N-Dimethylarginine dimethylaminohydrolase [Yersinia bercovieri ATCC 43970] (252 aa)
Score = 196, Expect = 1.3e-13, Identities = 42/111 (37%), Positives = 64/111 (57%)
  Q:   104 IFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F +   G L   D+L VDK FF+ L++ T+Q G+ +F + V   GY V  I  S    L++ +NYV  N LL+ + Y+    F  F+ +V+P  ES A   LW+N+T+I P
  S:   102 VFRMSSRGHLDGGDVLLVDKQFFIGLTSRTDQAGITEFTDAVARYGYRVTAIEVSAGLHLKSIVNYVGRNTLLLTEDYQHHPAFAAFDTMVIPAAESYAGNTLWINDTLITP 213
>gi|77963307|ref|ZP_00827118.1| COG1834: N-Dimethylarginine dimethylaminohydrolase [Yersinia mollaretii ATCC 43969] (252 aa)
Score = 196, Expect = 1.5e-13, Identities = 42/111 (37%), Positives = 65/111 (58%)
  Q:   104 IFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F +   G L   D+L VDK FF+ L++ T+Q G+++F   V   GY+V  I  S    L++ +NYV  N LL+ + Y+    F  F+ +V+P  ES A   LW+N+T+I P
  S:   102 VFRMSQRGHLDGGDVLLVDKQFFIGLTSRTDQAGIDEFTGAVARYGYQVTAIEVSAGLHLKSIVNYVGRNTLLLTEDYQHHPAFAAFDTIVIPEAESYAGNTLWINDTLITP 213
>gi|54294546|ref|YP_126961.1| hypothetical protein lpl1622 [Legionella pneumophila str. Lens] >gi|53754378|emb|CAH15862.1| hypothetical protein [Legionella pneumophila str. Lens] (255 aa)
Score = 190, Expect = 6.4e-13, Identities = 63/244 (25%), Positives = 115/244 (47%)
  Q:     4 FNYAILRTPSQSAQKYIVDT----EFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAML 247
           F  AI+RTPS +    +  +    + +++  + +H+     L    + V  LP L+       +  + + TE+  +L         ++   +   +  F+  D+IF I+ PG L + D+L +D  FF+ LS  TN+EG  Q I  +   GY    I   +   L+  ++Y++ + +LV       Q F    ++VV  EE+ A   + +NET++LP  C  I   L EL  + ++ +    F ++   L
  S:     2 FKNAIVRTPSSTMINGLTTSADLGKPNYELALIQHQNYIKALSTCGLEVTVLPDLEQFPDACFVEDVSLLTEQFAVLTCPGAQSRRDEVQEIEPSIQAFFK-DRIFRINPPGRLEAGDVLRIDNHFFIGLSERTNKEGAEQLIYLLNQHGYTASVIQLKKFLHLKTGVSYLNNDYVLVSGELINHQAFGHLKQIVVSPEEAYAANCIMINETVLLPKGCPKITHRLSELG-FSIIELDMSEFKKLDGGL 248
>gi|90409722|ref|ZP_01217739.1| hypothetical protein P3TCK_03126 [Photobacterium profundum 3TCK] >gi|90329075|gb|EAS45332.1| hypothetical protein P3TCK_03126 [Photobacterium profundum 3TCK] (254 aa)
Score = 190, Expect = 6.6e-13, Identities = 63/240 (26%), Positives = 111/240 (46%)
  Q:     4 FNYAILRTPSQSAQKYIV---DTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQI 243
           FNY I RTP ++    I    D + +++  +K+H      L+   + +  LP L++      +    + T+ C I+     +    +  ++   L RFY  D +  I+ PG L + D++ V  TF++ LS  TN +G  Q +  +   G     +T  +   L+  L Y+   NLL    +    EF   N + +P  ES A   +WVN  +I+P+    I E  I    Y V+++ T  + ++
  S:     2 FNYIIARTPCKALIDGISSADDGKPNYELAMKQHLAYLDALRMCGVEILLLPPLENYPDSVFVEDPALCTKHCGIVTRPGADSRRGEIDSIEPALRRFYG-DNVERIEAPGTLDAGDVMMVGDTFYIGLSARTNADGAGQLVAILEKYGLTGRLVTMEKVLHLKTGLAYLEDGNLLAAGEFVNKPEFSHLNIIEIPESESYAANCIWVNGNVIMPSG-YPISESKIRDLGYNVVTVDTSEYRKV 243
>gi|52841885|ref|YP_095684.1| NG,NG-dimethylarginine dimethylaminohydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628996|gb|AAU27737.1| NG,NG-dimethylarginine dimethylaminohydrolase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (255 aa)
Score = 190, Expect = 7.3e-13, Identities = 63/244 (25%), Positives = 114/244 (46%)
  Q:     4 FNYAILRTPSQSAQKYIVDT----EFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAML 247
           F  AI+RTPS +    +  +    + +++  + +H+     L    + V  LP L+       +  + + TE+  +L         ++   +   +  F+  D+IF I  PG L + D+L +D  FF+ LS  TN+EG  Q I  +   GY    I   +   L+  ++Y++ + +LV       Q F    ++VV  EE+ A   + +NET++LP  C  I   L EL  + ++ +    F ++   L
  S:     2 FKNAIVRTPSSTMINGLTTSADLGKPNYELALIQHQNYIKALSTCGLEVTVLPDLEQFPDACFVEDVSLLTEQFAVLTCPGAESRRDEVQEIEPSIQAFFK-DRIFRISTPGRLEAGDVLRIDNHFFIGLSERTNKEGAEQLIYLLNQHGYTASVIQLKKFLHLKTGVSYLNNDYVLVSGELINHQAFGHLKQIVVSHEEAYAANCIMINETVLLPKGCPKITHRLSELG-FSIIELDMSEFRKLDGGL 248
>gi|126649664|ref|ZP_01721900.1| NG,NG-dimethylarginine dimethylaminohydrolase [Bacillus sp. B14905] >gi|126593383|gb|EAZ87328.1| NG,NG-dimethylarginine dimethylaminohydrolase [Bacillus sp. B14905] (253 aa)
