>gi|26553468|ref|NP_757402.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma penetrans HF-2] >gi|26453474|dbj|BAC43806.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma penetrans HF-2] (299 aa)
Score = 1449, Expect = 9.1e-159, Identities = 299/299 (100%), Positives = 299/299 (100%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK
  S:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
>gi|110803692|ref|YP_697798.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens SM101] >gi|110684193|gb|ABG87563.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens SM101] (314 aa)
Score = 807, Expect = 2.4e-84, Identities = 162/297 (54%), Positives = 218/297 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+IL+I  + K +I DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ IE + E   S++GVQ V  + VSKYGI++      ++ +  +VK ++EKP P  +PSN AILGRY++TP IF  LE T+    GEI++T +LL L ++E +YA  F G+RYD+G K+G+L+AT++ +L +PD+RD  ++Y++ L  T
  S:     1 MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGRSKKAIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIECYNEYRTSVLGVQTVPEENVSKYGIVNGKH---IEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMREEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSAT 291
>gi|169343083|ref|ZP_02864110.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens C str. JGS1495] >gi|169298993|gb|EDS81067.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens C str. JGS1495] (314 aa)
Score = 806, Expect = 3.2e-84, Identities = 162/297 (54%), Positives = 217/297 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+IL+I  + K +I DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ IE + E   S++GVQ V  + VSKYGI++      ++ +  +VK ++EKP P  +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +PD+RD  ++Y++ L  T
  S:     1 MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGRSKKAIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIECYNEYRTSVLGVQTVPEENVSKYGIVNGKH---IEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSAT 291
>gi|168204318|ref|ZP_02630323.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens E str. JGS1987] >gi|170663950|gb|EDT16633.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens E str. JGS1987] (314 aa)
Score = 805, Expect = 4.7e-84, Identities = 163/297 (54%), Positives = 216/297 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+IL+I  + K SI DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI  AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V  + VSKYGI++      ++ +  +VK ++EKP P  +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +PD+RD  ++Y+K L  T
  S:     1 MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIYCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYRTSVLGVQTVPEENVSKYGIVNGKH---IEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLKELSAT 291
>gi|187935752|ref|YP_001887358.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum B str. Eklund 17B] >gi|187723905|gb|ACD25126.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum B str. Eklund 17B] (290 aa)
Score = 804, Expect = 5.4e-84, Identities = 165/289 (57%), Positives = 215/289 (74%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAVASGIE+ILII  + K  I DHFD   ELE  L++  K E  +LVRNISDM  IHYIRQKEP GLGHAI+ AK F+GNEPFA+LLGDDV+     S+KP LKQ I+ F E N +I+GVQ V  + VSKYGI+D L    ++ +  +VK+++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L + ++R+  +EY+K
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNKKCIEDHFDKSIELEFELEKSGKEELLELVRNISDMVDIHYIRQKEPKGLGHAIHCAKTFVGNEPFAVLLGDDVV----DSEKPCLKQLIDCFSEYNTTILGVQTVAQENVSKYGIVDGLH---IEDRVYKVKDLVEKPSVEEAPSNVAILGRYIITPEIFNILENTKPGKGGEIQLTDALKTLISKEAMYAYNFEGRRYDVGDKLGFLQATVEFALKREELREPFIEYLK 283
>gi|18309492|ref|NP_561426.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens str. 13] >gi|110799362|ref|YP_694942.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens ATCC 13124] >gi|168208913|ref|ZP_02634538.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|168212609|ref|ZP_02638234.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens CPE str. F4969] >gi|18144169|dbj|BAB80216.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens str. 13] >gi|110674009|gb|ABG82996.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens ATCC 13124] >gi|170712761|gb|EDT24943.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|170715822|gb|EDT28004.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens CPE str. F4969] (314 aa)
Score = 803, Expect = 7.8e-84, Identities = 162/297 (54%), Positives = 216/297 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+IL+I  + K SI DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI  AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V  + VSKYGI++      ++ +  +VK ++EKP P  +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +PD+RD  ++Y++ L  T
  S:     1 MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIYCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYRTSVLGVQTVPEENVSKYGIVNGKH---IEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSAT 291
>gi|167745494|ref|ZP_02417621.1| hypothetical protein ANACAC_00185 [Anaerostipes caccae DSM 14662] >gi|167655215|gb|EDR99344.1| hypothetical protein ANACAC_00185 [Anaerostipes caccae DSM 14662] (298 aa)
Score = 802, Expect = 9.7e-84, Identities = 155/297 (52%), Positives = 217/297 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           ++V KAVIPAAG+GTRFLPATKA+PKEMLPI+D PT+Q+I+EEAVASGIE+ILII +  K+ + +HFD  +ELE RL +  K    KL+ +I+++A+I+Y+RQKEP GLGHA+  AK FIGNEPFA+LLGDDV++  N+  +PAL+Q I  +++ + S+VGVQ V   +VSKYGI+ P   V    +++++ NM+EKP    +PS  A+LGRYVLTP IF  LE       GEI++T ++  L   + VYA  F G RYD+G K G++KAT+D +L +PD+RD++ +Y+K + E  K
  S:     4 QKVRKAVIPAAGLGTRFLPATKAIPKEMLPIVDVPTVQYIIEEAVASGIEEILIITNSNKHCMENHFDKDYELEARLSESGKTAQVKLINDIANLANIYYVRQKEPKGLGHAVLCAKSFIGNEPFAVLLGDDVVI--NKGGQPALQQLINAYDKHHASVVGVQTVAEDQVSKYGIVAPNRNVPADGRAVKLDNMVEKPKQEEAPSRMAVLGRYVLTPEIFDLLESQGAGAGGEIQLTDAICRLIDTQAVYAYDFEGIRYDVGDKFGFIKATIDFALERPDLRDQVADYLKEIAEKMK 298
>gi|188589208|ref|YP_001922298.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188499489|gb|ACD52625.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum E3 str. Alaska E43] (290 aa)
Score = 800, Expect = 1.9e-83, Identities = 164/289 (56%), Positives = 214/289 (74%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAVASGIE+ILII  + K  I DHFD   ELE  L++  K E  +LVRNISDM  IHYIRQKEP GLGHAI+ AK F+GNEPFA+LLGDDV+     S+ P LKQ I+ F E N +I+GVQ V  + VSKYGI+D L    ++ +  +VK+++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L + ++R+  +EY+K
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNKKCIEDHFDKSIELEFELEKSGKEELLELVRNISDMVDIHYIRQKEPKGLGHAIHCAKTFVGNEPFAVLLGDDVV----DSETPCLKQLIDCFSEYNTTILGVQTVAEENVSKYGIVDGLH---IEDRVYKVKDLVEKPSVEEAPSNVAILGRYIITPEIFNILENTKPGKGGEIQLTDALKTLISKEAMYAYNFEGRRYDVGDKLGFLQATVEFALKREELREPFIEYLK 283
>gi|182625091|ref|ZP_02952868.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens D str. JGS1721] >gi|177909711|gb|EDT72137.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens D str. JGS1721] (314 aa)
Score = 800, Expect = 2.0e-83, Identities = 161/297 (54%), Positives = 216/297 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKP IQ+I+EEA+ASGIE+IL+I  + K SI DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP+LKQ I+ + E   S++GVQ V    VSKYGI++      ++ +  +VK ++EKP P  +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +PD+RD  ++Y++ L  T
  S:     1 MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPIIQYIIEEAIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPSLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVNGKH---IEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSAT 291
>gi|182416970|ref|ZP_02625287.2| UTP-glucose-1-phosphate uridylyltransferase [Clostridium butyricum 5521] >gi|182379146|gb|EDT76648.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium butyricum 5521] (300 aa)
Score = 796, Expect = 5.0e-83, Identities = 162/292 (55%), Positives = 220/292 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           + K++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAVASGIE+ILII  + K  I DHFD   ELE  L++ NK E  +LV++ISDM  IHYIRQKEP GLGHAI  AK F+GNEPFAILLGDD++  +   +KP LKQ IE ++E   SI+GVQ V+ + VSKYGI+D    + ++ +  +VK ++EKP    +PSN AILGRY++TP IF  L+ T+     EI++T +LL L ++E +YA  F GKRYD+G K+G+L+AT++ +L KP++RD+ ++Y++
  S:     2 ITKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNKKCIEDHFDKSVELEMELEKNNKNELLELVQDISDMVDIHYIRQKEPRGLGHAIRCAKAFVGNEPFAILLGDDIVYND---EKPCLKQLIECYDEYKTSILGVQTVDKENVSKYGIVD---GILIEDRVCKVKGLVEKPCVDEAPSNTAILGRYIVTPKIFDILDNTKPGKGNEIQLTDALLELIKEEAMYAYNFEGKRYDVGDKLGFLEATVEYALRKPEIRDDFIKYLR 287
>gi|168216428|ref|ZP_02642053.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens NCTC 8239] >gi|182381384|gb|EDT78863.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens NCTC 8239] (313 aa)
Score = 796, Expect = 5.2e-83, Identities = 162/297 (54%), Positives = 216/297 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+IL+I  + K SI DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI  AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V  + VSKYGI++      ++ +  +VK ++EKP P  +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +PD+RD  ++Y++ L  T
  S:     1 MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIYCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYRTSVLGVQTVPEENVSKYGIVNGKH---IEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSAT 291
>gi|150019428|ref|YP_001311682.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149905893|gb|ABR36726.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium beijerinckii NCIMB 8052] (291 aa)
Score = 794, Expect = 9.0e-83, Identities = 162/288 (56%), Positives = 214/288 (74%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA PKEMLP++DKPTIQ+IVEEA+ASGIE+ILII  + K SI DHFD   ELE  L++  K E  +LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+GNEPFA+LLGDD++     S+KP LKQ I+ + E   +I+GVQ V  + VSKYGI+D +   D   +  +VK+++EKP+   +PSN AILGRY++TP IF  LE T+    GEI++T +L  L   E +YA  F GKRYD+G K+G+L+AT++ +L K ++RDE ++Y+
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPVVDKPTIQYIVEEAIASGIEEILIITGRNKKSIEDHFDKSVELELELEKSGKSELLELVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGNEPFAVLLGDDIV----DSEKPCLKQLIDCYSEYKTTILGVQTVAKENVSKYGIVDGIHVED---RVYKVKDLVEKPNTEEAPSNVAILGRYIITPEIFNILENTKPGKGGEIQLTDALKTLIGTEAMYAYNFEGKRYDVGDKLGFLQATIEFALKKDELRDEFIDYL 282
>gi|167635002|ref|ZP_02393320.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0442] >gi|167640046|ref|ZP_02398314.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0193] >gi|177652204|ref|ZP_02934707.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0174] >gi|167512127|gb|EDR87505.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0193] >gi|167529752|gb|EDR92501.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0442] >gi|172082210|gb|EDT67276.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0174] (296 aa)
Score = 793, Expect = 1.2e-82, Identities = 162/296 (54%), Positives = 219/296 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M KRV KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q IE +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRYVLTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     1 MMKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEGRRYQ---VRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILE 289
>gi|118480011|ref|YP_897162.1| UDP-glucose pyrophosphorylase [Bacillus thuringiensis str. Al Hakam] >gi|118419236|gb|ABK87655.1| UDP-glucose pyrophosphorylase [Bacillus thuringiensis str. Al Hakam] (296 aa)
Score = 791, Expect = 1.7e-82, Identities = 162/296 (54%), Positives = 219/296 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M KRV KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q IE +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRYVLTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     1 MMKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEGRRYQ---VRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILE 289
>gi|47566954|ref|ZP_00237671.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus G9241] >gi|47556272|gb|EAL14606.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus G9241] (295 aa)
Score = 789, Expect = 3.1e-82, Identities = 161/294 (54%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           KRV KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q IE +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRYVLTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEGRRYQ---VRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILE 288
>gi|30264961|ref|NP_847338.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. Ames] >gi|47530456|ref|YP_021805.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187779|ref|YP_031032.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. Sterne] >gi|49480988|ref|YP_038941.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140606|ref|YP_086223.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus E33L] >gi|65316910|ref|ZP_00389869.1| COG1210: UDP-glucose pyrophosphorylase [Bacillus anthracis str. A2012] >gi|165870956|ref|ZP_02215608.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0488] >gi|166996878|ref|ZP_02263338.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus AH820] >gi|170685572|ref|ZP_02876795.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0465] >gi|170706998|ref|ZP_02897455.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0389] >gi|190567171|ref|ZP_03020086.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|196033169|ref|ZP_03100582.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus W] >gi|30259638|gb|AAP28824.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. Ames] >gi|47505604|gb|AAT34280.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181706|gb|AAT57082.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. Sterne] >gi|49332544|gb|AAT63190.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974075|gb|AAU15625.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus E33L] >gi|164713465|gb|EDR18990.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0488] >gi|170128101|gb|EDS96971.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0389] >gi|170670036|gb|EDT20776.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0465] >gi|190561675|gb|EDV15645.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|195994598|gb|EDX58553.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus W] (295 aa)
Score = 789, Expect = 3.4e-82, Identities = 161/294 (54%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           KRV KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q IE +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRYVLTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEGRRYQ---VRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILE 288
>gi|196043921|ref|ZP_03111158.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus 03BB108] >gi|196025257|gb|EDX63927.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus 03BB108] (295 aa)
Score = 787, Expect = 5.2e-82, Identities = 161/294 (54%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           KRV KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q IE +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRYVLTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEGRRYQ---VRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILE 288
>gi|30022959|ref|NP_834590.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 14579] >gi|29898518|gb|AAP11791.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 14579] (296 aa)
Score = 784, Expect = 1.4e-81, Identities = 159/296 (53%), Positives = 219/296 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRY+LTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     1 MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQEGRRYQ---VRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILE 289
>gi|75760261|ref|ZP_00740314.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492256|gb|EAO55419.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] (296 aa)
Score = 783, Expect = 1.4e-81, Identities = 159/296 (53%), Positives = 219/296 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRY+LTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     1 MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLMDEYEKTLSSVIGVQTVPETETHRYGIIDPLEQEGRRYQ---VRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILE 289
>gi|56421804|ref|YP_149122.1| UTP-glucose-1-phosphate uridylyltransferase (uridine diphosphoglucose pyrophosphorylase) (general stress protein 33) [Geobacillus kaustophilus HTA426] >gi|56381646|dbj|BAD77554.1| UTP-glucose-1-phosphate uridylyltransferase (uridine diphosphoglucose pyrophosphorylase) (general stress protein 33) [Geobacillus kaustophilus HTA426] (295 aa)
Score = 783, Expect = 1.6e-81, Identities = 160/297 (53%), Positives = 220/297 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ASGIEDI+I+  + K +I DHFDY FELE+ LKQK K++  + V+  S +  IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++KP LKQ IE +E+   S++GV+ V  +E  +YGIIDPLEQ   + Q   V+  +EKP P  +PSN AI+GRYVLTP IF  LE+ +    GEI++T ++  L + + V+A  F GKRYD+G K+G+++ T++ +L   ++RD+LL +++ +V   K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKGKRAIEDHFDYAFELEQMLKQKGKLDLLEKVKEPSKV-DIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAEKPCLKQLIEQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQQGRRYQ---VRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEAGAGGEIQLTDAIGRLNEIQRVFAYEFEGKRYDVGEKLGFIETTIEFALQNEELRDDLLSFLERVVAEAK 290
>gi|110799732|ref|YP_694938.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens ATCC 13124] >gi|110674379|gb|ABG83366.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens ATCC 13124] (306 aa)
Score = 782, Expect = 2.2e-81, Identities = 162/296 (54%), Positives = 214/296 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+ILII  + K  I DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V    VSKYGI+D      ++ +  +VK ++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +P++R+  +EY+  L E
  S:     1 MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYKTSVLGVQTVPQSHVSKYGIVDGKY---IEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPEIREGFIEYLNNLSE 290
>gi|42784103|ref|NP_981350.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 10987] >gi|42740034|gb|AAS43958.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 10987] (295 aa)
Score = 781, Expect = 2.9e-81, Identities = 158/294 (53%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q IE +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRYVLTP IF  L++  +   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEGRRYQ---VRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLDQQHIGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILE 288
>gi|167939459|ref|ZP_02526534.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus AH1134] >gi|168137404|ref|ZP_02580633.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus B4264] (295 aa)
Score = 780, Expect = 3.4e-81, Identities = 158/294 (53%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRY+LTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQEGRRYQ---VRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILE 288
>gi|166984319|ref|ZP_02255675.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus AH187] >gi|168161672|ref|ZP_02596905.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus H3081.97] (295 aa)
Score = 780, Expect = 3.7e-81, Identities = 158/294 (53%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRY+LTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQEGRRYQ---VRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILE 288
>gi|168143657|ref|ZP_02586886.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus G9842] (295 aa)
Score = 780, Expect = 3.8e-81, Identities = 158/294 (53%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   S++GVQ V   E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRY+LTP IF  LE+  V   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD+++  MK ++E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKTKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLMDEYEKTLSSVIGVQTVPETETHRYGIIDPLEQEGRRYQ---VRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILE 288
>gi|18309488|ref|NP_561422.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens str. 13] >gi|18144165|dbj|BAB80212.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens str. 13] (306 aa)
Score = 780, Expect = 3.8e-81, Identities = 162/296 (54%), Positives = 215/296 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+ILII  + K  I DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V    VSKYGI+D      ++ +  +VK ++EKP    +PSN AILGRY++TP IF  LE+T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +P++R+  +EY+  L E
  S:     1 MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVDGKH---IEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILEKTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFVEYLNNLSE 290
>gi|168208917|ref|ZP_02634542.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|169342909|ref|ZP_02863938.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens C str. JGS1495] >gi|169298818|gb|EDS80892.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens C str. JGS1495] >gi|170712740|gb|EDT24922.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens B str. ATCC 3626] (306 aa)
Score = 778, Expect = 6.6e-81, Identities = 162/296 (54%), Positives = 214/296 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+ILII  + K  I DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V    VSKYGI+D      ++ +  +VK ++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +P++R+  +EY+  L E
  S:     1 MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVDGKY---IEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFIEYLNNLSE 290
>gi|169347290|ref|ZP_02866228.1| hypothetical protein CLOSPI_00005 [Clostridium spiroforme DSM 1552] >gi|169293907|gb|EDS76040.1| hypothetical protein CLOSPI_00005 [Clostridium spiroforme DSM 1552] (299 aa)
Score = 778, Expect = 6.9e-81, Identities = 154/299 (51%), Positives = 227/299 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLE--QVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           MK++V KA+IPAAG+GTRFLPATKA+ KEMLPI+D PTIQ+I++EAV SGIE+ILII +  K+S+ +HFD  +ELE RL +  K+E  K++++I++MA+I+YIRQKEP GLGHA+  AK FIG+EPFA+LLGDD++V  N+  KPALKQ I+ +  K  S+VGVQ V H++V KYGI+ P +   ++   + +++ +M+EKP+   +PS+ A+LGRYVLTP +F+ LE       GEI++T ++  L   + VYA  F G RYD+G K G++KAT+D SL++ D+++++ EY++ +V+ +K
  S:     1 MKQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIQYIIQEAVDSGIEEILIITNSNKHSMENHFDKNYELEARLTESGKMEQVKMIQDIANMANIYYIRQKEPKGLGHAVLCAKSFIGDEPFAVLLGDDIVV--NEGGKPALKQLIDAYMSKEASVVGVQTVPHQDVCKYGIVSPSKSHSIECNGRLVKLSDMVEKPEVDKAPSDMAVLGRYVLTPKVFELLETQGKGAGGEIQLTDAIKRLMDIQAVYAYDFEGIRYDVGDKFGFIKATIDFSLNRDDLKEKVREYIESIVKEDK 299
>gi|152977211|ref|YP_001376728.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025963|gb|ABS23733.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (295 aa)
Score = 777, Expect = 7.3e-81, Identities = 157/294 (53%), Positives = 219/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEAVASGIEDI+I+  + K SI DHFD+ FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++ P L+Q ++ +++   S++GVQ V  +E  +YGIIDPLEQ   + Q   V+N +EKP    +PSN AI+GRY+LTP IF  LEE  +   GEI++T ++  L + + V+A  F GKRYD+G K+G+++ T++++L   ++R++LL+ MK +VE
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVASGIEDIIIVTGKGKRSIEDHFDHAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAETPCLRQLMDEYDKTLSSVIGVQTVPEEETHRYGIIDPLEQEGRRYQ---VRNFVEKPAKGTAPSNLAIMGRYILTPEIFMFLEEQHIGAGGEIQLTDAIQKLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQYDELREDLLQLMKKIVE 288
>gi|150388215|ref|YP_001318264.1| UTP-glucose-1-phosphate uridylyltransferase [Alkaliphilus metalliredigens QYMF] >gi|149948077|gb|ABR46605.1| UTP-glucose-1-phosphate uridylyltransferase [Alkaliphilus metalliredigens QYMF] (307 aa)
Score = 777, Expect = 8.5e-81, Identities = 160/296 (54%), Positives = 223/296 (75%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           +V KAVIPAAG+GTRFLPATKA+PKEMLPI+DKPT+Q+I+EEAV SGIE+ILII  + K+SI +HFD   ELE  L++K K E  K VR ISDM +IHYIRQKEP GLGHAI+ AK FIGNEPFA++LGDD++    ++DKP L+Q +E+++E   +I+GVQEV  + V+KYGI+D +    ++    +VK+++EKP P  +PSN AILGRY++ P IF  LE T+    GEI++T +L  LA +E +YA VF G+R+D+G K G+L+AT++ +L + D+R+  L Y++ +V+  +
  S:     2 KVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTLQYIIEEAVDSGIEEILIITGRNKSSIENHFDKSIELELELEKKGKDELLKQVRAISDMVNIHYIRQKEPKGLGHAIHCAKSFIGNEPFAVMLGDDIV----ENDKPCLEQMMEMYDEYKTTILGVQEVPKESVNKYGIVDGMH---IEGGIYKVKDLVEKPSPQEAPSNIAILGRYIINPEIFDILENTKPGKGGEIQLTDALKELAHREAMYAYVFEGRRHDVGDKQGFLEATVEFALKREDLREGFLNYLEDVVKKER 290
>gi|134300932|ref|YP_001114428.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Desulfotomaculum reducens MI-1] >gi|134053632|gb|ABO51603.1| UDP-glucose pyrophosphorylase [Desulfotomaculum reducens MI-1] (288 aa)
Score = 775, Expect = 1.2e-80, Identities = 157/292 (53%), Positives = 211/292 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           RV KA+IPAAG+G RFLPATKA PKEMLPI+D PTIQ+I+EEAVASGIEDILI+  + K +I DHFD   ELE +L  K K E   LV++IS+M  IHYIRQKEP+GLGHA+  A++FIG+EPFA+LLGDDVI    +S  P LKQ + L+EE   SI+GVQEV  + V++YGI++   + D      R+ ++IEKP    +PS  A++GRY+L+P IF  L  T+    GEI++T +L  L Q E +Y  +F GKRYD+G K+GYLKAT++ +L +PD+ ++  +Y+K +V
  S:     2 RVRKAIIPAAGLGVRFLPATKATPKEMLPIVDTPTIQYIIEEAVASGIEDILIVTGRNKRAIEDHFDKNLELEMQLDHKQKHELLGLVKDISEMVDIHYIRQKEPLGLGHAVYCARKFIGDEPFAVLLGDDVI----RSKVPCLKQMMNLYEEVRYSILGVQEVPQEHVNRYGIVEATTEQD---NVCRIYDLIEKPQIDQAPSRLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRKLVQAEAIYGCMFEGKRYDVGDKLGYLKATVEFALERPDLSEDFRKYLKEIV 286
>gi|138896837|ref|YP_001127290.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196250413|ref|ZP_03149105.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. G11MC16] >gi|134268350|gb|ABO68545.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196210072|gb|EDY04839.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. G11MC16] (294 aa)
Score = 775, Expect = 1.4e-80, Identities = 157/297 (52%), Positives = 221/297 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ASGIEDI+I+  + K +I DHFD+ FELE+ LKQK K++  + V+  S +  IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++ P LKQ I+ +E+   S++GV+ V  +E  +YGIIDPLEQ   + +  +V+  +EKP P  +PSN AI+GRYVLTP IF  LE+ +V   GEI++T ++  L + + V+A  F GKRYD+G K+G+++ T++ +L   ++RD+LL +++ +V   K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAMASGIEDIIIVTGKGKRAIEDHFDHAFELEQLLKQKGKLDLLEKVKEPSKV-DIHYIRQKEPKGLGHAVWCARSFIGDEPFAVLLGDDIV----QAETPCLKQLIDQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQ---RGRRYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEVGAGGEIQLTDAIGRLNEIQRVFAYEFEGKRYDVGEKLGFIETTIEFALQNKELRDDLLSFLERMVTEAK 290
>gi|182419124|ref|ZP_02950378.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium butyricum 5521] >gi|182377079|gb|EDT74649.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium butyricum 5521] (295 aa)
Score = 774, Expect = 1.8e-80, Identities = 158/288 (54%), Positives = 213/288 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+ILII  + K  I DHFD   ELE  L++  K E  +LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFA+LLGDDV+     S  P LKQ I+ + E N +I+GVQ V  + VSKYGI++    + ++ +  +VK+++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +L  L  +E +YA  F GKRYD+G K+G+L+AT++ +L K ++RD+ ++Y+
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGRNKKCIEDHFDKSVELELELEKSGKSELLELVRDISDMVDIHYIRQKEPKGLGHAIHCAKTFVGDEPFAVLLGDDVV----DSSTPCLKQLIDCYNEYNTTILGVQTVPEESVSKYGIVN---GIHIEDKVYKVKDLVEKPSIEEAPSNVAILGRYIITPEIFNILENTKPGKGGEIQLTDALKTLISQEAMYAYNFEGKRYDVGDKLGFLQATIEFALKKEELRDDFIKYL 282
>gi|154687682|ref|YP_001422843.1| GtaB [Bacillus amyloliquefaciens FZB42] >gi|154353533|gb|ABS75612.1| GtaB [Bacillus amyloliquefaciens FZB42] (294 aa)
Score = 774, Expect = 1.9e-80, Identities = 158/294 (53%), Positives = 216/294 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEAV SGIEDI+I+  + K +I DHFD   ELE  L++K K+E  + V+  S++A IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   SI+GVQ+V   +  +YGIIDPL     + Q   VKN +EKP+P  +PSN AILGRYV TP IF  LE+ +V   GEI++T ++  L   + V+A  F GKRYD+G K+G+++ TL+ +L   D+R +L+ +MK L+E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVESGIEDIIIVTGKGKRAIEDHFDNAPELERNLEEKGKIELLQKVKKSSNIADIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAEKPGLRQLMDEYEKTLSSIIGVQQVPESDTHRYGIIDPLTNEGRRYQ---VKNFVEKPEPGTAPSNLAILGRYVFTPEIFMYLEQQEVGAGGEIQLTDAIQKLNDIQRVFAYDFEGKRYDVGEKLGFIETTLEFALQDQDIRHKLIPFMKDLLE 288
>gi|168204322|ref|ZP_02630327.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens E str. JGS1987] >gi|170664023|gb|EDT16706.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens E str. JGS1987] (306 aa)
Score = 774, Expect = 2.0e-80, Identities = 161/296 (54%), Positives = 214/296 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+ILII  + K  I DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V    VSKYGI+D      ++ +  +VK ++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +P++R+  ++Y+  L E
  S:     1 MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVDGKY---IEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFIKYLNNLSE 290
>gi|188587840|ref|YP_001922559.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188498121|gb|ACD51257.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum E3 str. Alaska E43] (292 aa)
Score = 773, Expect = 2.1e-80, Identities = 158/297 (53%), Positives = 216/297 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M K++ KAVIPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEA+ SGIE+ILII  + K SI DHFD   ELE  L++  K E  ++V++IS+M  IH+IRQKEP GLGHAI+ AK F G+EPFA+LLGDD++       KP LKQ I+ + E   S++GVQ V  + V+KYGI+D L    ++ +  +VK ++EKP    +P+N AILGRY++TP IF+ LE T+    GEI++T +LL L ++E +YA  F GKRYD+G K+G+L+AT++ +L K  +  E  EY+K +VET
  S:     1 MNKKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAIDSGIEEILIITGRNKKSIEDHFDRSLELEIELEKSGKSELLEMVKDISNMVDIHFIRQKEPKGLGHAIHCAKAFTGDEPFAVLLGDDIVYNEG---KPCLKQLIDCYNEYKTSVLGVQTVARENVNKYGIVDGLH---IEDRVYKVKGLVEKPSIEEAPTNVAILGRYIITPKIFEILENTKPGKGGEIQLTDALLKLVEQEAMYAYNFEGKRYDVGDKLGFLQATVEYALRKSSLNKEFTEYLKGVVET 291
>gi|83590216|ref|YP_430225.1| UDP-glucose pyrophosphorylase [Moorella thermoacetica ATCC 39073] >gi|83573130|gb|ABC19682.1| UDP-glucose pyrophosphorylase [Moorella thermoacetica ATCC 39073] (314 aa)
Score = 773, Expect = 2.4e-80, Identities = 155/294 (52%), Positives = 214/294 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           R+ KA+IPAAG GTRFLPATKA PKEMLPI+DKP IQFIVEEAV +G EDILII  + K +I DHFD   ELE  L++K K E   LV  I+++A IHYIRQKE +GLGHA+  A++FIG EPFA+LLGDD+IV +       L+Q + ++EE   +IV VQEV  +EV++YG+IDPLE   +    +RV++++EKP P  +PSN A++GRY+L P+IF  LE+ +    GEI++T +L  LA+++ VYA  F GKRYDIG K+G+L+AT++ +L++PD+     EY+  ++ +
  S:    15 RIQKAIIPAAGWGTRFLPATKAQPKEMLPIVDKPAIQFIVEEAVNAGAEDILIITGKNKRAIEDHFDRSLELENLLREKGKDELLALVEGIAELADIHYIRQKEQLGLGHAVYCARKFIGQEPFAVLLGDDIIVNS----PSCLEQMLAVYEEVGATIVAVQEVPREEVNRYGVIDPLE---VDGSLIRVRDLVEKPRPEEAPSNLAVIGRYILVPAIFPLLEKVKPGAGGEIQLTDALRLLARQDRVYAYRFQGKRYDIGDKLGFLQATVEFALARPDLAGPFSEYLAGIITS 301
>gi|150388137|ref|YP_001318186.1| UTP-glucose-1-phosphate uridylyltransferase [Alkaliphilus metalliredigens QYMF] >gi|149947999|gb|ABR46527.1| UTP-glucose-1-phosphate uridylyltransferase [Alkaliphilus metalliredigens QYMF] (309 aa)
Score = 772, Expect = 2.7e-80, Identities = 163/289 (56%), Positives = 217/289 (75%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEAVASGIE+ILII  + K SI DHFD   ELE  L+ K K E  + VR ISDM +IHYIRQKEP GLGHAI+ AK FIGNEPFA+LLGDD++     + KP LKQ I+ + E   SI+GVQEV  ++V+KYGI+  +    ++ +  +VK++IEKP  + +PSN AILGRY++TP+IF+ LE T     GEI++T +L  LAQKE +YA  F G+RYD+G K G+L+AT++ +L + D+R++ L Y++
  S:     3 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGRNKKSIEDHFDKSVELELELESKGKTELLEEVRKISDMVNIHYIRQKEPKGLGHAIHCAKSFIGNEPFAVLLGDDIV----DAPKPCLKQMIDAYNEYKTSILGVQEVPWEDVNKYGIVKGMH---IEDRIYKVKDLIEKPAVNEAPSNVAILGRYIITPNIFEILENTPPGKGGEIQLTDALRVLAQKEAMYAYHFEGRRYDVGDKQGFLEATVEFALKREDLREDFLAYLQ 284
>gi|110803285|ref|YP_697794.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens SM101] >gi|110683786|gb|ABG87156.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens SM101] (306 aa)
Score = 772, Expect = 3.1e-80, Identities = 161/296 (54%), Positives = 212/296 (71%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           MK ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIE+ILII  + K  I DHFD   ELE  L++  K E   LVR+IS M  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ I  + E   S++GVQ V    VSKYGI+D      ++ +  +VK ++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +P++R+  +EY+  L E
  S:     1 MKNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISGMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIGCYNEYKTSVLGVQTVPESHVSKYGIVDGKH---IEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFVEYLNNLSE 290
>gi|163942961|ref|YP_001647845.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163865158|gb|ABY46217.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus weihenstephanensis KBAB4] (293 aa)
Score = 771, Expect = 3.8e-80, Identities = 157/294 (53%), Positives = 213/294 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  K V+  S   +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E   +S++GVQ V   E  +YGIIDP+EQ D + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++R+EL+ YM  L+E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKHEMLKKVQ-ASSRINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQLSVIGVQTVPENETHRYGIIDPVEQNDRRYQ---VRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEMALQHKELREELIRYMSELLE 287
>gi|163942634|ref|YP_001647518.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163864831|gb|ABY45890.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus weihenstephanensis KBAB4] (295 aa)
Score = 769, Expect = 6.1e-80, Identities = 157/294 (53%), Positives = 218/294 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K SI DHFD  FELE+ L +K K E  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP L+Q ++ +++   S++GVQ V   E  +YGIIDPLEQ   + Q   V+  +EKP    +PSN AI+GRY+LTP IF  LE+ QV   GEI++T ++ +L + + V+A  F GKRYD+G K+G+++ T++++L  P++RD++L  MK +++
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKGKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLRQLMDEYDKTLSSVIGVQTVPEAETHRYGIIDPLEQEGRRYQ---VRKFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQQVGAGGEIQLTDAIQSLNEIQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMLVMMKKVLD 288
>gi|118444195|ref|YP_877621.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium novyi NT] >gi|118134651|gb|ABK61695.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium novyi NT] (293 aa)
Score = 768, Expect = 7.9e-80, Identities = 157/297 (52%), Positives = 214/297 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M   V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAVASGIE+ILII  + K +I DHFD   ELE +L+  NK E  ++VR IS+M  IHYIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     S+ P LKQ I  + E   SI+GVQ+V  + V KYGI+D    + ++ +  +VK ++EKP    +PS+ AILGRY++TP IF  LE T     GEI++T +L  L Q + +Y+  F G+RYD+G K+G+L+AT++ +L + D+++  L+Y+K + +T