Score = 189, Expect = 8.6e-13, Identities = 58/239 (24%), Positives = 110/239 (46%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEFD---FKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQ-DSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQ 242
           F   I++ P  S    +  ++      ++  ++H+     LK   + V  LP+ +     + +    + T    I+ N      N +   +   + +FY  DKI++I   G L   DIL+ +K F+V +S+ TN+EG  QF E V   GYE   I   +   L+  + YV  N +++   +     F+ + K+++P E+  +   + VN+ II+P         L++L  Y+ + +    F +
  S:     2 FKNVIVKNPGNSFVNGLTTSDLGKPILEKLYEQHDKYVEALKKCEVEVTQLPANEAFPDSTFVEDTAVLTPEFAIISNPGAAARNREIEDIEPAVKQFY--DKIYYIKGSGTLDGGDILQAEKKFYVGISDRTNEEGAQQFKEIVEQEGYEATIIPLKEFFHLKTGIAYVGDNRMVLAGEFVDHPAFESYEKIIIPKEDEYSANCIQVNDYIIIPAGYPDTNRKLLDLG-YQTIELEMSEFRK 241
>gi|123442313|ref|YP_001006292.1| putative hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122089274|emb|CAL12121.1| putative hydrolase [Yersinia enterocolitica subsp. enterocolitica 8081] (252 aa)
Score = 188, Expect = 1.3e-12, Identities = 41/111 (36%), Positives = 65/111 (58%)
  Q:   104 IFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F + + G L   D+L VDK FF+ L++ T++ G+++F   V   GY+V  I  S    L++ +NYV  N LL+ + Y+    F  FN +V+   ES A   LW+N+T+I P
  S:   102 VFRMSHQGHLDGGDVLLVDKQFFIGLTSRTDKAGISEFTSAVGRYGYQVTAIEVSAGLHLKSIVNYVGRNTLLLTEDYQHHPAFAGFNTIVITDAESYAGNTLWINDTLITP 213
>gi|54297577|ref|YP_123946.1| hypothetical protein lpp1628 [Legionella pneumophila str. Paris] >gi|53751362|emb|CAH12780.1| hypothetical protein [Legionella pneumophila str. Paris] (255 aa)
Score = 187, Expect = 1.8e-12, Identities = 62/244 (25%), Positives = 116/244 (47%)
  Q:     4 FNYAILRTPSQSAQKYIVDT----EFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAML 247
           F  AI+RTPS +    +  +    + +++  + +H+     L    + V  LP L+       +  + + TE+  +L         ++   +   +  F+  D+IF I+ PG L + D+L +D  FF+ LS  TN+EG  Q I  +   GY    I   +   L+  ++Y++ + +LV       Q F    ++ V  EE+ A   + +NET++LP  C  I ++L EL  + ++ +    F ++   L
  S:     2 FKNAIVRTPSSTMINGLTTSADLGKPNYELALIQHQNYIKALSTCGLEVTVLPVLEQFPDACFVEDVSLLTEQFAVLTCPGAESRRDEVQEIEPSIQVFFK-DRIFRINPPGRLEAGDVLRIDNHFFIGLSERTNKEGAEQLIYLLNQHGYTASVIQLKKFLHLKTGVSYLNNDYVLVSGELINHQAFGHLKQIEVSSEEAYAANCIMINETVLLPKGCPKITDHLSELG-FSIIELDMSEFRKLDGGL 248
>gi|148359193|ref|YP_001250400.1| NG,NG-dimethylarginine dimethylaminohydrolase [Legionella pneumophila str. Corby] >gi|148280966|gb|ABQ55054.1| NG,NG-dimethylarginine dimethylaminohydrolase [Legionella pneumophila str. Corby] (255 aa)
Score = 184, Expect = 3.6e-12, Identities = 62/244 (25%), Positives = 113/244 (46%)
  Q:     4 FNYAILRTPSQSAQKYIVDT----EFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAML 247
           F  AI+RTPS +    +  +    + +++  + +H+     L    + V  LP L+       +  + + TE+  +L         ++   +   +  F+  D+IF I  PG L + D+L +D  FF+ LS  TN+EG  Q I  +   GY    I   +   L+  ++Y++ + +LV       Q F    ++VV  EE+ A   + +NE ++LP  C  I   L EL  + ++ +    F ++   L
  S:     2 FKNAIVRTPSSTMINGLTTSADLGKPNYELALIQHQNYIKALSTCGLEVTVLPDLEQFPDACFVEDVSLLTEQFAVLTCPGAESRRDEVQEIEPSIQAFFK-DRIFRISPPGRLEAGDVLRIDNHFFIGLSERTNKEGAEQLIYLLNQHGYTASVIQLKKFLHLKTGVSYLNNDYVLVSGELINHQAFSHLKQIVVSPEEAYAANCIMINEIVLLPKGCPKITHRLSELG-FSIIELDMSEFRKLDGGL 248
>gi|40063281|gb|AAR38099.1| conserved hypothetical protein [uncultured marine bacterium 578] (254 aa)
Score = 156, Expect = 6.0e-09, Identities = 57/212 (26%), Positives = 105/212 (49%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF----DFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALT----AHLSRFYPLDK---IFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITIT-NSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPN 215
           F  AI+RTP +S    + D++     ++++ + +H++    L    + V  L   ++    + +  + + T  CVI+         N+  AL+     H   F    K   I  I+ PG + + DI+ V   F++ LS+ TN  G  Q I  ++  G    T+T N    L+  L+Y+  N L++   +     F+ ++ + +P EE  A   +WVNE +I+P+
  S:     2 FTNAIVRTPGRSIVDGLSDSKTLGLPNYEQAIIQHQSYIDVLTKCGLDVLVLEPCEEYPDSTFVEDVALVTPNCVII---------NRPGALSRRGEVHEIEFVLKQKFKNIEEIEAPGTIEAGDIMMVGNHFYIGLSDRTNLSGAKQAIGILKKYGMTGSTVTLNDVLHLKTGLSYLENNKLVIYGEFMNDPIFENYDFIEIPEEEDYAANCIWVNENVIVPS 216
>gi|94971120|ref|YP_593168.1| amidinotransferase [Acidobacteria bacterium Ellin345] >gi|94553170|gb|ABF43094.1| amidinotransferase [Acidobacteria bacterium Ellin345] (261 aa)
Score = 133, Expect = 2.5e-06, Identities = 58/227 (25%), Positives = 106/227 (46%)
  Q:     4 FNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGY--EVITITNSQD--SLQNYLNYVSGNNLLV-KDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPN---------ECVGIKEYLIELNRY 230
           F  AI+R P  +  + +   E    +++   ++H      L+   ++V  LP+       + +    + T    IL          +  A+ A + R      +  I+ PG L   DI EV + FF+ LS  +N+EGV Q   F+  LGY   V+ I   Q    L++ + Y+  N L+V ++  ++PQ F  +  + V  +E      + VN+ +++           EC   K  L+E++ +
  S:     6 FTKAIVRIPGSNFAEGLTTAELGAPNYELAFQQHARYCDALRECGLQVTVLPADLRYPDSTFVEDAAVLTAEAAILTRPGAASRAGEVEAIAAEI-RGGGFPSVLSINEPGTLDGGDICEVGRHFFLGLSLRSNEEGVQQLGMFLEALGYTASVVDIREMQSILHLKSGIAYIGENTLVVWEEMADLPQ-FQGYELIRVSPDEHYGANCVRVNDCVLVAEGFPKLTAELECRAFKPLLLEMSEF 247
>gi|170290300|ref|YP_001737116.1| amidinotransferase [Candidatus Korarchaeum cryptofilum OPF8] >gi|170174380|gb|ACB07433.1| amidinotransferase [Candidatus Korarchaeum cryptofilum OPF8] (268 aa)
Score = 133, Expect = 3.2e-06, Identities = 63/239 (26%), Positives = 108/239 (45%)
  Q:     4 FNYAILRTPSQSAQKYI----VDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKD--DIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSR--FYPLDKIFFIDYPGILSSRDILEVDKTF-FVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNET-IILPNECVGIKEYLIELNR--YRVLSIATPTFNQ 242
           FN A++R PS+   + +    +    D    +K+HE     L+   I V  LPSL    D +  +   L  A  R  ++  F E     ++ ++   L    F  ++    ++ P  L   DI+  D    FV L+  TN+ G      F   LG EV+++ T     L + +NYV    +++       + F  F ++ VP+EE+ A   L++ E  I++P    G       L R  YR++ +    F +
  S:    12 FNAALVRPPSREFPRCVSTHPLKDTVDLSLALKQHEDYVSALREEGIDVKKLPSLDGFPDSVFIQDTALARALNRKALISRFGEPSRRGEEASVREFLGELGFTAVN----VEAPATLEGGDIMITDLGLAFVGLTTRTNEGGAEALRSF---LGQEVVSVPTERVFHLLSAVNYVGNRKVVIVPELVDSKYFSGFRQINVPLEEAYAANVLYLGENRILMPQ---GYPRTAERLRREGYRIVEVDVSEFRK 253
>gi|167589078|ref|ZP_02381466.1| Dimethylargininase [Burkholderia ubonensis Bu] (258 aa)
Score = 130, Expect = 7.2e-06, Identities = 36/121 (29%), Positives = 63/121 (52%)
  Q:   111 GILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPN---------ECVGIKEYLIELNRYR 231
           G L   D++ V K F++ L+  T+ +G+  F   V P GY V+ +   +   L++ +N V  + LLV D       F  F ++VV   +  A   L VN+ +I P          E +G+  ++I+ + +R
  S:   115 GRLDGGDVMLVGKRFYIGLTGRTDADGIAAFESLVAPYGYTVVAVPVGEGLHLKSVVNCVGDDTLLVNDALAGHAAFAGFRRIVVAPADEYAGNTLRVNDALITPAGYPRVHASLEPLGLPLHVIDTSEFR 245
>gi|194559700|ref|YP_002094725.1| N-Dimethylarginine dimethylaminohydrolase [Burkholderia cenocepacia PC184] >gi|124875216|gb|EAY65206.1| N-Dimethylarginine dimethylaminohydrolase [Burkholderia cenocepacia PC184] (260 aa)
Score = 129, Expect = 8.3e-06, Identities = 50/212 (23%), Positives = 93/212 (43%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHF------LKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSR---FYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F  AI+R P+ S    +   E    ++ K   TLT F      L+ + + +  LP L        +  + + T    ++          + + + A L+      P+ +       G L   D+++V K FF+ L++ T+ EG+  F   V   GY V+ +   +   L++ +N +  + LLV D       F  + ++ +   +  A   L VN T+I P
  S:    10 QFTQAIVRRPAPSCGAGLTTAELGAPDYDK---TLTQFHAYCDALRALGVELTELPPLDAFPDSHFVEDVAVVTPEFAVITRPGAPARRGETVHIEAALAAHRDLLPMQQ-------GRLDGGDVMQVGKRFFIGLTSRTDAEGIAAFESLVSRHGYSVVAVPVGAGLHLKSVVNALGDDTLLVTDALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITP 221