  S:     1 MTLNVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNKRAIEDHFDKSIELELQLENTNKTELLEMVRGISNMVDIHYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVV----DSEVPCLKQLINCYNEYKTSILGVQKVPKENVCKYGIVD---GIHIEDRVYKVKGLVEKPSIEEAPSDIAILGRYIITPDIFDILENTPPGKGGEIQLTDALGILIQNQAMYSYCFEGRRYDVGDKLGFLQATVEFALKRDDIKEPFLKYLKSIEDT 290
>gi|167756711|ref|ZP_02428838.1| hypothetical protein CLORAM_02249 [Clostridium ramosum DSM 1402] >gi|167702886|gb|EDS17465.1| hypothetical protein CLORAM_02249 [Clostridium ramosum DSM 1402] (299 aa)
Score = 767, Expect = 1.3e-79, Identities = 157/299 (52%), Positives = 218/299 (72%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVK--NMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           MK++V KA+IPAAG+GTRFLPATKA+ KEMLPI+D PTIQ+I++EAV SGIE+ILII +  K+++ +HFD  +ELE RL +  K+E  K++++I+DMA+I+YIRQKEP GLGHA+  AK FIG+EPFA+LLGDD++V  N   +PALKQ I+ +  K  S+VGVQ VEHK+V KYGI+ P      +     VK  NM+EKP    +PS+ A+LGRYVLTP +F+ LE       GEI++T ++  L   + VYA  F G RYD+G K G++KAT+D +L + D+++++  Y+  LV+  K
  S:     1 MKQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIQYIIQEAVDSGIEEILIITNSNKHAMENHFDKSYELEARLTESGKMEQVKMIQDIADMANIYYIRQKEPKGLGHAVLCAKSFIGDEPFAVLLGDDIVV--NDGGEPALKQLIDAYINKEASVVGVQTVEHKDVCKYGIVSPSHSHPRENGGRLVKLNNMVEKPAVEEAPSDMAVLGRYVLTPKVFELLETQGKGAGGEIQLTDAIKRLMDIQAVYAYDFEGIRYDVGDKFGFIKATIDFALKREDLKEKVQAYINSLVKDVK 299
>gi|16080620|ref|NP_391447.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus subtilis subsp. subtilis str. 168] >gi|585225|sp|Q05852|GTAB_BACSU UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) (General stress protein 33) (GSP33) >gi|289287|gb|AAA71967.1| UDP-glucose pyrophosphorylase >gi|405623|emb|CAA80241.1| UDP-glucose pyrophosphorylase [Bacillus subtilis] >gi|2636093|emb|CAB15584.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus subtilis subsp. subtilis str. 168] (292 aa)
Score = 766, Expect = 1.3e-79, Identities = 156/293 (53%), Positives = 214/293 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEAV +GIEDI+I+  + K +I DHFDY  ELE  L++K K E  + V+  S++A IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++ P L+Q ++ +E+   SI+GVQ+V  +E  +YGIIDPL     + Q   VKN +EKP    +PSN AILGRYV TP IF  LEE QV   GEI++T ++  L + + V+A  F GKRYD+G K+G++  TL+ ++   ++RD+L+ +M+ L+
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEGRRYQ---VKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEIQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLL 287
>gi|15616279|ref|NP_244584.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus halodurans C-125] >gi|10176341|dbj|BAB07436.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus halodurans C-125] (293 aa)
Score = 764, Expect = 2.3e-79, Identities = 153/297 (51%), Positives = 213/297 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA++SGIEDI+I+  + K +I DHFD+ FELE+ L +K K +  + V N S    IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++ P LKQ I+ +E+   S++GVQ V   E  +YGI+DP++Q   K ++  VK  +EKP P  +PSN AI+GRYVLTP IF  L   +    GEI++T ++  L + + VYA  F GKRYD+G KIG++K T++ +L    ++DE   +++ ++E  K
  S:     2 KKIRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAISSGIEDIIIVTGKGKRAIEDHFDHSFELEQTLAEKEKYDLLEKV-NESTKVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIV----QAETPCLKQLIDQYEQTESSVIGVQTVADHETHRYGIVDPIDQ---KGRTYTVKQFVEKPKPGTAPSNLAIMGRYVLTPEIFTFLGRHETGAGGEIQLTDAIERLNEIQHVYAYDFEGKRYDVGEKIGFVKTTVEFALHDEAIKDEFARFLEAILEQKK 290
>gi|167938743|ref|ZP_02525818.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus AH1134] (293 aa)
Score = 763, Expect = 3.3e-79, Identities = 154/297 (51%), Positives = 216/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ SGIEDI+++  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ D   +S +V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++++EL++YM  LV+  K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIVVTGKGKRAIEDHFDHSFELEQSLLEKGKYEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPIEQND---RSYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYNFEGTRYDVGEKFGFIKTTIEMALQHEELKEELMKYMNELVQKEK 290
>gi|163762448|ref|ZP_02169513.1| glycosyl transferase, group 1 [Bacillus selenitireducens MLS10] >gi|160357187|gb|EDP83835.1| glycosyl transferase, group 1 [Bacillus selenitireducens MLS10] (294 aa)
Score = 763, Expect = 3.6e-79, Identities = 155/293 (52%), Positives = 218/293 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAVASGIEDI+I+  + K +I DHFD+ FELEE LK+K K E  + V++ S+M  IHYIRQKE +GLGHAI  A++FIG+EPFA+LLGDD++    QSD+P LKQ I+ +  +  S+VGVQ+V   E  +YGI+DP +Q++ +  S  V +++EKP    +PSN AI+GRYVLTP IF+ L E +     EI++T ++  L   + V+A  F G+R+D+G KIG++K T+++++  P++  EL  +++ L+
  S:     2 KQVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKGKRAIEDHFDHAFELEENLKEKGKDELLEKVQHSSNMVDIHYIRQKEALGLGHAIWCARKFIGDEPFAVLLGDDIV----QSDEPCLKQLIDRYNTRGASVVGVQQVPDAETKRYGIVDPEQQMEERLYS--VSHLVEKPKEGTAPSNLAIMGRYVLTPEIFEFLGEKERGAGNEIQLTDAIEKLNTIQRVFAYDFEGRRFDVGEKIGFVKTTVELAMQDPEIERELKPFLEELL 288
>gi|187605452|ref|ZP_02991647.1| UTP-glucose-1-phosphate uridylyltransferase [Exiguobacterium sp. AT1b] >gi|187482462|gb|EDU20471.1| UTP-glucose-1-phosphate uridylyltransferase [Exiguobacterium sp. AT1b] (293 aa)
Score = 763, Expect = 3.7e-79, Identities = 153/293 (52%), Positives = 214/293 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           RV KA+IPAAG+GTRFLPATKAMPKEMLPI++KPTIQFIVEEAVASGIEDI+I+  + K +I DHFD   ELE+ L+ K K    + VR+ S++A+IHYIRQ+EP GLGHAI  A++FIG+EPFA+LLGDD+I    +SD PA KQ I+ +E    SI+GVQ V ++  ++YGIIDPL    ++ + + V+  +EKP    +PSN+AILGRY+L P +F+ L   +    GEI++T ++  L + + V+A  F G+RYD+G  IG+++ T+  +LS PD++D++   +K LV+
  S:     3 RVRKAIIPAAGLGTRFLPATKAMPKEMLPIVNKPTIQFIVEEAVASGIEDIIIVTGKNKRAIEDHFDRALELEQNLESKGKTRLLESVRHSSNLANIHYIRQQEPKGLGHAIWCARKFIGDEPFAVLLGDDII----ESDVPATKQLIDQYEAHERSIIGVQRVPYEMTNRYGIIDPLA---VEGKLIPVRTFVEKPPVDEAPSNFAILGRYILKPDVFEALSGQEAGAGGEIQLTDAIARLNEAQTVFAYEFDGRRYDVGEPIGFVETTICHALSDPDLKDDVHALLKRLVD 288
>gi|126700329|ref|YP_001089226.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile 630] >gi|168695386|ref|ZP_02727663.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile QCD-37x79] >gi|168715921|ref|ZP_02748198.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile QCD-63q42] >gi|168722777|ref|ZP_02755054.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile QCD-76w55] >gi|168731290|ref|ZP_02763567.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile QCD-97b34] >gi|196126866|ref|ZP_03118615.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile ATCC 43255] >gi|196161665|ref|ZP_03122226.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile CIP 107932] >gi|115251766|emb|CAJ69601.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile 630] (291 aa)
Score = 761, Expect = 6.0e-79, Identities = 154/292 (52%), Positives = 218/292 (74%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+  V KA+IPAAG+GTRFLPATK+ PKEMLPI+DKPT+Q+I+EEA+ SGIE+ILII  + K SI DHFD   ELE  L+QK K E  ++VR+IS+M +IHYIRQKEP GLGHAI  AK FIG+EPFA+LLGDD++     SD P LKQ I+ + E   +++GVQ++  ++ +KYGI+D      ++ +  +VK+M+EKP    +PS+ AILGRY++TP+IF  LE+      GEI++T +L  L ++E +YA  F G+RYD+G KIG+L+AT+D +L + +++D+L++YM+
  S:     1 MQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKPTLQYIIEEAIESGIEEILIITGRNKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNMVNIHYIRQKEPKGLGHAIYCAKSFIGDEPFAVLLGDDIV----DSDVPCLKQLIDTYNEYKTTVLGVQKIAKEDTNKYGILDVKH---IEDRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFSILEKQTPGKGGEIQLTDALQTLGKQEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLKDDLMDYMR 285
>gi|145953184|ref|ZP_01802192.1| hypothetical protein CdifQ_04003163 [Clostridium difficile QCD-32g58] (314 aa)
Score = 761, Expect = 6.1e-79, Identities = 154/292 (52%), Positives = 218/292 (74%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+  V KA+IPAAG+GTRFLPATK+ PKEMLPI+DKPT+Q+I+EEA+ SGIE+ILII  + K SI DHFD   ELE  L+QK K E  ++VR+IS+M +IHYIRQKEP GLGHAI  AK FIG+EPFA+LLGDD++     SD P LKQ I+ + E   +++GVQ++  ++ +KYGI+D      ++ +  +VK+M+EKP    +PS+ AILGRY++TP+IF  LE+      GEI++T +L  L ++E +YA  F G+RYD+G KIG+L+AT+D +L + +++D+L++YM+
  S:    24 MQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKPTLQYIIEEAIESGIEEILIITGRNKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNMVNIHYIRQKEPKGLGHAIYCAKSFIGDEPFAVLLGDDIV----DSDVPCLKQLIDTYNEYKTTVLGVQKIAKEDTNKYGILDVKH---IEDRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFSILEKQTPGKGGEIQLTDALQTLGKQEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLKDDLMDYMR 308
>gi|52082103|ref|YP_080894.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus licheniformis ATCC 14580] >gi|52787493|ref|YP_093322.1| GtaB [Bacillus licheniformis ATCC 14580] >gi|52005314|gb|AAU25256.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus licheniformis ATCC 14580] >gi|52349995|gb|AAU42629.1| GtaB [Bacillus licheniformis DSM 13] (292 aa)
Score = 761, Expect = 6.3e-79, Identities = 150/293 (51%), Positives = 217/293 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEAV +GIEDI+I+  + K +I DHFD+  ELE  L++K K+E  + V+  S++A IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++KP L+Q ++ +E+   S++GVQ+V   +  +YGIIDPL     + +  +VKN +EKP P  +PSN AILGRYV TP IF  L++ Q+   GEI++T ++  L + + V+A  F GKRYD+G K+G+++ TL+ ++   +++D L+ +M+ L+
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRAIEDHFDFSPELERNLEEKGKIELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAEKPGLRQLMDEYEKTLSSVIGVQQVPEDQTHRYGIIDPLTN---EGRLYQVKNFVEKPKPGTAPSNLAILGRYVFTPEIFMYLDKQQIGAGGEIQLTDAIQKLNEIQRVFAYDFEGKRYDVGEKLGFIQTTLEFAMQDDELKDSLIPFMQDLL 287
>gi|118480317|ref|YP_897468.1| UDP-glucose pyrophosphorylase [Bacillus thuringiensis str. Al Hakam] >gi|118419542|gb|ABK87961.1| UDP-glucose pyrophosphorylase [Bacillus thuringiensis str. Al Hakam] (291 aa)
Score = 760, Expect = 6.7e-79, Identities = 155/297 (52%), Positives = 213/297 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S   +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ + + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++R+EL+ YM  LV+  K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQ-ASSRINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQSSVIGVQTVPEHETHRYGIIDPVEQNERRYQ---VRQFVEKPAKGTAPSNLAIMGRYVLTPEIFTFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEMALKHEELREELMNYMNELVKKEK 290
>gi|167037959|ref|YP_001665537.1| UTP-glucose-1-phosphate uridylyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040857|ref|YP_001663842.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Thermoanaerobacter sp. X514] >gi|166855097|gb|ABY93506.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Thermoanaerobacter sp. X514] >gi|166856793|gb|ABY95201.1| UTP-glucose-1-phosphate uridylyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] (302 aa)
Score = 760, Expect = 7.5e-79, Identities = 161/293 (54%), Positives = 211/293 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEA+ SGIEDILII  + K +I DHFD   ELE  LK+KNK     LV +IS+M +IHYIRQKEP GLGHAI  AK F+GNEPFA+LLGDD++     S+ P LKQ I+ +E  N SI+GVQEV +++V KYGI+D      ++ +  +VK+++EKP    +PSN AILGRY++TP IF+ LE T     GEI++T +L  L   E +YA  F GKRYD+G K+GYL AT++ +L + D+ +    Y+  LV+
  S:     2 KIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNKRAIEDHFDKSVELELELKKKNKESLLNLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFVGNEPFAVLLGDDIV----DSEVPVLKQMIDQYERYNCSIIGVQEVPYEDVDKYGIVD---AAIIEDRLYKVKDLVEKPKKEKAPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYEAIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLSEPFKRYLLELVD 287
>gi|196040498|ref|ZP_03107798.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus NVH0597-99] >gi|196028630|gb|EDX67237.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus NVH0597-99] (296 aa)
Score = 760, Expect = 8.1e-79, Identities = 157/297 (52%), Positives = 215/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAVA+GIEDI+I+  + K +I DHFD  FELE+ L +K K +  + V+  S M  IHYIRQKEP GLGHA+  A++FIG+EPFA+LLGDD++    Q++KP LKQ I+ +E    S++GVQ V   E  +YGIIDPLE+   + Q   VK  +EKP    +PSN AI+GRYVLTP IF+ LEE  +   GEI++T ++  L + + V+A  F GKRYD+G K+G+++ T++++L   +++D+LL  M+ +V   K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVAAGIEDIIIVTGKGKRAIEDHFDNAFELEQNLLEKKKYDLLEKVQASSKMVDIHYIRQKEPQGLGHAVWCARKFIGDEPFAVLLGDDIV----QAEKPCLKQLIDEYEHTLSSVIGVQTVPENETHRYGIIDPLEKEGRRYQ---VKQFVEKPALGEAPSNLAIMGRYVLTPEIFRFLEEQHIGAGGEIQLTDAIQKLNEIQRVFAYDFEGKRYDVGEKLGFIQTTIEMALQHEELKDDLLAIMEEIVNGQK 291
>gi|124521564|ref|ZP_01696466.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus coagulans 36D1] >gi|124496725|gb|EAY44308.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus coagulans 36D1] (294 aa)
Score = 760, Expect = 8.3e-79, Identities = 155/292 (53%), Positives = 217/292 (74%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +++ KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L  K K +  + VR  +++  IHYIRQKEP GLGHAI  A++FIGNEPFA+LLGDD+I    Q++ P LKQ I+++E+ + S++ V EV  +E ++YGIIDPL+Q   K +   VK  +EKP    +PSN AI+GRY+LTP IF  L   +    GEI++T ++  L + + VYA  + GKRYD+G K G++K+T++++LS+ D+RD+LL Y++ L
  S:     2 QKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIDSGIEDIIIVTGKGKRAIEDHFDHAFELEDNLIAKKKFDLLEKVRQPAEV-DIHYIRQKEPKGLGHAIWCARKFIGNEPFAVLLGDDII----QAEPPCLKQMIDVYEQVHSSVIAVMEVAREETNRYGIIDPLDQ---KGRIYDVKGFVEKPKVEEAPSNVAIIGRYILTPEIFDFLSLQKTGSGGEIQLTDAIEQLNEIQKVYAYAYEGKRYDVGEKFGFIKSTIEMALSREDLRDDLLRYLEDL 285
>gi|153955972|ref|YP_001396737.1| hypothetical protein CKL_3363 [Clostridium kluyveri DSM 555] >gi|146348830|gb|EDK35366.1| Hypothetical protein CKL_3363 [Clostridium kluyveri DSM 555] (293 aa)
Score = 759, Expect = 8.9e-79, Identities = 157/287 (54%), Positives = 214/287 (74%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           + KAVIPAAG+GTRFLPATKA PKEMLPI+DKPTIQ++VEEAV SGIE+ILII+ + K SI DHFD   ELE+ LK  +K    +L++NIS+M +I+Y+RQKEP GLGHAI++AK F+GNE FA++LGDD++     S+ P LKQ I  + + N SI+GVQ V  K+VSKYGIID + Q+D K    ++KNM+EKP    +PSN AILGRY++TP IF  LE T+     EI++T +L  L ++E +Y+  F GKRYDIG K+G+++A ++ +L + D+R+ L+ Y+
  S:     3 IKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYVVEEAVNSGIEEILIILGKNKKSIEDHFDKSVELEDELKSSHKDGLLELIQNISNMVNIYYVRQKEPKGLGHAISLAKAFVGNEAFAVILGDDIV----DSEVPCLKQLINCYNKYNTSIIGVQPVNRKDVSKYGIIDGI-QIDDKVH--KIKNMVEKPGKEEAPSNIAILGRYIITPEIFDILERTKPGKGNEIQLTDALKELLKQEAIYSYCFEGKRYDIGDKLGFIEANIEYALKRTDLRENLISYI 282
>gi|164688888|ref|ZP_02212916.1| hypothetical protein CLOBAR_02536 [Clostridium bartlettii DSM 16795] >gi|164602092|gb|EDQ95557.1| hypothetical protein CLOBAR_02536 [Clostridium bartlettii DSM 16795] (312 aa)
Score = 759, Expect = 9.4e-79, Identities = 159/298 (53%), Positives = 221/298 (74%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV-ETN 298
           M+K++ KAVIPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEAVASGIE+ILII  + K SI DHFD   ELE  L+QK K E  ++VR+IS M +I+YIRQKEP GLG AI  A+ FIG+EPFA++LGDD++     +D P LKQ +  +EE   +I+GVQ V  ++ +KYGII+      ++    +VK+++EKP+P   PSN AILGRY++TP IF+ LE       GE+++T +L  L++KE +YA  F G+RYD+G K+G+L+AT+D +L KP+++D  ++Y+K +  ETN
  S:     1 MQKKIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGKNKKSIEDHFDKSVELELELEQKGKTELLEIVRDISQMVNIYYIRQKEPKGLGDAIYCARSFIGDEPFAVMLGDDIV----DNDVPCLKQLMSAYEEYRTTILGVQTVAPEDANKYGIINARY---IEDNVYKVKDLVEKPEPGKQPSNIAILGRYIITPEIFEILENQAPGKGGEVQLTDALKTLSKKEAMYAYEFEGRRYDVGDKLGFLEATVDFALKKPELKDSFMDYLKKVCKETN 292
>gi|15895602|ref|NP_348951.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium acetobutylicum ATCC 824] >gi|15025344|gb|AAK80291.1|AE007734_5 UTP-glucose-1-phosphate uridylyltransferase [Clostridium acetobutylicum ATCC 824] (303 aa)
Score = 759, Expect = 1.1e-78, Identities = 153/288 (53%), Positives = 213/288 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           RV KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE+IL+I  + K +I DHFD  FELE  L+  NK E  K+V++IS++A+I+YIRQKEP GLGHAIN A+ F+GNEPFA+LLGDDV+     +  P LKQ I  + E   SI+GVQ V + EVSKYGI++ +    ++    +VK+++EKP    +PS+ AILGRY++TPSIF  L+ T+     EI++T +L  L + E +YA VF+G+RYD+G K+G+L+AT++ +L + +++   + Y+
  S:     2 RVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILVITGRNKRAIEDHFDKSFELESELESHNKKELLKVVKDISNLANIYYIRQKEPRGLGHAINCARTFVGNEPFAVLLGDDVV----NAKVPCLKQLINCYNEYKTSILGVQRVPNSEVSKYGIVNGMH---IEDGVYKVKDLVEKPKQEEAPSDLAILGRYIITPSIFDILDNTKPGKGDEIQLTDALKTLMKTEAMYAYVFSGRRYDVGDKLGFLQATVEYALKREELKKPFMNYL 282
>gi|168162353|ref|ZP_02597586.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus H3081.97] (293 aa)
Score = 759, Expect = 1.1e-78, Identities = 155/297 (52%), Positives = 214/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S   +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ D + Q   V+  +EKP+   +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++++ L+EYM  +V+  K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQTLLEKRKYEMLEKVQ-ASSRINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNDRRYQ---VRQFVEKPEKGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKMTIEMALQNEEIKEALIEYMNEVVQQKK 290
>gi|196166204|ref|ZP_03126735.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile QCD-23m63] (291 aa)
Score = 758, Expect = 1.2e-78, Identities = 153/292 (52%), Positives = 219/292 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+  V KA+IPAAG+GTRFLPATK+ PKEMLPI+DKPT+Q+I+EEA+ SGIE+ILII  + K SI DHFD   ELE  L+QK K E  ++VR+IS+M +IHYIRQKEP GLGHAI+ AK FIG+EPFA+LLGDD++     S+ P LKQ I+ + E   +++GVQ++  ++ +KYGI+D      ++ +  +VK+M+EKP    +PS+ AILGRY++TP+IF  LE+      GEI++T +L  L ++E +YA  F G+RYD+G KIG+L+AT+D +L + +++D+L++YM+
  S:     1 MQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKPTLQYIIEEAIESGIEEILIITGRNKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNMVNIHYIRQKEPKGLGHAIHCAKSFIGDEPFAVLLGDDIV----DSEVPCLKQLIDTYNEYKTTVLGVQKIAKEDTNKYGILDVKH---IEDRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFNILEKQTPGKGGEIQLTDALQTLGKQEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLKDDLMDYMR 285
>gi|196045580|ref|ZP_03112810.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus 03BB108] >gi|196023411|gb|EDX62088.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus 03BB108] (292 aa)
Score = 758, Expect = 1.4e-78, Identities = 153/293 (52%), Positives = 214/293 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E ++ V+  S   +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ D + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L + +++++L++YM  LV
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMFEKVQ-ASSRINIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYESTQSSVIGVQTVPENETHRYGIIDPVEQNDRRYQ---VRQFVEKPVEGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEMALQQKELKEQLIKYMVELV 286
>gi|118443279|ref|YP_877851.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium novyi NT] >gi|118133735|gb|ABK60779.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium novyi NT] (304 aa)
Score = 757, Expect = 1.6e-78, Identities = 154/288 (53%), Positives = 211/288 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           RV KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE+ILII  + K +I DHFD   ELE  L++K K +   +V++IS+M  I+YIRQKEP GLGHAIN AK F+GNEPFA++LGDDV+     S  P LKQ I+ F E   +I+GVQEV    V KYGI++ L    ++ +  +VK+++EKP  + +PSN AILGRY++TP IF  L  T+    GEI++T +L  L +KE +YA  F G+RYD+G K+G+L+AT++ +L +  +++E ++Y+
  S:     5 RVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILIITGRNKRAIEDHFDKSVELENILEEKGKNDLLSMVKDISNMVDIYYIRQKEPKGLGHAINCAKTFVGNEPFAVMLGDDVV----DSKVPCLKQLIDCFNEYKTTILGVQEVNKNSVDKYGIVEGLH---IEDRVYKVKDLVEKPSVNEAPSNVAILGRYIITPPIFDILSHTKPGKSGEIQLTDALRTLIKKEAMYAYKFEGRRYDVGDKLGFLEATVEFALKREGLKNEFMKYL 285
>gi|160914772|ref|ZP_02076986.1| hypothetical protein EUBDOL_00779 [Eubacterium dolichum DSM 3991] >gi|158433312|gb|EDP11601.1| hypothetical protein EUBDOL_00779 [Eubacterium dolichum DSM 3991] (290 aa)
Score = 757, Expect = 1.6e-78, Identities = 153/289 (52%), Positives = 212/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KA+IPAAG GTRFLPATKA+PKEMLPI+DKPTIQ+IVEEAVASGIE+ILII + YK+ I +HFD  FELE++L+     E  ++V+ IS+MA+I+ +RQK P GLGHA+  AK F+GNEPFAILLGDD++V  N++ K A +Q +E +E+   S+VGVQ+V   +V KYG++DP E ++ +  S  VK  +EKP    +PSN+AILGRYVLTP IF  LE  +     EI++T ++  L +++ V+A  F G RYD+G K G+LKA +D +L + D+ D +++ +K
  S:     2 KVKKAIIPAAGFGTRFLPATKAVPKEMLPIVDKPTIQYIVEEAVASGIEEILIITNCYKSCIENHFDVSFELEKKLEASKDQEHLEMVKEISNMANIYSVRQKNPRGLGHAVLCAKSFVGNEPFAILLGDDIVV--NKNGKTATQQLVEAYEQYGGSVVGVQKVADSQVHKYGVVDPSENINERCAS--VKGFVEKPKKEEAPSNFAILGRYVLTPEIFDLLETQEAGKGNEIQLTDAIDRLTKQQKVFAYDFEGVRYDVGDKAGFLKAQIDFALDRNDLHDVMVDILK 286
>gi|20807219|ref|NP_622390.1| UDP-glucose pyrophosphorylase [Thermoanaerobacter tengcongensis MB4] >gi|20515723|gb|AAM23994.1| UDP-glucose pyrophosphorylase [Thermoanaerobacter tengcongensis MB4] (302 aa)
Score = 757, Expect = 1.7e-78, Identities = 161/293 (54%), Positives = 209/293 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV SGIEDILII  + K +I DHFD   ELE  LK+KN+     LV +IS+M +IHYIRQKEP GLGHAI  AK F+GNEPFA+LLGDDV+     ++ P LKQ IE FE  N +I+GVQEV  ++V KYGI+       ++ +  +V ++IEKP    +PSN AILGRY++TP IF+ LE T     GEI++T +L  L   E +YA  F GKRYD+G K+GYL AT++ +L + D+R+    Y+  +V+
  S:     2 KIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVQSGIEDILIITGRNKRAIEDHFDKSVELELELKKKNQESLLSLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFVGNEPFAVLLGDDVV----DAEVPVLKQMIEQFERYNCTIIGVQEVPEEDVHKYGIV---SGTFIEDRLYKVNDLIEKPRREEAPSNIAILGRYIITPRIFEILEHTPPGRGGEIQLTDALKTLLNYEAIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLITIVQ 287
>gi|168185367|ref|ZP_02620002.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum C str. Eklund] >gi|169296375|gb|EDS78508.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum C str. Eklund] (291 aa)
Score = 757, Expect = 1.7e-78, Identities = 153/288 (53%), Positives = 211/288 (73%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAVASGIE+ILII  + K +I DHFD   ELE +L+  NK +  ++VR IS+M  IHYIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     S+ P LKQ I  + E   SI+GVQ+V ++ V KYGI+D    + ++ +  +VK ++EKP    +PS+ AILGRY++TP IF  LE T     GEI++T +L  L + + +Y+  F G+RYD+G K+G+L+AT++ +L + D+++  L+Y+K
  S:     3 VKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNKRAIEDHFDKSIELELQLENTNKTKLLEMVRGISNMVDIHYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVV----DSEVPCLKQLINCYNEYKTSILGVQKVPNENVCKYGIVD---GIHIEDRVYKVKGLVEKPSIEEAPSDIAILGRYIITPDIFDILENTPPGKGGEIQLTDALGILIKNQAMYSYCFEGRRYDVGDKLGFLQATVEFALKRDDIKEPFLKYLK 283
>gi|188587140|ref|YP_001918685.1| UDP-glucose pyrophosphorylase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351827|gb|ACB86097.1| UDP-glucose pyrophosphorylase [Natranaerobius thermophilus JW/NM-WN-LF] (292 aa)
Score = 757, Expect = 1.8e-78, Identities = 157/289 (54%), Positives = 212/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAVIPAAG+GTRFLPATKA PKEMLPILDKPTIQ+I+EEAV SG+EDILII  + K +I DHFD   ELEE L++K K +  + VR  +++  IHYIRQKEP+GLGHA+  AK+FIGNEPF +LLGDD++   N    P LKQ I+L+E+++ S++GVQEV  ++VS+YGI++     ++   + +V  +IEKP    +PS  AI+GRYV++P+IF  LE+T     GEI++T +L +LA+ E VYA  F G RYD G  +GYLK T++ +L + DV+DE  EY+K
  S:     3 KVRKAVIPAAGLGTRFLPATKAQPKEMLPILDKPTIQYIIEEAVESGVEDILIITGRGKRAIEDHFDRAIELEETLEEKGKQDLLEKVRETNEI-DIHYIRQKEPLGLGHAVLCAKKFIGNEPFGVLLGDDIV--RNGGGAPCLKQMIDLYEQEDASVIGVQEVPEQDVSRYGIVE--NGAEVSKGAYQVNQLIEKPPVEKAPSRLAIMGRYVISPTIFDYLEKTGPGSGGEIQLTDALNDLAKVEKVYAYPFKGTRYDAGDLLGYLKTTVEFALEREDVKDEFKEYLK 286
>gi|124521107|ref|ZP_01696119.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus coagulans 36D1] >gi|124497086|gb|EAY44656.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus coagulans 36D1] (298 aa)
Score = 757, Expect = 1.8e-78, Identities = 154/294 (52%), Positives = 214/294 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K +I DHFD  +ELE+ L +K K +    VR  S++A+IHYIRQKEP+GLGHA+  A+ FIG+EPFA+LLGDD++    Q+D P LKQ I+ +E  + SI+GVQEV  +E  +YGII P  Q     +S +V+  +EKP+   +PSN AI+GRY+LTP IF  L+  +    GEI++T ++  L Q + V+A  F GKRYD+G K+G++++ ++++L    +  +LL+ MK +VE
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVESGIEDIIIVTGKGKRAIEDHFDNAWELEQNLAEKGKFDLLDKVRYSSNLANIHYIRQKEPLGLGHAVWCARNFIGDEPFAVLLGDDIV----QNDPPCLKQLIDQYELTHSSIIGVQEVPEEETYRYGIIAPASQ---NGRSYQVEKFVEKPEQGTAPSNLAIIGRYLLTPEIFMFLDRQEKGAGGEIQLTDAIQQLNQIQRVFAYRFEGKRYDVGEKLGFIQSQIEMALKDETISRDLLKVMKRIVE 288
>gi|196252194|ref|ZP_03150855.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium thermocellum DSM 4150] >gi|196198327|gb|EDX93163.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium thermocellum DSM 4150] (316 aa)
Score = 756, Expect = 2.0e-78, Identities = 154/292 (52%), Positives = 219/292 (75%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           RV KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEA+ SGIEDI+II  + K +I DHFD  +ELE+ LK+K   +  KLV++IS++A+IHYIRQKE  GLGHAI  AK FIGNEPFA+LLGDD++     S+ P +KQ ++++++   +++GVQ+V   +VSKYGI+      D   +  +VK+++EKPD + +PSN AILGRY++TP IF  LE  +    GEI++T +L  L  +E +YA  F GKRYD+G+K+G+L+AT++ +L++ D+++E   Y+K ++
  S:    29 RVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIKSGIEDIIIISGRSKRAIEDHFDKSYELEQELKKKGNHDLLKLVQDISNLANIHYIRQKEAKGLGHAIYCAKSFIGNEPFAVLLGDDIV----DSEVPCIKQLMDVYDKYRTTVLGVQKVPEDQVSKYGIVGGEIVSD---RVYKVKDLVEKPDTASAPSNIAILGRYIITPRIFDYLENAKPGKGGEIQLTDALRELMGEEEMYAYDFIGKRYDVGNKLGFLQATVEFALARDDLKEEFEAYLKEII 313
>gi|47565302|ref|ZP_00236344.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus G9241] >gi|47557656|gb|EAL15982.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus G9241] (295 aa)
Score = 756, Expect = 2.1e-78, Identities = 152/295 (51%), Positives = 218/295 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE++L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    +++GVQ+V   EV +YGIIDP+EQ D + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G R+D+G K+G++K T++++L    +++ELL +M+ L+++
  S:     2 KKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEKKLLEKGKHEVLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDEYEGTQSAVIGVQKVPENEVHRYGIIDPVEQNDRRYQ---VRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQSVFAYDFEGTRFDVGEKLGFIKTTIEMALQDKGIQEELLNHMEWLLKS 288
>gi|125974668|ref|YP_001038578.1| UDP-glucose pyrophosphorylase [Clostridium thermocellum ATCC 27405] >gi|125714893|gb|ABN53385.1| UDP-glucose pyrophosphorylase [Clostridium thermocellum ATCC 27405] (289 aa)
Score = 755, Expect = 2.8e-78, Identities = 153/292 (52%), Positives = 219/292 (75%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           RV KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEA+ SGIEDI+II  + K +I DHFD  +ELE+ L++K   +  KLV++IS++A+IHYIRQKE  GLGHAI  AK FIGNEPFA+LLGDD++     S+ P +KQ ++++++   +++GVQ+V   +VSKYGI+      D   +  +VK+++EKPD + +PSN AILGRY++TP IF  LE  +    GEI++T +L  L  +E +YA  F GKRYD+G+K+G+L+AT++ +L++ D+++E   Y+K ++
  S:     2 RVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIKSGIEDIIIISGRSKRAIEDHFDKSYELEQELEKKGNHDLLKLVQDISNLANIHYIRQKEAKGLGHAIYCAKSFIGNEPFAVLLGDDIV----DSEVPCIKQLMDVYDKYRTTVLGVQKVPEDQVSKYGIVGGEIVSD---RVYKVKDLVEKPDTASAPSNIAILGRYIITPRIFDYLENAKPGKGGEIQLTDALRELMGEEEMYAYDFIGKRYDVGNKLGFLQATVEFALARDDLKEEFEAYLKEII 286
>gi|30023307|ref|NP_834938.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 14579] >gi|29898868|gb|AAP12139.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 14579] (293 aa)
Score = 755, Expect = 3.1e-78, Identities = 155/294 (52%), Positives = 213/294 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLP TKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ D + Q   V+  +EKP+   +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++  EL++YMK LV+
  S:     2 KKVRKAIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQSLLEKGKHEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNDRRYQ---VRQFVEKPEQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEVQRVFAYDFKGTRYDVGEKFGFIKTTIEMALQNEELNVELMKYMKELVK 287
>gi|157693970|ref|YP_001488432.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus pumilus SAFR-032] >gi|157682728|gb|ABV63872.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus pumilus SAFR-032] (293 aa)
Score = 754, Expect = 4.2e-78, Identities = 154/294 (52%), Positives = 213/294 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEAV SGIEDI+I+  + K +I DHFD+  ELE  L++K K E  + VR  S++A IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++ P L+Q ++ +E+   S++GVQ+V   +  +YGIIDPL Q   + Q   VKN +EKP    +PSN AILGRY+ TP IF  LE+ ++   GEI++T ++  L   + V+A  F GKRYD+G K G+++ TL+ +L   D++ +L+ +MK L+E
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVESGIEDIIIVTGKGKRAIEDHFDFAPELERNLEEKGKKELLEKVRKSSNIADIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAETPGLRQLMDEYEKTLSSVIGVQQVADHDTHRYGIIDPLTQEGRRYQ---VKNFVEKPPQGTAPSNLAILGRYIFTPEIFMYLEQQEIGAGGEIQLTDAIQKLNDIQRVFAYDFEGKRYDVGEKQGFIETTLEFALQDEDLKKKLIPFMKQLLE 288
>gi|145952643|ref|ZP_01801652.1| hypothetical protein CdifQ_04004020 [Clostridium difficile QCD-32g58] (326 aa)
Score = 753, Expect = 5.4e-78, Identities = 156/292 (53%), Positives = 220/292 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ +V KAVIPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEAVASGIE+ILII  + K SI DHFD   ELE  L++K K E  ++V+NIS+M +IHYIRQKEP GLG AI  A+ FIG+EPFA++LGDD++     +D P LKQ  + +EE   +I+GVQ+V  ++ +KYGII   E  +++ +  +VK+M+EKP+   +PSN AILGRY++TP IF  L++      GE+++T +L  L++KE +YA  F GKRYD+G K+G+L+AT+D +L K D++++ ++Y+K
  S:     6 MQVKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGRNKKSIEDHFDKSVELELDLEKKGKKELLEVVQNISNMINIHYIRQKEPKGLGDAIYCARHFIGDEPFAVMLGDDIV----DNDVPCLKQLTDAYEEYRTTILGVQKVNQEDTNKYGII---EAKNIEGRVYKVKDMVEKPESGKAPSNIAILGRYIITPEIFDILKDLPPGKGGEVQLTDALKILSKKEAMYAYNFEGKRYDVGDKLGFLEATVDFALKKEDLKEDFIKYLK 290
>gi|171323871|ref|ZP_02912389.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. WCH70] >gi|171090182|gb|EDT36494.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. WCH70] (296 aa)
Score = 752, Expect = 5.6e-78, Identities = 153/297 (51%), Positives = 217/297 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ASGIEDI+I+  + K +I DHFD  +ELE+ L ++ K++  + V+  S +  IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++ P LKQ I+ +E+   S++GV+ V  +E  +YGIIDPLEQ   + Q   V+  +EKP P  +PSN AI+GRY+LTP IF  LE+ +    GEI++T ++  L + + V+A  F GKRYD+G K+G+++ T++ +L   ++RD+LL +M+ +V   K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKGKRAIEDHFDNAYELEQILMKQGKLDLLEKVKEPSKV-DIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAETPCLKQLIDQYEQTFSSVIGVKRVPDEETHRYGIIDPLEQHGRRYQ---VRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQRVFAYEFEGKRYDVGEKLGFIQTTIEFALQNEELRDDLLAFMEKIVTETK 290
>gi|15616214|ref|NP_244519.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus halodurans C-125] >gi|10176276|dbj|BAB07371.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus halodurans C-125] (297 aa)
Score = 752, Expect = 6.3e-78, Identities = 154/292 (52%), Positives = 213/292 (72%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ SGIEDI+++  + K +I DHFD  FELEE L++KNK +  + V+ IS M +IHYIRQKE  GLGHAI  A++FIGNEPFA+LLGDD++    QSD P LKQ I++F+  + S+VGVQEV +++VSKYGI+ P +  +++   +     +EKP    +PSNYAI+GRYVL P IF  LE       GEI++T ++  L + + V A  F G RYD+G K G++KAT+D++L + D+ +++ +Y+K + E
  S:     3 VKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIESGIEDIIVVTGRGKRAIEDHFDKSFELEETLEKKNKSKLLEEVKAISSMTNIHYIRQKEANGLGHAIWCARKFIGNEPFAVLLGDDIV----QSDVPCLKQLIDVFDRYHSSVVGVQEVPNEDVSKYGIVSP-KGSEIEANVIHAAGFVEKPKLEEAPSNYAIMGRYVLRPEIFDILENLPPGAGGEIQLTDAIKVLNESQVVLAYNFDGVRYDVGDKFGFIKATIDLALQRDDLSEDVAQYIKDIYE 289
>gi|126701112|ref|YP_001090009.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile 630] >gi|168697778|ref|ZP_02730055.1| utp--glucose-1-phosphate uridylyltransferase (general stress protein 33) [Clostridium difficile QCD-37x79] >gi|168726413|ref|ZP_02758690.1| utp--glucose-1-phosphate uridylyltransferase (general stress protein 33) [Clostridium difficile QCD-76w55] >gi|168730139|ref|ZP_02762416.1| utp--glucose-1-phosphate uridylyltransferase (general stress protein 33) [Clostridium difficile QCD-97b34] >gi|196124996|ref|ZP_03116745.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile ATCC 43255] >gi|196162303|ref|ZP_03122864.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile CIP 107932] >gi|115252549|emb|CAJ70392.1| utp--glucose-1-phosphate uridylyltransferase (general stress protein 33) [Clostridium difficile 630] (321 aa)
Score = 752, Expect = 7.2e-78, Identities = 156/292 (53%), Positives = 220/292 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ +V KAVIPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEAVASGIE+ILII  + K SI DHFD   ELE  L++K K E  ++V+NIS+M +IHYIRQKEP GLG AI  A+ FIG+EPFA++LGDD++     +D P LKQ  + +EE   +I+GVQ+V  ++ +KYGII   E  +++ +  +VK+M+EKP+   +PSN AILGRY++TP IF  L++      GE+++T +L  L++KE +YA  F GKRYD+G K+G+L+AT+D +L K D++++ ++Y+K
  S:     1 MQVKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGRNKKSIEDHFDKSVELELDLEKKGKKELLEVVQNISNMINIHYIRQKEPKGLGDAIYCARHFIGDEPFAVMLGDDIV----DNDVPCLKQLTDAYEEYRTTILGVQKVNQEDTNKYGII---EAKNIEGRVYKVKDMVEKPESGKAPSNIAILGRYIITPEIFDILKDLPPGKGGEVQLTDALKILSKKEAMYAYNFEGKRYDVGDKLGFLEATVDFALKKEDLKEDFIKYLK 285
>gi|196164009|ref|ZP_03124540.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium difficile QCD-23m63] (321 aa)
Score = 751, Expect = 7.5e-78, Identities = 156/292 (53%), Positives = 220/292 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ +V KAVIPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEAVASGIE+ILII  + K SI DHFD   ELE  L++K K E  ++V+NIS+M +IHYIRQKEP GLG AI  A+ FIG+EPFA++LGDD++     +D P LKQ  + +EE   +I+GVQ+V  ++ +KYGII   E  +++ +  +VK+M+EKP+   +PSN AILGRY++TP IF  L++      GE+++T +L  L++KE +YA  F GKRYD+G K+G+L+AT+D +L K D++++ ++Y+K
  S:     1 MQVKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGRNKKSIEDHFDKSVELELDLEKKGKKELLEIVQNISNMINIHYIRQKEPKGLGDAIYCARHFIGDEPFAVMLGDDIV----DNDVPCLKQLTDAYEEYRTTILGVQKVNQEDTNKYGII---EAKNIEGRVYKVKDMVEKPESGKAPSNIAILGRYIITPEIFDILKDLPPGKGGEVQLTDALKILSKKEAMYAYNFEGKRYDVGDKLGFLEATVDFALKKEDLKEDFIKYLK 285
>gi|168714950|ref|ZP_02747227.1| utp--glucose-1-phosphate uridylyltransferase (general stress protein 33) [Clostridium difficile QCD-63q42] (321 aa)
Score = 751, Expect = 7.9e-78, Identities = 156/292 (53%), Positives = 220/292 (75%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ +V KAVIPAAG+GTRFLPATKA PKEMLPI+DKPT+Q+I+EEAVASGIE+ILII  + K SI DHFD   ELE  L++K K E  ++V+NIS+M +IHYIRQKEP GLG AI  A+ FIG+EPFA++LGDD++     +D P LKQ  + +EE   +I+GVQ+V  ++ +KYGII   E  +++ +  +VK+M+EKP+   +PSN AILGRY++TP IF  L++      GE+++T +L  L++KE +YA  F GKRYD+G K+G+L+AT+D +L K D++++ ++Y+K
  S:     1 MQVKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGRNKKSIEDHFDKSVELELDLEKKGKKELLEVVQNISNMINIHYIRQKEPKGLGDAIYCARHFIGDEPFAVMLGDDIV----DNDVPCLKQLTDAYEEYRTTILGVQKVNQEDTNKYGII---EAKNIEGRVYKVKDMVEKPESGKAPSNIAILGRYIITPEIFDILKDLPPGKGGEVQLTDALKILSKKEAMYAYNFEGKRYDVGDKLGFLEATVDFALKKEDLKEDFIKYLK 285
>gi|168179608|ref|ZP_02614272.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum NCTC 2916] >gi|182669646|gb|EDT81622.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum NCTC 2916] (298 aa)
Score = 751, Expect = 8.6e-78, Identities = 154/291 (52%), Positives = 216/291 (74%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE ILII  + K +I DHFD   ELE+ L++K K E   +V++IS+MA I+YIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     SDKP LKQ I+ + E   +IVGVQEV  ++V KYGI+   + + ++ +  ++K+++EKP    +PSN AILGRY+++P+IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L + ++    ++Y++ L
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNKRAIEDHFDKSVELEKELQEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVVY----SDKPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIV---KGMFIEDRVYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKEAMYAYNFEGRRYDVGDKLGFLQATVEYALRREELNTNFVKYLQEL 285