>gi|107026768|ref|YP_624279.1| dimethylargininase [Burkholderia cenocepacia AU 1054] >gi|116692040|ref|YP_837573.1| dimethylargininase [Burkholderia cenocepacia HI2424] >gi|170735967|ref|YP_001777227.1| dimethylargininase [Burkholderia cenocepacia MC0-3] >gi|105896142|gb|ABF79306.1| Dimethylargininase [Burkholderia cenocepacia AU 1054] >gi|116650040|gb|ABK10680.1| Dimethylargininase [Burkholderia cenocepacia HI2424] >gi|169818155|gb|ACA92737.1| Dimethylargininase [Burkholderia cenocepacia MC0-3] (256 aa)
Score = 129, Expect = 8.3e-06, Identities = 50/212 (23%), Positives = 93/212 (43%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHF------LKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSR---FYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F  AI+R P+ S    +   E    ++ K   TLT F      L+ + + +  LP L        +  + + T    ++          + + + A L+      P+ +       G L   D+++V K FF+ L++ T+ EG+  F   V   GY V+ +   +   L++ +N +  + LLV D       F  + ++ +   +  A   L VN T+I P
  S:     6 QFTQAIVRRPAPSCGAGLTTAELGAPDYDK---TLTQFHAYCDALRALGVELTELPPLDAFPDSHFVEDVAVVTPEFAVITRPGAPARRGETVHIEAALAAHRDLLPMQQ-------GRLDGGDVMQVGKRFFIGLTSRTDAEGIAAFESLVSRHGYSVVAVPVGAGLHLKSVVNALGDDTLLVTDALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITP 217
>gi|182416280|ref|YP_001821346.1| endoribonuclease L-PSP [Opitutus terrae PB90-1] >gi|177843494|gb|ACB77746.1| Endoribonuclease L-PSP [Opitutus terrae PB90-1] (368 aa)
Score = 128, Expect = 1.1e-05, Identities = 46/188 (24%), Positives = 86/188 (45%)
  Q:    26 DFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITIT-NSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGA--LWVNETIIL 213
           D +    +H  L   L  +  +V       DD  G+ +    +      ILG   ++       ++   L++  P+ +I     P +L  RD+L + +T FV+ +  TN EG+      V P GYEV  +  ++   L+   ++V  + L++   +  P++F   + VV+ V+E   + A  L VN T ++
  S:     2 DIQAARNQHAELARILGKLGAKVKFAAGQADDPRGALVEESIVVLPEMGILGRTQDSSQGAAAESMVPLLAQHRPIQRI---ADPALLDGRDVLRIGRTLFVAPTATTNAEGIADLSAIVEPFGYEVREVELHACAHLKLAASFVPPHYLVLNAAWANPKQFG--DLVVLGVDEREPLAASTLPVNGTTLV 187
>gi|182413012|ref|YP_001818078.1| endoribonuclease L-PSP [Opitutus terrae PB90-1] >gi|177840226|gb|ACB74478.1| Endoribonuclease L-PSP [Opitutus terrae PB90-1] (387 aa)
Score = 126, Expect = 1.7e-05, Identities = 40/149 (26%), Positives = 63/149 (42%)
  Q:     7 AILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVIL----GNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI 155
           A LR P             D K   K+H  L   LK +  +V  +P+  D   G  ++   +      ++    G   E+ V     AL  H     P+ +I     P  L  RD++ + +T F  +S  T+ EG+ +F   + P GYEV T+
  S:     3 AFLREPGPQFGVRDFRAPIDLKLLRKQHSQLVAILKELGAQVKLIPASPDQPDGVSVDHAAVVLPEVAVITQPRGLSRESEVETIATALANH----RPIVRIV---APACLDGRDVVRIGRTLFAGISRHTSAEGIAEFAGTIEPYGYEVRTV 148
>gi|50955498|ref|YP_062786.1| dimethylarginine dimethylaminohydrolase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951980|gb|AAT89681.1| dimethylarginine dimethylaminohydrolase [Leifsonia xyli subsp. xyli str. CTCB07] (262 aa)
Score = 121, Expect = 6.5e-05, Identities = 39/136 (28%), Positives = 66/136 (48%)
  Q:   107 IDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDV-FNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQ 242
           I+ PG L   D+L +  T +V  S  TN EG+ Q    V PLGY V+ +  ++   L+  +  +    ++   GYE P   DV F +  +PV E+     + ++E  +L +        LI+   YRV+++    F +
  S:   116 IEEPGTLDGGDVLTIGDTVYVGRSGRTNAEGIRQLRALVTPLGYTVVAVPVTKALHLKTAVTALPDGTVI---GYE-PIVDDVRFFERFLPVPEAHGTAVVILDEVTVLMSASAPQSVALIQDLGYRVVTVDISEFEK 249
>gi|184155931|ref|YP_001844271.1| hypothetical protein LAF_1455 [Lactobacillus fermentum IFO 3956] >gi|183227275|dbj|BAG27791.1| hypothetical protein [Lactobacillus fermentum IFO 3956] (140 aa)
Score = 121, Expect = 6.8e-05, Identities = 36/130 (27%), Positives = 62/130 (47%)
  Q:   118 ILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAML 247
           ++EVD T++V LS  TN+EG  QF        +  + +  +    L+    Y+  + LLV   +     F  F ++VVP EE+ A+  +     +I+P     +K+ L+E + + V   A   F +I   L