>gi|56421855|ref|YP_149173.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus kaustophilus HTA426] >gi|56381697|dbj|BAD77605.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus kaustophilus HTA426] (294 aa)
Score = 750, Expect = 1.0e-77, Identities = 154/297 (51%), Positives = 216/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAVASGIEDI+I+  + K +I DHFD  FELE+ L QK K +  + V+  S +  IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++ P LKQ I+ +E+   S++GV+ V   E  +YGIIDP+EQ   + Q   V+  +EKP P  +PSN AI+GRY+LTP IF  LE+ +    GEI++T ++  L + + V+A  F GKRYD+G K+G+++ T++ +L   ++R++L+++M+ L+   K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKGKRAIEDHFDNAFELEQNLIQKGKYDLLEKVKEPSKV-DIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAETPCLKQLIDQYEQTLSSVIGVKRVPDNETHRYGIIDPIEQHGRRYQ---VRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQRVFAYEFEGKRYDVGEKLGFIQTTIEFALQHDELREDLIQFMEKLLNDVK 290
>gi|192811399|ref|ZP_03040070.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. Y412MC10] >gi|192799962|gb|EDV76471.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. Y412MC10] (297 aa)
Score = 750, Expect = 1.0e-77, Identities = 151/295 (51%), Positives = 214/295 (72%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           + KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE +L+Q  K+E    V+  S MA IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    +++KP +KQ IE +E+   S++GV+ V  +EV +YGIIDP     +   S RV+ M+EKP    +PSN AI+GRY+LTP+IF  LE+ +    GEI++T ++  + + E VYA  + G RYD+G K+G++  +++ +L K ++R  LL  ++ ++  N+
  S:     4 IKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHAFELEHKLRQTKKLELLHEVQRPSRMADIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----RAEKPCIKQLIEQYEQTRSSVIGVKYVSPEEVHRYGIIDPYPVPTIGGLS-RVQGMVEKPKAEDAPSNLAIMGRYILTPAIFSYLEQMEEGIGGEIQLTDAIQRMTEIEEVYAYQYEGTRYDVGEKLGFILTSVEFALMKEELRLPLLHGLEQMIHKNR 293
>gi|166984682|ref|ZP_02256015.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus AH187] (293 aa)
Score = 750, Expect = 1.1e-77, Identities = 154/294 (52%), Positives = 211/294 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V K +IPAAG+GTRFLP TKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ + + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++  EL++YMK LVE
  S:     2 KKVRKVIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQSSVIGVQAVPENETHRYGIIDPVEQNNRRYQ---VRQFVEKPAQGTAPSNLAIMGRYVLTPEIFTFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGTRYDVGEKFGFIKTTIEMALQNKELNVELMKYMKELVE 287
>gi|168142873|ref|ZP_02586102.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus cereus G9842] (292 aa)
Score = 750, Expect = 1.1e-77, Identities = 151/297 (50%), Positives = 215/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ SGIEDI+++  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    +++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ D + Q   V+  +EKP+   +PSN AI+GRYVLTP IF  LE  Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++R+ L++YM  +++  K
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAMESGIEDIIVVTGKGKRAIEDHFDHSFELEQSLLEKGKYEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----KAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNDRRYQ---VRQFVEKPEQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGIRYDVGEKFGFIKTTIEMALQNEELRESLIDYMDGILKKRK 290
>gi|168187384|ref|ZP_02622019.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum C str. Eklund] >gi|169294687|gb|EDS76820.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum C str. Eklund] (301 aa)
Score = 749, Expect = 1.3e-77, Identities = 153/288 (53%), Positives = 212/288 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           RV KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE+ILII  + K +I DHFD   ELE  L++K K     +V++IS+M  I+YIRQKEP GLGHAIN AK F+GNEPFA++LGDDV+     S  P LKQ I+ F E   +I+GVQEV+   V KYGI+   E + ++ +  +VK+++EKP    +PSN AILGRY++TP IF  L +T+    GEI++T +L  L +KE +YA  F G+RYD+G K+G+L+AT++ +L + +++++ ++Y+
  S:     2 RVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILIITGRNKRAIEDHFDKSVELENMLEEKGKDNLLNMVKDISNMVDIYYIRQKEPKGLGHAINCAKTFVGNEPFAVMLGDDVV----DSKVPCLKQLIDCFNEYKTTILGVQEVDKNSVDKYGIV---EGIHIEDKVYKVKDLVEKPSIDEAPSNVAILGRYIITPPIFDILSKTKPGKSGEIQLTDALRTLIKKEAMYAYKFEGRRYDVGDKLGFLEATVEFALKREELKNQFMKYL 282
>gi|169186405|ref|ZP_02846566.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] >gi|169006374|gb|EDS53224.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] (298 aa)
Score = 749, Expect = 1.3e-77, Identities = 151/293 (51%), Positives = 206/293 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ASGIEDILII  + K +I DHFD  +ELE+ L +K K ++ + +R IS+MA+IHY RQKEP GLGHAI  A+ F+GNEPFA+LLGDD++    QS+ P L Q I +++    S+VGVQ V  ++VSKYGII P     ++     +  ++EKP    +PSNYAI+GRYVL+P IF  LE        EI++T ++  L  +  V A  F G RYD+G K G++KA LD +L + D++ ++L Y++ + E
  S:     2 KVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEDILIISGRGKRAIEDHFDKSYELEDMLAKKGKTKELEQIRGISEMANIHYTRQKEPKGLGHAIWCARSFVGNEPFAVLLGDDIV----QSEDPCLSQLIRVYDRYQSSVVGVQRVADEDVSKYGIIAP-RGSSIEPSVFFLDGLVEKPSKKAAPSNYAIMGRYVLSPEIFDILEHQSPGAGDEIQLTDAIKKLNDQRNVLAYNFEGVRYDVGDKFGFIKAQLDFALQRDDLQKDVLGYLQQVYE 289
>gi|23100349|ref|NP_693816.1| UTP-glucose-1-phosphate uridylyltransferase [Oceanobacillus iheyensis HTE831] >gi|22778581|dbj|BAC14850.1| UTP-glucose-1-phosphate uridylyltransferase [Oceanobacillus iheyensis HTE831] (295 aa)
Score = 748, Expect = 1.9e-77, Identities = 148/290 (51%), Positives = 210/290 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           + + KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K +    V + S +  +HYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    ++D P L+Q IE +EE   S+VGVQ+V   E  +YGI+DP     ++ +  +V + +EKP    +PSN AI+GRYV  P IF+ L++ Q+   GEI++T ++  L + + VYA  F GKRYD+G K+G++K T+D++L   +++DEL  Y++
  S:     2 RTIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHNFELEDNLVKKEKFDLLDKVNHASSV-DLHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----RADTPGLRQLIEQYEETQSSVVGVQQVPDTETHRYGIVDPSM---IEGRRYKVNHFVEKPAQGTAPSNLAIMGRYVFNPEIFQFLDKQQIGAGGEIQLTDAIQMLNEIQPVYAYDFLGKRYDVGEKLGFVKTTIDLALENAEIKDELFSYLE 283
>gi|28211869|ref|NP_782813.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium tetani E88] >gi|28204311|gb|AAO36750.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium tetani E88] (300 aa)
Score = 748, Expect = 2.0e-77, Identities = 156/293 (53%), Positives = 215/293 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           +V KAVIPAAG+GTRFLPATKA PKEMLPI+DKPTIQ I+EEAVASGIE+ILII  + K +I DHFD   ELE++LK   K +  ++V +IS+MA I+YIRQKEP GLGHAIN A+ F+GNEPFA++LGDDV+      DKP LKQ IE + E   +I+GVQ+V  ++V KYGI+   E   ++    +VK++IEKPD   +PSN AILGRY++TP IF+ L   +    GEI++T +L  L+ +E +YA  F G+RYD+G K+G+L+AT++ +L K +++++  +Y+  + E
  S:     9 KVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQHIIEEAVASGIEEILIITGRNKRAIEDHFDKSVELEQQLKDTGKKDMLEMVEDISNMAEIYYIRQKEPKGLGHAINCARTFVGNEPFAVMLGDDVVY----GDKPCLKQLIECYNEYKTTILGVQQVVREDVYKYGIV---EGKHIENNVYKVKDLIEKPDVDEAPSNIAILGRYIITPKIFEILSTIEPGKGGEIQLTDALKKLSLQEAIYAYDFEGRRYDVGDKLGFLEATIEFALRKDEIKNDFEKYILGIAE 294
>gi|42784441|ref|NP_981688.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 10987] >gi|42740373|gb|AAS44296.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus ATCC 10987] (293 aa)
Score = 747, Expect = 2.3e-77, Identities = 154/294 (52%), Positives = 214/294 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLP TKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +EE   S++GVQ V   E  +YGIIDP+E+ + + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE+ Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++  EL++YMK LV+
  S:     2 KKVRKAIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEETQSSVIGVQTVPENETHRYGIIDPIEKNERRYQ---VRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGIRYDVGEKFGFIKTTIEMALQNEELNVELMKYMKELVK 287
>gi|49478945|ref|YP_039265.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49330501|gb|AAT61147.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] (297 aa)
Score = 747, Expect = 2.7e-77, Identities = 154/297 (51%), Positives = 215/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK-LLVETNK 299
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q ++ +E    S++GVQ V   E  +YGIIDP+EQ + + Q   V+  +EKP    +PSN AI+GRYVLTP IF  LE+ Q    GEI++T ++  L + + V+A  F G RYD+G K G++K T++++L   ++R+ L+ YM  +L + NK
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNERRYQ---VRQFVEKPAEGTAPSNLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEIQRVFAYDFEGIRYDVGEKFGFIKTTIEMALQHEELRESLINYMAGILKKKNK 291
>gi|192808964|ref|ZP_03037639.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. Y412MC10] >gi|192801635|gb|EDV78140.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. Y412MC10] (290 aa)
Score = 746, Expect = 3.0e-77, Identities = 148/287 (51%), Positives = 208/287 (72%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           + KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEAVASGIEDI+I+  + K +I DHFD  FELE  L +K K    + VR  S+MA IHYIRQKEP GLGHAI  A++FIG+EPFA+LLGDD++    +S+ P LKQ +++++    +IVGVQ V+  EV +YGI+D  ++ D   ++ R   ++EKP    +PSN AI+GRY+L P IF  LE  +V   GEI++T +L  LA +  +YA  F G R+D+G K+G+++ ++  +L + ++R++LL Y+
  S:     3 IRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVASGIEDIIIVTGKGKRAIEDHFDSSFELEHNLAEKGKWGLLEEVRKPSNMADIHYIRQKEPKGLGHAIWCARKFIGDEPFAVLLGDDIV----ESEVPCLKQMMKVYDTYQSTIVGVQPVDWNEVDRYGIVDGSQKSDRIYETSR---LVEKPSRDEAPSNLAIMGRYILPPDIFDLLENQEVGKNGEIQLTDALSTLAHRSPIYAYHFDGMRHDVGEKLGFIETSIHYALQREELREDLLAYL 282
>gi|138896895|ref|YP_001127348.1| UDP-glucose pyrophosphorylase [Geobacillus thermodenitrificans NG80-2] >gi|134268408|gb|ABO68603.1| UDP-Glucose pyrophosphorylase [Geobacillus thermodenitrificans NG80-2] (294 aa)
Score = 746, Expect = 3.6e-77, Identities = 153/297 (51%), Positives = 215/297 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ASGIEDI+I+  + K +I DHFD  FELE+ L +K K +  + V+  S +  IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q++ P LKQ I+ +E+   S++GV+ V   E  +YGIIDP+EQ   + Q   V+  +EKP P  +PSN AI+GRY+LTP IF  LE+ +    GEI++T ++  L + + V+A  F GKRYD+G K+G++K T++ +L   ++R++L+++M+ L+   K
  S:     2 KTVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKGKRAIEDHFDIAFELEQNLIEKGKYDLLEKVKEPSKV-DIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QAETPCLKQLIDQYEQTLSSVIGVKRVPDNETHRYGIIDPIEQHGRRYQ---VRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQRVFAYEFEGKRYDVGEKLGFIKTTIEFALQHDELREDLIQFMEKLLNDVK 290
>gi|75760489|ref|ZP_00740527.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74492020|gb|EAO55198.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] (292 aa)
Score = 745, Expect = 4.2e-77, Identities = 150/293 (51%), Positives = 214/293 (73%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           K+V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELE+ L +K K E  + V+  S + +IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P L+Q +  +E    S++GVQ V   E  +YGIIDP+E+     +S +V+  +EKP    +PS+ AI+GRYVLTP IF  LE+ Q    GEI++T ++  L + + V+A  F G RYD+G K G+++ T++++L + +++++L++YM  LV
  S:     2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKI-NIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPCLRQLMNQYEGTQSSVIGVQTVPENETHRYGIIDPIER---NGRSYQVRQFVEKPAEGTAPSDLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEMQRVFAYDFEGTRYDVGEKFGFIRTTIEMALQQKELKEQLIKYMVELV 286
>gi|10956341|ref|NP_052790.1| hypothetical protein pxo1_94 [Bacillus anthracis] >gi|21392812|ref|NP_652892.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A2012] >gi|47566448|ref|YP_016460.2| UTP-glucose-1-phosphate uridylyltransferase, (pxo1-94) [Bacillus anthracis str. 'Ames Ancestor'] >gi|47568873|ref|ZP_00239566.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus G9241] >gi|165873518|ref|ZP_02218117.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0488] >gi|167642195|ref|ZP_02400417.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0193] >gi|170709553|ref|ZP_02899953.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0389] >gi|177656304|ref|ZP_02937197.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0174] >gi|190569550|ref|ZP_03022411.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|4894310|gb|AAD32398.1| pXO1-94 [Bacillus anthracis] >gi|20520199|gb|AAM26081.1| UTP-glucose-1-phosphate uridylyltransferase, (pXO1-94) [Bacillus anthracis str. A2012] >gi|47552263|gb|AAT28870.2| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47554452|gb|EAL12810.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus G9241] >gi|164710893|gb|EDR16471.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0488] >gi|167509878|gb|EDR85302.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0193] >gi|170125514|gb|EDS94441.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0389] >gi|172079664|gb|EDT64781.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0174] >gi|190559329|gb|EDV13353.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis Tsiankovskii-I] (295 aa)
Score = 744, Expect = 4.8e-77, Identities = 150/289 (51%), Positives = 212/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV+SGIEDI+I+  + K+ I DHFD  +ELE+ L +KNK++  + +  IS++A+IHYIRQKEP GLGHAI  A+RFIG EPFA+LLGDD++     S  P LKQ I+++EE + S+VGVQ V   EVSKYGI+    Q ++    + +  ++EKP    +PSN AI+GRY+L P IF+ L+   V   GEI++T ++  L +++ V A  F GKRYD+G K G++KAT+D +L +  +++++L Y++
  S:     2 KIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVSSGIEDIIIVSGRGKHVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFIGEEPFAVLLGDDIV----SSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVKSANQ-NVNQSIIPISMLVEKPPLETAPSNLAIMGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNKQQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLR 285
>gi|147679103|ref|YP_001213318.1| UDP-glucose pyrophosphorylase [Pelotomaculum thermopropionicum SI] >gi|146275200|dbj|BAF60949.1| UDP-glucose pyrophosphorylase [Pelotomaculum thermopropionicum SI] (292 aa)
Score = 744, Expect = 5.7e-77, Identities = 146/290 (50%), Positives = 211/290 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           KRV KAVIPAAG+G RFLPATKA PKEMLPI+DKPTIQ+IVEEA+ASGI DILII  + K +I DHFD   ELE +LK+  K  + +L+++IS +A I+++RQKEP+GLGHAI  A++FIGNEPFA+LLGDD++    +S++P LKQ + L+EE   S++ V EV  ++VSKYG++D +E+   +    R+ +++EKP    +PS  A++GRY++ P I   L ET+    GEI++T +L  L +++ +Y   F GKRYD+G K+GYL+A ++ +L +PD+     +Y++
  S:     2 KRVRKAVIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAIASGISDILIITGRNKRAIEDHFDRSVELEVQLKKAGKAAELELIQDISQLADIYFVRQKEPLGLGHAIYCARQFIGNEPFAVLLGDDIV----RSEEPCLKQLMNLYEEVQSSVIAVMEVPEEDVSKYGVLDAVEE---RPGVYRINDLVEKPAREKAPSRLAVMGRYIIQPGICSILAETRPGAGGEIQLTDALKVLCREQPMYGLAFEGKRYDVGDKLGYLQAMVEFALERPDLAGGFRKYLQ 284
>gi|52079689|ref|YP_078480.1| UTP--glucose-1-phosphate uridylyltransferase YngB [Bacillus licheniformis ATCC 14580] >gi|52785051|ref|YP_090880.1| YngB [Bacillus licheniformis ATCC 14580] >gi|52002900|gb|AAU22842.1| UTP--glucose-1-phosphate uridylyltransferase YngB [Bacillus licheniformis ATCC 14580] >gi|52347553|gb|AAU40187.1| YngB [Bacillus licheniformis DSM 13] (296 aa)
Score = 743, Expect = 7.2e-77, Identities = 155/289 (53%), Positives = 211/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAVIPAAG+GTRFLPATKA PKEMLPI+DKP IQ+IVEEAV SGIEDILII  + K SI DHFD   ELE+ L  K K +  K +R I+DMA+IHYIRQKEP+GLGHA+  AK FIG+EPFA+LLGDD++V    S+ PAL+Q +E++EE    ++GVQ V+  +VSKYGII    Q   K +  ++ +++EKP    +PSN A++GRYVL PSIF  LE+T+     EI++T +L  + +++ +YA+   G R+DIG K+G  KA+ +I+L + ++R +LL Y++
  S:     2 KVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVQSGIEDILIITGRNKRSIEDHFDRSVELEQNLLAKGKNDVLKEIREIADMANIHYIRQKEPIGLGHAVLSAKHFIGDEPFAVLLGDDIMV----SETPALRQLLEVYEEYQTEVIGVQPVDPADVSKYGIIQTSAQ---KNKVYQIDDLVEKPTVKDAPSNIAVMGRYVLRPSIFPVLEQTKRGAGNEIQLTDALREICREQSMYARKLKGSRFDIGDKLGSFKASTEIALMRDEMRPKLLAYLE 283
>gi|56964862|ref|YP_176593.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus clausii KSM-K16] >gi|56911105|dbj|BAD65632.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus clausii KSM-K16] (294 aa)
Score = 743, Expect = 7.7e-77, Identities = 156/294 (53%), Positives = 212/294 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K + KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ SGIEDI+I+  + K +I DHFD+ FELEE L +K K E  + V+    +  IHYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q +KP LKQ IE +EEK  SI+GVQ+V  +E ++YGIIDP  Q   + +   V   +EKP    +PSN AILGRY+LTP IF  LE+ +    GEI++T ++  L +++ VYA  F GKRYD+G K+G++  TL+ ++ + +++  L++ MK  +E
  S:     2 KPIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKGKRAIEDHFDHAFELEENLAKKEKFELLEAVQQAGKV-DIHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QHEKPCLKQLIEQYEEKQASIIGVQQVPREETNRYGIIDPANQ---EGRLYGVSRFVEKPKVEEAPSNLAILGRYLLTPEIFAHLEKQETGAGGEIQLTDAIQKLNEEQQVYAYDFEGKRYDVGEKLGFVLTTLEFAIQREELKPALIKKMKEYLE 287
>gi|170689770|ref|ZP_02880940.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0465] >gi|170666145|gb|EDT16938.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0465] (295 aa)
Score = 741, Expect = 1.1e-76, Identities = 150/289 (51%), Positives = 211/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV+SGIEDI+I+  + K  I DHFD  +ELE+ L +KNK++  + +  IS++A+IHYIRQKEP GLGHAI  A+RFIG EPFA+LLGDD++     S  P LKQ I+++EE + S+VGVQ V   EVSKYGI+    Q ++    + +  ++EKP    +PSN AI+GRY+L P IF+ L+   V   GEI++T ++  L +++ V A  F GKRYD+G K G++KAT+D +L +  +++++L Y++
  S:     2 KIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVSSGIEDIIIVSGRGKRVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFIGEEPFAVLLGDDIV----SSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVKSANQ-NVNQSIIPISMLVEKPPLETAPSNLAIIGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNKQQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLR 285
>gi|153955792|ref|YP_001396557.1| hypothetical protein CKL_3178 [Clostridium kluyveri DSM 555] >gi|146348650|gb|EDK35186.1| GalU [Clostridium kluyveri DSM 555] (308 aa)
Score = 741, Expect = 1.1e-76, Identities = 155/292 (53%), Positives = 214/292 (73%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAVASGIE+ILII  + K +I DHFD   ELE  L++K K +  K+VR+IS ++ I+YIRQKEP GLGHAI  A+ F+GN+PFA++LGDDV+     ++ P LKQ I+ + E   SI+GVQEV  +EV KYGI+  +    ++    +VK++IEKP    +PSN AILGRY++TPSIF+ L+ T     GEI++T +L  LA+ E +YA  F G+RYD+G K+G+L+AT++ +L K +++   ++Y+  L E
  S:     3 VKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNKRAIEDHFDKSIELERELEKKGKEDLLKIVRDISSISDIYYIRQKEPKGLGHAIGCARTFVGNQPFAVMLGDDVV----DNEIPCLKQLIDCYNEYKTSIIGVQEVPKEEVYKYGIVKGMY---IENNVYKVKDLIEKPKVKEAPSNMAILGRYIITPSIFEILQNTTPGKGGEIQLTDALRTLAKNEAMYAYTFQGRRYDVGDKLGFLQATVEFALKKEELKKPFMKYLLGLKE 287
>gi|89096329|ref|ZP_01169222.1| utp-glucose-1-phosphate uridylyltransferase, (pxo1-94) [Bacillus sp. NRRL B-14911] >gi|89089183|gb|EAR68291.1| utp-glucose-1-phosphate uridylyltransferase, (pxo1-94) [Bacillus sp. NRRL B-14911] (294 aa)
Score = 741, Expect = 1.2e-76, Identities = 152/291 (52%), Positives = 211/291 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           ++ KA+IPAAG+GTRFLPATKA+PKEMLPI+DKP IQ+IVEEAV SGIEDI+II  + K SI DHFD  +ELEE L +KNK    K V+ IS +A+IHYIRQKEP GLG AI  A+ F+ NEPFA+LLGDD++    +S  P L+Q IE+F+  + S+ GVQ+V  ++VSKYGII P+ + +L+     ++ ++EKP   ++PS  AI+GRY+LTP IF  L++      GEI++T +L  L + E V A  F G+RYDIG+K G+++AT+D +L + D++ E+  Y++ L
  S:     2 KIRKAIIPAAGLGTRFLPATKALPKEMLPIVDKPAIQYIVEEAVLSGIEDIIIISGRSKRSIEDHFDKSYELEETLYKKNKQSLLKEVQKISQLANIHYIRQKEPKGLGDAIYCARSFVNNEPFAVLLGDDIV----KSRIPCLRQLIEVFDLHHCSVAGVQQVAEEDVSKYGIIKPINR-NLEQDVFNIEALVEKPKKKLAPSRLAIMGRYILTPGIFSILKDLPPGSGGEIQLTDALNILNKSETVLACGFQGQRYDIGTKAGFIRATIDFALEREDLKAEISSYLRKL 287
>gi|146296612|ref|YP_001180383.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410188|gb|ABP67192.1| UDP-glucose pyrophosphorylase [Caldicellulosiruptor saccharolyticus DSM 8903] (302 aa)
Score = 741, Expect = 1.3e-76, Identities = 156/295 (52%), Positives = 217/295 (73%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           MKK + KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEA+ SGIE ILI+  + K +I DHFD  FELE  L+ K   +  +++R I+D  ++HYIRQKEP GLG A+  A+ FI NEPFA+LLGDD+I+    SDKP LKQ IE++EE   +I+GVQ+V  ++VSKYGI+   +   ++ +  +VK+++EKP    SPSN A+LGRY++TP I   LE T+    GEI++T +L  L++KE +YA  F GKRYD+G+K+G+L+AT++I+LS+ D+  +   Y+  +V
  S:     1 MKKLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGRGKRAIEDHFDKSFELEVALENKKDFDSLQMIRKIADY-NVHYIRQKEPRGLGDAVYCARLFIDNEPFAVLLGDDIII----SDKPCLKQLIEVYEEYRTTILGVQKVPEEDVSKYGIVAGKQ---IEDRIYKVKDLVEKPKKEESPSNIAVLGRYIITPEILNILEHTKEGIGGEIQLTDALRELSKKEAMYAYEFEGKRYDVGNKLGFLQATVEIALSREDIGKDFYNYLVTIV 287
>gi|167636894|ref|ZP_02395177.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0442] >gi|167527820|gb|EDR90659.1| UTP--glucose-1-phosphate uridylyltransferase [Bacillus anthracis str. A0442] (295 aa)
Score = 739, Expect = 1.8e-76, Identities = 150/289 (51%), Positives = 211/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV+SGIEDI+I+  + K  I DHFD  +ELE+ L +KNK++  + +  IS++A+IHYIRQKEP GLGHAI  A+RFIG EPFA+LLGDD++     S  P LKQ I+++EE + S+VGVQ V   EVSKYGI+  L   ++    + +  ++EKP    +PSN AI+GRY+L P IF+ L+   V   GEI++T ++  L +++ V A  F GKRYD+G K G++KAT+D +L +  +++++L Y++
  S:     2 KIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVSSGIEDIIIVSGRGKRVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFIGEEPFAVLLGDDIV----SSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVK-LANQNVNQSIIPISMLVEKPPLETAPSNLAIIGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNKQQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLR 285
>gi|169190173|ref|ZP_02850147.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] >gi|169003068|gb|EDS49941.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] (295 aa)
Score = 737, Expect = 3.1e-76, Identities = 155/296 (52%), Positives = 206/296 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELL---EYMKLLVETNK 299
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEA+ASGIEDI+I+  + K +I DHFD+ FELE  L  K K +    VR  S++  IHYIRQKE  GLGHA+  A+ FIG+EPFA+LLGDD++    QS  P +KQ IE +E  + S++GVQ V   +  +YGI+DP+E  D   Q   VK  +EKP    +PSN AI+GRY+LTP IF  L+  +    GEI++T ++  L + +GVYA  F G RYD+G K+G++  T+D +L   ++R  LL   E M L  ++NK
  S:     3 KVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKGKRAIEDHFDHAFELEHNLFSKGKFDLLDEVRRSSNV-DIHYIRQKEARGLGHAVWCARNFIGDEPFAVLLGDDIV----QSHVPCVKQLIEQYERTDRSVIGVQTVREDQTHRYGIVDPIESFDRLYQ---VKRFVEKPARGQAPSNLAIMGRYILTPEIFDCLKNQEEGAGGEIQLTDAIQKLNELQGVYAYDFEGTRYDVGEKLGFITTTIDFALRNDELRIPLLAAMEEMMLREQSNK 293
>gi|118727578|ref|ZP_01576174.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium cellulolyticum H10] >gi|118663038|gb|EAV69703.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium cellulolyticum H10] (290 aa)
Score = 737, Expect = 3.4e-76, Identities = 151/293 (51%), Positives = 214/293 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           +V KA+IPAAG+GTRFLPATKA PKEM+PI+DKPTIQ+IVEEAVA+GIEDILII  + K +I DHFD  +ELEE L +K K++   +V+ IS++A+IHYIRQKE  GLGHAI  AK FIGNEPFA++LGDD++     S  P +KQ ++++ E   +I+GVQ+V  ++V+KYG+I    Q+D      +VK ++EKP+   +PSN AILGRY+++P IF+ LE       GEI +T +L  L ++E +YA  F G RYD+G +IG+LKAT++ +L + D++D+   +++  +E
  S:     2 KVRKAIIPAAGLGTRFLPATKAQPKEMIPIVDKPTIQYIVEEAVAAGIEDILIISGRNKRAIEDHFDKSYELEEELHRKGKLDLLSVVQEISNIANIHYIRQKEAKGLGHAIYCAKSFIGNEPFAVMLGDDIV----DSPVPCIKQLMDVYNEYQTTILGVQKVPLQDVTKYGVIGG-TQID--ESVYKVKGLVEKPEVEQAPSNIAILGRYIISPRIFEFLETAVPGKNGEIWLTDALQKLMEQEAMYAFDFAGDRYDVGDRIGFLKATVEFALKREDLKDDFTAFLRHKME 287
>gi|167462819|ref|ZP_02327908.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus larvae subsp. larvae BRL-230010] (290 aa)
Score = 737, Expect = 3.8e-76, Identities = 150/293 (51%), Positives = 213/293 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++ KA+IPAAG+GTRFLPATKA PKEMLPI+DKP IQ+IVEEA+ SGIE+I+I+  ++K +I DHFD   ELE +L++K       LV+ +S++A +HYIRQKEP+GLGHAI  A+ FIG+EPFA+LLGDD+I    QS  P LK  +ELFEE   S++ VQEV H++VSKYGII P  +    TQ   +K+++EKPDP+ +PSN A++GRY+++P IF  LE  +    GEI++T +L  L +   + A    GKRYD+G K GY++AT++++L + ++ D + +Y+  LV+
  S:     2 KIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAIDSGIENIIIVTGRHKRAIEDHFDKSVELEMQLEEKGDERLLHLVQAVSNLADVHYIRQKEPLGLGHAILCARNFIGDEPFAVLLGDDII----QSQPPTLKGMMELFEETERSVIAVQEVAHEDVSKYGIISPSAENSRYTQ---IKDLVEKPDPAEAPSNLAVIGRYIISPEIFDILERQKPGRGGEIQLTDALRVLNRDFPMAAFPIQGKRYDVGDKFGYIEATIELALQRDELGDAVKQYLTELVK 287
>gi|172058594|ref|YP_001815054.1| UTP-glucose-1-phosphate uridylyltransferase [Exiguobacterium sibiricum 255-15] >gi|171991115|gb|ACB62037.1| UTP-glucose-1-phosphate uridylyltransferase [Exiguobacterium sibiricum 255-15] (293 aa)
Score = 736, Expect = 4.7e-76, Identities = 153/294 (52%), Positives = 210/294 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +V KA+IPAAG+GTRFLPATKAMPKEMLPIL KPTIQ+IVEEAVASGIE I+I+  + K +I DHFD+  ELE  L+QK K++  K V   + MA IHYIRQKEP GLGHAI  A+ FIG+EPFA+LLGDD+IV    S++P LKQ ++ +EE + S+VGV++V  ++  +YGIIDPL Q   + Q   V+  +EKP    +PSN AI+GRY+LTP+IF+ L   +    GEI++T ++  L  +E VY     GKR+D+G K+GY++ TL  +L   +++ ++ + +K  VE+
  S:     3 KVRKAIIPAAGLGTRFLPATKAMPKEMLPILTKPTIQYIVEEAVASGIEQIIIVSGRSKRAIEDHFDHAPELENILRQKGKLDLLKEVDASTTMAEIHYIRQKEPKGLGHAIWSARHFIGDEPFAVLLGDDIIV----SEEPGLKQLMDQYEELDASVVGVRQVPIEDTHRYGIIDPLNQTGRRYQ---VRQFVEKPVQGTAPSNMAIIGRYILTPAIFEYLATQEAGTGGEIQLTDAIERLNGQEDVYGYEVEGKRFDVGEKMGYVETTLAFALEDAEIQADVRQLLKRYVES 289
>gi|16078879|ref|NP_389700.1| hypothetical protein BSU18180 [Bacillus subtilis subsp. subtilis str. 168] >gi|2634201|emb|CAB13701.1| yngB [Bacillus subtilis subsp. subtilis str. 168] (297 aa)
Score = 736, Expect = 5.1e-76, Identities = 151/296 (51%), Positives = 211/296 (71%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M+K+V KAVIPAAG+GTRFLPATKA PKEMLPI+DKP IQ+IVEEA  SGIEDILII  + K SI DHFD   ELE  L++K K E  K ++ I+D+A+IHYIRQKEP+GLGHA+  A+ FIG+EPFA+LLGDD++V    S+ PAL+Q +++++     +VGVQ V  ++VSKYGII+       +     V +++EKP P  +PS  A++GRYVL  SIF  L+        EI++T +L  + +KE ++A++  G RYDIG K+G  KA+ +I L +P++R +LL Y++ +++
  S:     1 MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGRNKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEHFIGDEPFAVLLGDDIMV----SETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGS---QGHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCRKEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIK 289
>gi|78043028|ref|YP_361375.1| UTP-glucose-1-phosphate uridylyltransferase [Carboxydothermus hydrogenoformans Z-2901] >gi|77995143|gb|ABB14042.1| UTP-glucose-1-phosphate uridylyltransferase [Carboxydothermus hydrogenoformans Z-2901] (291 aa)
Score = 734, Expect = 7.2e-76, Identities = 155/293 (52%), Positives = 213/293 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++ KA+IPAAG+G RFLPATKA PKEMLPI+DKPTIQ+IVEEAVASGIEDILI+  + K +I DHFD   ELE  L+++ K +  ++VR+I +M  IHY+RQKEP+GLGHAI  A++FIGNEPFA+LLGDD++    ++  P LKQ I+L+E+   SIV VQ VE +EVSKYGII   E   +  +  RV +++EKP P  +PSN A++GRY++ P IF+ LE+T     GEI++T +L  L Q + +Y  V+ G RYD+G K+G+LKAT++ +L + ++      Y+K LVE
  S:     2 KIKKAIIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVTGKNKRAIEDHFDKSPELEMYLEKRGKEDLLEIVRSIGNMVDIHYVRQKEPLGLGHAIYCARKFIGNEPFAVLLGDDLM----KARTPVLKQMIDLYEKVEASIVAVQAVEPREVSKYGIIKAEE---VGERLYRVYDLVEKPKPEEAPSNLAVMGRYIIEPEIFEFLEKTPPGAGGEIQLTDALRMLCQVKPIYGYVYEGLRYDVGDKLGFLKATVEFALDREELAQGFKAYLKELVE 287
>gi|89210160|ref|ZP_01188552.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Halothermothrix orenii H 168] >gi|89160233|gb|EAR79889.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Halothermothrix orenii H 168] (304 aa)
Score = 734, Expect = 8.1e-76, Identities = 154/293 (52%), Positives = 213/293 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEA+ +GIEDILII  ++K +I DHFD   ELE  L++K K +  K+V++IS+M  IHY+RQKEP GLGHAI  A+ FIG+EPFA+LLGDDVI     S +  + Q I++FE++   ++GVQ+V  KEVSKYGI+    Q   +     ++++IEKPD   +PSN AILGRYV+TP IF  L  T+     EI++T +L  LA +  + A  F+GKRYD+G+K+G+L+AT++ +L + D+ DE  +Y+  L+E
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIEAGIEDILIITGKHKRAIEDHFDKSIELELALEKKGKDDLLKMVKDISNMVDIHYVRQKEPKGLGHAIYCARTFIGDEPFAVLLGDDVIY----SKRSVIGQMIDVFEKREEPVIGVQQVPEKEVSKYGIVKYDRQ---EEDIYHIEDLIEKPDIDKAPSNLAILGRYVITPDIFPILARTKPGRNNEIQLTDALRELASERNMVAYNFSGKRYDVGNKMGFLQATVEYALRREDLGDEFFKYLVNLME 287
>gi|15895518|ref|NP_348867.1| UDP-glucose pyrophosphorylase [Clostridium acetobutylicum ATCC 824] >gi|15025251|gb|AAK80207.1|AE007725_4 UDP-glucose pyrophosphorylase [Clostridium acetobutylicum ATCC 824] (287 aa)
Score = 733, Expect = 9.5e-76, Identities = 155/287 (54%), Positives = 213/287 (74%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           + KAVIPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEA  SGIE+ILII+ + K SI DHFD   ELEE LK  +K E  ++VR +S+M +I+Y+RQKEPMGLGHAI++AK F GNE FA++LGDD++     S  P LKQ ++ ++  N SI+GVQEV  K+V KYGI+D    ++++ +  +VKN++EKP   ++PSN AILGRY++TP+IF  LE T+    GE+++T +L  L ++E +Y+  F GKRYDIG K+G+++A +D +L    +  EL EY+
  S:     3 IRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAALSGIEEILIIIGRNKKSIEDHFDKSAELEEELKNNHKEELLRMVRQVSNMVNIYYVRQKEPMGLGHAISLAKSFAGNEAFAVMLGDDIV----DSKVPCLKQLMDCYDRYNTSILGVQEVRKKDVCKYGIVD---GINIENKICKVKNLVEKPSIEMAPSNIAILGRYIITPTIFPILENTKPGKGGEVQLTDALEELLKREAIYSYCFDGKRYDIGDKLGFIEANIDFALKNDKLNSELKEYL 282
>gi|150016601|ref|YP_001308855.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149903066|gb|ABR33899.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium beijerinckii NCIMB 8052] (296 aa)
Score = 733, Expect = 1.1e-75, Identities = 152/290 (52%), Positives = 205/290 (70%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           V KAVIPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV SGIE+ILII  + K +I DHFD   ELE+ L+   K E  K+V++IS+M  I+Y RQKEP GLG AI+ AK F+GNEPFA++LGDD++     ++ P LKQ I  +++   S++GVQE+    + KYGII  +E   +     +V +M+EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +L  L ++E VYA  F GKRYD+G K+GYL+A +  +L + D++D+ + Y+  L
  S:     3 VRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVESGIEEILIITGRNKRAIEDHFDKSVELEDELENSKKDELLKMVQSISNMVDIYYTRQKEPKGLGDAISHAKNFVGNEPFAVMLGDDIV----DNEVPCLKQLINCYDKYKTSVLGVQEISECNIPKYGIIKGIE---IDEGLYKVSDMVEKPKIEEAPSNIAILGRYIITPDIFDILESTKPGKSGEIQLTDALKELTRQEAVYAYCFEGKRYDVGDKLGYLQANIAFTLKRDDLKDDFITYLSDL 285
>gi|154686264|ref|YP_001421425.1| YngB [Bacillus amyloliquefaciens FZB42] >gi|154352115|gb|ABS74194.1| YngB [Bacillus amyloliquefaciens FZB42] (297 aa)
Score = 729, Expect = 2.9e-75, Identities = 151/292 (51%), Positives = 205/292 (70%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+K+V KAVIPAAG+GTRFLPATKA PKEMLPI+DKP IQ+IVEEA A+GIEDILII  + K SI DHFD   ELE  L++K K E  K ++ I+D+A+IHY+RQKEP+GLGHA+  A+ FIG+EPFA+LLGDD++V    SD PAL Q I+++ +     VGVQ V+  +VSKYGII    Q        +V+++IEKP    +PS+ A++GRY+LTP+IFK L+        EI++T +L  + +   +YA+   G R+DIG K G  KA  +I L + ++R +LL Y++
  S:     1 MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAAAGIEDILIITGRNKRSIEDHFDRSAELEFNLEEKGKTETLKEMQRIADLANIHYLRQKEPLGLGHAVLCAEHFIGDEPFAVLLGDDIMV----SDTPALSQLIDVYNQHGTETVGVQPVDPADVSKYGIIQTGRQ---GGHVYQVEDLIEKPAVEKAPSHIAVMGRYILTPAIFKTLKTIGRGAGNEIQLTDALREVCRTRSIYARELEGSRFDIGDKFGCFKAGTEIGLLREEMRPKLLAYLE 285
>gi|73663330|ref|YP_302111.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123641899|sp|Q49VP4|GTAB2_STAS1 UTP--glucose-1-phosphate uridylyltransferase 2 (UDP-glucose pyrophosphorylase 2) (UDPGP 2) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 2) (Uridine diphosphoglucose pyrophosphorylase 2) >gi|72495845|dbj|BAE19166.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (289 aa)
Score = 728, Expect = 4.0e-75, Identities = 150/292 (51%), Positives = 209/292 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  L++K K +  + V+  +++A+I Y+RQKE  GLGHAI  A++FIG+EPFA+LLGDD++    +SD PA+KQ IE +EE   S++GVQEV+  +  +YGIIDPL++   K +   V   +EKP    +PSN AI+GRYVLTP IF  L        GEI++T ++  L + + VYA  F G RYD+G K+G++K T++ +L    + DEL+E++K L
  S:     2 RKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGKHKRAIEDHFDNQKELEMILQEKGKTDLLEKVKYSTELANIFYVRQKEQKGLGHAIYSARQFIGDEPFAVLLGDDIV----ESDNPAIKQLIEAYEETGKSVIGVQEVDEAQTHRYGIIDPLQKFGRKYE---VNEFVEKPKQGTAPSNLAIMGRYVLTPDIFDYLATQGEGAGGEIQLTDAIERLNRADQVYAYDFEGDRYDVGEKLGFVKTTIEYALKDESMHDELVEFIKKL 286
>gi|169186833|ref|ZP_02846994.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] >gi|169006802|gb|EDS53652.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] (302 aa)
Score = 726, Expect = 7.1e-75, Identities = 143/291 (49%), Positives = 208/291 (71%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +++V KA+IPA G+GTRFLPATKA PKEMLPI+DKP IQ+IVEEAV SGI+ I+I+  ++K +I DHFD  +ELE+ L+++   E   +VR+IS +A I+Y+RQKEP+GLGHA+  A+RFIG+EPFA+LLGDD++    +S+ P L+Q I  +EE   S+V + EV   +  KYGI    +  D      R+ ++IEKP P  +PSN+A++GRYVL P+IF+ LE  +    GEI++T SL  L     + A  FTGKR+D+G K+G++KAT+D +L + D+ +E+ +Y++
  S:    15 RQQVRKAIIPAGGLGTRFLPATKAQPKEMLPIIDKPAIQYIVEEAVQSGIDSIIIVSGRHKRAIEDHFDKSYELEKELEERGNEEMLAIVRDISHLADIYYVRQKEPLGLGHAVLCARRFIGDEPFAVLLGDDIL----RSEPPCLQQMIHQYEETGSSVVALMEVPWNQTHKYGIA-AFDNAD--PSRNRILDLIEKPAPGQAPSNWAVVGRYVLDPAIFELLEHARPGKAGEIQLTDSLQQLNHFAPILAHRFTGKRHDVGDKLGFVKATIDFALEREDLSEEVRKYLR 298
>gi|121533465|ref|ZP_01665293.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Thermosinus carboxydivorans Nor1] >gi|121308024|gb|EAX48938.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Thermosinus carboxydivorans Nor1] (311 aa)
Score = 726, Expect = 7.3e-75, Identities = 151/290 (52%), Positives = 204/290 (70%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+R+ KAVIPAAG+GTRFLPATKA PKEMLPI+DKP IQ+I+EEA+ASGIE+ILII  + K +I DHFD   ELE  LK + K +   LV  ++++  IHY+RQKE  GLGHA+  AK+F+G EPFA+LLGDD+I     +  P LKQ I+++E+   ++VGVQEV    VS YGI+ P   + +K    R  +++EKP    +PS  A+LGRY++ P IF  LE+T+    GEI++T +L  LA    VYA  F G+RYDIG K GYL+AT++ +L +PD+RD+ L Y+
  S:     4 KQRIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIIEEAIASGIEEILIITGRNKRAIEDHFDRAIELEMTLKAQGKYDLLGLVEELANVT-IHYVRQKEARGLGHAVLCAKQFVGQEPFAVLLGDDII----DAPVPCLKQLIDVYEDCPGTVVGVQEVPANRVSSYGIVKP---IPVKENLWRAVDLVEKPKVEEAPSRLAVLGRYIIEPEIFAILEKTEPGRGGEIQLTDALRRLAAMRPVYAFNFAGRRYDIGDKQGYLEATVEFALKRPDLRDKFLRYL 285
>gi|187776974|ref|ZP_02993447.1| hypothetical protein CLOSPO_00518 [Clostridium sporogenes ATCC 15579] >gi|187775633|gb|EDU39435.1| hypothetical protein CLOSPO_00518 [Clostridium sporogenes ATCC 15579] (298 aa)
Score = 726, Expect = 7.4e-75, Identities = 154/291 (52%), Positives = 215/291 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE ILII  + K +I DHFD   ELE+ L++K K E   +V++IS+MA I+YIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     SDKP L+Q I+ + E   +IVGVQEV  ++V KYGI+   + + ++ +  ++K+++EKP    +PSN AILGRY+++P+IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L + ++     EY++ L
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNKRAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVVY----SDKPCLEQLIKCYNEYQTTIVGVQEVPEQDVHKYGIV---KGMFIEDRVYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALKTLINKEAMYAYNFQGRRYDVGDKLGFLQATVEYALRRENLNTNFAEYLQQL 285
>gi|172058640|ref|YP_001815100.1| UTP-glucose-1-phosphate uridylyltransferase [Exiguobacterium sibiricum 255-15] >gi|171991161|gb|ACB62083.1| UTP-glucose-1-phosphate uridylyltransferase [Exiguobacterium sibiricum 255-15] (296 aa)
Score = 725, Expect = 8.2e-75, Identities = 151/293 (51%), Positives = 207/293 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           RV KAVIPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ SGIEDILII  + K +I DHFD   ELE  L  KNK E   LV   +++ +IH+IRQ +P GLG AI  AK FIGNEPF ++LGDD++    Q++ P  +Q IE +E  N SI+GVQ V  ++  +YGI+DP     +     +VK+ +EKP P  +PSN AILGRY+LTP IFK LE  ++   GEI++T ++  L + + V+A  F GKRYD+G K+G+++ TL+ +L + D+ D++ + M+ L++
  S:     2 RVKKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDILIITGKGKRAIEDHFDSVPELEANLIAKNKSELLHLVEATTNI-NIHFIRQSKPKGLGDAILQAKAFIGNEPFVVMLGDDIV----QAEVPCTRQLIEQYEITNSSIIGVQPVADEDTQRYGIVDP--STSISENLHKVKSFVEKPAPGTAPSNLAILGRYLLTPEIFKYLETQEIGSGGEIQLTDAITRLNEMQRVFAYEFDGKRYDVGEKLGFIQTTLEFALKREDLGDDVAKMMEELLK 287
>gi|170759335|ref|YP_001788434.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A3 str. Loch Maree] >gi|169406324|gb|ACA54735.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A3 str. Loch Maree] (298 aa)
Score = 724, Expect = 1.1e-74, Identities = 154/291 (52%), Positives = 215/291 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE ILII  + K +I DHFD   ELE+ L++K K E   +V++IS+MA I+YIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     SDKP LKQ I+ + E   +IVGVQEV  ++V KYGI+   + + ++ +  ++K+++EKP    +PSN AILGRY+++P+IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L +  +    ++Y++ L
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNKRAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVVY----SDKPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIV---KGMFIEDRVYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKEAMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNANFVKYLQQL 285
>gi|167628971|ref|YP_001679470.1| UTP-glucose-1-phosphate uridylyltransferase [Heliobacterium modesticaldum Ice1] >gi|167591711|gb|ABZ83459.1| utp-glucose-1-phosphate uridylyltransferase [Heliobacterium modesticaldum Ice1] (296 aa)
Score = 723, Expect = 1.3e-74, Identities = 144/296 (48%), Positives = 207/296 (69%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSL--LNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K+V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQFI+EEA+A+GIEDILI+  + K +I DHFD   ELE  L+++ K E  + VR I  +A IHY+RQKEP+GLGHAI  A+ FIG EPFA+LLGDDVI     +++P + Q IE + +   ++VGVQ V  +   +YG++    +    T   ++  ++EKP+P  +PS+ A++GRYV+ P +F  LE       GEI++T +L  L+    +G++A +F G RYD+G +IGYLKAT+D +L + D+ +E   Y++ +++
  S:     1 MHKKVRKAIIPAAGLGTRFLPATKAQPKEMLPIIDKPTIQFIIEEAIAAGIEDILIVTGRNKRAIEDHFDRSVELEVFLEERGKWELLESVRQIGSLADIHYVRQKEPLGLGHAIYCARSFIGQEPFAVLLGDDVI----HANRPCIGQLIEAYHQVRGTVVGVQPVPREHSRRYGMVSLAAEAG--TNLWKLDAIVEKPEPEKAPSDLAVMGRYVIEPEVFCILENQAPGKGGEIQLTDALHALHAECDKGLFAYLFEGIRYDVGDRIGYLKATVDYALRRDDLAEEFTAYLQEVLQ 292
>gi|148381063|ref|YP_001255604.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|153931503|ref|YP_001385436.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153936051|ref|YP_001388843.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A str. Hall] >gi|148290547|emb|CAL84675.1| UTP--glucose-1-phosphate uridylyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152927547|gb|ABS33047.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|152931965|gb|ABS37464.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum A str. Hall] (298 aa)
Score = 723, Expect = 1.6e-74, Identities = 154/291 (52%), Positives = 215/291 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE ILII  + K +I DHFD   ELE+ L++K K E   +V++IS+MA I+YIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     SDKP LKQ I+ + E   +IVGVQEV  ++V KYGI+   + + ++ +  ++K+++EKP    +PSN AILGRY+++P+IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L +  +    ++Y++ L
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNKRAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVVY----SDKPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIV---KGMFIEDRIYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKEAMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNTNFVKYLQQL 285
>gi|12045312|ref|NP_073123.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma genitalium G37] >gi|66880443|ref|ZP_00405424.1| COG1210: UDP-glucose pyrophosphorylase [Mycoplasma genitalium G-37] >gi|1346094|sp|P47691|GALU_MYCGE UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|3845047|gb|AAC72473.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma genitalium G37] >gi|166078811|gb|ABY79429.1| UTP-glucose-1-phosphate uridylyltransferase [synthetic Mycoplasma genitalium JCVI-1.0] (292 aa)
Score = 722, Expect = 1.8e-74, Identities = 154/294 (52%), Positives = 207/294 (70%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV-RDELLEYMKLL 294
           MK ++ KAVIPAAG+G R LPATKA+PKEMLP+++KPTIQ+IVEEAV SGIE IL+IVS  K +I+DHFDY   LE  L QKNK++++K + +I+++AHI ++RQK   GLG AI  A+ F+GNE FA+LLGDDV+     S +PALKQC+E + E N   +GVQEV+   V KYGII P  + D K + + +V  M EKP P  + SN AILGRYVL PSIFK L        GE+++T  L    + E  YA+ FTG R+D+G+K G++KA L  +L+  D+ + E+LE + L+
  S:     1 MKTKIRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGIEQILVIVSSKKTAILDHFDYDLILENALIQKNKLQEHKEIEDIANLAHIFFVRQKNQDGLGDAILFAESFVGNEDFAVLLGDDVVF----SKEPALKQCLEAYYETNCQTIGVQEVDPCHVDKYGIITP--EGDYKNKDLIKVLAMTEKPKPKDAKSNLAILGRYVLKPSIFKALRSVPYGVGGELQLTDGLNFCLKNENFYARKFTGTRFDVGTKSGFIKANLFTALNNKDISKKEVLELLNLV 290
>gi|168181806|ref|ZP_02616470.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum Bf] >gi|182674970|gb|EDT86931.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum Bf] (298 aa)
Score = 721, Expect = 2.8e-74, Identities = 153/291 (52%), Positives = 214/291 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE ILII  + K +I DHFD   ELE+ L++K K E   +V++IS+MA I+YIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+  N    KP LKQ I+ + E   +IVGVQEV  ++V KYGI+   + + ++ +  ++K+++EKP    +PSN AILGRY+++P+IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L +  +    ++Y++ L
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNKRAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVVYSN----KPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIV---KGMFIEDRVYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKEAMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNTNFVKYLQQL 285
>gi|56965460|ref|YP_177192.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus clausii KSM-K16] >gi|56911704|dbj|BAD66231.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus clausii KSM-K16] (293 aa)
Score = 721, Expect = 2.8e-74, Identities = 144/292 (49%), Positives = 207/292 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+I+EEA+ +GIEDI+I+  + K +I DHFD+ FELE+ L  K K++  + V+  S    +HYIRQKEP GLGHA+  A++FIGNEPFA+LLGDD++    Q++ P LKQ +  +++   S++GVQ V   E  +YGIIDP  Q     +  RV + +EKP    +PSN AI+GRY+LTP IF  LE+ +    GEI++T ++  L +++ VYA  F GKR+D+G K+G++   L+ +L + ++R+ LL+ M+  +
  S:     3 KVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIEAGIEDIIIVTGKGKRAIEDHFDHSFELEQNLFNKGKLDMLEKVQ-ASSKVELHYIRQKEPKGLGHAVWCARKFIGNEPFAVLLGDDIV----QAETPGLKQLMNQYDQTERSVIGVQPVPENETHRYGIIDPESQ---NGRLYRVSSFVEKPKQGTAPSNLAIMGRYILTPEIFTFLEKQETGAGGEIQLTDAIQTLNEQQSVYAYDFEGKRFDVGEKLGFVLTQLEFALEREELREPLLQKMREFI 286
>gi|57865457|ref|YP_189612.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus epidermidis RP62A] >gi|81673344|sp|Q5HLD1|GTAB_STAEQ UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|160013888|sp|Q8CR67|GTAB_STAES UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|57636115|gb|AAW52903.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus epidermidis RP62A] (288 aa)
Score = 719, Expect = 4.1e-74, Identities = 148/292 (50%), Positives = 207/292 (70%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  L+ K K +  + V+  +D+A+I Y+RQKE  GLGHAI+ AK+FIGNEPFA+LLGDD++    +SD PA+KQ ++++EE   S++GVQEV   +  +YG+IDP  +   +     V+  +EKP    +PSN AI+GRYVLTP IF  LE  Q     EI++T ++  +  K+ VYA  F G RYD+G K+G++K T++ +L  P++  +L  ++K L
  S:     2 KKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKHKRAIEDHFDNQKELEMVLENKGKADLLEKVQYSTDLANIFYVRQKEQKGLGHAIHTAKQFIGNEPFAVLLGDDIV----ESDTPAIKQLMDVYEETGHSVIGVQEVPESDTHRYGVIDPSAK---EGSRYEVRQFVEKPKQGTAPSNLAIMGRYVLTPEIFDYLETQQEGAGNEIQLTDAIERMNSKQQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDLKAFIKQL 286
>gi|153938591|ref|YP_001392391.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum F str. Langeland] >gi|170754464|ref|YP_001782748.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum B1 str. Okra] >gi|152934487|gb|ABS39985.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum F str. Langeland] >gi|169119676|gb|ACA43512.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium botulinum B1 str. Okra] (298 aa)
Score = 718, Expect = 5.1e-74, Identities = 153/291 (52%), Positives = 215/291 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIE ILII  + K +I DHFD   ELE+ L++K K E   +V++IS+MA I+YIRQKEP GLGHAI+ AK F+GNEPFA++LGDDV+     SDKP L+Q I+ + E   +IVGVQEV  ++V KYGI+   + + ++ +  ++K+++EKP    +PSN AILGRY+++P+IF  LE T+    GEI++T +L  L  KE +YA  F G+RYD+G K+G+L+AT++ +L +  +    ++Y++ L
  S:     2 KVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNKRAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFVGNEPFAVMLGDDVVY----SDKPCLEQLIKCYNEYQTTIVGVQEVPEEDVHKYGIV---KGMFIEDRVYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALKTLINKEAMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNANFVKYLQQL 285
>gi|70725580|ref|YP_252494.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus haemolyticus JCSC1435] >gi|123661103|sp|Q4L8Y7|GTAB_STAHJ UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|68446304|dbj|BAE03888.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus haemolyticus JCSC1435] (288 aa)
Score = 717, Expect = 6.6e-74, Identities = 149/292 (51%), Positives = 210/292 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  L++K K +  + V+  +D+A+I Y+RQKE  GLGHAI+ A++FIGNEPFA+LLGDD++    +S+ PA+KQ + ++EE   S++GVQEV      +YGIIDPLE+   + +   VK  +EKP    +PSN AI+GRY+LTP IF  LE  +     EI++T ++  +     VYA  F G RYD+G K+G++K T++ +L  P ++DEL++++K L
  S:     2 KQIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGIEDIIIVTGKHKRAIEDHFDNQKELEMVLEEKGKDDLLEKVQYSTDLANIFYVRQKEQKGLGHAIHTARQFIGNEPFAVLLGDDIV----ESETPAIKQLMNVYEETGHSVIGVQEVPESVTHRYGIIDPLEK---EGRRYEVKQFVEKPKQGTAPSNLAIMGRYILTPEIFDYLETQKEGAGNEIQLTDAIERMNSDIPVYAYDFDGDRYDVGEKLGFVKTTIEYALKDPKMKDELIKFIKEL 286
>gi|118586969|ref|ZP_01544401.1| UTP-glucose-1-phosphate uridylyltransferase [Oenococcus oeni ATCC BAA-1163] >gi|118432591|gb|EAV39325.1| UTP-glucose-1-phosphate uridylyltransferase [Oenococcus oeni ATCC BAA-1163] (291 aa)
Score = 717, Expect = 6.7e-74, Identities = 155/297 (52%), Positives = 204/297 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M ++V KAVIPAAG+GTRFLPATKA+ KEMLPI+D PTIQFIVEEA+ SGIEDI+I+  + K SI DHFD   ELE+ L  K K +  KLV++ +D+ +I++IRQ  P GLG A+  AK FIGNEPF ++LGDD++        P  KQ ++ + E   S + V  V H+E SKYG+IDP ++V  K     VKN +EKP P  +PS+ AI+GRY+ TP+IF ELE T      EI++T ++ +L  KE VYA  F GKRYDIGSKIG+L+  ++  L  PD  DEL +Y+K L +T
  S:     1 MVQKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDTPTIQFIVEEAIQSGIEDIVIVDGKSKRSIEDHFDSNTELEDNLSAKGKDKLLKLVQDTTDL-NIYFIRQSHPRGLGDAVLKAKSFIGNEPFVVMLGDDLMTDR----VPLTKQLVDRYNETEQSTLAVMPVPHEETSKYGVIDPSKEV--KPGLFEVKNFVEKPRPQDAPSDLAIIGRYLFTPTIFSELENTMPGKGNEIQLTDAIESLNHKEHVYAHQFDGKRYDIGSKIGFLETNIEFGLKHPDTGDELRKYIKELAKT 290
>gi|15925490|ref|NP_373024.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|15928079|ref|NP_375612.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus N315] >gi|57651007|ref|YP_187303.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|148268934|ref|YP_001247877.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150395011|ref|YP_001317686.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|151222607|ref|YP_001333429.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980815|ref|YP_001443074.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus Mu3] >gi|161510695|ref|YP_001576354.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|81693737|sp|Q5HD54|GTAB_STAAC UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|81705058|sp|Q7A3J9|GTAB_STAAN UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|81780914|sp|Q99RD4|GTAB_STAAM UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|160013892|sp|Q2FE05|GTAB_STAA3 UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|160013896|sp|Q2G1T6|GTAB_STAA8 UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|13702450|dbj|BAB43591.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus N315] >gi|14248274|dbj|BAB58662.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|57285193|gb|AAW37287.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|147742003|gb|ABQ50301.1| UDP-glucose pyrophosphorylase [Staphylococcus aureus subsp. aureus JH9] >gi|149947463|gb|ABR53399.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|150375407|dbj|BAF68667.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722950|dbj|BAF79367.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus Mu3] >gi|160369504|gb|ABX30475.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (288 aa)
Score = 717, Expect = 7.2e-74, Identities = 149/292 (51%), Positives = 208/292 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  LK+K K E  + V+  +++A+I Y+RQKE  GLGHAI+ A++FIGNEPFA+LLGDD++    +S+ PA+KQ I+++EE   S++GVQEV   +  +YGIIDPL +     +   VK  +EKP    +PSN AI+GRYVLTP IF  L+  +     EI++T ++  +     VYA  F G+RYD+G K+G++K T++ +L    +R+EL  ++K L
  S:     2 KKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV----ESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTK---NGRQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKAL 286
>gi|169832230|ref|YP_001718212.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Candidatus Desulforudis audaxviator MP104C] >gi|169639074|gb|ACA60580.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Candidatus Desulforudis audaxviator MP104C] (286 aa)
Score = 716, Expect = 8.6e-74, Identities = 142/288 (49%), Positives = 202/288 (70%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           V KAVIPAAG+G RFLPATK+ PKEM+PI+DKPTIQ+I+EEA+ASGIEDILII  + K +I DHFD+  ELE  L  K K  +   VR ISDM +IHY+RQ+ P+GLGHA+  A+ F+G+EPFA+LLGDD++    +   P LKQ +E   +   S+V ++EV  ++VSKYG+I   +      +   V++++EKP    +PS  A++GRYVL P IF  +E+T+    GEI++T +L  L +++ +Y   F G+RYD+G  +GYLKAT+D +L + +VR+  LEY++
  S:     3 VKKAVIPAAGLGVRFLPATKSQPKEMIPIIDKPTIQYIIEEALASGIEDILIISGRGKRAIEDHFDHAPELEAHLAAKGKAAELAEVRRISDMGNIHYVRQRHPLGLGHAVGCARAFVGDEPFAVLLGDDIV----RGAVPCLKQLLEQHAKLGASVVALEEVPLEDVSKYGVI---QGRAAGPRLFAVEDLVEKPPVDQAPSRMAVMGRYVLDPRIFPLIEQTRPGAGGEIQLTDALRLLVREQPLYGYQFEGRRYDVGHCLGYLKATVDFALERDEVREPFLEYLR 283
>gi|73661368|ref|YP_300149.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123643796|sp|Q4A122|GTAB1_STAS1 UTP--glucose-1-phosphate uridylyltransferase 1 (UDP-glucose pyrophosphorylase 1) (UDPGP 1) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 1) (Uridine diphosphoglucose pyrophosphorylase 1) >gi|72493883|dbj|BAE17204.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (287 aa)
Score = 716, Expect = 1.0e-73, Identities = 147/289 (50%), Positives = 207/289 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEAVA+GIEDI+I+  ++K +I DHFD   ELE  L++K K +  + V+  S++A++ Y+RQKE  GLGHAI  A++FIGNEPFA+LLGDD++    Q+D PA+KQ +  +E    SI+GVQ+V   E  +YGI+DP E  +   +   V   +EKP+   +PSN AI+GRYVL P IF  LE  ++   GEI++T ++ +L  ++ VYA  F G+RYD+G KIG++K T+  +L    ++ E+ E++K
  S:     2 KIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVAAGIEDIIIVTGKHKRAIEDHFDNQKELEMILEEKGKSDLLQSVKYSSNLANMFYVRQKEQKGLGHAIWTARQFIGNEPFAVLLGDDIV----QADTPAIKQLMNQYETTGKSIIGVQQVNEIETHRYGIVDPEESYN---ELFSVNKFVEKPEIGTAPSNLAIMGRYVLKPDIFDYLERQEIGRGGEIQLTDAIEHLNSEDCVYAYNFEGERYDVGEKIGFVKTTIQFALKDDYMKKEITEFIK 283
>gi|21284148|ref|NP_647236.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus MW2] >gi|49487278|ref|YP_044499.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|81648641|sp|Q6G6H5|GTAB_STAAS UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|81761993|sp|Q8NUU9|GTAB_STAAW UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|21205591|dbj|BAB96284.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus subsp. aureus MW2] >gi|49245721|emb|CAG44200.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus MSSA476] (288 aa)
Score = 714, Expect = 1.8e-73, Identities = 149/292 (51%), Positives = 208/292 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  LK+K K E  + V+  +++A+I Y+RQKE  GLGHAI+ A++FIGNEPFA+LLGDD++    +S+ PA+KQ I+++EE   S++GVQEV   +  +YGIIDPL +     +   VK  +EKP    +PSN AI+GRYVLTP IF  L+  +     EI++T ++  +     VYA  F G+RYD+G K+G++K T++ +L    +R+EL  ++K L
  S:     2 KKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV----ESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTK---NGRQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKEL 286
>gi|153201816|ref|ZP_01943573.1| hypothetical protein LMSG_01225 [Listeria monocytogenes HPB2262] >gi|133735605|gb|EBA37303.1| hypothetical protein LMSG_01225 [Listeria monocytogenes HPB2262] (293 aa)
Score = 713, Expect = 2.4e-73, Identities = 145/284 (51%), Positives = 205/284 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           RV KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQ+IVEEAVASGIEDILI+  + K +I DHFD   ELE  L++KNK+E   LV   +++ ++H+IRQ +P GLG AI  AK F+GNEPF ++LGDD++    +S  P  KQ +  +E+ + S++GVQ V H+E  +YGIIDP+ + D       VK  +EKPDP+ +PS+ AILGRY+LTP IF  LE  +    GEI++T ++ +L + + V+A  F G+R+D+G K G+++ T+  +L  P+++D++
  S:     2 RVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLELLHLVEQTTNI-NLHFIRQAKPKGLGDAILQAKGFVGNEPFIVMLGDDIV----ESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDPINEYD--KNLYNVKGFVEKPDPANAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEVQRVFAYDFEGQRFDVGDKFGFIQTTMQFALKHPEIKDDV 278
>gi|23100385|ref|NP_693852.1| UTP-glucose-1-phosphate uridylyltransferase [Oceanobacillus iheyensis HTE831] >gi|22778618|dbj|BAC14886.1| UTP-glucose-1-phosphate uridylyltransferase [Oceanobacillus iheyensis HTE831] (294 aa)
Score = 713, Expect = 2.4e-73, Identities = 154/288 (53%), Positives = 215/288 (74%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNV-SIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           V KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV SGIEDI+II  + K +I DHFD  +ELEE+L +K   +  + ++ IS +A+IHYIRQKEP GLGHAI+ A  FIGNEPFA+LLGDD++V    SD+P LKQ I +FEE +  S++GV +V  ++VSKYGI+ P + +D  +    ++++IEKPD   +PSN AI+GRYVLTP +F  LE+       EI++T +L+ L + E + A  F GKRYD+G+K+G+++AT+D +L++ D+ +++   +K
  S:     3 VKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVHSGIEDIIIISGRGKRAIEDHFDKSYELEEKLTEKEDYDMLQEIQQISGLANIHYIRQKEPKGLGHAIHCAHTFIGNEPFAVLLGDDIVV----SDEPCLKQLINVFEENHQKSVIGVHDVPWEDVSKYGIVKPSKGLDDSSSIHFIEDLIEKPDRDKAPSNLAIMGRYVLTPEVFPILEKLPPGKDNEIQLTDALIELKKVEEMIAYNFQGKRYDVGNKLGFIEATIDFALNRNDLHNDVKHLLK 287
>gi|118578920|ref|YP_900170.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Pelobacter propionicus DSM 2379] >gi|118501630|gb|ABK98112.1| UDP-glucose pyrophosphorylase [Pelobacter propionicus DSM 2379] (287 aa)
Score = 712, Expect = 2.4e-73, Identities = 139/289 (48%), Positives = 202/289 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATK+ PKEMLP++DKP +Q++VEEAVASGIE +L +  + K SI DHFD   ELE  L  + K  +   VR I++MA I Y+RQ++ +GLGHAI  A+ FIGNEPFA+LLGDD+I     S +P L+Q +++FEE N S++ +++V  + +S YG +       L  +   V +M+EKP  + +PS+ AI+GRYVLTP+IF  L + Q    GEI++T ++L L+++E VY  +F G R+D G K+G+LKAT+D++L + + R+EL  Y++
  S:     2 KVRKAVFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVASGIEQVLFVTGRGKRSIEDHFDISVELEAHLNGQGKARELSSVRRIAEMAEIFYVRQRQALGLGHAILCARDFIGNEPFAVLLGDDII----DSQRPCLRQLLDVFEEHNGSVLALEKVPMENISSYGCV---RATALSDRVFDVLDMVEKPSRAEAPSDMAIIGRYVLTPAIFDILMQQQPGKGGEIQLTDAVLTLSKEEKVYGCLFEGLRHDCGDKLGFLKATVDMALKRDEFREELSAYLR 283
>gi|49484703|ref|YP_041927.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|81650406|sp|Q6GDU6|GTAB_STAAR UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|49242832|emb|CAG41559.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus MRSA252] (288 aa)
Score = 712, Expect = 2.6e-73, Identities = 148/292 (50%), Positives = 208/292 (71%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+I+EEA  +GIEDI+I+  ++K +I DHFD   ELE  LK+K K E  + V+  +++A+I Y+RQKE  GLGHAI+ A++FIGNEPFA+LLGDD++    +S+ PA+KQ I+++EE   S++GVQEV   +  +YGIIDPL +     +   VK  +EKP    +PSN AI+GRYVLTP IF  L+  +     EI++T ++  +     VYA  F G+RYD+G K+G++K T++ +L    +R+EL  ++K L
  S:     2 KKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIIEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV----ESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTK---NGRQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKEL 286
>gi|46907310|ref|YP_013699.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes str. 4b F2365] >gi|47091881|ref|ZP_00229675.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes str. 4b H7858] >gi|46880577|gb|AAT03876.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes str. 4b F2365] >gi|47019597|gb|EAL10336.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes str. 4b H7858] (295 aa)
Score = 712, Expect = 2.9e-73, Identities = 145/284 (51%), Positives = 205/284 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           RV KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQ+IVEEAVASGIEDILI+  + K +I DHFD   ELE  L++KNK+E   LV   +++ ++H+IRQ +P GLG AI  AK F+GNEPF ++LGDD++    +S  P  KQ +  +E+ + S++GVQ V H+E  +YGIIDP+ + D       VK  +EKPDP+ +PS+ AILGRY+LTP IF  LE  +    GEI++T ++ +L + + V+A  F G+R+D+G K G+++ T+  +L  P+++D++
  S:     2 RVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLELLHLVEQTTNI-NLHFIRQAKPKGLGDAILQAKGFVGNEPFIVMLGDDIV----ESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDPINEYD--KNLYNVKGFVEKPDPANAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEVQRVFAYDFEGQRFDVGDKFGFIQTTMQFALKHPEIKDDV 278
>gi|116490631|ref|YP_810175.1| UDP-glucose pyrophosphorylase [Oenococcus oeni PSU-1] >gi|116091356|gb|ABJ56510.1| UDP-glucose pyrophosphorylase [Oenococcus oeni PSU-1] (291 aa)
Score = 711, Expect = 3.4e-73, Identities = 154/297 (51%), Positives = 203/297 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M ++V KAVIPAAG+GTRFLPATKA+ KEMLPI+D PTIQFIVEEA+ SGIEDI+I+  + K SI DHFD   ELE+ L  K K +  KLV++ +D+ +I++IRQ  P GLG A+  AK FI NEPF ++LGDD++        P  KQ ++ + E   S + V  V H+E SKYG+IDP ++V  K     VKN +EKP P  +PS+ AI+GRY+ TP+IF ELE T      EI++T ++ +L  KE VYA  F GKRYDIGSKIG+L+  ++  L  PD  DEL +Y+K L +T
  S:     1 MVQKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDTPTIQFIVEEAIQSGIEDIVIVDGKSKRSIEDHFDSNTELEDNLSAKGKDKLLKLVQDTTDL-NIYFIRQSHPHGLGDAVLKAKSFISNEPFVVMLGDDLMTDR----VPLTKQLVDRYNETEQSTLAVMPVPHEETSKYGVIDPSKEV--KPGLFEVKNFVEKPRPQDAPSDLAIIGRYLFTPTIFSELENTMPGKGNEIQLTDAIESLNHKEHVYAHQFDGKRYDIGSKIGFLETNIEFGLKHPDTGDELRKYIKELAKT 290
>gi|89896099|ref|YP_519586.1| hypothetical protein DSY3353 [Desulfitobacterium hafniense Y51] >gi|109648310|ref|ZP_01372213.1| UTP-glucose-1-phosphate uridylyltransferase [Desulfitobacterium hafniense DCB-2] >gi|89335547|dbj|BAE85142.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109641400|gb|EAT50955.1| UTP-glucose-1-phosphate uridylyltransferase [Desulfitobacterium hafniense DCB-2] (294 aa)
Score = 711, Expect = 3.8e-73, Identities = 147/297 (49%), Positives = 209/297 (70%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISP-SNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           +R+ KA+IPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+IVEEAV SGIEDI+I+  + K +I DHFD   ELE  L++  K E   +V++I+ M  I+Y+RQKE +GLGHAI  A++FIGNEPFA+LLGDD+I     S+ P L+Q + ++E    SIVGVQ+V  ++ SKYGI+D    V L     R  +++EKP P  +P +  AI+GRY+L P IF  LE       GEI++T  L  LA+ + + A  F G+RYD+G K+G+++AT++ +L + D+ + L+ Y+K  +E+++
  S:     4 RRIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVHSGIEDIIIVTGRNKRAIEDHFDRSIELETFLQKSEKEELLDMVQDIARMVDIYYVRQKEALGLGHAIYCARKFIGNEPFAVLLGDDII----HSEVPCLRQMMHVYERHGASIVGVQQVPLEDTSKYGIVD---AVPLDDSLYRALDLVEKPQPEDAPEARLAIMGRYILNPEIFGILESIPPGKGGEIQLTDGLKELARFQEILAYEFDGQRYDVGDKLGFVQATIEYALRREDLAEPLMRYLKQRIESDE 294
>gi|168265616|ref|ZP_02687581.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes FSL J2-071] (293 aa)
Score = 711, Expect = 3.9e-73, Identities = 144/284 (50%), Positives = 204/284 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           RV KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQ+IVEEAV SGIEDILI+  + K +I DHFD   ELE  L++KNK+E   L+   +++ ++H+IRQ +P GLG AI  A+ F+GNEPF ++LGDD++    Q+  P  KQ I+ +E+ + SI+GVQ V H+E  +YGIIDP+++         V   +EKPDPS +PS+ AILGRY+LTP IF  LE  +    GEI++T ++ +L + + V+A  F G+R+D+G K G++K T+  +L  P+++D++
  S:     2 RVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGKRAIEDHFDSVPELELNLREKNKLELLHLIEETTNI-NLHFIRQSKPKGLGDAILQARGFVGNEPFIVMLGDDIV----QAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDE--YSKNLYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQRVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDV 278
>gi|69249419|ref|ZP_00604968.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Enterococcus faecium DO] >gi|68194171|gb|EAN08702.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Enterococcus faecium DO] (312 aa)
Score = 710, Expect = 4.9e-73, Identities = 152/294 (51%), Positives = 203/294 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +V KAVIPAAG+GTRFLPATKAM KEMLPI+DKPTIQFIVEEA+ SGIEDILI+  + K  I DHFD   ELE  L +K K E  KLV   +D+ ++H+IRQ  P GLGHA+  A+ FIGNEPF ++LGDD++    + + P  +Q I+ +E  + S + V +V H E SKYGII+P E   L+     VKN +EKPDPS +PS+ AI+GRY+LTP IF  L E Q     EI++T ++  L + + V+A+ FTGKRYD+G K G++K +++  L+ P+V   L EY+  L +T
  S:     2 KVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAKRPIEDHFDSNIELETNLSEKGKTELLKLVEETTDV-NLHFIRQSHPKGLGHAVLQARAFIGNEPFVVMLGDDIM----EDEVPLTQQLIDDYERTHASTIAVMQVPHDETSKYGIINPGEV--LEDGLYNVKNFVEKPDPSKAPSDLAIIGRYLLTPEIFDVLSEQQPGAGNEIQLTDAIDTLNKTQRVFARKFTGKRYDVGDKFGFMKTSIEYGLTHPEVGAPLREYILSLGKT 288
>gi|116872475|ref|YP_849256.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741353|emb|CAK20477.1| galU [Listeria welshimeri serovar 6b str. SLCC5334] (295 aa)
Score = 709, Expect = 6.1e-73, Identities = 144/284 (50%), Positives = 204/284 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           RV KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQ+IVEEAV SGIEDILI+  + K +I DHFD   ELE  L++KNK+E   L+   +++ ++H+IRQ +P GLG AI  A+ F+GNEPF ++LGDD++    Q+  P  KQ I+ +E+ + SI+GVQ V H+E  +YGIIDP+++         V   +EKPDPS +PS+ AILGRY+LTP IF  LE  +    GEI++T ++ +L + + V+A  F G+R+D+G K G++K T+  +L  P+++D++
  S:     2 RVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGKRAIEDHFDSVPELELNLREKNKLELLHLIEETTNI-NLHFIRQSKPKGLGDAILQARGFVGNEPFIVMLGDDIV----QAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDE--YSKNLYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQRVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDV 278
>gi|82752083|ref|YP_417824.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus RF122] >gi|123548675|sp|Q2YW63|GTAB_STAAB UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|82657614|emb|CAI82062.1| UTP-glucose-1-phosphate uridyltransferase [Staphylococcus aureus RF122] (288 aa)
Score = 709, Expect = 6.1e-73, Identities = 148/292 (50%), Positives = 207/292 (70%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++ KA+IPAAG+GTRFLPATKAMPKEMLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  LK+K K E  + V+  +++A+I Y+RQKE  GLGHAI+ A++FIGNEPF +LLGDD++    +S+ PA+KQ I+++EE   S++GVQEV   +  +YGIIDPL +     +   VK  +EKP    +PSN AI+GRYVLTP IF  L+  +     EI++T ++  +     VYA  F G+RYD+G K+G++K T++ +L    +R+EL  ++K L
  S:     2 KKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFVVLLGDDIV----ESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTK---NGRQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKEL 286
>gi|89096475|ref|ZP_01169367.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus sp. NRRL B-14911] >gi|89088490|gb|EAR67599.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus sp. NRRL B-14911] (295 aa)
Score = 709, Expect = 6.3e-73, Identities = 139/291 (47%), Positives = 208/291 (71%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           V KA+IPAAG+GTRFLPATKA PKEMLPI  KP IQ+IVEEA ASGIEDI+II  + K +I DHFD  +ELEE L ++N+ E  + V  +S++A IHY+RQKEP GLG AI  A+ +IG+EPFA++LGDDV+    Q ++P L + ++  ++   ++VGVQEV  +E+ KYG+++P + +D   Q M++K+++EKP   + PS+YA++GRY+L P IF  LE        E+++T ++  LA    VY  V +G RYDIG ++G+LKA +++++ + D+R +L+ Y++ ++
  S:     3 VRKAIIPAAGLGTRFLPATKAQPKEMLPIAGKPAIQYIVEEAAASGIEDIIIISGRGKRAIEDHFDKSYELEETLAKQNRHELLEAVEAVSNLASIHYVRQKEPKGLGDAIYCARSYIGDEPFAVMLGDDVV----QGERPCLSELLQAHQQYGGTVVGVQEVAAEELCKYGVVEPEKFID--RQLMKLKSLVEKPPKGLEPSSYALMGRYILPPEIFSILETLPAGANKEVQLTDAIRFLAGITPVYGVVLSGSRYDIGDRMGFLKANIEMAMLQADIRTDLIVYLEKML 287
>gi|148989911|ref|ZP_01821194.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP6-BS73] >gi|147924696|gb|EDK75781.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP6-BS73] (299 aa)
Score = 707, Expect = 1.1e-72, Identities = 146/291 (50%), Positives = 198/291 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K++  KLV   +DM  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PSN AI+GRY+LTP IF+ LE        EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKIDLLKLVDKTTDM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSNLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|116628515|ref|YP_821134.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus LMD-9] >gi|116101792|gb|ABJ66938.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus LMD-9] (304 aa)
Score = 707, Expect = 1.2e-72, Identities = 143/289 (49%), Positives = 198/289 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  L+QK K    KLV + + M ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ I  +EE + S + V  V  +EVS YG+I P  Q   +     V+  +EKP+P  +PSN AI+GRY+LTP IF  LE  +     E+++T ++  L + + V+A+VFTG RYD+G K G++K ++D +L  P ++D+L +Y+
  S:     4 QKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLEQKGKTNLLKLVNDTTSM-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVSSEEVSAYGVIAP--QGKGENGRYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFGILENQEPGAGNEVQLTDAIDTLNKTQRVFARVFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYL 289
>gi|16800139|ref|NP_470407.1| hypothetical protein lin1070 [Listeria innocua Clip11262] >gi|16413529|emb|CAC96301.1| lin1070 [Listeria innocua] (295 aa)
Score = 706, Expect = 1.5e-72, Identities = 144/284 (50%), Positives = 205/284 (72%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           RV KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQ+IVEEAVASGIEDILI+  + K +I DHFD   ELE  L++KNK+E   LV   +++ ++H+IRQ +P GLG AI  AK F+GNEPF ++LGDD++    +S  P  KQ +  +E+ + S++GVQ V H+E  +YGIIDP+ + D       VK  +EKPDP+ +PS+ AILGRY+LTP IF  LE  +    GEI++T ++ +L + + V+A  F G+R+D+G K G+++ T+  +L  P++++++
  S:     2 RVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLELLHLVEQTTNI-NLHFIRQAKPKGLGDAILQAKGFVGNEPFIVMLGDDIV----ESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDPINEYD--KNLYNVKGFVEKPDPAKAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEVQRVFAYDFEGERFDVGDKFGFIQTTMQFALKHPEIKEDV 278
>gi|167453725|ref|ZP_02319948.1| hypothetical protein LmonocytoFSL_07518 [Listeria monocytogenes FSL J2-064] (320 aa)
Score = 703, Expect = 3.3e-72, Identities = 146/284 (51%), Positives = 204/284 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           +V KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQFIVEEAVASGIEDILI+  + K +I DHFD   ELE  L++KNK++   LV   +++ ++H+IRQ +P GLG AI  AK FIGNEPF ++LGDD++    QS  P  KQ I+ +E+ + S++GVQ V  +E  +YGIIDP ++V  +  +  V   +EKP+   +PSN AILGRY+LTP IFK LE  +    GEI++T ++  L + + V+A  F G+R+D+G K G+++ TL  +L  P+++D++
  S:     2 KVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQFIVEEAVASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLDLLHLVEETTNI-NLHFIRQSKPKGLGDAILQAKGFIGNEPFVVMLGDDIV----QSKTPCAKQLIDQYEKTHSSVIGVQNVPREETYRYGIIDPDKEVSDRLYN--VTGFVEKPNVEDAPSNLAILGRYLLTPEIFKYLETQEAGSGGEIQLTDAINRLNEIQPVFAYDFEGERFDVGDKFGFIETTLKFALKHPEIKDDV 278
>gi|16803118|ref|NP_464603.1| hypothetical protein lmo1078 [Listeria monocytogenes EGD-e] >gi|47094936|ref|ZP_00232549.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes str. 1/2a F6854] >gi|153166406|ref|ZP_01926992.1| hypothetical protein LMHG_02092 [Listeria monocytogenes FSL N1-017] >gi|153174144|ref|ZP_01929706.1| hypothetical protein LMIG_02291 [Listeria monocytogenes FSL N3-165] >gi|153184741|ref|ZP_01935468.1| hypothetical protein LMOG_01382 [Listeria monocytogenes J0161] >gi|153190484|ref|ZP_01937873.1| hypothetical protein LMPG_01035 [Listeria monocytogenes J2818] >gi|153195875|ref|ZP_01940283.1| hypothetical protein LMRG_00540 [Listeria monocytogenes 10403S] >gi|167014415|ref|ZP_02276948.1| hypothetical protein LmonFS_06331 [Listeria monocytogenes FSL J1-194] >gi|167211974|ref|ZP_02282281.1| hypothetical protein LmonL_09399 [Listeria monocytogenes LO28] >gi|167217262|ref|ZP_02286898.1| hypothetical protein LmonocFSL_08678 [Listeria monocytogenes FSL J1-175] >gi|16410480|emb|CAC99156.1| lmo1078 [Listeria monocytogenes] >gi|47016554|gb|EAL07474.1| UTP-glucose-1-phosphate uridylyltransferase [Listeria monocytogenes str. 1/2a F6854] >gi|126942712|gb|EBA20449.1| hypothetical protein LMOG_01382 [Listeria monocytogenes J0161] >gi|127634157|gb|EBA23543.1| hypothetical protein LMRG_00540 [Listeria monocytogenes 10403S] >gi|127765866|gb|EBA26210.1| hypothetical protein LMPG_01035 [Listeria monocytogenes J2818] >gi|133727603|gb|EBA29301.1| hypothetical protein LMHG_02092 [Listeria monocytogenes FSL N1-017] >gi|133730513|gb|EBA32211.1| hypothetical protein LMIG_02291 [Listeria monocytogenes FSL N3-165] (290 aa)
Score = 703, Expect = 3.3e-72, Identities = 146/284 (51%), Positives = 204/284 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           +V KAVIPAAG+GTRFLPATKAMPKE+LPI+DKPTIQFIVEEAVASGIEDILI+  + K +I DHFD   ELE  L++KNK++   LV   +++ ++H+IRQ +P GLG AI  AK FIGNEPF ++LGDD++    QS  P  KQ I+ +E+ + S++GVQ V  +E  +YGIIDP ++V  +  +  V   +EKP+   +PSN AILGRY+LTP IFK LE  +    GEI++T ++  L + + V+A  F G+R+D+G K G+++ TL  +L  P+++D++
  S:     2 KVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQFIVEEAVASGIEDILIVTGKGKRAIEDHFDSVPELENNLREKNKLDLLHLVEETTNI-NLHFIRQSKPKGLGDAILQAKGFIGNEPFVVMLGDDIV----QSKTPCAKQLIDQYEKTHSSVIGVQNVPREETYRYGIIDPDKEVSDRLYN--VTGFVEKPNVEDAPSNLAILGRYLLTPEIFKYLETQEAGSGGEIQLTDAINRLNEIQPVFAYDFEGERFDVGDKFGFIETTLKFALKHPEIKDDV 278
>gi|169186444|ref|ZP_02846605.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] >gi|169006413|gb|EDS53263.1| UTP-glucose-1-phosphate uridylyltransferase [Paenibacillus sp. JDR-2] (295 aa)
Score = 702, Expect = 3.9e-72, Identities = 149/293 (50%), Positives = 201/293 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQ+IVEEAVA+GIEDI+I+  + K +I DHFD  FELE  L +K K+     V+  S    IHYIRQKE  GLGHA+  A+ FIG+EPFA+LLGDD++     S+ P  KQ ++ FE+   S++GV+ V   E  +YGI++  E+  L +    V   IEKP P  + SN AI+GRYVLTP IFK L + +    GEI++T ++  L + +GVYA  F G+R+D+G K+G++  TLD +L    ++  LLE MK ++E
  S:     3 KVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVAAGIEDIIIVTGKGKRAIEDHFDSAFELEHNLMEKGKLTLLDEVQK-SSRVDIHYIRQKEAKGLGHAVWCARNFIGDEPFAVLLGDDIV----DSEVPCTKQLMDQFEQTGRSVIGVKPVPTNETERYGIVEYSEKNGLLS---LVDRFIEKPTPGTTESNLAIMGRYVLTPDIFKFLSKQEKGAGGEIQLTDAIQKLNESQGVYAYEFEGRRFDVGEKLGFITTTLDYALRNESLKGPLLEAMKEILE 287