  S:     1 MMEVDGTYYVGLSARTNREGFEQFKAIAAQFNHPALAVPVHDFLHLKTGTTYLGDSKLLVTGEFVNHPAFANFTQLVVPAEEAYAVNCINTGNGVIMPTGFPVVKQ-LLEDHGFPVFEAAMSEFEKIDGGL 130
>gi|194564632|ref|YP_002099654.1| N-Dimethylarginine dimethylaminohydrolase [Burkholderia dolosa AUO158] >gi|124898292|gb|EAY70135.1| N-Dimethylarginine dimethylaminohydrolase [Burkholderia dolosa AUO158] (289 aa)
Score = 120, Expect = 8.2e-05, Identities = 48/212 (22%), Positives = 87/212 (41%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F  AI+R P+ S    +        D+++ + + +     L  + + V  LP L D      +  + + T    ++          + + + A L+    L  +      G L   D++   K F V LS  T+ +G+  F   V   GY V+ +  +    L++ +N +  + LLV D       F  F ++ V  E+  A   L VN  +I P
  S:    39 QFTRAIVRRPAPSCGAGLTTATLGAPDYRKTLAQFDAYCDALTALGVEVTELPPLHDFPDAHFVEDVAVVTPEFAVITRPGAPARRGETVHVEAALAAHRDLLPM----RAGRLDGGDVMLTGKRFHVGLSTRTDADGIAAFESLVSRYGYSVVAVPIAAGLHLKSAVNALDDDTLLVADALAAHPAFAGFRRIAVAQEDEYAANTLRVNGALIAP 250
>gi|78062990|ref|YP_372898.1| dimethylargininase [Burkholderia sp. 383] >gi|77970875|gb|ABB12254.1| Dimethylargininase [Burkholderia sp. 383] (256 aa)
Score = 120, Expect = 9.0e-05, Identities = 48/212 (22%), Positives = 90/212 (42%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHF------LKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F  AI+R P+ S    +   E    ++ K   TLT F      L+ + + +  LP L        +    + T    ++          + + + A L+    L  +      G L   D+++V K F++ L+  T+ EG+  F   V   GY V+ +   +   L++ +N +  + LLV +       F  + ++ +   +  A   L VN T+I P
  S:     6 QFTQAIVRRPAPSCGAGLTTAELGAPDYDK---TLTQFHAYCDALRTLGVELTELPPLDAFPDSHFVEDTAVVTPEFAVITRPGAPARRGETVHIEAALAAHRDLLPM----QDGRLDGGDVMQVGKRFYIGLTGRTDAEGIAAFDSLVSRYGYSVVAVPVGAGLHLKSVVNALGDDTLLVTEALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITP 217
>gi|88855817|ref|ZP_01130480.1| dimethylarginine dimethylaminohydrolase [marine actinobacterium PHSC20C1] >gi|88815141|gb|EAR25000.1| dimethylarginine dimethylaminohydrolase [marine actinobacterium PHSC20C1] (401 aa)
Score = 118, Expect = 1.6e-04, Identities = 41/136 (30%), Positives = 67/136 (49%)
  Q:   110 PGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQDSLQNYLNYVSGNNLLVKD---GY-EIPQEFDVFNK-VVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQA 245
           PG L   D+L+V  T +V     TN EGV Q    V PLGY VI +      ++  L+  SG   L      GY ++    D++++ + VP  E +A+  L  ++  +L +        LIE   YRV+++    F +++ 
  S:   258 PGTLDGGDVLKVGSTVYVGRGGRTNAEGVRQLRAIVGPLGYTVIAV-----PVEKVLHLKSGVTALPDGTVIGYADLVDNVDLYDRFLAVPEAEGAAVVVL--SDDAVLMSSSAPKTAALIEDLGYRVVTVDVSEFEKMEG 391
>gi|170782911|ref|YP_001711245.1| integral membrane NG,NG-dimethylarginine dimethylaminohydrolase [Clavibacter michiganensis subsp. sepedonicus] >gi|169157481|emb|CAQ02671.1| integral membrane NG,NG-dimethylarginine dimethylaminohydrolase [Clavibacter michiganensis subsp. sepedonicus] (394 aa)
Score = 118, Expect = 1.7e-04, Identities = 34/99 (34%), Positives = 54/99 (54%)
  Q:   107 IDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEI----PQEFDVFNKVVVPVEESSAIGAL 205
           ID P  +   D+LEV +T +V  S+ TN  G+ +  E  RPLGY V+ +  S+   L++ +  +    ++   GYE     P+ F  F  + VP  E +A+ AL
  S:   248 IDLPATIDGGDVLEVGRTLYVGASSRTNAAGIQRLREIARPLGYAVVGVPVSRTLHLKSQVTALPDGTVI---GYEPLVDEPRLFPSF--LPVPEAEGTAVVAL 346
>gi|161521182|ref|YP_001584609.1| amidinotransferase [Burkholderia multivorans ATCC 17616] >gi|189352642|ref|YP_001948269.1| N-dimethylarginine dimethylaminohydrolase [Burkholderia multivorans ATCC 17616] >gi|160345232|gb|ABX18317.1| amidinotransferase [Burkholderia multivorans ATCC 17616] >gi|189336664|dbj|BAG45733.1| N-dimethylarginine dimethylaminohydrolase [Burkholderia multivorans ATCC 17616] (252 aa)
Score = 117, Expect = 2.2e-04, Identities = 29/104 (27%), Positives = 53/104 (50%)
  Q:   111 GILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           G L   D++ V K F++ L++ T+ EG+ +F   V   GY V+ +  +    L++ +N +  + LLV +       F  + ++ +  E+  A   L VN T+I P