>gi|189423578|ref|YP_001950755.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter lovleyi SZ] >gi|189419837|gb|ACD94235.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter lovleyi SZ] (291 aa)
Score = 699, Expect = 8.6e-72, Identities = 136/289 (47%), Positives = 200/289 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KA+ P AG+GTRFLPATK+ PKEMLP++DKP +Q++VEEAVA+GIE I+ +  + K SI DHFD   ELE  L++K K E  + VR I+D+  I Y+RQK+ +GLGHAI  A+ FIGNEPFA+LLGDD+I  +     P L+Q ++++E    S++ +++V  +++S YG +      D     M V +M+EKP  + +PSN AI+GRYVLTP+IF  LE+ Q    GEI++T ++  L+Q E VY  +F G R+D G K+G+LKAT+D++L + + +++   Y+K
  S:     2 KVRKAIFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVAAGIEQIIFVTGRTKRSIEDHFDSSPELENHLEEKGKDETLQAVRCIADLVDIFYVRQKKALGLGHAILCARDFIGNEPFAVLLGDDII--DTPGSAPCLRQLLDVYEHYKGSVLALEQVPMEQISSYGCVAVNRITD---HVMEVTDMVEKPPQAEAPSNLAIIGRYVLTPAIFPLLEQQQPGRGGEIQLTDAIKRLSQDEAVYGCLFEGLRHDCGDKLGFLKATVDLALKRDEFKEDFTAYLK 285
>gi|13508406|ref|NP_110356.1| UDP-glucose pyrophosphorylase [Mycoplasma pneumoniae M129] >gi|2501467|sp|P75124|GALU_MYCPN UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|1673837|gb|AAB95823.1| UDP-glucose pyrophosphorylase [Mycoplasma pneumoniae M129] (291 aa)
Score = 699, Expect = 9.6e-72, Identities = 144/289 (49%), Positives = 212/289 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSL-LNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV-RDELLEYMK 292
           ++ KAVIPAAG+GTR LPATKA+PKEMLP+++KPTIQ+IVEEAVASGI++IL+IVS  K +I+DHFDY F LE  L QK+K ++++ +++I+++AHI+++RQK   GLG AI  AK F+GNE FA+LLGDDV+      ++PAL QCI+ +E+ +  ++GVQEV H +V+KYGI+ P  + + + Q++ ++  M+EKP  + + SN AIL RY+L PSIF  L++      GE+++T  L   L Q E  +AK F G R+D+G+K G++KA L  +L    + +DE+L  +K
  S:     3 KIRKAVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGIKEILVIVSSKKEAIIDHFDYDFILENALLQKHKDQEHQEIKDIANLAHIYFVRQKHQHGLGDAILHAKSFVGNEDFAVLLGDDVVF----GEQPALAQCIQAYEQTDCQVIGVQEVPHDQVNKYGIVTP--EANWQKQALVKILGMVEKPAVNEAKSNLAILSRYILKPSIFTALKQVPFGVGGELQLTDGLNYCLQQGEPFFAKHFGGTRFDVGTKNGFIKANLYTALKTDAITKDEVLAILK 288
>gi|89097412|ref|ZP_01170301.1| UDP-glucose pyrophosphorylase [Bacillus sp. NRRL B-14911] >gi|89087708|gb|EAR66820.1| UDP-glucose pyrophosphorylase [Bacillus sp. NRRL B-14911] (293 aa)
Score = 698, Expect = 1.2e-71, Identities = 149/295 (50%), Positives = 201/295 (68%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           + KAVIPAAG+GTRFLPATKA PKEMLP+ DKP IQ+IVEEA+ SGIEDI+II  + K +I DHFD   ELE  LK+  K E  + V   S++A IHY+RQKEP+GLGHA+  AK+FIGNEPFA+LLGDD++     S  PAL Q I  F+E    ++G +EV  + VSKYGIID       K  ++ +++ ++EKP    +P+N AI+GRYVLTP IF  LE  Q    GEI++T +L  L +K  +Y+ +  G RYD G K G+L+A+++ SL   +++++L  Y+  L E  K
  S:     2 IRKAVIPAAGLGTRFLPATKAQPKEMLPVADKPAIQYIVEEAILSGIEDIIIITGRNKRAIEDHFDKSIELELILKKTGKTELLEKVEAASNLASIHYVRQKEPLGLGHAVLCAKQFIGNEPFAVLLGDDLV----DSGTPALLQMISQFKETGTCMIGAKEVPWENVSKYGIID----YSFKAGNLCKIEQLVEKPSKDSAPTNQAIIGRYVLTPEIFTVLESLQPDFSGEIQLTEALSQLLKKGPMYSCLIEGNRYDTGDKFGFLQASIEFSLKNEEIKEKLERYLYSLREREK 289
>gi|149182094|ref|ZP_01860578.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus sp. SG-1] >gi|148850196|gb|EDL64362.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus sp. SG-1] (286 aa)
Score = 698, Expect = 1.3e-71, Identities = 145/288 (50%), Positives = 207/288 (71%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           + KAVIPAAG+GTRFLPATKA PKEMLPI+DKPTIQ+I+EEAV SGIEDI+I+  + K +I DHFD   ELE  L++  K E  ++V +IS++  IHY+RQKEP+GLGHA+  AK+FIG+EPFA+LLGDD+I     ++ PALKQ ++ +     SI+GV EV   EV KYGI+   EQ   + +  +V +++EKP    +PS  AI+GRY+L+P+IF+ LE  +   +GEI++T ++  L  KE +Y+ +  G RYD+G K G+L+A++D +L + D+ ++L  Y+K
  S:     2 IKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEDIIIVTGRSKRAIEDHFDKSVELEMLLERTGKHEMLEIVESISNLVDIHYVRQKEPLGLGHAVLCAKKFIGDEPFAVLLGDDII----DNEVPALKQMMDQYNIVQSSILGVNEVPRSEVDKYGIVSYQEQ---QGELYKVDSLVEKPAVEDAPSTQAIVGRYILSPTIFETLETVKPDKKGEIQLTEAIDKLLDKEDIYSYILQGNRYDVGDKFGFLQASIDFALKREDLSEKLKSYLK 282
>gi|55821805|ref|YP_140247.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus LMG 18311] >gi|55823723|ref|YP_142164.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus CNRZ1066] >gi|15722252|emb|CAC79217.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus] >gi|55737790|gb|AAV61432.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus LMG 18311] >gi|55739708|gb|AAV63349.1| UDP-glucose pyrophosphorylase [Streptococcus thermophilus CNRZ1066] (304 aa)
Score = 697, Expect = 1.5e-71, Identities = 141/289 (48%), Positives = 198/289 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++V KAVIPA G+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  L+QK K +  KLV + + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ I  +EE + S + V  V  +EVS YG+I P  Q   +     V+  +EKP+P  +PS+ AI+GRY+LTP IF  LE  +     E+++T ++  L + + V+A+VFTG RYD+G K G++K ++D +L  P ++D+L +Y+
  S:     4 QKVRKAVIPAGGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTSI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVSSEEVSAYGVIAP--QGKGENGRYSVETFVEKPNPEDAPSDLAIIGRYLLTPEIFGILENQEPGAGNEVQLTDAIDTLNKTQRVFARVFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYL 289
>gi|149002921|ref|ZP_01827832.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP14-BS69] >gi|147758924|gb|EDK65919.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP14-BS69] (299 aa)
Score = 697, Expect = 1.7e-71, Identities = 144/291 (49%), Positives = 198/291 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K++  KLV   +DM  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE        EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+++L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKIDLLKLVDKTTDM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKEDLKNYL 288
>gi|51893851|ref|YP_076542.1| UTP-glucose-1-phosphate uridylyltransferase [Symbiobacterium thermophilum IAM 14863] >gi|51857540|dbj|BAD41698.1| UTP-glucose-1-phosphate uridylyltransferase [Symbiobacterium thermophilum IAM 14863] (294 aa)
Score = 696, Expect = 2.2e-71, Identities = 148/292 (50%), Positives = 204/292 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           RV KAVIPAAG+GTRFLPATKA PKEMLP++DKP IQ++VEEAVASGIEDI+I+ S+ K +I DHFD   ELE  L+ +N  E    VR +SDMA IH+IRQK+PMGLGHA+  A+R +GNEPFA+LLGD+V +       P LKQ I+ +EE   S++ V+ V  +EVS+YG+I P    +   +  R  +++EKP  + +PSN AI+GRYVL P+IF+ L +      GEI++T  L  L +   VYA     KRYD+G K+G+++AT++++L + ++ D L  Y++ LV
  S:     3 RVRKAVIPAAGLGTRFLPATKAQPKEMLPLVDKPIIQYVVEEAVASGIEDIIIVTSRGKRAIEDHFDRNLELELMLEGRNG-ELLAAVRRLSDMADIHFIRQKQPMGLGHAVYQARRHVGNEPFAVLLGDEVFI----GATPCLKQLIDTYEETGGSVIAVRPVPLEEVSRYGVIAPEPAGE---RLHRAVDLVEKPSVTKAPSNLAIVGRYVLDPAIFEILSDLPPGRNGEIQLTDGLRELNRFSQVYAYEPAVKRYDVGEKLGFIQATIELALERNELADGLRVYLEDLV 286
>gi|149011949|ref|ZP_01833097.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|168494153|ref|ZP_02718296.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC3059-06] >gi|169833946|ref|YP_001695454.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|147763904|gb|EDK70837.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|168996448|gb|ACA37060.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|183575935|gb|EDT96463.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC3059-06] (299 aa)
Score = 695, Expect = 2.5e-71, Identities = 144/291 (49%), Positives = 196/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   +DM  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE        EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDKTTDM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAIDTLNKTQRVFAREFNGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|22536589|ref|NP_687440.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae 2603V/R] >gi|25010514|ref|NP_734909.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae NEM316] >gi|76788651|ref|YP_329125.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae A909] >gi|77407013|ref|ZP_00784025.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae H36B] >gi|77409739|ref|ZP_00786398.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae COH1] >gi|77412324|ref|ZP_00788637.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae CJB111] >gi|77414750|ref|ZP_00790877.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae 515] >gi|22533425|gb|AAM99312.1|AE014210_2 UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae 2603V/R] >gi|23094867|emb|CAD46085.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563708|gb|ABA46292.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae A909] >gi|77159200|gb|EAO70384.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae 515] >gi|77161613|gb|EAO72611.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae CJB111] >gi|77171653|gb|EAO74863.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae COH1] >gi|77174373|gb|EAO77230.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae H36B] (299 aa)
Score = 694, Expect = 3.3e-71, Identities = 146/288 (50%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K E  KLV   + +  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ I  FE  + S + V EV H++VS YG+I P  Q +       V   +EKP P  +PSN AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L +Y+
  S:     2 KVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKNELLKLVDETTGI-RLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVMEVPHEDVSAYGVIAP--QGEGVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTLNKTQRVFARKFTGDRYDVGDKFGFMKTSIDYALQHPQVKDDLKKYI 286
>gi|148992064|ref|ZP_01821838.1| tyrosyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|168489153|ref|ZP_02713352.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP195] >gi|147929113|gb|EDK80124.1| tyrosyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|183572302|gb|EDT92830.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP195] (299 aa)
Score = 694, Expect = 3.7e-71, Identities = 144/291 (49%), Positives = 197/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKTVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|29376295|ref|NP_815449.1| UTP-glucose-1-phosphate uridylyltransferase [Enterococcus faecalis V583] >gi|29343758|gb|AAO81519.1| UTP-glucose-1-phosphate uridylyltransferase [Enterococcus faecalis V583] (298 aa)
Score = 693, Expect = 4.1e-71, Identities = 144/288 (50%), Positives = 205/288 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKAM KEMLPI+DKPTIQFIVEEA+ASGIEDILI+  + K  I DHFD   ELE  LK+KNK +  KLV   +D+ ++H+IRQ  P GLGHA+  AK F+GNEPF ++LGDD++    +   P  KQ ++ +E+ + S + V +V H++ SKYGII+P ++++    +  V+N +EKP P  +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ F G+RYD+G K G++K +++  L+ P+V+D L EY+
  S:     2 KVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAKRPIEDHFDSNVELENNLKEKNKTDLLKLVEETTDV-NLHFIRQSHPKGLGHAVLQAKAFVGNEPFVVMLGDDLM----EDKVPLTKQLMDDYEQTHASTIAVMKVPHEDTSKYGIINPEKEIEKGLYN--VENFVEKPKPEEAPSDLAIIGRYLLTPEIFDVLENQKPGAGNEIQLTDAIDTLNKTQRVFAREFKGERYDVGDKFGFMKTSIEYGLTHPEVKDNLREYI 282
>gi|149006940|ref|ZP_01830621.1| tyrosyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|149023788|ref|ZP_01836249.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP23-BS72] >gi|147761541|gb|EDK68506.1| tyrosyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|147929584|gb|EDK80577.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP23-BS72] (299 aa)
Score = 693, Expect = 4.5e-71, Identities = 144/291 (49%), Positives = 197/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|116617715|ref|YP_818086.1| UDP-glucose pyrophosphorylase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096562|gb|ABJ61713.1| UDP-glucose pyrophosphorylase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (291 aa)
Score = 693, Expect = 4.7e-71, Identities = 150/292 (51%), Positives = 202/292 (69%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K V KA+IPAAG+GTRFLPATKA+ KEMLPI+D PTI++IV EA+ SGIEDI+I+  + K SI DHFD   ELE  L++K K E  KLV   +D+ ++++IRQ  P GLG A+  AK FIG+EPF +LLGDD++    Q + P  KQ I+ +EE   S + V +V H +VS+YG+IDP  QVD K    RVK+ +EKP P  +PS+ AI+GRY+LTP IF+ELE T+     EI++T ++ +L  ++ VYA  F G RYDIGSKIG+L+  ++  L  P  +D L  Y+K L
  S:     2 KPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIESGIEDIVIVDGKSKRSIEDHFDSNPELENNLREKGKDELLKLVEETTDI-NMYFIRQSHPKGLGDAVLTAKAFIGDEPFVVLLGDDLM----QDEVPLTKQLIQRYEETGESTLAVMKVPHDQVSEYGVIDPAAQVD-KGGLYRVKSFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTKPGKGNEIQLTDAIDSLNNRQHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTKDALRAYIKEL 287
>gi|28895078|ref|NP_801428.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes SSI-1] >gi|28810323|dbj|BAC63261.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes SSI-1] (300 aa)
Score = 693, Expect = 5.0e-71, Identities = 144/291 (49%), Positives = 198/291 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+ILI+  + K SI DHFD  FELE  L+ K K+E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N + KP  KQ I+ +EE + + + V  V H++VS YGII P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE+ +     E+++T ++  L + + V+A+ F GKRYD+G K G++K +LD +L  P V+D+L  Y+
  S:     1 MMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSI-NLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP--QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYI 288
>gi|15901907|ref|NP_346511.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae TIGR4] >gi|111657568|ref|ZP_01408306.1| hypothetical protein SpneT_02001227 [Streptococcus pneumoniae TIGR4] >gi|18202327|sp|P58313|CAP4C_STRPN UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|14973602|gb|AAK76151.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae TIGR4] (299 aa)
Score = 692, Expect = 5.1e-71, Identities = 144/291 (49%), Positives = 197/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   +DM  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDKTTDM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFKGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|94971576|ref|YP_593624.1| UDP-glucose pyrophosphorylase [Acidobacteria bacterium Ellin345] >gi|94553626|gb|ABF43550.1| UDP-glucose pyrophosphorylase [Acidobacteria bacterium Ellin345] (299 aa)
Score = 692, Expect = 5.3e-71, Identities = 136/292 (46%), Positives = 198/292 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K + KAV PAAG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+ +G + I+I+  + K+SI DHFD  +ELE+ L+++ K E   +VR ISDM H+ Y+RQKE +GLGHA+ M+K  +G+EPFA+LL DDVI     ++   LKQ +E+F     S++  Q VE K +S YG++D  P+       +   + +++EKP P  +PSN AI+GRY+LTP++F  L+       GEI++T  L  L ++E +Y   F GKR+D G K+G+LKAT++ +L  P++     +Y++ L
  S:     2 KTIRKAVFPAAGLGTRFLPATKAQPKEMLPIVDKPIIQYGVEEALDAGCDQIIIVTGRGKSSIEDHFDVSYELEKMLEERGKTELLSIVRKISDMIHVAYVRQKEALGLGHAVLMSKELVGDEPFAVLLADDVI----DAEPSCLKQMVEVFNATQCSVIATQVVEGKAISSYGVLDAKPVTSGPFAGRLFEISDLVEKPKPEEAPSNQAIIGRYLLTPTVFDCLQNIPTGAGGEIQLTDGLRALLKREKIYGFQFEGKRHDAGDKLGFLKATVEFALKNPELGPGFAKYLREL 291
>gi|168491618|ref|ZP_02715761.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|183574002|gb|EDT94530.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC0288-04] (299 aa)
Score = 692, Expect = 6.4e-71, Identities = 144/291 (49%), Positives = 197/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ I+ ++  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLIDDYKRTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|170017601|ref|YP_001728520.1| UTP-glucose-1-phosphate uridylyltransferase [Leuconostoc citreum KM20] >gi|169804458|gb|ACA83076.1| UTP-glucose-1-phosphate uridylyltransferase [Leuconostoc citreum KM20] (290 aa)
Score = 690, Expect = 8.6e-71, Identities = 149/292 (51%), Positives = 201/292 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K V KAVIPAAG+GTRFLPATKA+ KEMLPI+D PTI++IV EA+ASGIEDI+I+  + K SI DHFD   ELE  L++K K E  K+V+  +D+ ++++IRQ  P GLG A+  AK FIG+EPF +LLGDD++    Q + P  KQ IE +EE   S + V +V H +VS+YG+IDP  +        RVK  +EKP P  +PS+ AI+GRY+LTP IF+ELE T+     EI++T ++ +L  ++ VYA  F G RYDIGSKIG+L+  ++  L  P  RD+L  Y+K L
  S:     2 KPVRKAVIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIASGIEDIVIVDGKSKRSIEDHFDSNPELENNLREKGKDELLKIVQETTDI-NMYFIRQSHPNGLGDAVLTAKAFIGDEPFVVLLGDDLM----QDEVPLTKQLIERYEETGESTLAVMKVPHDQVSEYGVIDPAAEA--SDGLYRVKTFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTKPGKGNEIQLTDAIDSLNNRQHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTRDQLRAYIKEL 286
>gi|196040300|ref|ZP_03107601.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus NVH0597-99] >gi|196028785|gb|EDX67391.1| UTP-glucose-1-phosphate uridylyltransferase [Bacillus cereus NVH0597-99] (290 aa)
Score = 690, Expect = 9.3e-71, Identities = 148/295 (50%), Positives = 208/295 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETN 298
           ++ KAVIPAAG+GTRFLPATKA+PKEMLPI+DKPTIQ+IVEEAVASGIEDILII  + K +I DHFD  +ELEE L +  + E  + V+ IS +A+I+YIRQKEP GLG A+  A+ FI NEPFA+LLGDD+I    QS  P LKQ + ++ +    I+ VQ+V   +VSKYGI+ P  ++      ++V  +IEKP      SN AI+GRY+LTP I + + +       EI++T ++  +A+++ VYA  F G+RYDIG K G++KA L+ ++ +P +++EL+ Y+K+L+  N
  S:     2 KIRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQYIVEEAVASGIEDILIISGRGKRAIEDHFDKSYELEEILLKSGRDEILEDVKRISRLANIYYIRQKEPKGLGDAVYCARSFIANEPFAVLLGDDII----QSKTPCLKQLMNIYLKLKSPIIAVQKVPLNDVSKYGIVVPENKI--TENLVQVDTLIEKPPSHTCISNLAIMGRYILTPDILEIIPKLPQINGMEIQLTDAIRIMAEQQNVYAYYFEGERYDIGDKFGFIKANLEYAMQRPKLKEELMAYLKILMGNN 290
>gi|171778998|ref|ZP_02920006.1| hypothetical protein STRINF_00881 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282356|gb|EDT47781.1| hypothetical protein STRINF_00881 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (306 aa)
Score = 690, Expect = 1.1e-70, Identities = 145/297 (48%), Positives = 201/297 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM-----KLLVETNK 299
           ++V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  L+ K K +  KLV + + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++  NN    P  KQ I  +E  + S + V  V H+EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P ++D + +Y+     KL  E+ K
  S:     4 RKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDINNDKAVPLTKQLINDYENTHASTIAVMPVPHEEVSSYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTLNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDNMKQYLIDLGKKLEAESTK 302
>gi|15903944|ref|NP_359494.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae R6] >gi|116516192|ref|YP_817307.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae D39] >gi|15459597|gb|AAL00705.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae R6] >gi|116076768|gb|ABJ54488.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae D39] (299 aa)
Score = 690, Expect = 1.1e-70, Identities = 143/291 (49%), Positives = 196/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ ++  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE        EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYKRTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|50913570|ref|YP_059542.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10394] >gi|71902853|ref|YP_279656.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS6180] >gi|94987825|ref|YP_595926.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS9429] >gi|94989701|ref|YP_597801.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10270] >gi|94991702|ref|YP_599801.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS2096] >gi|94993584|ref|YP_601682.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10750] >gi|50902644|gb|AAT86359.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10394] >gi|71801948|gb|AAX71301.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS6180] >gi|94541333|gb|ABF31382.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS9429] >gi|94543209|gb|ABF33257.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10270] >gi|94545210|gb|ABF35257.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS2096] >gi|94547092|gb|ABF37138.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10750] (301 aa)
Score = 689, Expect = 1.1e-70, Identities = 143/288 (49%), Positives = 197/288 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+ILI+  + K SI DHFD  FELE  L+ K K+E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N + KP  KQ I+ +EE + + + V  V H++VS YGII P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE+ +     E+++T ++  L + + V+A+ F GKRYD+G K G++K +LD +L  P V+D+L  Y+
  S:     5 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSI-NLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP--QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYI 289
>gi|15674413|ref|NP_268587.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes M1 GAS] >gi|19745365|ref|NP_606501.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS8232] >gi|21909696|ref|NP_663964.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS315] >gi|71910006|ref|YP_281556.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS5005] >gi|139473053|ref|YP_001127768.1| UTP--glucose-1-phosphate uridylyltransferase 2 [Streptococcus pyogenes str. Manfredo] >gi|54037244|sp|P67069|HASC2_STRP3 UTP--glucose-1-phosphate uridylyltransferase 2 (UDP-glucose pyrophosphorylase 2) (UDPGP 2) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 2) (Uridine diphosphoglucose pyrophosphorylase 2) >gi|54037245|sp|P67070|HASC2_STRP8 UTP--glucose-1-phosphate uridylyltransferase 2 (UDP-glucose pyrophosphorylase 2) (UDPGP 2) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 2) (Uridine diphosphoglucose pyrophosphorylase 2) >gi|54041558|sp|P67068|HASC2_STRP1 UTP--glucose-1-phosphate uridylyltransferase 2 (UDP-glucose pyrophosphorylase 2) (UDPGP 2) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 2) (Uridine diphosphoglucose pyrophosphorylase 2) >gi|73919931|sp|Q5XE04|HASC1_STRP6 UTP--glucose-1-phosphate uridylyltransferase 1 (UDP-glucose pyrophosphorylase 1) (UDPGP 1) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 1) (Uridine diphosphoglucose pyrophosphorylase 1) >gi|13621506|gb|AAK33308.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes M1 GAS] >gi|19747471|gb|AAL97000.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS8232] >gi|21903879|gb|AAM78767.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS315] >gi|71852788|gb|AAZ50811.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS5005] >gi|134271299|emb|CAM29516.1| UTP--glucose-1-phosphate uridylyltransferase 2 [Streptococcus pyogenes str. Manfredo] (299 aa)
Score = 689, Expect = 1.1e-70, Identities = 143/288 (49%), Positives = 197/288 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+ILI+  + K SI DHFD  FELE  L+ K K+E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N + KP  KQ I+ +EE + + + V  V H++VS YGII P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE+ +     E+++T ++  L + + V+A+ F GKRYD+G K G++K +LD +L  P V+D+L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSI-NLHFIRQSHPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP--QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYI 287
>gi|108763943|ref|YP_629682.1| UTP-glucose-1-phosphate uridylyltransferase [Myxococcus xanthus DK 1622] >gi|108467823|gb|ABF93008.1| UTP-glucose-1-phosphate uridylyltransferase [Myxococcus xanthus DK 1622] (300 aa)
Score = 689, Expect = 1.2e-70, Identities = 140/295 (47%), Positives = 195/295 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           + K VIPAAG+GTRFLPATKA+PKEMLPI+D PT+Q+IVEEAV++GIED+++I  + K +I DHFD  FELE  L+ + K  +   +R I+D+  +  IRQKEP GLGHA+  AK  IG+EPF +LLGDD+I     +++P ++Q   ++ + N +++ + EV   E   YGI       DL    MR+  ++EKP    +PSN A++GRYVL P IF  LE       GEI++T  L  L Q +G+    F G+RYD G K+GYLKA +  +L +PD+R  LLEYM+ +V+T K
  S:    12 IRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTPTLQYIVEEAVSAGIEDVVLINGRGKGAIEDHFDIGFELETTLRARGKDSEADKLRAIADLVRVVSIRQKEPKGLGHAVLCAKSVIGDEPFGVLLGDDMI----DAEEPGIRQLARVYRQYNQAVIALMEVPESETHMYGIA---AGTDLGDGVMRIDRIVEKPKKGTAPSNLAVIGRYVLPPDIFPILENQTPGVGGEIQLTDGLATLQQSKGLLGYRFKGQRYDAGDKVGYLKANIAYALKRPDLRAGLLEYMREVVKTEK 299
>gi|168486908|ref|ZP_02711416.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|183570176|gb|EDT90704.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC1087-00] (299 aa)
Score = 688, Expect = 1.6e-70, Identities = 143/291 (49%), Positives = 196/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFNGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|154498406|ref|ZP_02036784.1| hypothetical protein BACCAP_02395 [Bacteroides capillosus ATCC 29799] >gi|150272474|gb|EDM99659.1| hypothetical protein BACCAP_02395 [Bacteroides capillosus ATCC 29799] (289 aa)
Score = 687, Expect = 2.0e-70, Identities = 148/289 (51%), Positives = 201/289 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI--IDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAVIPAAG+GTR LPATK +PKEMLP++DKP IQ+I+EEAVA+GIEDILI+ ++ K+++ D+FDY+ ELE RL Q  K ++   VR  +D+A+I Y+RQKE  GLGHAI+ A+RF+G+EPFA+LLGDD++    ++ KP +KQ IE  E+ N S VGVQ+V  + +SKY    I PLE      +   V +M EKP P+   SNYAILGRYVLTP IF  LE       GEI++T  L  L ++  + A  F G+RYD G+  G+L+AT+D +L  P+    L  ++K
  S:     2 KVRKAVIPAAGLGTRMLPATKTVPKEMLPMVDKPVIQYIIEEAVAAGIEDILIVTNRAKSAMDDYFDYYPELETRLNQAGKEKELSEVRRAADLANIFYVRQKETKGLGHAISRARRFVGDEPFAVLLGDDIM----RARKPVMKQLIEAAEKYNASCVGVQKVATEAISKYSSVKISPLED-----RIFSVSDMNEKPAPTEMFSNYAILGRYVLTPDIFDILEHQAPGYGGEIQLTDGLRTLCRQNQMIAVDFEGRRYDTGNLKGFLEATIDFALEHPETGAWLKGFIK 283
>gi|148998112|ref|ZP_01825625.1| tyrosyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|168577124|ref|ZP_02722944.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae MLV-016] >gi|147756122|gb|EDK63165.1| tyrosyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|183577260|gb|EDT97788.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae MLV-016] (299 aa)
Score = 687, Expect = 2.1e-70, Identities = 143/291 (49%), Positives = 198/291 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ +  +E+ + S + V  V H++VS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDEATGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMNDYEKTHASTIAVMPVPHEDVSSYGVIAP--QDEGKDGLYSVETFVEKPAPEETPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFARKFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|18977142|ref|NP_578499.1| glucose-1-phosphate uridylyltransferase [Pyrococcus furiosus DSM 3638] >gi|18892791|gb|AAL80894.1| glucose-1-phosphate uridylyltransferase [Pyrococcus furiosus DSM 3638] (292 aa)
Score = 686, Expect = 2.5e-70, Identities = 143/293 (48%), Positives = 214/293 (73%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           +V KAVIPAAG+GTR LP TK+MPKEMLPI+D+P I ++VEEA+ +GIEDILII  + K +I D+FD  FELE  L+++ K E+ K V  I +M  I+Y+RQK+P+GLG AI  A++ +  EPFA+LLGDD+I+    S KPA+KQ +E+ E KN S++GV++V  + VS+YGII+  +++D   Q   + +M+EKP P  +PSN AI+GRYVL P IF  L+ET     GEI++T +L  +  +  + AKV +G+RYDIG++IG++KA +++SL + D+R+ ++ ++K +++
  S:     2 KVRKAVIPAAGLGTRMLPITKSMPKEMLPIVDRPAIHYVVEEAIKAGIEDILIITGKGKRAIEDYFDRSFELEYYLRERGKFEELKQVEEIGEMVDIYYVRQKKPLGLGDAILHAEKHVNGEPFAVLLGDDIII----SKKPAIKQLMEVAERKNTSVIGVEKVPWELVSRYGIING-QKID--EQLYTITDMVEKPSPDEAPSNMAIIGRYVLIPEIFDFLKETPPGKGGEIQLTDALRAMLNEYEMLAKVISGRRYDIGTRIGFIKANIELSLLRDDLREGVILFIKNILQ 287
>gi|168484397|ref|ZP_02709349.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|182685028|ref|YP_001836775.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CGSP14] >gi|194397153|ref|YP_002038681.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae G54] >gi|172042353|gb|EDT50399.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|182630362|gb|ACB91310.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae CGSP14] >gi|194356820|gb|ACF55268.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae G54] (299 aa)
Score = 686, Expect = 2.7e-70, Identities = 143/291 (49%), Positives = 196/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ ++ +E  + S + V  V H EVS YG+I P  Q + K     V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAP--QGEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFKGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|148984389|ref|ZP_01817677.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP3-BS71] >gi|147923166|gb|EDK74280.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP3-BS71] (299 aa)
Score = 686, Expect = 3.0e-70, Identities = 142/291 (48%), Positives = 197/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ +  +E+ + S + V  V H++VS YG+I P  Q +       V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMNDYEKTHASTIAVMPVPHEDVSSYGVIAP--QGEGSNGLYSVETFVEKPAPEETPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|3550619|emb|CAA06172.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae] (299 aa)
Score = 686, Expect = 3.0e-70, Identities = 142/291 (48%), Positives = 197/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + M  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   ++   P  KQ +  +E+ + S + V  V H++VS YG+I P  Q +       V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+       EI++T ++  L + + V+A+ FTG RYD+G K G++K ++D +L  P V+D+L  Y+
  S:     1 MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGM-RLHFIRQTHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDEKAVPLTKQLMNDYEKTHASTIAVMPVPHEDVSSYGVIAP--QGEGSNGLYSVETFVEKPAPEETPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAIDTLNKTQRVFAREFTGTRYDVGDKFGFMKTSIDYALKHPQVKDDLKNYL 288
>gi|196250458|ref|ZP_03149150.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. G11MC16] >gi|196210117|gb|EDY04884.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacillus sp. G11MC16] (258 aa)
Score = 685, Expect = 3.7e-70, Identities = 142/265 (53%), Positives = 191/265 (72%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKI 267
           K V KA+IPAAG+GTRFLPATKAMPKEMLPI+DK TIQ+IVEEA+ASGIEDI+I+  + K +I DHFD  +ELE+ L +K K +  + V+  S +  IHYIRQKEP GLGHA+  A+ FIG+EPFA+LLGDD++    Q+D P LKQ I+ +E+   S++GV++V   E+ +YGIIDP+EQ   + Q   V   +EKP P  +P N AI+GRY+LTP IF  LE+ +    GEI++T ++  L + + V+A  F GKRYD+G K+
  S:     2 KTVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKSTIQYIVEEAIASGIEDIIIVTGKGKRAIEDHFDNTYELEQNLMEKGKYDLLEKVKEPSKV-DIHYIRQKEPKGLGHAVWCARNFIGDEPFAVLLGDDIV----QADPPCLKQLIDQYEQTLSSVIGVKQVPDHEIHRYGIIDPIEQNGRRYQ---VCQFVEKPAPGTAPPNLAIMGRYILTPEIFLFLEKQETGAGGEIQLTDAIQKLNEIQRVFAYEFEGKRYDVGEKL 258
>gi|20093245|ref|NP_619320.1| UTP-glucose-1-phosphate uridylyltransferase [Methanosarcina acetivorans C2A] >gi|19918598|gb|AAM07800.1| UTP-glucose-1-phosphate uridylyltransferase [Methanosarcina acetivorans C2A] (318 aa)
Score = 685, Expect = 4.2e-70, Identities = 144/295 (48%), Positives = 205/295 (69%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRV-KNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           + KA+IPAAG+GTRFLPATK+MPKEMLPI+D P IQ++VEEA+ASGIEDI+II  + K +I D+FD   ELE  L +KN+ +  KLVR+IS +  IHYIRQKEP GLG A+  A+  IGNEPFA+LLGDD+IV    +DKP   Q IE FE+   S + V+EV +++++ YGII   PL+       S+ V ++++EKP P  +PSN   +GRYV TP IF  +++       EI++T  +  L++ + +YA  F GKR+D G ++GY+K+ +D +L    +RD +LEY++ ++   K
  S:    26 IKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVIQYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKNQTDMLKLVRDISSLVDIHYIRQKEPNGLGDAVLRAENHIGNEPFAVLLGDDIIV----NDKPCTAQLIENFEKYGRSTIAVEEVPYEKLNSYGIIKGRPLD------DSLYVLEDIVEKPSPEEAPSNIGAIGRYVFTPEIFDCIKKAGTGVGSEIQLTDGIRLLSRSQMIYACRFKGKRFDTGDRLGYIKSIIDFALQNESLRDNVLEYLREILAVEK 313
>gi|148323074|gb|EDK88324.1| UTP--glucose-1-phosphate uridylyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (301 aa)
Score = 684, Expect = 4.4e-70, Identities = 154/292 (52%), Positives = 200/292 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQ-KEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K+VTKAVIPAAG+GTR LPATKA+PKEML I+DKP++Q+IVEE VASGI DI+II  + KNSI DHFD+ +ELE  LK  +K E    V +IS+MA+I+Y+RQ  P+GLGHAI  AK FIG+EPF I LGDD+I      +KP  KQ IE +E    SI+G QEV  ++VSKYGI    ++ D  T  M   + +EKP    +PS  A LGRY+L   +FK LEET+    GEI++T  +L + +  E V A  F GKRYDIGSK G LKA ++  L   + ++++ EY+K L
  S:     9 KKVTKAVIPAAGLGTRVLPATKALPKEMLTIVDKPSLQYIVEELVASGITDIVIITGRNKNSIEDHFDFSYELENTLKNDHKSELLDKVSHISNMANIYYVRQNMPLGLGHAILKAKSFIGDEPFVIALGDDIIY---NPEKPVTKQMIEKYEVYGKSIIGCQEVAKEDVSKYGIAKLGDRFDEATYQML--DFLEKPSLDSAPSRTACLGRYLLLGKVFKYLEETKPGKNGEIQLTDGILAMMKDNEEVLAYNFIGKRYDIGSKFGLLKANIEFGLRNEETKEDIKEYLKNL 296
>gi|24378821|ref|NP_720776.1| glucose-1-phosphate uridylyltransferase [Streptococcus mutans UA159] >gi|24376696|gb|AAN58082.1|AE014880_9 glucose-1-phosphate uridylyltransferase [Streptococcus mutans UA159] >gi|3192048|dbj|BAA28714.1| glucose-1-phosphate uridylyltransferase [Streptococcus mutans] (306 aa)
Score = 684, Expect = 5.3e-70, Identities = 141/289 (48%), Positives = 198/289 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  L+QK K +  KLV + + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   +    P  +Q +  +EE + S + V EV H++VS YG+I P  Q +  +    V   +EKP P  +PSN AI+GRY+LTP IF  LE  +     E+++T ++  L + + V+A+ F GKRYD+G K G++K ++D +L  P V+++L  Y+
  S:     4 KKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDDKAIPLTRQLMNDYEETHASTIAVMEVPHEDVSAYGVIAP--QGEGVSGLYSVDTFVEKPAPKEAPSNLAIIGRYLLTPEIFTILETQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSIDYALKHPQVKEDLKAYI 289
>gi|19704601|ref|NP_604163.1| UTP--glucose-1-phosphate uridylyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714897|gb|AAL95462.1| UTP--glucose-1-phosphate uridylyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (301 aa)
Score = 683, Expect = 6.0e-70, Identities = 152/292 (52%), Positives = 203/292 (69%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQ-KEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K+VTKAVIPAAG+GTR LPATKA+PKEML I+DKP++Q+IVEE V SGI DI+II  + KNSI DHFD+ +ELE  LK  NK++  + V +IS++A+I+Y+RQ  P+GLGHA+  AK FIG+EPF I LGDD+I      +KP  KQ IE +E    SI+G QEV  ++VSKYGI     +VD  T  M   + +EKP  + +PS  A LGRY+L+  +FK LEET+    GEI++T  +L + +  E V A  F GKRYDIGSK G L+A ++  L   + ++E+ EY+K L
  S:     9 KKVTKAVIPAAGLGTRVLPATKALPKEMLTIVDKPSLQYIVEELVDSGITDIVIITGRNKNSIEDHFDFSYELENTLKNDNKLDLLEKVSHISNIANIYYVRQSMPLGLGHAVLKAKSFIGDEPFVIALGDDIIY---NPEKPVTKQMIEKYELYGKSIIGCQEVAKEDVSKYGIAKLGHKVDETTYQML--DFLEKPSVNEAPSRTACLGRYLLSGKVFKYLEETKPGKNGEIQLTDGILAMMRDNEEVLAYNFIGKRYDIGSKFGLLRANIEFGLRNEETKEEVKEYLKKL 296
>gi|195977348|ref|YP_002122592.1| UTP--glucose-1-phosphate uridylyltransferase 1 HasC.1 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974053|gb|ACG61579.1| UTP--glucose-1-phosphate uridylyltransferase 1 HasC.1 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (300 aa)
Score = 683, Expect = 7.2e-70, Identities = 145/296 (48%), Positives = 201/296 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEY-MKLLVETNK 299
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ +GIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ IE ++  + S + V  V H+EVS YG+I P  Q         V+  +EKP P  +PS+ AI+GRY+LTP IF  LE+       E+++T ++  L + + V+A+ F G+RYD+G K G++K +LD +L  P V+D+L +Y +KL  + NK
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAP--QGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILEKQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIKLSKQLNK 296
>gi|195977363|ref|YP_002122607.1| UTP--glucose-1-phosphate uridylyltransferase HasC.2 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974068|gb|ACG61594.1| UTP--glucose-1-phosphate uridylyltransferase HasC.2 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (322 aa)
Score = 680, Expect = 1.5e-69, Identities = 141/288 (48%), Positives = 196/288 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ +GIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ IE ++  + S + V  V H+EVS YG+I P  Q         V+  +EKP P  +PS+ AI+GRY+LTP IF  LE+       E+++T ++  L + + V+A+ F G+RYD+G K G++K +LD +L  P V+D+L +Y+