  S:   109 GRLDGGDVMLVGKRFYIGLTSRTDAEGIAEFESLVSRYGYSVVAMPVAAGLHLKSVVNALGDDTLLVTEALAAHPAFAGYRRIAIRAEDEYAGNTLRVNGTLITP 213
>gi|148273727|ref|YP_001223288.1| putative dimethylarginine dimethylaminohydrolase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831657|emb|CAN02626.1| putative dimethylarginine dimethylaminohydrolase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (283 aa)
Score = 117, Expect = 2.3e-04, Identities = 36/139 (25%), Positives = 67/139 (48%)
  Q:   107 IDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYE----IPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQA 245
           ID P  L   D+L V +T +V  S  TN  G+ +  E  RPLGY V+ +  S+   L++ +  +    ++   GYE     P+ F  F    +PV E+  +  + +++  +L +        L+    Y V+++    F +++ 
  S:   137 IDLPATLDGGDVLAVGRTLYVGASGRTNAAGIQRLREIARPLGYAVVGVPVSRTLHLKSQVTALPDGTVI---GYEPLVDAPRLFPSF----LPVPEAEGVAVVALDDDTLLLSAAAPRTADLLRGLGYAVVAVDISEFEKLEG 273
>gi|171316060|ref|ZP_02905286.1| Dimethylargininase [Burkholderia ambifaria MEX-5] >gi|171098762|gb|EDT43555.1| Dimethylargininase [Burkholderia ambifaria MEX-5] (252 aa)
Score = 114, Expect = 4.2e-04, Identities = 29/104 (27%), Positives = 50/104 (48%)
  Q:   111 GILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           G L   D++ V K F++ L+  T+ EG+  F   V   GY V+ +   +   L++ +N +  + LLV D       F  + ++ +   +  A   L VN T+I P
  S:   109 GRLDGGDVMLVGKRFYIGLTGRTDAEGIAAFEALVSRYGYSVVAVPVGAGLHLKSVVNALGDDTLLVTDALAAHPAFTDYRRIAISAADEYAGNTLRVNGTLITP 213
>gi|115358071|ref|YP_775209.1| dimethylargininase [Burkholderia ambifaria AMMD] >gi|115283359|gb|ABI88875.1| Dimethylargininase [Burkholderia ambifaria AMMD] (256 aa)
Score = 111, Expect = 1.1e-03, Identities = 47/212 (22%), Positives = 88/212 (41%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHF------LKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F  AI+R P+ S    +        ++ K   TLT F      L+ + + +  LP L        +  + + T    ++          + + + A L     L  +      G L   D++ V K F++ L+  T+ EG+  F   V   GY V+ +  +    L++ +N +  + LLV +       F  + ++ +   +  A   L VN T+I P
  S:     6 QFTQAIVRRPAPSCGAGLTTATLGAPDYDK---TLTQFHAYCDALRGLGVELTELPPLDAFPDAHFVEDVAVVTPEFAVITRPGAPARRGETVHIEAALGAHRDLLPM----QAGRLDGGDVMLVGKRFYIGLTGRTDAEGIAAFEALVSRFGYSVVAVPVAAGLHLKSVVNALGDDTLLVTEALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITP 217
>gi|170701961|ref|ZP_02892884.1| Dimethylargininase [Burkholderia ambifaria IOP40-10] >gi|170133139|gb|EDT01544.1| Dimethylargininase [Burkholderia ambifaria IOP40-10] (252 aa)
Score = 109, Expect = 1.8e-03, Identities = 28/104 (26%), Positives = 50/104 (48%)
  Q:   111 GILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           G L   D++ V K F++ L+  T+ EG+  F   V   GY V+ +   +   L++ +N +  + LLV +       F  + ++ +   +  A   L VN T+I P
  S:   109 GRLDGGDVMLVGKRFYIGLTGRTDAEGIAAFEALVSRYGYSVVAVPVGAGLHLKSVVNALGDDTLLVTEALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITP 213
>gi|172062869|ref|YP_001810520.1| dimethylargininase [Burkholderia ambifaria MC40-6] >gi|171995386|gb|ACB66304.1| Dimethylargininase [Burkholderia ambifaria MC40-6] (252 aa)
Score = 107, Expect = 3.0e-03, Identities = 46/212 (21%), Positives = 88/212 (41%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHF------LKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILP 214
           +F  AI+R P+ S    +        ++ K   TLT F      L+ + + +  LP L        +  + + T    ++          + + + A L     L  +      G L   D++ V K F++ L+  T+ +G+  F   V   GY V+ +  +    L++ +N +  + LLV +       F  + ++ +   +  A   L VN T+I P
  S:     2 QFTQAIVRRPAPSCGAGLTTATLGAPDYDK---TLTQFHAYCDALRGLGVELTELPPLDAFPDAHFVEDVAVVTPEFAVITRPGAPARRGETVHIEAALGAHRDLLPM----QAGRLDGGDVMLVGKRFYIGLTGRTDADGIAAFEALVSRFGYSVVAVPVAAGLHLKSVVNALGDDTLLVTEALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITP 213
>gi|149202374|ref|ZP_01879347.1| NG,NG-dimethylarginine dimethylaminohydrolase, putative [Roseovarius sp. TM1035] >gi|149144472|gb|EDM32503.1| NG,NG-dimethylarginine dimethylaminohydrolase, putative [Roseovarius sp. TM1035] (261 aa)