  S:    23 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAP--QGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILEKQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYI 307
>gi|33318650|gb|AAQ05209.1|AF468691_2 UDP-glucose pyrophosphorylase [Streptococcus equi subsp. zooepidemicus] (302 aa)
Score = 679, Expect = 2.1e-69, Identities = 140/288 (48%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ +GIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ IE ++  + S + V  V H+EVS YG+I P  Q         V+  +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++  ++  L + + V+A+ F G+RYD+G K G++K +LD +L  P V+D+L +Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLAKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAP--QGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILENQAPGAGNEVQLADAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYI 287
>gi|24940624|gb|AAN65250.1|AF347022_3 UDP-glucose pyrophosphorylase [Streptococcus equi subsp. zooepidemicus] (300 aa)
Score = 678, Expect = 2.2e-69, Identities = 144/296 (48%), Positives = 199/296 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEY-MKLLVETNK 299
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ +GIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ IE ++  + S + V  V H+EVS YG+I P  Q         V+  +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++  ++  L + + V+A+ F G+RYD+G K G++K +LD +L  P V+D+L +Y +KL  + NK
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLAKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAP--QGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILENQAPGAGNEVQLADAIDKLNKTQRVFAREFKGERYDVGDKFGFMKTSLDYALKHPQVKDDLTDYIIKLSKQLNK 296
>gi|21227235|ref|NP_633157.1| UTP--glucose-1-phosphate uridylyltransferase [Methanosarcina mazei Go1] >gi|20905579|gb|AAM30829.1| UTP--glucose-1-phosphate uridylyltransferase [Methanosarcina mazei Go1] (323 aa)
Score = 678, Expect = 2.3e-69, Identities = 144/295 (48%), Positives = 206/295 (69%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII--DPLEQVDLKTQSMRV-KNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           + KA+IPAAG+GTRFLPATK+MPKEMLPI+D P IQ++VEEA+ASGIEDI+II  + K +I D+FD   ELE  L +K++ +  KLVR+IS +  IHYIRQKEP GLG A+  A+  IG+EPFA+LLGDD+IV    +DKP   Q IE FE+   S + V+EV ++++S YGII   PL+       S+ V ++++EKP P  +PSN   +GRYV TP IF  ++        EI++T  +  L + + +YA  F GKR+D G ++GY+K+ +D +L   ++RD++LEY++ ++  NK
  S:    26 IKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVIQYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKHQTDMLKLVRDISSLVDIHYIRQKEPNGLGDAVLRAENHIGDEPFAVLLGDDIIV----NDKPCTAQLIENFEKYGRSTIAVEEVPYEKLSSYGIIKGKPLD------DSLYVLEDIVEKPAPEDAPSNIGAIGRYVFTPEIFDCIKHAGTGVGSEIQLTDGIRLLNKSQMIYACRFKGKRFDTGDRLGYVKSIVDFALQNENLRDDVLEYLREILAVNK 313
>gi|14521364|ref|NP_126840.1| alpha-d-glucosyl-1-phosphate uridylyltransferase [Pyrococcus abyssi GE5] >gi|5458582|emb|CAB50070.1| UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) (UDPgp) (alpha-D-glucosyl-1-phosphate uridylyltransferase) (uridine diphosphoglucose pyrophosphorylase) [Pyrococcus abyssi GE5] (291 aa)
Score = 678, Expect = 2.4e-69, Identities = 146/292 (50%), Positives = 205/292 (70%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           + KAVIPAAG+GTR LP TK+MPKEMLPI+D+P I ++VEEAV +GIEDILII  + K +I D+FD  FELE  LK++ K+E  + V  I +M  I+Y+RQK+P+GLG AI  A++ +  EPFA+LLGDD+I+    S KPA+KQ IE+ E KN  ++GV+ V  + VS+YGII   E   ++    R+K ++EKP P  +PSN AI+GRY+L P IF  L ET     GEI++T +L  L  K  + AK   G+RYDIGSK G++ A L +SL + ++R+E+L+Y+K +++
  S:     2 IRKAVIPAAGLGTRMLPITKSMPKEMLPIVDRPVIHYVVEEAVKAGIEDILIITGKGKRAIEDYFDRSFELEYYLKERGKLEALREVEEIGEMVDIYYVRQKKPLGLGDAILYAEKHVNGEPFAVLLGDDIII----SKKPAIKQLIEVAERKNTPVIGVESVPRELVSRYGII---EGELIENDLYRIKRLVEKPSPKEAPSNIAIIGRYILIPEIFDILRETPPGRDGEIQLTDALQILLNKNEILAKRIEGERYDIGSKFGFVMANLKLSLRREELRNEVLKYLKSILK 286
>gi|145618179|ref|ZP_01774240.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Geobacter bemidjiensis Bem] >gi|144945639|gb|EDJ80703.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Geobacter bemidjiensis Bem] >gi|197087245|gb|ACH38516.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter bemidjiensis Bem] (288 aa)
Score = 678, Expect = 2.8e-69, Identities = 133/289 (46%), Positives = 197/289 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           RV KAV P AG+GTRFLPATK+ PKEMLP++DKP +Q++VEEAVASGIE IL +  + K +I DHFD  FELE  L +K K ++   VR I++MA+I ++RQKE +GLGHAI  AK FIG+EPFA+LLGDD+I     + +P L Q +E +E     ++ +++V  + +S YG +       L  ++  V +++EKP  + +PS+ AI+GRY+LTP IF  LE  +    GEI++T ++  L+++E +Y   F G R+D G K+G+LKAT+D++L + +   E L +++
  S:     2 RVKKAVFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRGKRAIEDHFDISFELESLLYEKGKDQELHQVRKIAEMANIFFVRQKEALGLGHAILCAKEFIGDEPFAVLLGDDII----DAQQPCLSQLLETYESYRSPVLALEQVPIETISSYGCV---RANHLANRAFEVLDLVEKPPVAEAPSDLAIIGRYILTPGIFPILENQEPGKGGEIQLTDAIKTLSREESIYGCRFDGIRHDCGDKLGFLKATVDMALKRDEFNGEFLAFLR 283
>gi|42519467|ref|NP_965397.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus johnsonii NCC 533] >gi|41583755|gb|AAS09363.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus johnsonii NCC 533] (301 aa)
Score = 677, Expect = 2.9e-69, Identities = 142/288 (49%), Positives = 205/288 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKAMPKEM+PI+DKPTIQFIVEEA  SGIEDILI+  + K SI DHFD   ELE+ L++K K E   L ++I+++  +++Y RQ  P GLG AI  A+ F+G+EPFA++LGDD++    +   P  KQ I+ +++ + S + V  V H+EVSKYG+IDP  +++     + VK  +EKPD   +PS+YAI+GRY+LTP IF  L   +    GEI++T ++  + + + V+A VF G+R+D+G+K GYL+ +++  LS P ++D+L EY+
  S:     2 KVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNKRSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSFVGDEPFAVMLGDDLM----EDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDSEIE--PGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNKTQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLREYI 284
>gi|78222375|ref|YP_384122.1| UDP-glucose pyrophosphorylase [Geobacter metallireducens GS-15] >gi|78193630|gb|ABB31397.1| UDP-glucose pyrophosphorylase [Geobacter metallireducens GS-15] (291 aa)
Score = 677, Expect = 3.3e-69, Identities = 134/289 (46%), Positives = 199/289 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATKA PKEMLP++DKP +Q++VEEAVA+GIE IL +  + K +I DHFD  FELE  L++K K +  + VR+I++M +I Y+RQK+ MGLGHAI  A+ F+GNEPFA+LLGDD+I     ++KP L Q ++++ +    ++ +++V  + +S YG +      D   +   V +++EKP    +PS+ AI+GRYVLTP IF  LE  +    GEI++T +LL L++ E +Y  +F G R+D G K+G+LKAT+D++L + +   E  EY++
  S:     2 QVKKAVFPVAGLGTRFLPATKASPKEMLPLIDKPLVQYVVEEAVAAGIEQILFVTGRGKRAIEDHFDISFELEALLQEKGKNDTLREVRDIAEMVNIFYVRQKQAMGLGHAILCAREFVGNEPFAVLLGDDII----DAEKPCLGQLLDVYRKYRGPVLALEKVPMENISSYGCVRANGITD---RIFEVTDLVEKPKREEAPSDMAIIGRYVLTPEIFPILERQEPGKGGEIQLTDALLKLSKDEAIYGCLFEGIRHDCGDKLGFLKATVDMALKREEFNTEFEEYLR 283
>gi|157150886|ref|YP_001449484.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075680|gb|ABV10363.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus gordonii str. Challis substr. CH1] (302 aa)
Score = 677, Expect = 3.4e-69, Identities = 142/288 (49%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGI+DIL++  + K SI DHFD  FELE  LK+K K +  KLV   + +  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ +  +E  + S + V EV H+EVS YG+I P  Q +       V+  +EKP P  +PSN AI+GRY+LTP IF+ LE        EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L +Y+
  S:     3 KVKKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIDDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKDDLLKLVDETTGIG-LHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNDKAMPLTKQLMNDYEATHASTIAVMEVPHEEVSSYGVIAP--QGEGLNGLYSVEKFVEKPSPEEAPSNLAIIGRYLLTPEIFEILENQAPGAGNEIQLTDAIDTLNKTQRVFAREFKGDRYDVGDKFGFMKTSIDYALKHPQVKDDLEQYI 287
>gi|28849784|gb|AAN52125.1| glucose-1-phosphate-uridylyltransferase [Streptococcus gordonii] (313 aa)
Score = 677, Expect = 3.5e-69, Identities = 142/291 (48%), Positives = 195/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +  +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + +  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ +  +E  + S + V +V H+EVS YG+I P  Q +       V+  +EKP P  +PS+ AI+GRY+LTP IFK LE        EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L +Y+
  S:    13 LMSKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKDDLLKLVDETTGIG-LHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNDKAMPLTKQLMNDYEATHASTIAVMQVPHEEVSSYGVIAP--QGEGLNGLYSVEKFVEKPSPEEAPSDLAIIGRYLLTPEIFKILENQAPGAGNEIQLTDAIDTLNKTQRVFAREFKGDRYDVGDKFGFMKTSIDYALKHPQVKDDLEQYI 300
>gi|125718953|ref|YP_001036086.1| glucose-1-phosphate uridylyltransferase, putative [Streptococcus sanguinis SK36] >gi|125498870|gb|ABN45536.1| Glucose-1-phosphate uridylyltransferase, putative [Streptococcus sanguinis SK36] (319 aa)
Score = 677, Expect = 3.6e-69, Identities = 142/288 (49%), Positives = 195/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + +  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ I+ +E  + S + V +V H EVS YG+I P  Q +       V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE+ +     EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D L +Y+
  S:    21 KVKKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKDDLLKLVDETTGIG-LHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNDKAVPLTKQLIDDYEATHASTIAVMQVPHDEVSSYGVIAP--QGEGVKGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILEKQEPGAGNEIQLTDAIDTLNKTQRVFAREFKGDRYDVGDKFGFMKTSIDYALKHPQVKDSLKQYI 305
>gi|146319695|ref|YP_001199407.1| glucose-1-phosphate-uridylyltransferase [Streptococcus suis 05ZYH33] >gi|146321888|ref|YP_001201599.1| glucose-1-phosphate-uridylyltransferase [Streptococcus suis 98HAH33] >gi|145690501|gb|ABP91007.1| glucose-1-phosphate-uridylyltransferase [Streptococcus suis 05ZYH33] >gi|145692694|gb|ABP93199.1| glucose-1-phosphate-uridylyltransferase [Streptococcus suis 98HAH33] (299 aa)
Score = 676, Expect = 4.1e-69, Identities = 141/289 (48%), Positives = 196/289 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K +  KLV   + +  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   +    P  KQ +  +E+ + S + V  V H+EVS YG+I P  Q +       V+  +EKP P  +PS+ AI+GRY+LTP IF+ LE  +     EI++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+D+L +Y+
  S:     2 KKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGI-RLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAP--QGEGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYL 287
>gi|81429114|ref|YP_396115.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|78610757|emb|CAI55808.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus sakei subsp. sakei 23K] (300 aa)
Score = 676, Expect = 4.3e-69, Identities = 150/296 (50%), Positives = 203/296 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           +V KAVIPAAG+GTRFLPATKAM KEMLPI+DKPTIQFIVEEA ASGIEDILII  + K  I DHFD   ELE+ LK KNK +  K+V   +DM  ++++IRQ  P GLG A+ +AK F+ +EPF ++LGDD++    +   P  KQ I  +EE + S + V +V H EV KYG+I+P  +V  K     VKN +EKPD   +PS+ AI+GRY+LTP IF  LE  +    GEI++T ++  L + + V+A  F G+RYD+G+K GYL+ +++  L  P+V+D+L +Y+  L E  K
  S:     2 KVRKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEAKASGIEDILIITGKGKRPIEDHFDSAPELEQNLKSKNKTKMLKMVNETTDMGVNLYFIRQSHPNGLGDAVRLAKSFVADEPFVVMLGDDLM----EDKVPLSKQLINEYEETHASQLAVMKVPHNEVDKYGVINPENKV--KDDLYNVKNFVEKPDVDKAPSDLAIIGRYLLTPEIFDVLENQKPGLGGEIQLTDAIDELNKTQRVFAHEFKGRRYDVGNKFGYLETSIEYGLKHPEVKDDLKKYIIKLGEELK 292
>gi|116620170|ref|YP_822326.1| UDP-glucose pyrophosphorylase [Solibacter usitatus Ellin6076] >gi|116223332|gb|ABJ82041.1| UDP-glucose pyrophosphorylase [Solibacter usitatus Ellin6076] (294 aa)
Score = 676, Expect = 4.5e-69, Identities = 139/294 (47%), Positives = 198/294 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           M  +V KAV PAAG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+ SGI++I+I+  + K +I DHFD  FELE  L+ + K E   +VR+ISDM  + YIRQKE +GLGHA+  +   IG+EPF+++L DDVI    +++ P L+Q ++++E     ++ V EV  + +S YG ID  P+       +  R+++++EKP  S +PSN AI+GRYVLTP IF  L+       GEI++T +L +L +   +YA  F G RYD G K+G+LKAT++ +L + D+     EY+K L
  S:     1 MPAKVRKAVFPAAGLGTRFLPATKAQPKEMLPIVDKPIIQYGVEEAIHSGIQNIIIVTGRGKTAIEDHFDVSFELEYLLESRGKKELLAIVRSISDMISVSYIRQKEALGLGHAVLRSLELIGDEPFSVVLADDVI----EAETPCLRQLLDVYEFFAAPVLAVMEVPPENISAYGAIDAEPVMHNGRNDRVYRIRDLVEKPKQSDAPSNLAIIGRYVLTPEIFGSLQSIDPGSGGEIQLTDALRHLLRSRPIYAYRFDGTRYDAGDKLGFLKATVEYALRRHDLGGPFREYLKTL 292
>gi|116629360|ref|YP_814532.1| UDP-glucose pyrophosphorylase [Lactobacillus gasseri ATCC 33323] >gi|116094942|gb|ABJ60094.1| UDP-glucose pyrophosphorylase [Lactobacillus gasseri ATCC 33323] (302 aa)
Score = 674, Expect = 7.1e-69, Identities = 143/288 (49%), Positives = 206/288 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDK-PALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKAMPKEM+PI+DKPTIQFIVEEA  SGIEDILI+  + K SI DHFD   ELE+ L++K K E   L ++I+++  +++Y RQ  P GLG AI  A+ F+G+EPFA++LGDD++      DK P  KQ I+ +++ + S + V  V H+EVSKYG+IDP  +++     + VK  +EKPD   +PS+YAI+GRY+LTP IF  L   +    GEI++T ++  + + + V+A VF G+R+D+G+K GYL+ +++  LS P ++D+L +Y+
  S:     2 KVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAKKSGIEDILIVTGKNKRSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQPHPAGLGDAILRARSFVGDEPFAVMLGDDLM-----DDKVPLTKQLIDRYDKTHASTIAVMPVPHEEVSKYGVIDPDNEIE--PGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNKTQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLRKYI 284
>gi|116492247|ref|YP_803982.1| UDP-glucose pyrophosphorylase [Pediococcus pentosaceus ATCC 25745] >gi|116102397|gb|ABJ67540.1| UDP-glucose pyrophosphorylase [Pediococcus pentosaceus ATCC 25745] (293 aa)
Score = 674, Expect = 7.1e-69, Identities = 148/294 (50%), Positives = 198/294 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K+V KA+IPAAG+GTRFLP TKA PKEMLPI+DKPTIQ+IVEEA  SGIEDILII  + K +I DHFD   ELEE LK K K E  K+V   + + ++++ RQ  P GLG A+  AK F+GNEPF ++LGDD++    +   P  KQ ++ FEE   S + V  V H+EVSKYG+IDP E+V+       V   +EKP    +PSN AI+GRYVLTP IF  LE+  +    E+++T ++  L +K+ V+AKVF G RYD+G+K G+LK  ++  L  P+ +DEL  Y+K L +
  S:     2 KKVRKAIIPAAGLGTRFLPVTKASPKEMLPIVDKPTIQYIVEEARKSGIEDILIITGKGKRAIEDHFDAVPELEENLKAKGKKEMLKMVEETTGL-NMYFKRQSHPRGLGDAVLTAKSFVGNEPFVVMLGDDLM----EDKVPLTKQLVDSFEETGASTLAVLPVPHEEVSKYGVIDPSEEVE--KDLYNVSKFVEKPAVDEAPSNLAIIGRYVLTPEIFNILEKQGLGEGNEVQLTDAIDTLNKKQRVFAKVFNGDRYDVGNKFGFLKTNIEYGLKHPETKDELKTYIKELAK 288
>gi|69245226|ref|ZP_00603304.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Enterococcus faecium DO] >gi|68195901|gb|EAN10335.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Enterococcus faecium DO] (293 aa)
Score = 673, Expect = 9.2e-69, Identities = 147/288 (51%), Positives = 190/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKAM KEMLPI+DKPTIQFIVEEA+ SGIEDILI+  + K  I DHFD   ELE  L++K K E   LV   + + ++H+IRQ  P GLG A+  AK FIGNEPF ++LGDD++    + D P  +Q +  +EE   S V V  V   E SKYGIIDP  + D +    RVK  +EKP+   +PSN AI+GRY+LTP IF+ LE  +     EI++T +L  L Q E VYA+ F GKRYD+G K+GY+K  ++  L   ++   L  Y+
  S:     2 KVKKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALDSGIEDILIVTGKEKRPIEDHFDANIELENNLREKEKTELLALVEETTQV-NLHFIRQSHPRGLGDAVLQAKAFIGNEPFVVMLGDDLM----KDDIPLTQQLMMDYEETQASAVAVMRVPENETSKYGIIDP--KTDSEKGRCRVKGFVEKPEMGKAPSNLAIIGRYLLTPKIFEILETQEPGAGNEIQLTDALQTLNQTEAVYAREFKGKRYDVGDKLGYMKTNIEYGLQHSEIGTSLSAYI 282
>gi|90962242|ref|YP_536158.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus salivarius UCC118] >gi|90821436|gb|ABE00075.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus salivarius UCC118] (290 aa)
Score = 672, Expect = 1.1e-68, Identities = 143/291 (49%), Positives = 199/291 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KAVIPAAG+GTRFLPATKA+ KEM PI+DKPTIQ+IVEEA  SGIEDIL++  + K  I DHFD   ELE+ L +K K E  +LV+  +D+ ++++IRQ  P GLG A+ MAK F+GNEPF ++LGDD++    +   P  +Q I+ +E+ + S + V +V H+EV+KYG+IDP  +   +     VK  +EKPD   +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A  F G+RYD+G K GYLK ++   L  P+VRDEL EY+K L
  S:     2 KVRKAVIPAAGLGTRFLPATKALAKEMFPIIDKPTIQYIVEEAKKSGIEDILVVTGKGKRPIEDHFDSVPELEQNLTEKGKTELLRLVQQTTDI-NLYFIRQSHPRGLGDAVLMAKDFVGNEPFVVMLGDDLM----EDKVPLTRQLIDRYEKTHASTLAVMKVPHEEVNKYGVIDPAAET--QPGLFDVKQFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLETQKPGAGNEIQLTDAIDRLNKIQRVFAHEFKGQRYDVGYKFGYLKTSIQFGLRHPEVRDELKEYIKEL 285
>gi|124516392|gb|EAY57900.1| UDP-glucose pyrophosphorylase [Leptospirillum sp. Group II UBA] (297 aa)
Score = 671, Expect = 1.5e-68, Identities = 143/299 (47%), Positives = 192/299 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M   V KA+ P AG GTRFLP TKA PKEMLP++DKP +Q++VEEAVASGI +I++I  + K +I DHFD  +ELE+ L+QK K+   + VR IS +A I Y RQKE  GLGHA+   +  IGNEPFA+ LGD+VI        PAL Q + +F + +  ++GVQ+V   +VS YGI+      D+    +RV +++EKP PS +PSN AI+GRYVLTP IF  LE       GEI++T +L  L++K  VYA    G RYD G K+G+LKAT+   L  PD+      Y++ L+   K
  S:     1 MSADVRKALFPLAGHGTRFLPMTKASPKEMLPLVDKPVVQYVVEEAVASGINEIVMITGRGKRAIEDHFDISYELEDVLRQKGKMALLEEVRKISSLAEIVYTRQKESRGLGHAVLCGRLLIGNEPFAVALGDEVI----DGPAPALSQLMSVFAKLDGPVIGVQKVPDSDVSSYGIV---AGSDIGDGIIRVSSLVEKPSPSEAPSNLAIIGRYVLTPDIFDILETQNPGVGGEIQLTDALRTLSEKRPVYACEIKGSRYDTGDKLGFLKATVQFGLKSPDMGGVFRHYLEGLLHPRK 292
>gi|73668654|ref|YP_304669.1| UDP-glucose pyrophosphorylase [Methanosarcina barkeri str. Fusaro] >gi|72395816|gb|AAZ70089.1| UDP-glucose pyrophosphorylase [Methanosarcina barkeri str. Fusaro] (295 aa)
Score = 671, Expect = 1.5e-68, Identities = 140/288 (48%), Positives = 197/288 (68%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           V KA+IPAAG+GTRFLPATK+MPKEMLPI+D P IQ++VEEA+ASGIEDI+II  + K +I D+FD   ELE  L +K+  E  KLVRN+S +  IHYIRQKEP GLG A+  A+  IG+EPFA+LLGDD+IV N    KP   Q I+ FE+   S + V+EV  +++S YGII   +   L      +++++EKP P  +PSN   +GRYV TP IF  ++E       EI++T  +  L + + +YA  F GKR+D G ++GY+K+ +D +L   ++R+++LEY++
  S:     3 VKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVIQYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKHNTELLKLVRNVSSLVDIHYIRQKEPNGLGDAVLRAENHIGDEPFAVLLGDDIIVNN----KPCTAQLIDNFEKYGRSTLAVEEVPREKLSSYGII---KGKPLSNSLYVLEDIVEKPSPENAPSNMGAIGRYVFTPEIFDCIKEAGTGVGNEIQLTDGIRVLNRSQMIYACRFKGKRFDTGDRLGYVKSIVDFALENENLREDVLEYLR 283
>gi|39995965|ref|NP_951916.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter sulfurreducens PCA] >gi|39982730|gb|AAR34189.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter sulfurreducens PCA] (289 aa)
Score = 671, Expect = 1.5e-68, Identities = 131/289 (45%), Positives = 200/289 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATK+ PKEMLP++DKP +Q++VEEAVASGIE +L +  + K +I DHFD  FELE  L++K K +  + VR I+DM  I Y+RQK+ +GLGHAI  A+ F+G+EPFA+LLGDD+I     +++P L Q ++++ +    +V +++V  + +S YG +   +   +  +   V +++EKP    +PS+ AI+GRYVLTP IF  LE       GEI++T +LL L+++E +Y  +F GKR+D G K+G+LKAT+D++L + +  +E  +Y++
  S:     2 QVKKAVFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVASGIEQLLFVTGRSKRAIEDHFDISFELEALLQEKGKDDMLQEVREIADMVKIFYVRQKQALGLGHAILCAREFVGDEPFAVLLGDDII----DAEQPCLGQLLDVYRKYRGPVVALEKVPIEAISSYGCV---KATGITDRIFEVTDLVEKPRREEAPSDMAIIGRYVLTPDIFPILERQTPGKGGEIQLTDALLTLSREEAIYGCLFKGKRHDCGDKLGFLKATVDMALKREEFNEEFRDYLR 283
>gi|160931689|ref|ZP_02079083.1| hypothetical protein CLOLEP_00520 [Clostridium leptum DSM 753] >gi|156869334|gb|EDO62706.1| hypothetical protein CLOLEP_00520 [Clostridium leptum DSM 753] (289 aa)
Score = 670, Expect = 1.8e-68, Identities = 139/289 (48%), Positives = 198/289 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAVIPAAG+GTR LPATK+MPKEMLPI+DKP IQ+IVEEAV SGI DILII ++ K  I DHFD   ELE +L   NK E +  V +IS +A+I+++RQKE  GLGHA+N A+ F+GNEPFA+L GDDVI+  +    PA  Q I  +EE  + ++GV++V  + ++KY     L+   ++    +  +MIEKP      S Y+ILGR VLTP IF  L+ T     GEI++T ++  +A+ +G+ A  +TGKRYD+G+K+G ++A ++++L   ++  +  EY+K
  S:     2 KVTKAVIPAAGLGTRVLPATKSMPKEMLPIVDKPAIQYIVEEAVNSGITDILIITNRGKGLIEDHFDRAPELEAKLTGANKNEMFHQVVDISKLANIYFVRQKETKGLGHAVNCARSFVGNEPFAVLYGDDVIIGKD----PACGQLIRAYEEFGMGVLGVKQVSEEAITKY---SSLKVEKIRDNLFKCTDMIEKPSKDKIMSLYSILGRCVLTPDIFDILDNTAPGAGGEIQLTDAMCAMARTQGMIAVDYTGKRYDMGNKLGIIQAAVEVALEHSEIGKDFREYLK 283
>gi|163783971|ref|ZP_02178938.1| UTP-glucose-1-phosphate uridylyltransferase [Hydrogenivirga sp. 128-5-R1-1] >gi|159880767|gb|EDP74304.1| UTP-glucose-1-phosphate uridylyltransferase [Hydrogenivirga sp. 128-5-R1-1] (297 aa)
Score = 669, Expect = 2.5e-68, Identities = 143/293 (48%), Positives = 206/293 (70%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKN-MIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           K V KAVIP AG GTRFLPATKA PKEM+PI+DKP IQ+IVEEAV+SGI+ I+ +  ++K +I DHFDY  +LE  L++  K+E  +L+R +S++A+  Y+RQKE +GLGHAI  A+  IG+EPFA++LGD++I+     ++P LKQ I+++++   S++G  EV  +E  KYGI++      L   S+R+ N M+EKP P  +PS  AI+GRYVLTP IF  L+ T     GE+++T +L+ L Q+E +Y+K   GKR+D G+KIGY+KA +D +L + D      E+MK L+
  S:     2 KEVKKAVIPVAGFGTRFLPATKATPKEMMPIVDKPIIQYIVEEAVSSGIDTIIFVTGRHKRAIEDHFDYAPDLEHTLEKAGKIELLELIREVSNLANFVYVRQKEQLGLGHAILTAEHVIGDEPFAVMLGDELIINQ---EEPGLKQLIDVYKKFGKSVLGTTEVPKEETYKYGIVEG----SLIEDSIRLVNYMVEKPAPEEAPSTSAIIGRYVLTPKIFDALKRTPFGKGGELQLTDALMTLRQEEVIYSKDIVGKRHDTGNKIGYIKAIVDFALEREDTS----EFMKNLI 284
>gi|73670368|ref|YP_306383.1| UDP-glucose pyrophosphorylase [Methanosarcina barkeri str. Fusaro] >gi|72397530|gb|AAZ71803.1| UDP-glucose pyrophosphorylase [Methanosarcina barkeri str. Fusaro] (310 aa)
Score = 668, Expect = 3.6e-68, Identities = 139/292 (47%), Positives = 199/292 (68%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           V KA+IPAAG+GTRFLPATK+MPKEMLPI+D P I ++VEEA+ASGIEDI+II  + K +I D+FD   ELE  L +K+  E  KLVR++S +  IHYIRQKEP GLG A+  A+  IG+EPFA+LLGDD+IV    +DKP   Q IE FE+   S + V+EV ++++S YGII      D       +++++EKP P  +PSN   +GRYV TP IF  ++E       EI++T  +  L + + +YA  F GKR+D G ++GY+K+ +D +L   ++R+++ EY++ ++E
  S:     3 VKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVIHYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKHNTELLKLVRDVSSLVDIHYIRQKEPNGLGDAVLRAENHIGDEPFAVLLGDDIIV----NDKPCTAQLIENFEKYGRSTLAVEEVPYEKLSSYGIIKGKPLCD---SLYMLEDIVEKPSPENAPSNLGAIGRYVFTPEIFDCIKEAGTGVGNEIQLTDGIRVLNKSQIIYACRFKGKRFDTGDRLGYVKSVVDFALQNENLREDVFEYLRKILE 287
>gi|56808227|ref|ZP_00366000.1| COG1210: UDP-glucose pyrophosphorylase [Streptococcus pyogenes M49 591] >gi|71904548|ref|YP_281351.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS6180] >gi|94991482|ref|YP_599582.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10270] >gi|94993381|ref|YP_601480.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS2096] >gi|71803643|gb|AAX72996.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS6180] >gi|94544990|gb|ABF35038.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10270] >gi|94546889|gb|ABF36936.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS2096] (304 aa)
Score = 668, Expect = 3.8e-68, Identities = 138/288 (47%), Positives = 195/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ +E +++ + S + V +V H++VS YG+I P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P+V+++L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAP--QGKAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQTPGAGNEVQLTDAIDTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPEVKEDLKNYI 287
>gi|15675935|ref|NP_270109.1| UDP-glucose pyrophosphorylase [Streptococcus pyogenes M1 GAS] >gi|71911666|ref|YP_283216.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS5005] >gi|94989494|ref|YP_597595.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS9429] >gi|81170781|sp|P0C0I9|HASC1_STRP1 UTP--glucose-1-phosphate uridylyltransferase 1 (UDP-glucose pyrophosphorylase 1) (UDPGP 1) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 1) (Uridine diphosphoglucose pyrophosphorylase 1) >gi|13623175|gb|AAK34830.1| UDP-glucose pyrophosphorylase [Streptococcus pyogenes M1 GAS] >gi|71854448|gb|AAZ52471.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS5005] >gi|94543002|gb|ABF33051.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS9429] (304 aa)
Score = 667, Expect = 4.4e-68, Identities = 138/288 (47%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ +E +++ + S + V +V H++VS YG+I P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+++L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAP--QGKAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFGILERQTPGAGNEVQLTDAIDTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYI 287
>gi|191638032|ref|YP_001987198.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus casei] >gi|190712334|emb|CAQ66340.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus casei BL23] (304 aa)
Score = 667, Expect = 4.6e-68, Identities = 143/288 (49%), Positives = 200/288 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA ASGIEDILI+  + K SI DHFD   ELE+ LK+K+K    +LV + +D+  ++ ++RQ  P GLG A+ +AK F+G+EPF ++LGDD++        P  KQ I  +++ + SI+ V++V H EVS YG+IDP ++V        VK  +EKP  + +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L Q + V+A  FTG RYD+G+K GY+K  ++  L+ P+V+DEL  Y+
  S:     2 KVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQKRSIEDHFDSAPELEQNLKEKHKDALLELVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSFVGDEPFVVMLGDDLM----HDKVPLTKQLINEYDKTHASILAVKKVPHDEVSAYGVIDPEKEV--SKGLFNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILENQKPGKGNEIQLTDAIDTLNQTQRVFAHEFTGDRYDVGNKFGYVKTNIEYGLTHPEVKDELRAYI 284
>gi|19747034|ref|NP_608170.1| UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS8232] >gi|73919932|sp|Q8NKW9|HASC1_STRP8 UTP--glucose-1-phosphate uridylyltransferase 1 (UDP-glucose pyrophosphorylase 1) (UDPGP 1) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 1) (Uridine diphosphoglucose pyrophosphorylase 1) >gi|76364068|sp|P0C0I8|HASC_STRPY UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|995767|gb|AAA91810.1| UDP-glucose pyrophosphorylase >gi|19749294|gb|AAL98669.1| UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS8232] (304 aa)
Score = 667, Expect = 5.2e-68, Identities = 138/288 (47%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ +E +++ + S + V +V H++VS YG+I P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+++L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAP--QGKAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQTPGAGNEVQLTDAIDTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYI 287
>gi|20338419|gb|AAM18802.1| UDP-glucose pyrophosphorylase [Bacillus subtilis] (295 aa)
Score = 666, Expect = 5.5e-68, Identities = 141/292 (48%), Positives = 200/292 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+K+V KAVIPAAG+GTRFLPATKA  KEMLP++DKP IQ+IVEEAV SGIEDILII  + +  I DHFD   ELE  L++K K E  K ++ I+D+A+IHYIRQKEP+GLGHA+  A+ FIG+EPFA+LLGDD++V    S+KPAL+Q ++++      +        ++VSKY  I   +    +     V +++EKP P  +PS  A++GRYVL PSIF  L+        EI++T + + L + + ++A++  GKRYDI  K+G  KA+ +I L +P++R +LL Y++
  S:     1 MRKKVRKAVIPAAGLGTRFLPATKAH-KEMLPVVDKPAIQYIVEEAVESGIEDILIITGRKQRCIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEHFIGDEPFAVLLGDDIMV----SEKPALRQLMDVYAAYGTEVARRTACSPEDVSKYANI---QTSGSQGHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNPSIFPILKSIGRGAGNEIQLTDAFVRL-RTQPIHARLLEGKRYDIADKLGCFKASTEIGLMRPEMRSQLLAYLE 283
>gi|182625090|ref|ZP_02952867.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens D str. JGS1721] >gi|177909710|gb|EDT72136.1| UTP-glucose-1-phosphate uridylyltransferase [Clostridium perfringens D str. JGS1721] (277 aa)
Score = 666, Expect = 6.1e-68, Identities = 140/267 (52%), Positives = 189/267 (70%)
  Q:    30 MLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           MLPI+DKPTIQ+I+EEA+ASGIE+IL+I  + K SI DHFD   ELE  L++  K E   LVR+ISDM  IHYIRQKEP GLGHAI+ AK F+G+EPFAILLGDDV+      +KP LKQ I+ + E   S++GVQ V    VSKYGI+D      ++ +  +VK ++EKP    +PSN AILGRY++TP IF  LE T+    GEI++T +LL L  +E +YA  F G+RYD+G K+G+L+AT++ +L +P++R+  +EY+  L E
  S:     1 MLPIVDKPTIQYIIEEAIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVY---NEEKPCLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVDGKY---IEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFIEYLNNLSE 261
>gi|21911389|ref|NP_665657.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS315] >gi|28896761|ref|NP_803111.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes SSI-1] >gi|50915217|ref|YP_061189.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10394] >gi|73919930|sp|Q8K5G4|HASC1_STRP3 UTP--glucose-1-phosphate uridylyltransferase 1 (UDP-glucose pyrophosphorylase 1) (UDPGP 1) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 1) (Uridine diphosphoglucose pyrophosphorylase 1) >gi|73919933|sp|Q5X9A7|HASC2_STRP6 UTP--glucose-1-phosphate uridylyltransferase 2 (UDP-glucose pyrophosphorylase 2) (UDPGP 2) (Alpha-D-glucosyl-1-phosphate uridylyltransferase 2) (Uridine diphosphoglucose pyrophosphorylase 2) >gi|21905605|gb|AAM80460.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes MGAS315] >gi|28812015|dbj|BAC64944.1| putative UDP-glucose pyrophosphorylase [Streptococcus pyogenes SSI-1] >gi|50904291|gb|AAT88006.1| UTP--glucose-1-phosphate uridylyltransferase [Streptococcus pyogenes MGAS10394] (304 aa)
Score = 665, Expect = 8.9e-68, Identities = 138/288 (47%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ +E +++ + S + V +V H++VS YG+I P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+++L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKTHASTIAVMKVPHEDVSSYGVIAP--QGKAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQVPGAGNEVQLTDAIDTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYI 287
>gi|167772025|ref|ZP_02444078.1| hypothetical protein ANACOL_03399 [Anaerotruncus colihominis DSM 17241] >gi|167665823|gb|EDS09953.1| hypothetical protein ANACOL_03399 [Anaerotruncus colihominis DSM 17241] (289 aa)
Score = 664, Expect = 9.1e-68, Identities = 144/294 (48%), Positives = 196/294 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +V KAVIPAAG+GTR LPA+KA+PKEMLPI+DKP IQ+IVEEAVASGIEDILII ++ K+ I DHFD+  ELEE+L    K + Y  V  ++ + +I Y+RQKE  GLGHA+  AK F+GNEPFA+L GDDVI+    SDKPA+ Q I + EE    +VG+++V  + +  Y     L    ++     V +MIEKP P    SN+AILGR VLTP IF  LE T  S  GE+++T ++  +A+  G+    + G RYD+GSK+G L+A +++ LS PD+      Y++ +  T
  S:     2 KVRKAVIPAAGLGTRVLPASKAVPKEMLPIVDKPAIQYIVEEAVASGIEDILIITNRGKSLIEDHFDHAPELEEKLLSSGKQDLYDEVVALARLCNIQYVRQKETRGLGHAVWCAKSFVGNEPFAVLYGDDVII----SDKPAVGQLIGVHEEFGKGVVGIKQVARELLPSYCT---LGVNAVRGNIYDVFDMIEKPMPEEIISNFAILGRCVLTPDIFDILEHTPPSRNGEVQLTDAMRTIARHGGMMGIEYEGTRYDMGSKLGILQAIVEVGLSHPDIGGGFRSYLREIART 288
>gi|53803502|ref|YP_114623.1| UTP-glucose-1-phosphate uridylyltransferase [Methylococcus capsulatus str. Bath] >gi|53757263|gb|AAU91554.1| UTP-glucose-1-phosphate uridylyltransferase [Methylococcus capsulatus str. Bath] (292 aa)
Score = 664, Expect = 1.1e-67, Identities = 138/294 (46%), Positives = 196/294 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII--DPLEQ-VDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           M K + KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEAVA+GI++++ I  + KN+IMDHFD  +ELE  L  + K +   +VRNI    H+   YIRQ E +GLGHA+N AK  IGN+PFA+LL DD+I  NN      L Q + +F++   S++G++ ++  +   YGI+   P+E  +D      +V+ ++EKP P  +PSN A++GRY+LTP+IF +L        GEI++T ++  L  ++ V A  F GKRYD GSK+GYL AT++  L  PD+R     Y++ L
  S:     1 MAKVIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGIDEMVFITGRSKNAIMDHFDKAYELETELAARGKDDILNIVRNIIP-PHVTCIYIRQAEALGLGHAVNCAKAVIGNQPFAVLLADDLIDGNNHGG--CLSQMVRVFDKWQCSVLGIERIDPGDTHSYGIVKTSPIEAGLD------KVEAIVEKPRPENAPSNQAVVGRYILTPAIFDKLANVSRGAGGEIQLTDAIAMLLNEQTVLAYEFNGKRYDCGSKLGYLIATVEQGLQHPDLRAGFEAYLRSL 290
>gi|148543608|ref|YP_001270978.1| UDP-glucose pyrophosphorylase [Lactobacillus reuteri F275] >gi|184153016|ref|YP_001841357.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus reuteri F275] >gi|194468156|ref|ZP_03074142.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus reuteri 100-23] >gi|68160828|gb|AAY86860.1| lr1180 [Lactobacillus reuteri] >gi|148530642|gb|ABQ82641.1| UDP-glucose pyrophosphorylase [Lactobacillus reuteri F275] >gi|183224360|dbj|BAG24877.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus reuteri F275] >gi|194453009|gb|EDX41907.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus reuteri 100-23] (304 aa)
Score = 663, Expect = 1.2e-67, Identities = 141/292 (48%), Positives = 201/292 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           KRV KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA  SGIEDI+++  + K SI DHFD   ELE+ L+ K+K E  K+V   +D+ +I++IRQ  P GLG A+  A+ FIG+EPF ++LGDD+   NN+++    KQ IE + +   S + V  V H++ +KYG+I+P ++V        V + +EKP P  +PS+ AI+GRYV TP IF  L +T+    GEI++T ++  L Q + V+A+ + G RYD+G+K G++K  ++  L  P V++EL EY+K L
  S:     2 KRVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKNKRSIEDHFDSNPELEDNLRSKHKDEMLKMVEETTDV-NIYFIRQSHPRGLGDAVLTARDFIGDEPFVVMLGDDLNNINNKNEA-LTKQLIESYNQTGASTLAVMRVPHEDTAKYGVINPSKEV--TPGLYNVTSFVEKPAPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGGEIQLTDAIDTLNQTQRVFAREYKGDRYDVGNKFGWVKTNIEYGLEHPQVKEELREYIKEL 289
>gi|139474622|ref|YP_001129338.1| UTP--glucose-1-phosphate uridylyltransferase 1 [Streptococcus pyogenes str. Manfredo] >gi|134272869|emb|CAM31151.1| UTP--glucose-1-phosphate uridylyltransferase 1 [Streptococcus pyogenes str. Manfredo] (304 aa)
Score = 663, Expect = 1.2e-67, Identities = 138/288 (47%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ +E +++ + S + V +V H++VS YG+I P  Q         V   +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ F G RYD+G K G++K ++D +L  P V+++L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKMHASTIAVMKVPHEDVSSYGVIAP--QGKAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQVPGAGNEVQLTDAIDTLNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYI 287
>gi|94311567|ref|YP_584777.1| UDP-glucose pyrophosphorylase [Ralstonia metallidurans CH34] >gi|93355419|gb|ABF09508.1| UDP-glucose pyrophosphorylase [Ralstonia metallidurans CH34] (299 aa)
Score = 663, Expect = 1.3e-67, Identities = 129/291 (44%), Positives = 196/291 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M+ RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +ELE  L+ KNK     +VR+I       +Y+RQ E +GLGHA+  A + +G+ PFA++L DD++  +   D P +KQ ++++   N S++GV+E+  ++   YG+ID  E  D   + +++  ++EKP P  +PSN  ++GRY+LTP IF  + E +    GEI++T ++ ++  +E V A  + G RYD GSK+GYLKAT++ +L  P+VRDE   Y+
  S:     1 MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAYELEAELEAKNKQALLDVVRSIKPANVECYYVRQPEALGLGHAVLCAAKLVGDTPFAVMLADDLL--DGGKDLPVMKQMVDIYNHYNCSVLGVEEIAPEQSRSYGVIDGREWDD---RVIKMSAIVEKPAPEKAPSNLGVVGRYILTPRIFDHIRELKPGAGGEIQLTDAIQSMLDQEQVLAYRYKGVRYDCGSKLGYLKATVEFALRHPEVRDEFSAYL 287
>gi|116494594|ref|YP_806328.1| UDP-glucose pyrophosphorylase [Lactobacillus casei ATCC 334] >gi|116104744|gb|ABJ69886.1| UDP-glucose pyrophosphorylase [Lactobacillus casei ATCC 334] (304 aa)
Score = 662, Expect = 1.6e-67, Identities = 142/288 (49%), Positives = 199/288 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA ASGIEDILI+  + K SI DHFD   ELE+ LK+K+K    +LV + +D+  ++ ++RQ  P GLG A+ +AK F+G+EPF ++LGDD++        P  KQ I  +++ + SI+ V++V H EVS YG+IDP ++V        VK  +EKP  + +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L Q + V+A  F G RYD+G+K GY+K  ++  L+ P+V+DEL  Y+
  S:     2 KVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQKRSIEDHFDSAPELEQNLKEKHKDALLELVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSFVGDEPFVVMLGDDLM----HDKVPLTKQLINEYDKTHASILAVKKVPHDEVSAYGVIDPEKEV--SKGLFNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILENQKPGKGNEIQLTDAIDTLNQTQRVFAHEFNGDRYDVGNKFGYVKTNIEYGLTHPEVKDELRAYI 284
>gi|194290341|ref|YP_002006248.1| glucose-1-phosphate uridylyltransferase [Cupriavidus taiwanensis] >gi|193224176|emb|CAQ70185.1| glucose-1-phosphate uridylyltransferase [Cupriavidus taiwanensis] (306 aa)
Score = 661, Expect = 2.2e-67, Identities = 131/292 (44%), Positives = 193/292 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  FELE  L+ KNK     +VR+I       +Y+RQ E +GLGHA+  A + +G+ PFA++L DD+I  N     P +KQ ++ F   N S++GV+E+  ++   YG+ID  E  D     ++V  ++EKP P  +PSN  ++GRY+LTP IF  L E +    GE+++T ++ +L  +E V A  + G+RYD GSK+GYLKAT++ +L  P+V  +   Y++
  S:    11 MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECYYVRQPEALGLGHAVLCAAKLVGDTPFAVMLADDLIDGN----PPVMKQMVDAFNHYNCSVLGVEEITPEQSRSYGVIDGREWDD---DVIKVSGIVEKPAPEDAPSNLGVVGRYILTPRIFDHLRELKPGAGGELQLTDAIQSLLGQEQVLAYRYQGRRYDCGSKLGYLKATVEFALKHPEVGTDFSAYLE 296
>gi|58337977|ref|YP_194562.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus acidophilus NCFM] >gi|58255294|gb|AAV43531.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus acidophilus NCFM] (294 aa)
Score = 661, Expect = 2.3e-67, Identities = 143/288 (49%), Positives = 202/288 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPAL-KQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQFIVEEA A+GIEDILI+  + K +I +HFD   ELE+ L+   KV+  KL ++I+++  +++Y RQ  P GLG AI  A+ F+G EPF ++LGDD++      DK  L KQ +  +++ + S + V +V HKEVSKYG+IDP  +VD       VK  +EKP    +PS++AI+GRY+LTP IF+ LE  +    GEI++T ++  L Q + V+A VF G+R+D+G+K GYL+ ++   L  P+ RD L +Y+
  S:     2 KVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAKAAGIEDILIVTGKNKRAIENHFDSNPELEQDLEATGKVKLLKLTQDITNLGINLYYTRQPHPAGLGDAIYRARSFVGEEPFVVMLGDDLM-----KDKITLTKQLMNDYDKIHASTIAVMQVPHKEVSKYGVIDPEGKVD--KDLYNVKKFVEKPAVDKAPSDFAIIGRYLLTPEIFEILENQKPGRGGEIQLTDAIDTLNQTQRVFAHVFRGQRFDVGNKEGYLETSIQYGLRHPETRDALKKYI 284
>gi|7739964|emb|CAB90754.1| putative UDP-glucose pyrophosphorylase [Streptococcus uberis] (304 aa)
Score = 660, Expect = 3.1e-67, Identities = 138/288 (47%), Positives = 193/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIE+IL++  + K SI DHFD  FELE  L++K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ ++ +E  + S + V +V H +VS YG+I P  +      S  V   +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ FTGKRYD+G K G++K ++D +L    V+D+L  Y+
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEEILVVTGKSKRSIEDHFDSNFELEYNLQEKGKTELLKLVDETTSI-NLHFIRQSHPKGLGDAVLQAKAFVGNEPFIVMLGDDLMDITNTKAVPLTKQLMDDYETTHASTIAVMKVPHDDVSSYGVIAPNGKALNGLYS--VDTFVEKPKPEDAPSDLAIIGRYLLTPEIFDILENQAPGAGNEVQLTDAIDTLNKTQRVFAREFTGKRYDVGDKFGFMKTSIDYALKHHQVKDDLKAYI 287
>gi|72160777|ref|YP_288434.1| UDP-glucose pyrophosphorylase [Thermobifida fusca YX] >gi|71914509|gb|AAZ54411.1| UDP-glucose pyrophosphorylase [Thermobifida fusca YX] (309 aa)
Score = 660, Expect = 3.2e-67, Identities = 133/288 (46%), Positives = 196/288 (68%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI--IDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG-----VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           VTKAVIP AG+GTRFLPATK+ PKEMLPI+DKP IQ++VEEAV++G+ DIL+I  + K SI DHFD  +ELEE L+ K  +E    VR+ SD+A +HY+RQ EP GLGHA+      +GNEPFA+LLGDD+I     + +  L++ IE+ +    S++ + EVE  +VS YG   I+P ++ D+ T    V +++EKP    +PS +AI+GRY+  P IF+ L +T     GEI++T +L  LAQ+       V+  +F G+R+D G+K+ YL+  ++ +   PD+  E + +++
  S:    11 VTKAVIPVAGLGTRFLPATKSTPKEMLPIVDKPAIQYVVEEAVSAGLNDILMITGRNKRSIEDHFDRAYELEEALRAKGDIERLNAVRHPSDLAQLHYVRQGEPRGLGHAVLCGAAHVGNEPFAVLLGDDLI----GARETLLQRMIEVRQTYGGSVIALMEVEPDQVSLYGCAAIEPTDEPDVVT----VTDLVEKPPADQAPSRWAIIGRYICDPEIFEVLRKTPPGRGGEIQLTDALRELAQRSSNGGGRVHGVLFRGQRFDTGNKLDYLRTVVEFACESPDLAKEFVPWLR 297
>gi|114321620|ref|YP_743303.1| UDP-glucose pyrophosphorylase [Alkalilimnicola ehrlichei MLHE-1] >gi|114228014|gb|ABI57813.1| UDP-glucose pyrophosphorylase [Alkalilimnicola ehrlichei MLHE-1] (292 aa)
Score = 659, Expect = 3.4e-67, Identities = 132/290 (45%), Positives = 194/290 (66%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++R+ KAV P AG+GTRFLPATKA PKEMLP++D+P IQ+ V+EA A+G E ++ I  + K +I DHFD  +ELE  L+QK K E  +LVR+ + D  H  YIRQ E +GLGHA++ A+  IG+EPF++LL DD+I  N    +  L Q  E + E   S++GV+ + ++E  KYG++       L  +   V  ++EKP P+ +PS+ A++GRY+LTP+IF EL  T    +GEI++T ++  L ++E V A  F+G+RYD GSK+GYL+ATLD  L  P++     +Y+
  S:     3 EQRIKKAVFPVAGLGTRFLPATKASPKEMLPVVDRPLIQYAVDEACAAGAETLIFITGRTKRAIEDHFDKAYELEAELEQKQKHEMLELVRSTVPDGVHCIYIRQGEALGLGHAVHCARAVIGDEPFSVLLADDLIDGNG---REVLCQMAEQYAEHRSSVLGVERIPNEETHKYGVV---SAESLGERVYDVNGIVEKPSPAEAPSDLAVVGRYILTPAIFDELARTPPDAKGEIQLTDAIATLLRRERVLAYEFSGRRYDCGSKLGYLEATLDYGLKHPELGPAFRDYV 287
>gi|161507148|ref|YP_001577102.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus helveticus DPC 4571] >gi|160348137|gb|ABX26811.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus helveticus DPC 4571] (299 aa)
Score = 659, Expect = 3.4e-67, Identities = 139/291 (47%), Positives = 205/291 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KAVIPAAG+GTRFLPATKA+PKEMLPI+DKPTIQFIVEEA  SGIEDILI++ + K  I DHFD   ELE+ L++K+K +  KL + I+++  +++Y RQ  P GLG AI  A+ F+G+EPF ++LGDD++        P  KQ I  +++ + S + V  V H+EVSKYG+I+P  + ++    + VK+ +EKPD   +PS+YAI+GRY+LTP IF  L   +    GEI++T ++  + + + V+A VF G+R+D+G+K GYL+ +++  L  P+++D+L  Y+K L
  S:     2 KVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIVIGKNKRPIEDHFDSNPELEQDLEEKSKSKLLKLTQGITNLGVNLYYTRQPHPAGLGDAIYRARSFVGDEPFVVMLGDDLM----DDQVPLTKQLINRYDKTHASTIAVMPVPHEEVSKYGVIEP--ENEIMPGLINVKSFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQKPGRGGEIQLTDAIDTMNKTQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKDQLRAYIKKL 287
>gi|58336950|ref|YP_193535.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus acidophilus NCFM] >gi|58254267|gb|AAV42504.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus acidophilus NCFM] (300 aa)
Score = 657, Expect = 6.0e-67, Identities = 141/291 (48%), Positives = 207/291 (71%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDK-PALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKA+PKEMLPI+DKPTIQFIVEEA  SGIEDILII+ + K  I DHFD   ELE+ LK+K K E  +L + I+++  +++Y RQ  P GLG AI  A+ F+G+EPF ++LGDD++      DK P  KQ I+ + + + S + V  V H+EVSKYG+I+P  + ++    + VK+ +EKPD   +PS+YAI+GRY+L P IF+ L   +    GEI++T ++  + + + V+A VF G+R+D+G+K GYL+ +++  L  P+++D+L EY++ L
  S:     2 KVRKAIIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIIIGKNKRPIEDHFDANPELEQDLKEKGKDELLELTQGITNLGVNLYYTRQPHPAGLGDAIYRARSFVGDEPFVVMLGDDLM-----DDKVPLTKQLIDRYNKTHASTIAVMPVPHEEVSKYGVIEP--ENEILPGLINVKSFVEKPDVDKAPSDYAIIGRYLLMPEIFEILANQKPGRGGEIQLTDAIDTMNKTQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKDQLREYIQRL 287
>gi|116513670|ref|YP_812576.1| UDP-glucose pyrophosphorylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092985|gb|ABJ58138.1| UDP-glucose pyrophosphorylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (304 aa)
Score = 657, Expect = 6.2e-67, Identities = 139/288 (48%), Positives = 198/288 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHI----HYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQFIVEEA+ASGIEDILII  + K +I DHFD   ELE+ L +K+K    KL R  + M++I    ++ RQ  P GLG A+N A+ FI  EPF ++LGDD++    +   P  KQ I+ + E + S + V +V H+EV+KYG+IDP+ +         VK  +EKPD   +PS+ AI+GRY+LTP IF  L++ +    GEI++T ++  L + + V+A  F G+R+D+G+K GY++ ++   L  P+ +D L +Y+
  S:     2 KVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRSKRAIEDHFDSNTELEDNLTEKHKDALLKLARETT-MSNIKVNLYFTRQPHPNGLGDAVNRARSFIAGEPFVVMLGDDLM----RDKTPLTKQLIDCYHETHASTIAVMKVPHEEVNKYGVIDPIGET--APDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDALNKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYI 286
>gi|148643664|ref|YP_001274177.1| UDP-glucose pyrophosphorylase, GalU [Methanobrevibacter smithii ATCC 35061] >gi|148552681|gb|ABQ87809.1| UDP-glucose pyrophosphorylase, GalU [Methanobrevibacter smithii ATCC 35061] (283 aa)
Score = 656, Expect = 8.6e-67, Identities = 137/292 (46%), Positives = 200/292 (68%)
  Q:     7 KAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETN 298
           KAVIPAAG GTRFLPATKA PKEMLP+ DKPTIQ+++EEAVASGI+DILI+  + K SI DHFD  FELE  LKQ  K +  K V++I+D+A I YIRQKE  GLG AI  AK+ +G EPFA++LGD +     +   P  KQ I+++ +   S + +++V  ++V +YGII   E   ++T   ++  ++EKP    +PSN AI+GRYVLTP IF +++ET     GEI++T +   LA+ + +Y   F GK YDIG+++ +LK +++ ++   + +++L+ YMK ++ +N
  S:     2 KAVIPAAGFGTRFLPATKAQPKEMLPVFDKPTIQYVIEEAVASGIDDILIVTGKNKRSIEDHFDKSFELEYTLKQAGKTKYLKQVQDITDLADICYIRQKEQKGLGDAIYCAKKHVGEEPFAVMLGDTI----TKGKTPCTKQLIDIYNKYEASAISLEKVPQEKVERYGIIKGEE---IETDVYQIDELVEKPPVDQAPSNLAIMGRYVLTPDIFDKIKETGAGVGGEIQLTDA---LAKLDKIYGNTFEGKTYDIGNRLEWLKTSIEFAMDDEESKNDLISYMKEIIASN 283
>gi|88855679|ref|ZP_01130342.1| UTP-glucose-1-phosphate uridylyltransferase [marine actinobacterium PHSC20C1] >gi|88815003|gb|EAR24862.1| UTP-glucose-1-phosphate uridylyltransferase [marine actinobacterium PHSC20C1] (296 aa)
Score = 656, Expect = 8.6e-67, Identities = 133/297 (44%), Positives = 200/297 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI--IDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE---GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M  ++TKAVIPAAG+GTRFLPATKAMPKEMLP++DKP IQ++VEEAVA+G+ D+L+I  + KN++ +HFD   ELE  L+QK   +    V   +D+A +HY+RQ +P GLGHA+  A+  +GNEPFA+LLGDD+I + +      L + +     +N +++ + EV+  +   YGI  ++P +  D+    +R+  ++EKP    +PSN AI+GRYVL P IF+ LE T     GEI++T +LL +AQ +   GVY  VF G+RYD G ++ Y+KA + +++ + D+  +L  ++K    T
  S:     1 MASKITKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVAAGLTDVLMITGRNKNALENHFDRMTELEATLEQKGDTDRLSKVEFSNDLADMHYVRQGDPRGLGHAVLRARMHVGNEPFAVLLGDDLIDERDV----LLSRMLAEQTSRNATVIALMEVDPAQSHMYGIATVEPTDDNDV----VRITGLVEKPVQGTAPSNLAIIGRYVLRPEIFEILERTDPGKGGEIQLTDALLEMAQNDVAGGVYGVVFRGRRYDTGDRLDYIKAIVQLAVEREDLGPDLRPWLKQFSST 294
>gi|148263243|ref|YP_001229949.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Geobacter uraniireducens Rf4] >gi|146396743|gb|ABQ25376.1| UDP-glucose pyrophosphorylase [Geobacter uraniireducens Rf4] (293 aa)
Score = 655, Expect = 1.1e-66, Identities = 130/289 (44%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KA+ P AG+GTRFLPATK+ PKEMLP++DKP +Q++VEEAVASGIE IL +  + K +I DHFD  FELE  L  K K  +   +R I+DM +I Y+RQK+ +GLGHAI  AK F+GNEPFA+LLGDD+I     ++KP L Q +E++ +    ++ +++V  + +S YG +   +   +  +   V +M+EKP    +PS+ AI+GRY+LTP IF  LE  +    GEI++T ++  LA  E +Y   F G R+D G K+G+LKAT+D++L + +   E   +++
  S:     2 QVKKAIFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRSKRAIEDHFDISFELESLLYDKGKDAELSQIREIADMINIFYVRQKQALGLGHAILCAKEFVGNEPFAVLLGDDII----DAEKPCLGQLLEVYRKYRGPVLALEQVPMENISSYGCV---KANTISERVFEVVDMVEKPKREEAPSDLAIIGRYILTPDIFPILERQEPGKGGEIQLTDAIKKLANDEAIYGCRFEGIRHDCGDKLGFLKATVDMALKREEFNGEFEAFLR 283
>gi|163789811|ref|ZP_02184248.1| UTP-glucose-1-phosphate uridylyltransferase [Carnobacterium sp. AT7] >gi|159875033|gb|EDP69100.1| UTP-glucose-1-phosphate uridylyltransferase [Carnobacterium sp. AT7] (293 aa)
Score = 655, Expect = 1.2e-66, Identities = 141/289 (48%), Positives = 196/289 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++V KAVIPAAG+GTRFLPATKAM KEMLPI+DKPTIQFIVEEA+ SGIEDILI+  + K  I DHFD   ELE  LK K K+E  +LV   + + ++ ++RQ  P GLG A+  AK F+GNEPF ++LGDD++    + + P  KQ I  +++ + S + V +V H+E SKYGIID   QVD  T ++R    +EKP+P  +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A  F G RYD+G K G+LK ++   L  P+++D L +Y+
  S:     2 QKVRKAVIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEAINSGIEDILIVTGKSKRPIEDHFDSNPELEANLKSKGKMELLELVEETTGL-NLFFVRQSYPKGLGDAVLQAKAFVGNEPFVVMLGDDLM----EDEVPLTKQLINGYDKTHASNIAVMKVPHEETSKYGIIDVEGQVDETTYNVR--RFVEKPNPEDAPSDLAIIGRYLLTPEIFDILENQEPGAGNEIQLTDAIDTLNKTQRVFAHEFKGTRYDVGDKFGFLKTSIQYGLKHPEIKDSLNDYI 283
>gi|113868710|ref|YP_727199.1| UTP-glucose-1-phosphate uridylyltransferase [Ralstonia eutropha H16] >gi|113527486|emb|CAJ93831.1| UTP-glucose-1-phosphate uridylyltransferase [Ralstonia eutropha H16] (296 aa)
Score = 654, Expect = 1.4e-66, Identities = 131/292 (44%), Positives = 192/292 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  FELE  L+ KNK     +VR+I        Y+RQ E +GLGHA+  A + +G+ PFA++L DD+I  N     P +KQ ++ F   N S++GV+E+  ++   YG+ID  E        ++V  +IEKP P  +PSN  ++GRY+LTP IF+ L + +    GE+++T ++ +L  +E V A  + G+RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     1 MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECFYVRQPEALGLGHAVLCAAKLVGDTPFAVMLADDLIDGN----PPVMKQMVDTFNHYNCSVLGVEEITPEQSRSYGVIDGRE---WDADVIKVSGIIEKPAPEDAPSNLGVVGRYILTPRIFEHLRDLKPGAGGELQLTDAIQSLLGQEQVLAYRYQGRRYDCGSKLGYLKATVEFALKHPEVGTEFSAYLE 286
>gi|188996788|ref|YP_001931039.1| UTP-glucose-1-phosphate uridylyltransferase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931855|gb|ACD66485.1| UTP-glucose-1-phosphate uridylyltransferase [Sulfurihydrogenibium sp. YO3AOP1] (299 aa)
Score = 654, Expect = 1.5e-66, Identities = 136/290 (46%), Positives = 205/290 (70%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVD-LKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           K+V KAVIP AG GTRFLPATK+ PKEM+P++DKP I +IVEEAV SGIE I+ +  ++K +I D+FDY+ ELE+ L +  K ++ +++R IS+MA   +IRQK+ +GLGHA+  A   +GNEPFA+LLGD++I      +KP +KQ I+++ +   S++G  EV  ++VSKYGI+   E ++ +K     ++++IEKP    +PS  AI+GRYVLTP++F  L ET +   GEI++T  L  L +KE +YAK   G R+D G+K+GY++A +D +L + D++DE+ + +K
  S:     2 KKVRKAVIPVAGFGTRFLPATKSTPKEMMPLIDKPIIHYIVEEAVNSGIETIIFVTGRHKRAIEDYFDYYPELEQVLNKSGKEKEIEMLRQISNMAEFVFIRQKQQLGLGHAVLTAANLVGNEPFAVLLGDEII---KNDEKPGIKQLIDIYYQFGKSVIGTMEVPKEDVSKYGIVAGKEVINGIKI----IESLIEKPSVEEAPSTTAIIGRYVLTPNVFDALRETPIGRGGEIQLTDGLSKLREKEVIYAKDIEGIRHDTGNKLGYIEAIIDFALDRQDLKDEVFKMIK 285
>gi|116333293|ref|YP_794820.1| UDP-glucose pyrophosphorylase [Lactobacillus brevis ATCC 367] >gi|116098640|gb|ABJ63789.1| UDP-glucose pyrophosphorylase [Lactobacillus brevis ATCC 367] (301 aa)
Score = 653, Expect = 1.7e-66, Identities = 139/292 (47%), Positives = 197/292 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K+V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA  SGIEDI+I+  + K SI DHFD   ELE  L+ K+K E  + V+  + M ++++IRQ  P GLG A+  AK FIG+EPF ++LGDD+      S  P  KQ I+ +++   S + V  V HK+ +KYG+I+P E+         V N +EKP+P  +PS+ AI+GRY+ TP IF+ LE T V    E+++T ++ NL + + V+A  +TGKR+D+G+K G+++  +   L  P+ + +L EY+K L
  S:     2 KKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVIVDGKSKRSIEDHFDSNPELEANLEAKHKDEMLRQVKETTGM-NLYFIRQPYPRGLGDAVLTAKAFIGDEPFIVMLGDDM----TDSKVPLTKQLIDRYDQTGASTLAVMRVPHKDTAKYGVINPSEET--APGLYNVTNFVEKPEPDEAPSDLAIIGRYLFTPEIFEALESTPVGLGNELQLTDAIDNLNKTQRVFAHEYTGKRFDVGNKFGWIQTNIAYGLQHPETKTQLREYIKTL 286
>gi|116512178|ref|YP_809394.1| UDP-glucose pyrophosphorylase [Lactococcus lactis subsp. cremoris SK11] >gi|116107832|gb|ABJ72972.1| UDP-glucose pyrophosphorylase [Lactococcus lactis subsp. cremoris SK11] (313 aa)
Score = 653, Expect = 1.8e-66, Identities = 145/289 (50%), Positives = 201/289 (69%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVI-VQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRG-EIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDILI+  + K  I DHFD   ELE+ L +K K E  KLV   +D+ ++H+IRQ  P GLGHA+  AK F+GNEPF ++LGDD++ +  N++  P  K  I  +E+ + S + V +V H++V KYG+IDP  +V     +  V+  +EKP    +PS+ AI+GRY+LTP IF  L ETQV   G EI++T ++  L + + V+A  FTGKRYD+G K+G+++ T++  L  P + D L  Y+
  S:    11 RKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDI-NLHFIRQSHPKGLGHAVLQAKAFVGNEPFVVMLGDDLMNITGNET--PLTKDLINDYEKTHASTIAVMKVPHEDVDKYGVIDPNGEVSKGLYN--VERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVL-ETQVPGAGNEIQLTDAVERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGDNLRNYI 295
>gi|125623944|ref|YP_001032427.1| UDP--glucose-1-phosphate uridylyltransferase [Lactococcus lactis subsp. cremoris MG1363] >gi|14626602|gb|AAK71621.1|AF304368_1 UDP-glucose pyrophosphorylase [Lactococcus lactis subsp. cremoris] >gi|124492752|emb|CAL97707.1| UDP--glucose-1-phosphate uridylyltransferase [Lactococcus lactis subsp. cremoris MG1363] (313 aa)
Score = 653, Expect = 2.1e-66, Identities = 145/289 (50%), Positives = 201/289 (69%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVI-VQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRG-EIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDILI+  + K  I DHFD   ELE+ L +K K E  KLV   +D+ ++H+IRQ  P GLGHA+  AK F+GNEPF ++LGDD++ +  N++  P  K  I  +E+ + S + V +V H++V KYG+IDP  +V     +  V+  +EKP    +PS+ AI+GRY+LTP IF  L ETQV   G EI++T ++  L + + V+A  FTGKRYD+G K+G+++ T++  L  P + D L  Y+
  S:    11 RKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDI-NLHFIRQSHPKGLGHAVLQAKAFVGNEPFVVMLGDDLMNITGNET--PLTKDLINDYEKTHASTIAVMKVPHEDVDKYGVIDPNGEVSKGLYN--VERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVL-ETQVPGAGNEIQLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGDNLKNYI 295
>gi|28377616|ref|NP_784508.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus plantarum WCFS1] >gi|28270449|emb|CAD63351.1| UTP--glucose-1-phosphate uridylyltransferase [Lactobacillus plantarum WCFS1] (306 aa)
Score = 653, Expect = 2.1e-66, Identities = 140/291 (48%), Positives = 201/291 (69%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KAVIPAAG+GTRFLPATKAMPKEMLPI+DKPTIQFIV+EA  SGIEDI+I+  + K SI D++D   ELE+ L+ K+K E  KLV+  +D+ ++++IRQ  P GLG A+  AK F+G+EPF ++LGDD++    +   P  KQ +  +++ + S + V +V H+EVSKYG+I+P  + + +     V N +EKP P  +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A  F G R+D+G K GYLK T++  L+ PDV+ +L  Y+K L
  S:     3 KVRKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVDEARKSGIEDIVIVTGKSKRSIEDYYDSNPELEDNLRAKHKEEMLKLVQETTDI-NLYFIRQSHPRGLGDAVLTAKAFVGDEPFVVMLGDDLM----EDKVPLTKQLMNSYDKTHASTLAVMKVPHEEVSKYGVINP--ESEKEPGLYNVNNFVEKPSPEDAPSDLAIIGRYLLTPEIFDVLENQKPGKGDEIQLTDAIDTLNKTQRVFAHEFKGTRHDVGYKFGYLKTTIEYGLTHPDVKADLRTYIKDL 286
>gi|17546956|ref|NP_520358.1| UTP--glucose-1-phosphate uridylyltransferase protein [Ralstonia solanacearum GMI1000] >gi|17429257|emb|CAD15944.1| probable utp--glucose-1-phosphate uridylyltransferase protein [Ralstonia solanacearum] (289 aa)
Score = 651, Expect = 3.3e-66, Identities = 129/289 (44%), Positives = 197/289 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +ELE  L+ K K    ++VR+I   AH+   Y+RQ E +GLGHA+  A++ +GN PFA++L DD++  N     P +KQ ++L+E  N S++GV+E+E ++   YG++D  P E+       +++  ++EKP P  +PSN  ++GRY+LTP IF  +   +    GE+++T ++ +L   E V A  + G RYD GSK+GYLKAT++++L   +V +E  EY+
  S:     2 QRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKP-AHVDCFYVRQPEALGLGHAVLCAEKLVGNAPFAVILADDLLDGN----PPVMKQMVDLYEHYNCSVIGVEEIEREQSRSYGVVDGRPWEE---DGSVIKMSGIVEKPAPEAAPSNLGVVGRYILTPRIFDHIRNIKPGAGGELQLTDAIQSLLSAEQVLAYRYDGVRYDCGSKLGYLKATVELALKHKEVAEEFREYL 286
>gi|126732874|ref|ZP_01748665.1| UDP-glucose pyrophosphate [Sagittula stellata E-37] >gi|126706650|gb|EBA05724.1| UDP-glucose pyrophosphate [Sagittula stellata E-37] (298 aa)
Score = 651, Expect = 3.5e-66, Identities = 130/299 (43%), Positives = 205/299 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE--GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M K+VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + + S+ K ++ D+FD+  +LE+ LK+K K +   ++++ + D   I YIRQ + +GLGHAI  A++ +GNEPFA++L DDVI     S+KP L+Q +E +EE   ++V   EV  ++   YG++D  E +      ++VK M+EKP+P  +PSN A++GRY+L+P IFK L   Q    GEI++T ++     KE  GVY   F G+R+D GSK G+L+AT+   L++ D+RDEL  Y++ L+ T K
  S:     1 MPKKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHAPQLEQELKKKGKDDLLSILKSTNMDSGEIAYIRQHKALGLGHAIWCARKLVGNEPFAVMLPDDVIA----SEKPCLQQMVEAYEETGGNMVAAMEVPQEKTKAYGVLDVAEDMG---SMVKVKGMVEKPEPKDAPSNLAVIGRYILSPQIFKNLNSKQAGAGGEIQLTDAIAQEIDKEDGGVYGFRFRGQRFDCGSKAGFLQATVAFGLARDDLRDELEGYLQELMSTRK 295
>gi|91781105|ref|YP_556312.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] >gi|91693765|gb|ABE36962.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] (293 aa)
Score = 650, Expect = 3.9e-66, Identities = 127/289 (43%), Positives = 196/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P ++Q IE F+  + S++GV+E+  ++   YG+ID  E  D     +R+  ++EKP+P+++PSN  ++GRYVL P IFK L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+VR E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKP-SHVDCFYVRQSEALGLGHAVLCAEKLVGDNPFAVILADDLL----HGTPPVMRQMIEAFDHYHSSMIGVEEIPSQDTGSYGVIDGSEWGD---SIIRMAGIVEKPEPNVAPSNLGVVGRYVLKPRIFKHLRAIKAGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVRSEFRAYLE 285
>gi|169825208|ref|YP_001692819.1| UTP-glucose-1-phosphate uridylyltransferase [Finegoldia magna ATCC 29328] >gi|167832013|dbj|BAG08929.1| UTP-glucose-1-phosphate uridylyltransferase [Finegoldia magna ATCC 29328] (287 aa)
Score = 650, Expect = 4.0e-66, Identities = 142/289 (49%), Positives = 203/289 (70%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++ KAVIPAAG GTR LPA+K++PKEMLPI DKPT+  IV+E V SGI DILII+S+ K SI D+FD  FELE  L +K+  E    +  +S MA+I+ IRQK+  GLG AI  A+ F+G+EPFAILLGDD+I  N   + P +KQ  +++E +   I+GVQEV  ++V KYGI++ ++  D  T+   V++++EKP    + +N AILGRY++TP IF  L ET+     EI++T +L  LA+K  + A  F GKRYD+G+K+G++KAT+D +L    ++DELLE+++
  S:     2 KIRKAVIPAAGFGTRMLPASKSVPKEMLPIYDKPTLHHIVKEVVDSGITDILIIISKDKGSIEDYFDVNFELEYELNKKSS-EISGEIHELSKMANIYTIRQKKKNGLGDAIKYAESFVGDEPFAILLGDDIIY-NTSDELPCIKQMADIYEREESPILGVQEVSWEDVDKYGIVNGVKTSDRITE---VESLVEKPSREEATTNLAILGRYIVTPDIFPILHETKPGKNNEIQLTDALNKLAEKRKMIAYDFIGKRYDVGNKLGFVKATVDFALHDEKIKDELLEFLR 285
>gi|91773574|ref|YP_566266.1| UDP-glucose pyrophosphorylase [Methanococcoides burtonii DSM 6242] >gi|91712589|gb|ABE52516.1| UDP-glucose pyrophosphorylase [Methanococcoides burtonii DSM 6242] (290 aa)
Score = 650, Expect = 4.0e-66, Identities = 139/288 (48%), Positives = 194/288 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           V KAVIPAAG+GTRFLPATK+MPKEMLPI+DKP I ++VEEA+ASGI+DI+ +  + K +I D+FD   EL+  LK+ +K    K+V +IS M  IHYIRQKEP GLG AI  AK+ I  +PFA+LLGDD+IV    +D P  KQ IE+F++   S + V+EV  ++VS YGII   P++          ++++IEKP    +PSN   +GRYV TP IF  + +T     GEI++T  +  L +++ VYA  F G+RYD G K+GY+KA +D +L   ++   + E++K
  S:     3 VKKAVIPAAGLGTRFLPATKSMPKEMLPIIDKPVIHYVVEEAIASGIDDIIFVTGRSKRAIEDYFDESPELQMHLKEHHKDSLLKMVEDISSMVDIHYIRQKEPRGLGDAIMTAKKHISGDPFAVLLGDDIIV----NDVPCTKQLIEVFQKYRCSTIAVEEVPREKVSSYGIISGKPIDD-----SLCILEDIIEKPSVEEAPSNIGAIGRYVFTPEIFDCINKTSTGVGGEIQLTDGIRLLNEQQKVYAYRFAGQRYDTGDKLGYVKAIVDFALKNEEMAPSIREHIK 283
>gi|184154816|ref|YP_001843156.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus fermentum IFO 3956] >gi|183226160|dbj|BAG26676.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus fermentum IFO 3956] (303 aa)
Score = 650, Expect = 4.7e-66, Identities = 138/292 (47%), Positives = 200/292 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K+V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA  SGIEDI+++  + K SI DHFD   ELE+ L+ K+K E  KLV+  +D+ +I++IRQ  P GLG A+  A+ FIG+EPF ++LGDD+   N  ++ P  K+ I  +EE   S + V  V H++ +KYG+I+P ++V        V + +EKP+P  +PS+ AI+GRYV TP IF  L +T+     EI++T ++  L + + V+A  + G RYD+G+K G+++  ++  L  P+ +DEL EY+K L
  S:     2 KQVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEARKSGIEDIVVVDGKNKRSIEDHFDSNPELEDNLRDKHKDEMLKLVQETTDI-NIYFIRQSHPRGLGDAVLTARDFIGDEPFVVMLGDDLNNINGDAE-PLTKELINSYEETGASTLAVMRVPHEDTAKYGVINPSKEV--MPGLYNVTSFVEKPEPKDAPSDLAIIGRYVFTPEIFDVLAKTKPGKGNEIQLTDAINTLNKTQRVFAHEYKGHRYDVGNKFGWIETNIEYGLKHPETKDELREYIKDL 289
>gi|15673321|ref|NP_267495.1| UTP-glucose-1-phosphate uridylyltransferase [Lactococcus lactis subsp. lactis Il1403] >gi|12724321|gb|AAK05437.1|AE006366_6 UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) [Lactococcus lactis subsp. lactis Il1403] (313 aa)
Score = 650, Expect = 4.7e-66, Identities = 144/289 (49%), Positives = 200/289 (69%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVI-VQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRG-EIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDILI+  + K  I DHFD   ELE+ L +K K E  KLV   +D+ ++H+IRQ  P GLGHA+  AK F+GNEPF ++LGDD++ +  N++  P  K  I  +E+ + S + V +V H +V KYG+IDP  +V     +  V+  +EKP+   +PS+ AI+GRY+LTP IF  L ETQV   G EI++T ++  L + + V+A  FTGKRYD+G K+G+++ T++  L  P +   L  Y+
  S:    11 RKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDI-NLHFIRQSHPKGLGHAVLQAKAFVGNEPFVVMLGDDLMNITGNET--PLTKDLINDYEKTHASTIAVMKVPHDDVDKYGVIDPNGEVSKGLYN--VERFVEKPNVDEAPSDLAIIGRYLLTPEIFDVL-ETQVPGAGNEIQLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGANLKNYI 295
>gi|104773674|ref|YP_618654.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422755|emb|CAI97388.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (304 aa)
Score = 649, Expect = 5.3e-66, Identities = 138/288 (47%), Positives = 198/288 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHI----HYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQFIVEEA+ASGIEDILII  + K +I DHFD   ELE+ L +K+K    KL R  + M++I    ++ RQ  P GLG A+N A+ FI  EPF ++LGDD++    +   P  KQ I+ + E + S + V +V ++EV+KYG+IDP+ +         VK  +EKPD   +PS+ AI+GRY+LTP IF  L++ +    GEI++T ++  L + + V+A  F G+R+D+G+K GY++ ++   L  P+ +D L +Y+
  S:     2 KVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRSKRAIEDHFDSNTELEDNLTEKHKDALLKLARETT-MSNIKVNLYFTRQPHPNGLGDAVNRARSFIAGEPFVVMLGDDLM----RDKTPLTKQLIDCYHETHASTIAVMKVPNEEVNKYGVIDPIGET--APDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDALNKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYI 286
>gi|110602364|ref|ZP_01390471.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter sp. FRC-32] >gi|110546922|gb|EAT60241.1| UTP-glucose-1-phosphate uridylyltransferase [Geobacter sp. FRC-32] (291 aa)
Score = 649, Expect = 6.4e-66, Identities = 130/289 (44%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATK+ PKEMLP++DKP +Q++VEEAVASGIE IL +  + K +I DHFD  FELE  L  K K  +   +R+I++M +I Y+RQK+ +GLGHAI  AK FIGNEPFA+LLGDD+I       KP L Q +E++ +    ++ +++V  + +S YG +       +  +   V +M+EKP    +PS+ AI+GRY+LTP IF  LE+ +    GEI++T ++  LA+ E +Y   F G R+D G K+G+LKAT+D++L + +   +   +++
  S:     2 QVKKAVFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRSKRAIEDHFDISFELESLLYDKGKDAELSQIRDIAEMMNIFYVRQKQALGLGHAILCAKEFIGNEPFAVLLGDDII----DGKKPCLGQLLEVYRKYRGPVLALEQVPMENISSYGCV---AANTISDRIYEVVDMVEKPKQEDAPSDLAIIGRYILTPDIFPILEKQEPGKGGEIQLTDAIKKLAKDEAIYGCRFEGIRHDCGDKLGFLKATVDMALKREEFNGDFERFLR 283
>gi|116754385|ref|YP_843503.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Methanosaeta thermophila PT] >gi|116665836|gb|ABK14863.1| UDP-glucose pyrophosphorylase [Methanosaeta thermophila PT] (304 aa)
Score = 647, Expect = 8.6e-66, Identities = 135/292 (46%), Positives = 192/292 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           + KAVIPAAG GTRFLP T+A PKEMLP++DKP IQ++VEEA++SGIEDILII  + K +I DHFD   ELE+ L QKN  + Y   R ISD+A IHYIRQKEP GLG AI  A+R    EPFA+LLGD + V  N S+ P   Q I+ +++ + +IV V+ V   ++  YGIID      L+    ++ +++EKP P ++PS+   +GRY+L P IF  L   +    GEI++T +L       G+  +    +RYDIG KI ++K++L+++L++ +  DEL  +MK L++
  S:    19 IRKAVIPAAGQGTRFLPITRAQPKEMLPVVDKPVIQYVVEEAISSGIEDILIITGRGKRAIEDHFDVSCELEKTLLQKNDAKLYDQYRRISDLADIHYIRQKEPRGLGDAILHAERHCDGEPFAVLLGDTITVPYNGSE-PCTSQMIKFYKKYHSTIVAVERVPKNKIQDYGIID---GTLLEDGVYKITDIVEKPSPEVAPSDLGAIGRYILMPEIFDILRTIKPGHGGEIQLTDALKCCGDAIGLVTRC---RRYDIGDKISWMKSSLELALARDEFADELRRFMKSLLK 303
>gi|89067375|ref|ZP_01154888.1| UDP-glucose pyrophosphate [Oceanicola granulosus HTCC2516] >gi|89046944|gb|EAR52998.1| UDP-glucose pyrophosphate [Oceanicola granulosus HTCC2516] (297 aa)
Score = 647, Expect = 9.1e-66, Identities = 130/297 (43%), Positives = 198/297 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSL-LNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M +RVTKAV P AG+GTRFLPATKA+PKE++ ++D+P IQ+ ++EA A+GI + + + S+ K+++ D+FD   ELE  LK+K K + Y+++++ + +   I YIRQ + +GLGHA+  A+R +G+EPFA++L DDVI     +DKP L+Q +E  EE    +V   EV  ++ S YGI+D  + +      + VK M+EKP    +PSN A++GRY+LTP I K L E      GEI++T ++ + +     VY   F G+R+D GSK G+L+AT+   L++PD+RDEL +Y+  L  T
  S:     1 MSQRVTKAVFPVAGLGTRFLPATKALPKEIMTLVDRPLIQYAIDEARAAGISEFIFVTSRGKSALEDYFDCAPELETALKEKGKDDLYEVLQSTNMESGQIAYIRQHQALGLGHAVWCARRLVGDEPFAVILPDDVIA----ADKPCLQQMVEAHEETGGCMVAAMEVPREKTSSYGILDCKDDMG---SLVSVKGMVEKPKAEDAPSNLAVIGRYILTPQIMKNLNEVDRGAGGEIQLTDAIAMEINSARDVYGYRFQGERFDCGSKAGFLQATVAFGLARPDLRDELSQYLDELSST 292
>gi|161507988|ref|YP_001577953.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus helveticus DPC 4571] >gi|160348977|gb|ABX27651.1| UTP-glucose-1-phosphate uridylyltransferase [Lactobacillus helveticus DPC 4571] (291 aa)
Score = 647, Expect = 1.0e-65, Identities = 139/291 (47%), Positives = 197/291 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+IPAAG+GTRFLPATKAMPKEMLPI+DKPTIQFIVEEA ASGIEDILI+  + K +I +HFD   ELE+ L++  K    KL + I+D+  +++Y RQ  P GLG A+  A+ F+  EPF I+LGDD++    +   P  KQ I  +++ + S + V +V HKEVSK+G+I P    ++      VKN +EKP    +PS+ AI+GRY+LTP IF  LE  +    GEI++T ++  + + + V+A VF G+R+D+G+K GYL+ ++   L  P+ RD L +Y+K L
  S:     2 KVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAKASGIEDILIVTGKNKRAIENHFDSNPELEQDLEKTGKSGLLKLTQEITDLGVNVYYTRQPYPAGLGDAVYRARSFVAGEPFVIMLGDDLM----KDKVPLTKQLINDYDKTHASTIAVMKVPHKEVSKFGVIAP--DGNIAPDLYNVKNFVEKPAVDKAPSDLAIIGRYLLTPEIFDILEHQKPGRGGEIQLTDAIDTMNKTQRVFAHVFKGERFDVGNKEGYLETSIQYGLIHPETRDALRKYIKEL 287
>gi|15678662|ref|NP_275777.1| UTP--glucose-1-phosphate uridylyltransferase [Methanothermobacter thermautotrophicus str. Delta H] >gi|2621716|gb|AAB85140.1| UTP--glucose-1-phosphate uridylyltransferase [Methanothermobacter thermautotrophicus str. Delta H] (285 aa)
Score = 645, Expect = 1.4e-65, Identities = 142/290 (48%), Positives = 197/290 (67%)
  Q:     7 KAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFI-GNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           KAVIPAAG+GTRFLPATKA PKEMLP+ DKPTIQ++VEEAVASGI+DILII  + K SI DHFD  FELE  L++ NK+     V  ISD+A I+++RQKE  GLG AI  A++ I G + FA+LLGD +      S  P  +Q ++++E    S + V+EV   +V +YGIID  E+V     S+R  +M+EKP  + +PSN AI+GRYVL   IF  + E      GEI++T ++  L   E VY  VF G+ YDIG+++ +LK +L+ +++  ++R EL+EY+K L++
  S:     2 KAVIPAAGLGTRFLPATKAQPKEMLPVFDKPTIQYVVEEAVASGIDDILIITGKGKRSIEDHFDRSFELEYFLRKNNKMNYLDEVEAISDLADIYFVRQKEQKGLGDAIYCARKHIDGEDAFAVLLGDTI----TSSGVPCTRQLMDIYERYGASAIAVEEVPRDKVERYGIIDG-EEVSEGIYSIR--DMVEKPPVTEAPSNLAIMGRYVLESEIFDHIREVPPGFGGEIQLTDAMRCL---EEVYGCVFRGRTYDIGNRVDWLKTSLEFAMNDDEIRPELIEYLKNLID 282
>gi|50954369|ref|YP_061657.1| UTP-glucose-1-phosphate uridylyltransferase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950851|gb|AAT88552.1| UTP-glucose-1-phosphate uridylyltransferase [Leifsonia xyli subsp. xyli str. CTCB07] (323 aa)
Score = 645, Expect = 1.7e-65, Identities = 129/292 (44%), Positives = 194/292 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYG--IIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M   VTKAVIPAAG+GTRFLPATKAMPKEMLP++DKP IQ++VEEAV +G+ D+L+I  + KN++ +HFD   ELE+ L +K   +  + V   + +A +HY+RQ +P GLGHA+  AK  +G EPFA+LLGDD+I     +    L++ + +  E N ++V + EV+   +  YG   ++P  + D+    +R+  ++EKPD   +PSNYAI+GRY+L P +F  LE T+    GEI++T +L  +A       GVY  VF G+RYD G ++ Y+KA + ++  + D+  EL  +++
  S:     1 MATSVTKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVEAGLHDVLMITGRNKNALENHFDRNAELEDTLTKKGDTDRLRKVNYSTSLADMHYVRQGDPKGLGHAVLRAKMHVGREPFAVLLGDDII----DARDDLLRRMLRVQHEHNTTVVALMEVDPDSIHLYGAAAVEPTGEDDV----VRITGLVEKPDKEDAPSNYAIIGRYILRPEVFDVLERTEPGRGGEIQLTDALQAMAHAPDWTGGVYGVVFRGRRYDTGDRLDYIKAIVQLAADRDDLGPELRPWLR 290
>gi|86159887|ref|YP_466672.1| UDP-glucose pyrophosphorylase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85776398|gb|ABC83235.1| UDP-glucose pyrophosphorylase [Anaeromyxobacter dehalogenans 2CP-C] (289 aa)
Score = 645, Expect = 1.8e-65, Identities = 136/294 (46%), Positives = 201/294 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKP--DPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K++ KAVIPAAG+GTRFLPATKA+PKE+LPI+D PTIQ+IV EAVA+G+ DI++I ++ K+SI+DHFD   ELE+RL++  K E  K +R I+ MA++  IRQ+EP+GLGHA+  A+  IG+EPF ++LGDD+I     +  P  KQ  + +E   +  V + EV  ++   YGI        + ++++R++ ++EKP  DP   PSN A++GRYVL P IF+ LE  +    GEI++T +L  LA++EG+    F G+RYD G + GYLKA +  ++ +P++   L   MK LV+
  S:     4 KKIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDIILICARGKDSIVDHFDIAGELEDRLEKAGKHELRKQMREIAHMANVLTIRQQEPLGLGHAVLCARDAIGDEPFVVMLGDDII----DAPVPGAKQLADCWERHGLGTVALMEVPREDTPMYGIA---AGQAMDSRTVRIERLVEKPKADP---PSNLAVIGRYVLPPRIFEILERVKPGVGGEIQLTDALAVLAREEGLLGYRFEGERYDAGDRFGYLKANILYAMKRPELAGPLRALMKELVK 289
>gi|170692477|ref|ZP_02883640.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia graminis C4D1M] >gi|170142907|gb|EDT11072.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia graminis C4D1M] (304 aa)
Score = 643, Expect = 2.5e-65, Identities = 124/295 (42%), Positives = 194/295 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETN 298
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ +NK +   LVR+I        Y+RQ E +GLGHA+  A++ +G  PFA++L DD++     S KP + Q ++ F   + S++GV+ +  ++   YG++D  E  D     +++  ++EKP P  +PSN  ++GRYVL P+IFK +   +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++ +L  P+V+DE   Y++  ++ N
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEKLVGQSPFAVILADDLL----HSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWED---NVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLTEEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKDEFGAYLQAYLQAN 291
>gi|167456962|ref|ZP_02323178.1| UTP-glucose-1-phosphate uridylyltransferase [Anaeromyxobacter dehalogenans 2CP-1] >gi|167416785|gb|EDR83496.1| UTP-glucose-1-phosphate uridylyltransferase [Anaeromyxobacter dehalogenans 2CP-1] (289 aa)
Score = 643, Expect = 2.6e-65, Identities = 137/294 (46%), Positives = 201/294 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI-----IDPLEQVDLKTQSMRVKNMIEKP--DPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K++ KAVIPAAG+GTRFLPATKA+PKE+LPI+D PTIQ+IV EAVA+G+ DI++I ++ K+SI+DHFD   ELE+RL++  K E  + +R I+ MA++  IRQ+EP+GLGHA+  A+  IG+EPF ++LGDD+I     +  P  KQ  + +E   +  V + EV  ++   YGI     +DP        +++R+  ++EKP  DP   PSN A++GRYVL P IF+ LE  +    GEI++T +L  LA++EG+    F G+RYD G + GYLKA +  ++ +P++   L   MK LV+
  S:     4 KKIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDIILICARGKDSIVDHFDIAAELEDRLEKAGKRELRRQMREIAQMANVLTIRQQEPLGLGHAVLCARDAIGDEPFVVMLGDDII----DAQVPGAKQLADCWERHGLGTVALMEVPREDTHMYGIAAGQAMDP--------RTVRIDRLVEKPKADP---PSNLAVIGRYVLPPRIFEILERVKPGVGGEIQLTDALAVLAREEGLLGYQFEGERYDAGDRFGYLKANILYAMKRPELAGPLRALMKELVK 289
>gi|186477228|ref|YP_001858698.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phymatum STM815] >gi|184193687|gb|ACC71652.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phymatum STM815] (310 aa)
Score = 643, Expect = 3.1e-65, Identities = 126/287 (43%), Positives = 189/287 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           + KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L  + K+   +LV+NI   +H+   Y+RQ EP+GLGHA+  A++ +G+EPFA++L DD++      + P L Q + LF   + SIVGV+E++ +E   YG+ID     D   +  ++  ++EKP P  +PSN  ++GRYVL P+IF  L   Q    GEI++T ++  L   E   A  + G+R+D GSK+GYLKAT++ +L  P+V+D    Y+
  S:     4 IRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVECELLARGKLALLELVQNIKP-SHVECCYVRQPEPLGLGHAVLCAEKLVGDEPFAVILADDLL----DGEPPVLSQMVSLFNHYHCSIVGVEEIDKQESRSYGVIDGKRWDD---RLFKMSGIVEKPAPEDAPSNLGVVGRYVLMPAIFDRLRRQQAGAGGEIQLTDAIQALLGSEQALAYQYVGRRFDCGSKLGYLKATVEFALRHPEVKDAFDAYL 284
>gi|29830216|ref|NP_824850.1| UTP:glucose-1-phosphate uridylyltransferase [Streptomyces avermitilis MA-4680] >gi|29607327|dbj|BAC71385.1| putative UTP:glucose-1-phosphate uridylyltransferase [Streptomyces avermitilis MA-4680] (300 aa)