Score = 99, Expect = 2.3e-02, Identities = 51/211 (24%), Positives = 89/211 (42%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEF---DFKEFVKEHETLTHFLKNIPIRVHNLPSLKD--DIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQDSLQNY---LNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIIL 213
           +F  AI R P +S    +   +    D    ++ H      L++    V  LP L+D  D +  +   LC+      +       +   +   +   ++ FY  D+I  I  PG +   DIL   +   V LS  TN+EGV Q  + VR  GY V+ +  +   + ++      V    +L      +   FD ++ + VP  E +A   +  N  +I+
  S:     7 EFRRAITRKPGRSIVGGLRAEDTGTPDLARMLEAHAAYVATLRSTGAEVVELPPLEDYPDAVFVEDTMLCLPELAIAMRPGAPTRM--GEVAEVRPAIAGFYG-DRIAEITAPGTIEGGDILVTGREILVGLSARTNREGVAQLSDIVREYGY-VLRLVETPAGVLHFKTDCGLVGPETILSTRRLAVSGCFDGYDVLEVPDGEEAASNCIRFNTLVIM 221
>gi|157132288|ref|XP_001662541.1| ng,ng-dimethylarginine dimethylaminohydrolase [Aedes aegypti] >gi|108871221|gb|EAT35446.1| ng,ng-dimethylarginine dimethylaminohydrolase [Aedes aegypti] (270 aa)
Score = 98, Expect = 3.4e-02, Identities = 51/189 (26%), Positives = 85/189 (44%)
  Q:    24 EFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNF--------DENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEG----VNQFIEFVRPLGYEVITITNSQDSLQNYLNYVSGNNLLV----KDGYEIPQEFD---VFNKVVVPVEESSAIGALWVNETII 212
           E D +E   +HE     L+++ + V  LP   D+ +     P C   E C ++ N         D N +     A+ + L +   L      D    L   D+L   + FFV LS WTN+ G     + F E      Y  + I  ++     Y   ++GN++L     K+  EI +  +    +    + ++E  A   L+VN T+I
  S:    24 EIDLEEAKLQHEAYVRLLRDLGLDVLELPP--DENL-----PECPFIEDCAVVCNGIALICRPGDPNRLKEVD-AVRSVLRKELDLPLAEIADQNARLDGGDVLFTGREFFVGLSKWTNEAGARAVASAFPE------YPCVPIKVTEHHHLKYYVSMAGNDVLCVSRSKESQEILKRIEREATYTYSTLTLQEEQAANVLFVNGTLI 217
>gi|16264556|ref|NP_437348.1| putative NG,NG-dimethylarginine dimethylaminohydrolase (dimethylargininase) protein [Sinorhizobium meliloti 1021] >gi|15140694|emb|CAC49208.1| putative NG,NG-dimethylarginine dimethylaminohydrolase (dimethylargininase) protein [Sinorhizobium meliloti 1021] (264 aa)
Score = 91, Expect = 1.9e-01, Identities = 61/245 (24%), Positives = 109/245 (44%)
  Q:     3 KFNYAILRTPSQSAQKYI--VDTEFDFKEFVK-EHETLTHFLKNIPIRVHNLPSLK---DDIIGSKINPLCIATERCVILGNFDENIVNN-QKLALTAHLSRFYPLDKIF--FIDYP-GILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGY--EVITITNSQDSLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPNECVGIKEYLIELNRYRVLSIATPTFNQIQAML 247
           +FN  I+R+PS+S    +   D      E VK EH+     +++  ++V  LP+L+   D I     +P  + TE  V+L       V   +++A T        L  +F   +D P G     D+L   ++  + LS  T+  G       +  LG   EV+         +   + +    +L  D       F  F ++++P  E  A  AL VN+ +++ ++     E +++   YRV+ + T    +I A L
  S:     7 QFNSIIVRSPSRSVVNGLRAEDRGSPTYEGVKAEHDAYVEAMRDAGVKVTVLPALEAFPDSIFVE--DPALVFTEGAVLLRPGAATRVKEVEEIAPT--------LRDMFETVLDLPQGYADGGDVLTTRESVMIGLSARTDTAGAAALQACLEKLGRKSEVVATPEGVLHFKTDCSLLDDETILSTDRLARSGVFGEFRQMIIPEGEEPAANALRVNDVVLVGSDFPRTIE-MLDKAGYRVVPLKTTEIGKIDAGL 252
>gi|170040160|ref|XP_001847877.1| ng,ng-dimethylarginine dimethylaminohydrolase [Culex quinquefasciatus] >gi|167863736|gb|EDS27119.1| ng,ng-dimethylarginine dimethylaminohydrolase [Culex quinquefasciatus] (271 aa)
Score = 88, Expect = 5.3e-01, Identities = 50/189 (26%), Positives = 82/189 (43%)
  Q:    24 EFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNF--------DENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEG----VNQFIEFVRPLGYEVITITNSQDSLQNYLNYVSGNNLLV----KDGYEIPQEFD---VFNKVVVPVEESSAIGALWVNETII 212
           E D +E   +HE     L+++ + V  LP   D+ +     P C   E C ++ N         D N V     A+ + L +   L      D    L   D+L   + FFV LS WTN+ G     + F E      Y  + I   +     Y   ++G ++L     K+  EI +  +    +    + ++E  A   L+ N T+I
  S:    25 EIDLEEAKLQHEAYVRLLRDLGLDVLELPP--DENL-----PECPFVEDCAVVCNGIALICRPGDPNRVKEVD-AIRSVLRKELDLPLAEIADPNARLDGGDVLFTGREFFVGLSKWTNEAGARAVASAFPE------YPCVPIKVVEHHHLKYYVSMAGADVLCVSRGKESQEILKRIEREATYTYSTLTLQEEQAANVLYANGTLI 218
>gi|126738144|ref|ZP_01753865.1| NG,NG-dimethylarginine dimethylaminohydrolase, putative [Roseobacter sp. SK209-2-6] >gi|126720641|gb|EBA17346.1| NG,NG-dimethylarginine dimethylaminohydrolase, putative [Roseobacter sp. SK209-2-6] (266 aa)
Score = 87, Expect = 6.4e-01, Identities = 45/212 (21%), Positives = 91/212 (42%)
  Q:     4 FNYAILRTPSQSAQKYI--VDTEF-DFKEFVKEHETLTHFLKNIPIRVHNLPSLKD--DIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQDSL--QNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVVPVEESSAIGALWVNETIILPN 215
           F++A+ R P ++  + +  VDT   D   F + H      LK     V  L +L++  D +  +   LC+      +       +   +  A+   L++ Y    +  ++ PG +   DIL  ++   V  S  T+  G+ +  + V P GY V  +   +  L  +   + +  N +L  +       F+ +  ++    E +   A+  NE +I+P+
  S:     8 FSHAVTRKPCKAVIEGLRAVDTGTPDLALFEQHHADYVLALKATGAEVVTLEALEEFPDSVFVEDAALCLPEGAIAMRPGAPSRL--REAEAMAPILAQIY--GSVQTVEGPGFIDGGDILVTEREILVGTSARTDSTGIEELRQIVTPWGYTVRELKTPEGVLHFKTDCSLLDENTILSTERLAKSGCFEGYEVILTAEGEEACANAIRFNELVIMPD 222
>gi|125981053|ref|XP_001354533.1| GA14591-PA [Drosophila pseudoobscura] >gi|54642842|gb|EAL31586.1| GA14591-PA [Drosophila pseudoobscura] (288 aa)
Score = 86, Expect = 7.1e-01, Identities = 55/210 (26%), Positives = 95/210 (45%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIV--NNQK-----LALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDG---YEIPQEFD-----VFNKVVVPVEESSAIGALWVNETII 212
           K+ +AI+   ++ ++  +    FD K   ++HE     L+ I + V  LP   DD++     P  +  E C ++ N    I   NN K      ++   L +   +  I   D    L   D+L   + FF+ +S  TN+EG  + +    P  Y V  I  N    L+ Y+     + L V       EI +  +      + K+ +P  E +A   L++N TI+
  S:     4 KYTHAIV---ARISEALLESGPFDLKLAKRQHEQYCTLLREIGLDVIELPP--DDML-----PEGVFVENCAVICNGVALICRSNNPKRRREAASMAIILKKELDIPVIEMEDPHARLDGGDVLFTGREFFIGISGSTNEEGA-RAVAMAYP-EYPVTPIRVNGSKRLKYYVTMAGPDVLCVSKSAPCQEIVKRMEREASFTYQKLTLP--EETAANMLYINGTIV 215
>gi|85705007|ref|ZP_01036107.1| NG,NG-dimethylarginine dimethylaminohydrolase, putative [Roseovarius sp. 217] >gi|85670329|gb|EAQ25190.1| NG,NG-dimethylarginine dimethylaminohydrolase, putative [Roseovarius sp. 217] (261 aa)
Score = 86, Expect = 8.5e-01, Identities = 20/49 (40%), Positives = 25/49 (51%)
  Q:   102 DKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGY 150
           D+I  I  PG +   DIL   +   V LS  TN+EGV Q  + V   GY
  S:   108 DRIAEITAPGTIEGGDILVTGREILVGLSARTNREGVAQLSDIVSEYGY 156
>gi|159896657|ref|YP_001542904.1| dimethylargininase [Herpetosiphon aurantiacus ATCC 23779] >gi|159889696|gb|ABX02776.1| Dimethylargininase [Herpetosiphon aurantiacus ATCC 23779] (258 aa)
Score = 86, Expect = 8.6e-01, Identities = 27/99 (27%), Positives = 48/99 (48%)
  Q:   103 KIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITITNSQD-SLQNYLNYVSGNNLLVKDGYEIPQEFDVFNKVVV-PVEESSA 201
           ++ ++  P  L   D++ + KT ++ LS+ +NQ  V Q     +  GY V  +   Q   L+  +  V  N +L+   +  PQ F  +  + V P EE +A
  S:   101 QLAWLSEPATLDGGDVVVLGKTIWIGLSSRSNQAAVEQVQAVTKAFGYRVQGVELGQCLHLKTAVCAVDSNTVLLNPQWVEPQVFAEYQVIEVDPREEFAA 201
>gi|194764067|ref|XP_001964153.1| GF21405 [Drosophila ananassae] >gi|190619078|gb|EDV34602.1| GF21405 [Drosophila ananassae] (268 aa)
Score = 86, Expect = 8.7e-01, Identities = 49/210 (23%), Positives = 93/210 (44%)
  Q:     3 KFNYAILRTPSQSAQKYIVDTEFDFKEFVKEHETLTHFLKNIPIRVHNLPSLKDDIIGSKINPLCIATERCVILGNFDENIVNNQKLALTAHLSRFYPLDKIFFIDYPGILSSRDILEVDKTFFVSLSNWTNQEGVNQFIEFVRPLGYEVITI-TNSQDSLQNYLNYVSGNNLLVKDG---YEIPQEFD-----VFNKVVVPVEESSAIGALWVNETII 212
           K+ +AI+   ++ +   + + +FD +   ++HE     L++I + V  LP   +   G  +    +      ++G  +      +  ++   L +   +  I   D    L   D+L   + FFV +S++TN+EG  + +    P  Y V  I  N    L+ Y+     + L V       EI +  +      + K+ +P  E SA   L+VN TI+
  S:     4 KYTHAIV---ARISDALLENGQFDVQLAKQQHEEYCTLLRSIGLDVIELPPDDELPEGVFVENSAVICNGVALIGRSENPKRRREAESMAIILKKELDIPIIEIEDQHAQLDGGDVLFTGREFFVGISSYTNEEGA-RAVAMAYP-EYPVTPIRVNGNRRLKYYVTMAGPDVLCVSSSPTCQEIVKRMEREASFTYQKLTLP--EESAANVLFVNGTIV 215