Score = 642, Expect = 3.2e-65, Identities = 132/292 (45%), Positives = 197/292 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI--IDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG----VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           R+TKAVIPAAG+GTRFLPATKA PKEMLP++DKP IQ++VEEAV++G++D+L+I  + K  + DHFD  +ELE  L++K        V+  SD+A +HY+RQ +P GLGHA+  A   +G EPFA+LLGDD+I        P L + +E+ E++  S++ + EV  +++  YG   ++  ++ DL    ++V +++EKPDP+ +PSNYAI+GRYVL P IF  L +T+    GEI+IT +L  LA  E     V+  VF G+RYD G +  YL+A + ++  + D+  E   +++  V
  S:     7 RITKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVSAGLDDVLMITGRNKRPLEDHFDRNYELESALQKKGDASRLAKVQESSDLATMHYVRQGDPKGLGHAVLCAAPHVGREPFAVLLGDDLI----DPRDPLLARMVEVQEQRGGSVIALMEVAPEQIHLYGCAAVEATDEGDL----VKVTDLVEKPDPADAPSNYAIIGRYVLDPHIFDILRKTEPGRGGEIQITDALQQLAADEKVGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPEFRTWLRSYV 296
>gi|163790723|ref|ZP_02185150.1| UTP-glucose-1-phosphate uridylyltransferase [Carnobacterium sp. AT7] >gi|159874024|gb|EDP68101.1| UTP-glucose-1-phosphate uridylyltransferase [Carnobacterium sp. AT7] (294 aa)
Score = 642, Expect = 3.4e-65, Identities = 139/288 (48%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +V KAVIPAAG+GTRFLPATKA  KEMLPI+DKPTIQFI+EEA+ SGIE+ILI+  + K SI DHFD  FELE+ L+ K K E  KLV + + +  +H++RQ  P GLG A+   K F+GNEPF +LLGDD++V     D P  KQ +  ++E   S++    V HK+ SKYGI+D   +V       +V + +EKP P  +PS+ AI+GRY+LTP IF  LE+ +     EI++T ++  L +K+ V A  F GKRYD+G K GY+   ++  L   +++D L EY+
  S:     3 KVRKAVIPAAGLGTRFLPATKATAKEMLPIVDKPTIQFIIEEAIDSGIEEILIVTGRSKRSIEDHFDSNFELEQNLQMKEKYELLKLVESTTKI-KLHFVRQSYPKGLGDAVLHGKSFVGNEPFIVLLGDDLMV----DDVPLTKQLMNHYDETGSSVLATMRVPHKDTSKYGIVDIDGEV--SKDLYKVNHFVEKPKPEEAPSDLAIIGRYLLTPEIFDILEKQEPGAGNEIQLTDAIETLNKKQQVLALEFKGKRYDVGDKFGYMMTNIEYGLEHKEIKDNLKEYI 283
>gi|163766926|ref|ZP_02173946.1| UTP-glucose-1-phosphate uridylyltransferase [Anaeromyxobacter sp. K] >gi|196173793|gb|ACG74766.1| UTP-glucose-1-phosphate uridylyltransferase [Anaeromyxobacter sp. K] (289 aa)
Score = 642, Expect = 3.5e-65, Identities = 138/294 (46%), Positives = 201/294 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI-----IDPLEQVDLKTQSMRVKNMIEKP--DPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K++ KAVIPAAG+GTRFLPATKA+PKE+LPI+D PTIQ+IV EAVA+G+ DI++I ++ K+SI+DHFD   ELE+RL++  K E  K +R I+ MA++  IRQ+EP+GLGHA+  A+  IG+EPF ++LGDD+I     +  P  KQ  + +E   +  V + EV  ++   YGI     +DP        +++R+  ++EKP  DP   PSN A++GRYVL P IF+ LE  +    GEI++T +L  LA++EG+    F G+RYD G + GYLKA +  ++ +P++   L   MK LV+
  S:     4 KKIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDIILICARGKDSIVDHFDIAAELEDRLEKAGKRELRKQMREIAQMANVLTIRQQEPLGLGHAVLCARDAIGDEPFVVMLGDDII----DAPVPGAKQLADCWERHGLGTVALMEVPREDTHMYGIAAGQAMDP--------RTVRIDRLVEKPKADP---PSNLAVIGRYVLPPRIFEILERVKPGVGGEIQLTDALAVLAREEGLLGYQFEGERYDAGDRFGYLKANILYAMKRPELAGPLRALMKELVK 289
>gi|153887735|ref|ZP_02008884.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Ralstonia pickettii 12D] >gi|151575849|gb|EDN40256.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Ralstonia pickettii 12D] (290 aa)
Score = 642, Expect = 4.0e-65, Identities = 126/289 (43%), Positives = 195/289 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +ELE  L+ K K    ++VR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++      D P +KQ ++L+E  N S++GV+E++  +   YG++D  P E+       +++  ++EKP P  +PSN  ++GRY+LTP IF  +   +    GE+++T ++ +L   E V A  + G RYD GSK+GYLKAT++++L   +V DE   Y+
  S:     2 QRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKP-SHVDCFYVRQPEALGLGHAVQCAEKLVGDSPFAVILADDLL----DGDPPVMKQMVDLYEHYNCSVIGVEEIDPVQSRSYGVVDGRPWEE---DGSVIKMSGIVEKPAPENAPSNLGVVGRYILTPRIFDHIRNLKPGAGGELQLTDAIQSLLSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVADEFRAYL 286
>gi|73540565|ref|YP_295085.1| UDP-glucose pyrophosphorylase [Ralstonia eutropha JMP134] >gi|72117978|gb|AAZ60241.1| UDP-glucose pyrophosphorylase [Ralstonia eutropha JMP134] (298 aa)
Score = 642, Expect = 4.1e-65, Identities = 127/292 (43%), Positives = 189/292 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M+ RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  FELE  L+ KNK     +VR+I       +Y+RQ E +GLGHA+  A + +G  PFA++L DD+I        P +KQ ++L+   N S++GV+E+  ++   YG++D  E        +++  ++EKP P  +PSN  ++GRY+LTP IF  L E +    GE ++T ++ +L  +E V A  + G RYD GSK+GYLKAT++ +L  P+V     +Y++
  S:     1 MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECYYVRQPEALGLGHAVLCAAKLVGEAPFAVMLADDLI----DGTPPVMKQMVDLYNHYNCSVLGVEEIAPEQSRSYGVVDGRE---WDEGVIKMSGIVEKPAPEDAPSNLGVVGRYILTPRIFDHLRELKPGAGGEFQLTDAIQSLLSQEQVLAYRYHGTRYDCGSKLGYLKATVEYALKHPEVSAGFRDYLE 286
>gi|148983763|ref|ZP_01817082.1| glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP3-BS71] >gi|2501469|sp|Q54800|CAP3C_STRPN UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|695746|emb|CAA87405.1| glucosephosphate uridylyltransferase [Streptococcus pneumoniae] >gi|147923910|gb|EDK75022.1| glucose-1-phosphate uridylyltransferase [Streptococcus pneumoniae SP3-BS71] >gi|1586510|prf||2204223F UDP-glucose pyrophosphorylase (306 aa)
Score = 642, Expect = 4.1e-65, Identities = 126/289 (43%), Positives = 192/289 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+V KAVIPAAG+GTRFLPATKA+ KEMLPI+D+PTI F++EEA+ SGIEDIL++  + K SI D+FD  FELE  L+++ K+E  K V   +D+  +H++RQ  P GLG A+  AK F+G++PF ++LGDD++   + +  P  +Q ++ +     S + V  V +++VS YG+I P  +++       V   +EKP P  +PSN AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ F GKRYD+G K  ++K ++D +L  P +++ L  Y+
  S:     2 KKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDRPTIHFVIEEALRSGIEDILVVTGKSKRSIEDYFDSTFELEYSLRKQGKMELLKSVNESTDI-KVHFVRQSSPRGLGDAVLQAKSFVGDDPFVVMLGDDLMDITDSTAVPLTRQLMDDYNATQASTIAVMPVRYEDVSSYGVISP--RLESSNGLYSVDAFVEKPKPEEAPSNLAIIGRYLLTPEIFSILETQKPGAGNEIQLTDAIDTLNKTQSVFAREFVGKRYDVGDKFNFMKTSIDYALQHPQIKESLKNYV 287
>gi|86136823|ref|ZP_01055401.1| UDP-glucose pyrophosphate [Roseobacter sp. MED193] >gi|85826147|gb|EAQ46344.1| UDP-glucose pyrophosphate [Roseobacter sp. MED193] (300 aa)
Score = 641, Expect = 4.2e-65, Identities = 118/299 (39%), Positives = 207/299 (69%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLL-NLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M+K+VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + + S+ K ++ D+FD+   LE+ L++K K    +++++ + D   I Y+RQ+  +GLGHA+  A+R I NEPFA++L DDVI     +DKP L+Q +E +EE   ++V   EV  ++ + YG++DP    +     +  + M+EKPDP+ +PSN A++GRY+L+PS+ + L + +    GEI++T ++  ++A +   +   F G+RYD GSK G+L+AT+  +LS+P++RD+L+ ++  + + +K
  S:     1 MRKKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHSPVLEQELRKKGKDALLEILKDTNMDSGAIAYLRQRRALGLGHAVWCARRLIANEPFAVILPDDVIA----ADKPCLQQMVEAYEELGGNMVATMEVSPEQTASYGVLDPSAGAETSGAVVAARGMVEKPDPAEAPSNLAVIGRYILSPSVLRNLNKMKSGAGGEIQLTDAIAEDIATEVPTHGFRFKGERYDCGSKAGFLQATVSFALSRPELRDDLMAHLHKVTQLDK 297
>gi|83746528|ref|ZP_00943579.1| UTP--glucose-1-phosphate uridylyltransferase [Ralstonia solanacearum UW551] >gi|83726859|gb|EAP73986.1| UTP--glucose-1-phosphate uridylyltransferase [Ralstonia solanacearum UW551] (290 aa)
Score = 641, Expect = 4.5e-65, Identities = 127/289 (43%), Positives = 196/289 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +ELE  L+ K K    ++VR+I   +H+   Y+RQ E +GLGHA+  A++ +GN PFA++L DD++  N     P +KQ ++L++  N S++GV+E+E ++   YG++D  P E+       +++  ++EKP P  +PSN  ++GRY+LTP IF  +   +    GE+++T ++ +L   E V A  + G RYD GSK+GYLKAT++++L   +V  E  EY+
  S:     2 QRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVGNAPFAVILADDLLDGN----PPVMKQMVDLYDHYNCSVIGVEEIEREQSRSYGVVDGRPWEE---DGSVIKMSGIVEKPAPENAPSNLGVVGRYILTPRIFDHIRNIKPGAGGELQLTDAIQSLLSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVAAEFREYL 286
>gi|167580752|ref|ZP_02373626.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis TXDOH] >gi|167618856|ref|ZP_02387487.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis Bt4] (294 aa)
Score = 640, Expect = 5.5e-65, Identities = 126/288 (43%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F   + S++GV+E+  ++   YG+ID     D      ++  ++EKPDP+ +PSN+ ++GRYVLTP IF  L   +    GE+++T +L +L + E V A  + G R+D GSKIGYLKAT++ +L  P+V  E   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPR-HVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVILADDLL----DGRPPVLRQMIDVFNHYHTSVIGVEEIAPQDSKSYGVIDGKRWED---DLFKLSGIVEKPDPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGTRFDCGSKIGYLKATVEFALRHPEVATEFERYL 284
>gi|83719064|ref|YP_441910.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis E264] >gi|83652889|gb|ABC36952.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis E264] (293 aa)
Score = 640, Expect = 5.5e-65, Identities = 126/288 (43%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F   + S++GV+E+  ++   YG+ID     D      ++  ++EKPDP+ +PSN+ ++GRYVLTP IF  L   +    GE+++T +L +L + E V A  + G R+D GSKIGYLKAT++ +L  P+V  E   Y+
  S:     2 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPR-HVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVILADDLL----DGRPPVLRQMIDVFNHYHTSVIGVEEIAPQDSKSYGVIDGKRWED---DLFKLSGIVEKPDPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGTRFDCGSKIGYLKATVEFALRHPEVATEFERYL 283
>gi|163840494|ref|YP_001624899.1| UTP--glucose-1-phosphate uridylyltransferase [Renibacterium salmoninarum ATCC 33209] >gi|162953970|gb|ABY23485.1| UTP--glucose-1-phosphate uridylyltransferase [Renibacterium salmoninarum ATCC 33209] (300 aa)
Score = 640, Expect = 5.6e-65, Identities = 131/290 (45%), Positives = 194/290 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +R+ KAVIPAAG+GTRFLPATKAMPKEMLP++DKP IQ++V+EAV +G+ED+L+I  + K ++ DHFD    +E  L+ K   E  + V++ +D+  IHY+RQ +P GLGHA+  AK  +G+EPFA+LLGDD+I + ++     L   +E+ E    S++ + EVE   +S YG +D  P++  D     +RV  ++EKP    +PSN A++GRYVL P +F+ LE T     GEI++T +L  LA  E    GVY  VF+G+RYD G K+ YL+A + +     ++  +L  ++K
  S:     5 QRIRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVQEAVDAGLEDVLMITGRNKRALEDHFDRVPNIERLLEAKGDAERLEAVQHATDLGEIHYVRQGDPKGLGHAVLRAKTHVGDEPFAVLLGDDLIDERDE----LLSTMLEVQESTGGSVIALIEVEPARISAYGCVDMTPIDGKDY----VRVNELVEKPAVEDAPSNLAVIGRYVLHPRVFEVLENTLPGRGGEIQLTDALQTLATSEGEGSGVYGVVFSGRRYDTGDKLSYLQAVVTLGCENAELGPDLRAWLK 292
>gi|91783590|ref|YP_558796.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] >gi|91687544|gb|ABE30744.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] (305 aa)
Score = 640, Expect = 6.1e-65, Identities = 124/295 (42%), Positives = 195/295 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETN 298
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ +NK +   LVR+I        Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++     S KP + Q ++ F   + S++GV+ +  ++   YG++D  E  D     +++  ++EKP P  +PSN  ++GRYVL P+IFK +   +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++ +L  P+V+ E   Y++  ++TN
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEKLVGDSPFAVILADDLL----HSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWED---NVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLTEEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKAEFEAYLQAYMQTN 291
>gi|89994185|emb|CAI32748.2| glucosephosphate uridylyltransferase [Streptococcus pneumoniae] (306 aa)
Score = 640, Expect = 6.6e-65, Identities = 126/289 (43%), Positives = 192/289 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+V KAVIPAAG+GTRFLPATKA+ KEMLPI+D+PTI F++EEA+ SGIEDIL++  + K SI D+FD  FELE  L+++ K+E  K V   +D+  +H++RQ  P GLG A+  AK F+G++PF ++LGDD++   + +  P  +Q ++ +     S + V  V +++VS YG+I P  +++       V   +EKP P  +PSN AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ F GKRYD+G K  ++K ++D +L  P +++ L  Y+
  S:     2 KKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDRPTIHFVIEEALRSGIEDILVVTEKSKRSIEDYFDSTFELEYSLRKQGKMELLKSVNESTDI-KVHFVRQSSPRGLGDAVLQAKSFVGDDPFVVMLGDDLMDITDSTAVPLTRQLMDDYNATQASTIAVMPVRYEDVSSYGVISP--RLESSNGLYSVDAFVEKPKPEEAPSNLAIIGRYLLTPEIFSILETQKPGAGNEIQLTDAIDTLNKTQSVFAREFVGKRYDVGDKFNFMKTSIDYALQHPQIKESLKNYV 287
>gi|187929521|ref|YP_001900008.1| UTP-glucose-1-phosphate uridylyltransferase [Ralstonia pickettii 12J] >gi|187726411|gb|ACD27576.1| UTP-glucose-1-phosphate uridylyltransferase [Ralstonia pickettii 12J] (290 aa)
Score = 640, Expect = 7.0e-65, Identities = 125/289 (43%), Positives = 197/289 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +RVTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +ELE  L+ K+K    ++VR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++      D P +KQ ++L++  N S++GV+E++  +   YG++D  P E+       +++  ++EKP P  +PSN  ++GRY+LTP IF+ +   +    GE+++T ++ +L   E V A  + G RYD GSK+GYLKAT++++L   +V DE   Y+
  S:     2 QRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAYELEAELEAKHKTALLEVVRSIKP-SHVDCFYVRQPEALGLGHAVQCAEKLVGDAPFAVILADDLL----DGDPPVMKQMVDLYDHYNCSVIGVEEIDPVQSRSYGVVDGRPWEE---DGSVIKMSAIVEKPAPENAPSNLGVVGRYILTPRIFEHIRNLKPGAGGELQLTDAIQSLLSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVADEFRAYL 286
>gi|94264676|ref|ZP_01288458.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [delta proteobacterium MLMS-1] >gi|94266524|ref|ZP_01290212.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [delta proteobacterium MLMS-1] >gi|94268710|ref|ZP_01291261.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [delta proteobacterium MLMS-1] >gi|93451493|gb|EAT02322.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [delta proteobacterium MLMS-1] >gi|93452853|gb|EAT03373.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [delta proteobacterium MLMS-1] >gi|93454907|gb|EAT05151.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [delta proteobacterium MLMS-1] (292 aa)
Score = 639, Expect = 7.3e-65, Identities = 142/292 (48%), Positives = 203/292 (69%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M  +V KAVIP AG GTRFLPA+KA+PKEML I+D+PTIQ+IVEE VASGIE I+ + S+ K++I +HFDY FEL+  LK+KNK +    V++IS++  I  +RQK+P+GLGHAI  A+  +GNEPF +LL  D +V ++QS  P  +Q ++L+E+   SIV +Q V  +EV++YGI+   E   L+ +  +V+ M+EKP P  + S+ AI+GRY+L P IF  LE+T     GEI++T +LL LA+K  +YA  F G RYD G K+GYLKA +  +L  P +  E  ++++
  S:     1 MITKVRKAVIPVAGFGTRFLPASKAIPKEMLTIVDRPTIQYIVEEVVASGIELIIFVTSEGKSAIENHFDYDFELDTLLKEKNKRDLRDEVQHISNLIDIIAVRQKKPLGLGHAIWSARNVVGNEPFLVLL-GDDLVLSDQS--PCCRQMLDLYEDLGESIVAIQRVAPEEVNQYGIV---EGTPLRERVHQVQRMVEKPTPGTTDSDLAIIGRYLLQPDIFSLLEKTTPGHGGEIQLTDALLALAKKRPMYAYEFEGTRYDAGDKLGYLKAIVAFALRHPTLGKEFRQHLQ 286
>gi|167837700|ref|ZP_02464583.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis MSMB43] (294 aa)
Score = 639, Expect = 7.8e-65, Identities = 126/288 (43%), Positives = 192/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F   + S++GV+E+  ++   YG+ID     D      ++  ++EKP+P+ +PSN+ ++GRYVLTP IF  L   +    GE+++T +L +L + E V A  + G+R+D GSKIGYLKAT++ +L  P+V  E  +Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRGIKPR-HVDCFYVRQAEALGLGHAVLCAEKLVGDSPFAVILADDLL----DGRPPVLRQMIDVFNHYHTSVIGVEEIAPQDSKSYGVIDGKRWED---DLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGRRFDCGSKIGYLKATVEFALRHPEVATEFEQYL 284
>gi|82701781|ref|YP_411347.1| UTP-glucose-1-phosphate uridylyltransferase [Nitrosospira multiformis ATCC 25196] >gi|82409846|gb|ABB73955.1| UDP-glucose pyrophosphorylase [Nitrosospira multiformis ATCC 25196] (294 aa)
Score = 638, Expect = 9.5e-65, Identities = 129/288 (44%), Positives = 189/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           ++ KAV P AGMGTRFLPATKA PKEM+P++DKP IQ+ VEEA+A+GI +++ I  ++K +I DHFD  +E+E  L+ + K E  +++R+I     H  YIRQ E +GLGHAI  A+  +GN+PFA+LL DD++V     D+P ++Q  +++EE   SI+ VQ VE ++   YGI+     ++       +  ++EKP P  +PS   ++GRY+LTP IF+ LE  Q    GEI++T  + +L ++E   A  F G RYD GSKIGYLKAT+ ++L  P+V  E   Y+
  S:     3 KIRKAVFPVAGMGTRFLPATKANPKEMMPVVDKPLIQYAVEEAIAAGITEMIFITGRHKRAIEDHFDKAYEIENELEARGKNETLEMLRSILPKNIHCIYIRQSEALGLGHAILCARPAVGNDPFAVLLADDLLV----GDEPIMRQLGKVYEENGCSILAVQNVEPEDTLNYGIVKCGPGMN---GLHPITGIVEKPAPENAPSRLGVVGRYILTPKIFEHLERVQPGAGGEIQLTDGIASLLREERALAYEFHGTRYDCGSKIGYLKATIALALQHPEVGREFAAYL 284
>gi|159046117|ref|YP_001534911.1| UTP-glucose-1-phosphate uridylyltransferase [Dinoroseobacter shibae DFL 12] >gi|157913877|gb|ABV95310.1| UTP-glucose-1-phosphate uridylyltransferase [Dinoroseobacter shibae DFL 12] (298 aa)
Score = 638, Expect = 9.6e-65, Identities = 126/299 (42%), Positives = 200/299 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M + V  AV P AGMGTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GIE+ + + S+ K+++ D+FD   +LE+ L+ K K +  +++RN + D   I Y+RQ   +GLGHA+  A+R +GNEPFA++L DDVI     ++KP L Q +E ++E   ++V   EV   + S YGI+D  E +      +RVK MIEKP    +PSN A++GRY+L+P +   L++ Q+   GEI++T ++   +  K  VY   F+G+RYD GSK G+L+AT+  +L++PD+RDEL ++++ L    K
  S:     2 MSRSVKTAVFPVAGMGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIEEFIFVTSRGKSALEDYFDAAPQLEQTLEDKGKTKLLEILRNTNMDSGAIAYVRQTRALGLGHAVWCARRLLGNEPFAVILPDDVIA----AEKPCLAQMVEAYQELGGNMVATMEVPMDKASAYGIVDVEEDMG---SVVRVKGMIEKPKAEDAPSNLAVIGRYILSPEVLDNLDKGQIGAGGEIQLTDAIAQEITSKNNVYGFRFSGQRYDCGSKAGFLQATVSFALARPDLRDELSDFLQELAFARK 295
>gi|171914312|ref|ZP_02929782.1| UTP-glucose-1-phosphate uridylyltransferase [Verrucomicrobium spinosum DSM 4136] (293 aa)
Score = 638, Expect = 1.2e-64, Identities = 130/296 (43%), Positives = 195/296 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M  +V KAVIPAAG GTRFLP +KA+PKEMLP++DKP IQ++VEEAVASGI DIL+I+S+ K SI +HF    ELE  L+ K + E    +R +  +A IHY+ Q +  GLG A+  A+  +G EPFA+LLG D +V      KP L+Q +++ E    S V ++EV  ++VS+YGI+   E   ++    +    +EKP P+ +PS  A+  RY+L+PSIF++L++T     GE+++T ++  L Q+E +Y   + G+R+DIG+K+ ++KA L   L + D+R+EL  Y+  L+E
  S:     1 MTAKVRKAVIPAAGFGTRFLPISKAVPKEMLPVVDKPVIQYVVEEAVASGITDILLIISRGKRSIEEHFIANTELEADLESKGRHETLAELRQLQSLARIHYVFQPKMGGLGDAVRCAREHVGGEPFAVLLG-DALVSPADGAKPVLRQLLDVHERHGGSTVALEEVPAEKVSRYGILGGAE---IEPGVFKADKFVEKPSPAEAPSRLAVSARYILSPSIFEQLDQTPTGKGGELQLTDAMAALMQREALYGVRYAGRRHDIGNKLDFVKANLWWGLQREDMREELKRYLAGLLE 292
>gi|556004|gb|AAC43313.1| glucose-1-phosphate uridylyltransferase >gi|1095718|prf||2109359C glucose-1-phosphate uridylyltransferase (306 aa)
Score = 637, Expect = 1.5e-64, Identities = 125/289 (43%), Positives = 192/289 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+V KAVIPAAG+GTRFLPATKA+ KEMLPI+D+PTI F++EEA+ SGIEDIL++  + K SI D+FD  FELE  L+++ K+E  K V   +D+  +H++RQ  P GLG A+  AK F+G++PF ++LGDD++   + +  P  +Q ++ +     S + V  V +++VS YG+I P  +++       V   +EKP P  +PS+ AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ F GKRYD+G K  ++K ++D +L  P +++ L  Y+
  S:     2 KKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDRPTIHFVIEEALRSGIEDILVVTGKSKRSIEDYFDSTFELEYSLRKQGKMELLKSVNESTDI-KVHFVRQSSPRGLGDAVLQAKSFVGDDPFVVMLGDDLMDITDSTAVPLTRQLMDDYNATQASTIAVMPVRYEDVSSYGVISP--RLESSNGLYSVDAFVEKPKPEEAPSHLAIIGRYLLTPEIFSILETQKPGAGNEIQLTDAIDTLNKTQSVFAREFVGKRYDVGDKFNFMKTSIDYALQHPQIKESLKNYV 287
>gi|163745051|ref|ZP_02152411.1| UTP--glucose-1-phosphate uridylyltransferase [Oceanibulbus indolifex HEL-45] >gi|161381869|gb|EDQ06278.1| UTP--glucose-1-phosphate uridylyltransferase [Oceanibulbus indolifex HEL-45] (297 aa)
Score = 636, Expect = 2.0e-64, Identities = 123/299 (41%), Positives = 206/299 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M+K+VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + + S+ K ++ D+FD+  +LE+ L++K K E  +++++ + D   I YIRQ + +GLGHA+  A+R IGNEPFA++L DDVI     ++KP L+Q +E +EE   S+V   EVE    S YGI+D  E+   +   ++VK M+EKP    +PSN A++GRY+L+P++ K L + +    GEI++T ++   + Q   VY   F G+R+D GSK G+L+AT+   L++ ++RD+L  Y++ + + ++
  S:     1 MRKKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHAPQLEQELRKKGKTELLQILQDTNMDSGAIAYIRQHKALGLGHAVWCARRLIGNEPFAVMLPDDVIA----AEKPCLQQMVEAYEETGGSMVAAMEVEPSRASSYGILDTSEE---RGDLVKVKGMVEKPAADEAPSNLAVIGRYILSPNVLKNLNKLKSGSGGEIQLTDAIAQEIEQDREVYGFRFRGQRFDCGSKAGFLQATVAFGLAREELRDDLSAYLQSIAQIDR 294
>gi|84500646|ref|ZP_00998895.1| UDP-glucose pyrophosphate [Oceanicola batsensis HTCC2597] >gi|84391599|gb|EAQ03931.1| UDP-glucose pyrophosphate [Oceanicola batsensis HTCC2597] (297 aa)
Score = 634, Expect = 3.2e-64, Identities = 128/299 (42%), Positives = 200/299 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           MK ++TKA+ P AG+GTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GI++ + + S+ K ++ D+FD+  +LE  LK+K K +  + ++N + D   I YIRQ +P+GLGHA+  A+R IGNEPFA++L DD+I     ++KP L+Q +E F E   ++V   EV  +  S YGI+D  E        + +K M+EKP     PSN A++GRY+LTP I K L   Q    GEI++T ++ + + +   VY   F G+RYD GSK GYL+AT+  +LS+P++RD+LL +++ +V   +
  S:     1 MKNKITKAIFPVAGLGTRFLPATKSIPKEIMSLVDRPLIQYAIDEARAAGIKEFIFVTSRGKAALEDYFDHAPQLEAELKKKGKDDLLEEIKNTNMDSGAIAYIRQHKPLGLGHAVWCARRLIGNEPFAVILPDDIIA----AEKPCLQQMVEAFAENPGNMVAAMEVPPERASAYGILDVKED---HGSLVSIKGMVEKPKTGEEPSNLAVIGRYLLTPQILKNLNLKQTGAGGEIQLTDAIAHEITENRPVYGYRFRGQRYDCGSKSGYLQATVSFALSRPELRDDLLGFLREVVNVEQ 294
>gi|152967632|ref|YP_001363416.1| UTP-glucose-1-phosphate uridylyltransferase [Kineococcus radiotolerans SRS30216] >gi|151362149|gb|ABS05152.1| UTP-glucose-1-phosphate uridylyltransferase [Kineococcus radiotolerans SRS30216] (310 aa)
Score = 634, Expect = 3.4e-64, Identities = 133/289 (46%), Positives = 195/289 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYG--IIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSK----PDVRDELLEYM 291
           + V KAVIPAAG GTRFLPATKAMPKEMLP++D P IQ+IVEEAV SG+ D+L+I  + K  + DHFD   ELE  L++K        V+  +D+A +HY+RQ +P GLGHA+ +A++ +G+EPF +LLGDD++     S  P L   I++ EE+  S+V   EV H ++  YG  + +P ++ D+    ++V  ++EKP    +PS+ AI+GRY+L P++F  L ET     GEI++T +L  LAQ +    GV+  VF G+RYD G K+ Y+KA + ++  +    PD+R+ L EY+
  S:    10 RTVRKAVIPAAGQGTRFLPATKAMPKEMLPVVDTPAIQYIVEEAVRSGLTDVLMITGRNKRPLEDHFDRNVELEVGLEKKGDQTKLARVQESTDLAQVHYVRQGDPKGLGHAVLVAEQHVGDEPFVVLLGDDIV----DSRDPLLDVMIKVREERGGSVVAFMEVPHDQIHLYGCAVAEPTDETDV----VKVSGLVEKPKTEEAPSDLAIIGRYLLDPAVFAVLHETAPGKGGEIQLTDALQVLAQGDGPGYGVHGVVFRGRRYDTGDKLDYIKAVVRLATERADIGPDLREWLGEYV 300
>gi|117927376|ref|YP_871927.1| UDP-glucose pyrophosphorylase [Acidothermus cellulolyticus 11B] >gi|117647839|gb|ABK51941.1| UDP-glucose pyrophosphorylase [Acidothermus cellulolyticus 11B] (302 aa)
Score = 633, Expect = 3.6e-64, Identities = 128/297 (43%), Positives = 197/297 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI--IDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG----VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           +RV KAVIPAAG+GTRFLPATKA PKEMLP++DKP IQ++VEEAVA+G++DIL+I  + K  + DHFD  +ELE  L  K       LV   + +A IHY+RQ EP GLGHA++ A   +G EPFA+LLGDD+I        P L + I++ + +  +++ + EV+   +  YG   ++P ++ D+    +RV +++EKP    +PSN A++GRYV+ P IF  L +T+    GEI++T +L  LA ++G    V+  +F G+RYD G ++ YL+A + +++ + D+   LL +++  V+  +
  S:     6 RRVRKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLDDILMITGRNKRPLEDHFDRNYELESALAAKGDDRKLALVEESTRLATIHYVRQGEPRGLGHAVSCAAMHVGEEPFAVLLGDDII----DGRDPLLPRMIDVLQRRGGTVIALMEVDPDHIHLYGCAAVEPTDEPDV----VRVTDLVEKPRER-APSNLALIGRYVIAPEIFDVLAKTEPGAGGEIQLTDALRVLAGRDGDGGPVHGVLFRGRRYDTGDRLEYLRAVIQLAVEREDLGPPLLSWLREFVDARR 299
>gi|134280055|ref|ZP_01766766.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 305] >gi|134248062|gb|EBA48145.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 305] (294 aa)
Score = 633, Expect = 4.0e-64, Identities = 125/288 (43%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F   + S++GV+++  ++   YG+ID     D      ++  ++EKP+P+ +PSN+ ++GRYVLTP IF  L   +    GE+++T +L +L + E V A  + G+R+D GSKIGYLKAT++ +L  P+V  E   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLTLVRGIKPR-HVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVVLADDLL----DGRPPVLRQMIDVFNHYHTSVIGVEQIAPQDSKSYGVIDGKRWED---NLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGQRFDCGSKIGYLKATVEFALRHPEVAPEFERYL 284
>gi|187924776|ref|YP_001896418.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phytofirmans PsJN] >gi|187715970|gb|ACD17194.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phytofirmans PsJN] (293 aa)
Score = 633, Expect = 4.0e-64, Identities = 126/289 (43%), Positives = 196/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P + Q IE+F+  + S++GV+E+  +E   YGI+D  E  D     +++  ++EKP+PS++PSN  ++GRYVL P IF+ L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +  EY++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVMCAEKLVGDNPFAVILADDLLY----GTPPVMTQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWED---SIIKMSGIVEKPEPSVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLR 285
>gi|126441054|ref|YP_001060220.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 668] >gi|126220547|gb|ABN84053.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 668] (294 aa)
Score = 633, Expect = 4.5e-64, Identities = 126/288 (43%), Positives = 190/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F   + S++GV+++  +E   YG+ID     D      ++  ++EKP+P+ +PSN+ ++GRYVLTP IF  L   +    GE+++T +L +L + E V A  + G R+D GSKIGYLKAT++ +L  P+V  E   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLTLVRGIKPR-HVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVVLADDLL----DGRPPVLRQMIDVFNHYHTSVIGVEQIAPQESKSYGVIDGKRWED---NLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGLRFDCGSKIGYLKATVEFALRHPEVAPEFERYL 284
>gi|187479240|ref|YP_787265.1| UTP--glucose-1-phosphate uridylyltransferase [Bordetella avium 197N] >gi|115423827|emb|CAJ50378.1| UTP--glucose-1-phosphate uridylyltransferase [Bordetella avium 197N] (279 aa)
Score = 633, Expect = 4.5e-64, Identities = 134/272 (49%), Positives = 179/272 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATL 274
           K V KAV P AGMGTRFLPATKAMPKEMLP++DKP IQ+ VEEAVA+GI D++ +  + K +I DHFD   ELE  L++K K E   LVR+I   AH+H  YIRQ  P+GLGHA+  A   +G+EPFA+LL DD+I      D PAL Q I    E++ S++GVQEV  K+ +KYGI+       +  ++ RV +++EKP P  +PS  A++GRYVL P IF  L  T      EI++T  +  + ++  VYA  + G+RYD GSK G  +AT+
  S:     2 KPVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDTAPELETDLEKKAKYELLALVRDILP-AHVHCIYIRQSAPLGLGHAVLTAAPVVGDEPFAVLLADDLI----DGDTPALAQLIACAAEQDGSVLGVQEVPRKDTNKYGIV---ASSHIAPRTERVSHLVEKPAPEDAPSTLAVVGRYVLEPQIFDHLRNTGKGAGNEIQLTDGIAAMMRERAVYAYRYEGQRYDCGSKAGMFQATV 267
>gi|153006419|ref|YP_001380744.1| UTP-glucose-1-phosphate uridylyltransferase [Anaeromyxobacter sp. Fw109-5] >gi|152029992|gb|ABS27760.1| UTP-glucose-1-phosphate uridylyltransferase [Anaeromyxobacter sp. Fw109-5] (293 aa)
Score = 632, Expect = 5.2e-64, Identities = 133/290 (45%), Positives = 199/290 (68%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKP--DPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           + + KAVIPAAG+GTRFLPATKA+PKE+LPI+D PTIQ+IV EAVA+G+ D++++V++ K SI+DHFD   ELE  L++  K E  + +R+I+ MA++  +RQ+EP+GLGHA+  A+  IG+EPF ++LGDD+I     +  P  KQ  + + +  ++ V + EV  +E S YGI    E   L+ +++ V+ ++EKP  DP   PSN A++GRYVL P IF+ L++ +    GEI++T +L  LA++E +    F G RYD G ++GYLKA L  +L +P++   L E MK
  S:     8 RTIRKAVIPAAGLGTRFLPATKAVPKELLPIVDTPTIQYIVAEAVAAGVRDVVLVVARGKESIVDHFDIAAELEAHLERTGKHELKRQMRSIAQMANVITVRQQEPLGLGHAVLCARDVIGDEPFVVMLGDDII----DAKVPGAKQLADCYAKHGLATVALMEVPPEETSMYGIAAGTE---LEPRTIEVERIVEKPKQDP---PSNLAVIGRYVLPPRIFEVLDQVEPGVGGEIQLTDALAVLAREESLLGYRFEGDRYDAGDRLGYLKANLAFALKRPELAGPLRELMK 289
>gi|88810658|ref|ZP_01125915.1| UTP--glucose-1-phosphate uridylyltransferase [Nitrococcus mobilis Nb-231] >gi|88792288|gb|EAR23398.1| UTP--glucose-1-phosphate uridylyltransferase [Nitrococcus mobilis Nb-231] (317 aa)
Score = 631, Expect = 6.0e-64, Identities = 133/291 (45%), Positives = 184/291 (63%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M K + KAV P AG+GTRFLPATKA PKEMLP++DKP +Q+ VEEAV +GIE ++ I  + K SI DHFD  +ELE  L+ K K +    VRNI   AH+   YIRQ E +GLGHA+  A+  IG+EPFA++L DD+I  ++      L Q +E +     SI+GVQ V  +   +YGI+D         +  RV+ +IEKP P  +PSN  ++GRY+L P IF++L +T     GEI++T ++  L + E V A  F G RYD G K+GYL+A ++  L   ++ DE  EY+
  S:    26 MSKAIRKAVFPVAGLGTRFLPATKANPKEMLPVVDKPLVQYAVEEAVRAGIEVLVFITGRNKRSIPDHFDKAYELESELEAKGKSKQLNTVRNIIP-AHVTPIYIRQTEALGLGHAVLCAEPVIGDEPFAVILADDLI--DDAEGNGCLDQMVEQYAASGASILGVQRVPAEHTDRYGIVD---ATVCSARVSRVQGLIEKPRPQEAPSNLGVVGRYILNPGIFRKLRQTIPGAGGEIQLTDAIAALMEDETVLAYEFRGIRYDCGDKLGYLQAQVEFGLKHAELGDEFREYL 312
>gi|145589897|ref|YP_001156494.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048303|gb|ABP34930.1| UDP-glucose pyrophosphorylase [Polynucleobacter sp. QLW-P1DMWA-1] (296 aa)
Score = 630, Expect = 8.1e-64, Identities = 128/290 (44%), Positives = 193/290 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           K+VTKAV P AG GTRFLPATKA PKEML ++DKP IQ+ V+EA+A+GI +++ +  + K +I DHFD  +ELE  L+ KNK +   LVR++  D     YIRQ EP+GLGHA+  A++ +G+EPFAI+L DD++        P L Q +++ EE+  S++ V++++  + S YGII   E   ++    R+  ++EKP P+ +PSN A++GRYVL+  IF  +   +    GEI++T ++  L + E V+   + G RYD GSK+GYLKA++D +L  P+V ++  EY+K
  S:     8 KKVTKAVFPVAGFGTRFLPATKASPKEMLNVVDKPLIQYAVDEAIAAGITELIFVTGRSKRAIEDHFDKAYELEAALEAKNKQDLLHLVRSVKPDNVDCVYIRQSEPLGLGHAVLCAEKLVGDEPFAIILADDLL----DGQPPVLSQMLKVHEEQEGSVLAVEKIDPSKSSSYGIISGKE---VQQGIYRLDGIVEKPKPADAPSNLAVVGRYVLSSKIFDHIRNVKPGAGGEIQLTDAIAALLKDEPVFGYEYDGVRYDCGSKLGYLKASVDFALRHPEVGEDFAEYLK 291
>gi|77407080|ref|ZP_00784083.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae H36B] >gi|77174311|gb|EAO77177.1| UTP-glucose-1-phosphate uridylyltransferase [Streptococcus agalactiae H36B] (258 aa)
Score = 630, Expect = 8.6e-64, Identities = 135/260 (51%), Positives = 174/260 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDI 263
           +V KAVIPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ SGIEDIL++  + K SI DHFD  FELE  LK+K K E  KLV   + +  +H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N    P  KQ I  FE  + S + V EV H++VS YG+I P  Q +       V   +EKP P  +PSN AI+GRY+LTP IF  LE  +     EI++T ++  L + + V+A+ FTG RYD+
  S:     2 KVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSKRSIEDHFDSNFELEYNLKEKGKNELLKLVDETTGI-RLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVMEVPHEDVSAYGVIAP--QGEGVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTLNKTQRVFARKFTGDRYDV 258
>gi|53720378|ref|YP_109364.1| putative UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei K96243] >gi|76808713|ref|YP_334632.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710b] >gi|126455419|ref|YP_001067485.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106a] >gi|161356938|ref|ZP_02102815.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106b] >gi|161371261|ref|ZP_02110826.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710a] >gi|167720996|ref|ZP_02404232.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei DM98] >gi|167739969|ref|ZP_02412743.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 14] >gi|167817190|ref|ZP_02448870.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 91] >gi|167825602|ref|ZP_02457073.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 9] >gi|167847087|ref|ZP_02472595.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei B7210] >gi|167895671|ref|ZP_02483073.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 7894] >gi|167904064|ref|ZP_02491269.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei NCTC 13177] >gi|167912321|ref|ZP_02499412.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 112] >gi|167920278|ref|ZP_02507369.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei BCC215] >gi|194505473|ref|YP_002035044.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1655] >gi|194507377|ref|YP_002019915.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei Pasteur 52237] >gi|194517867|ref|YP_002053501.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei S13] >gi|194569382|ref|YP_002104385.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 406e] >gi|52210792|emb|CAH36778.1| putative UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei K96243] >gi|76578166|gb|ABA47641.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710b] >gi|126229061|gb|ABN92601.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106a] >gi|157809010|gb|EDO86180.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 406e] >gi|157939329|gb|EDO94999.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei Pasteur 52237] >gi|169651669|gb|EDS84362.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei S13] >gi|184211360|gb|EDU08403.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1655] (294 aa)
Score = 630, Expect = 8.9e-64, Identities = 125/288 (43%), Positives = 190/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F   + S++GV+++  ++   YG+ID     D      ++  ++EKP+P+ +PSN+ ++GRYVLTP IF  L   +    GE+++T +L +L + E V A  + G R+D GSKIGYLKAT++ +L  P+V  E   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLTLVRGIKPR-HVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVVLADDLL----DGRPPVLRQMIDVFNHYHTSVIGVEQIAPQDSKSYGVIDGKRWED---NLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGLRFDCGSKIGYLKATVEFALRHPEVAPEFERYL 284
>gi|149928189|ref|ZP_01916434.1| UTP--glucose-1-phosphate uridylyltransferase [Limnobacter sp. MED105] >gi|149823080|gb|EDM82320.1| UTP--glucose-1-phosphate uridylyltransferase [Limnobacter sp. MED105] (291 aa)
Score = 630, Expect = 9.2e-64, Identities = 129/289 (44%), Positives = 190/289 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           RV KAV P AGMGTRFLPATKA PKEM+P++DKP IQ+ VEEA+ +G+ +++ I  + K SI DHFD  +ELE  L+ + K    ++V+NI   +H++  YIRQ EP+GLGHA+  A+  +G EPFA+LL DD ++  ++       Q +++FE ++ S++ VQEV+  E   YGI+          +S RV  ++EKPDP  +P+N A++GRYVL   IF  + +T     GEI++T  + +L + + V A  FTG R+D GSK+GYLKAT+++ L   +V  E  +Y+K
  S:     3 RVRKAVFPVAGMGTRFLPATKASPKEMMPVVDKPLIQYAVEEALEAGLSELVFITGRSKRSIEDHFDKAYELEAELQARGKTALLEIVKNIVP-SHVNCIYIRQMEPLGLGHAVLCAEPVVGTEPFAVLLADD-LMDVDKGTPSVTHQMVKVFEREHASVLAVQEVDPSETKSYGIV---SSTPWNNRSERVNAIVEKPDPKDAPTNLAVVGRYVLNSQIFDHIRKTGKGAGGEIQLTDGIASLLEDQPVLAYRFTGTRFDCGSKMGYLKATVELGLKHHEVAAEFAQYLK 288
>gi|27762602|gb|AAO20099.1| UDP-glucose pyrophosphorylase [Streptococcus equi subsp. zooepidemicus] (264 aa)
Score = 630, Expect = 9.9e-64, Identities = 132/265 (49%), Positives = 178/265 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIG 268
           +V KA+IPAAG+GTRFLPATKA+ KEMLPI+DKPTIQFIVEEA+ +GIE+IL++  + K SI DHFD  FELE  L+ K K E  KLV   + + ++H+IRQ  P GLG A+  AK F+GNEPF ++LGDD++   N S KP  KQ IE ++  + S + V  V H+EVS YG+I P  Q         V+  +EKP P  +PS+ AI+GRY+LTP IF  LE        E+++T ++  L + + V+A+ F G+RYD+G K G
  S:     3 KVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKAGIEEILVVTGKAKRSIEDHFDSNFELEYNLQAKGKTELLKLVDETTAI-NLHFIRQSHPRGLGDAVLQAKAFVGNEPFVVMLGDDLMDITNPSAKPLTKQLIEDYDCTHASTIAVMRVPHEEVSNYGVIAP--QGKAVKGLYSVETFVEKPSPDEAPSDLAIIGRYLLTPEIFAILENQAPGAGNEVQLTDAIDKLNKTQRVFAREFKGERYDVGDKFG 264
>gi|182438089|ref|YP_001825808.1| putative UTP-glucose-1-phosphate uridylyltransferase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178466605|dbj|BAG21125.1| putative UTP-glucose-1-phosphate uridylyltransferase [Streptomyces griseus subsp. griseus NBRC 13350] (300 aa)
Score = 629, Expect = 1.0e-63, Identities = 132/288 (45%), Positives = 190/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG----VYAKVFTGKRYDIGSKIGYLKATLDISLSK----PDVRDELLEYM 291
           R++KAVIPAAG+GTRFLPATKA PKEMLP++DKP IQ++VEEAVA+G+ D+L+I  + K  + DHFD  +ELE  L +K   E    V+  SD+A +HY+RQ +P GLGHA+  A   +G++PFA+LLGDD+I          L + +E+ E +  S++ + EVE  +V  YG       VD     +R+ +++EKPDP+ +PSN AI+GRYVL P++F  L  T+    GEI++T +L  LA  E     V+  VF G+RYD G +  YL+A + ++  +    PD R  L +Y+
  S:     7 RISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLSDVLMITGRNKRPLEDHFDRNYELESALTRKGDAERLAKVQESSDLATMHYVRQGDPRGLGHAVLCAAPHVGDQPFAVLLGDDLI----DPRDALLARMVEVQEREGGSVIALMEVEPSQVHLYGCAAADATVD--GDVVRITDLVEKPDPADAPSNLAIIGRYVLDPAVFDILRHTEPGRGGEIQLTDALQLLAADEKIGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLRKYV 296
>gi|149204256|ref|ZP_01881223.1| UTP-glucose-1-phosphate uridylyltransferase [Roseovarius sp. TM1035] >gi|149142141|gb|EDM30188.1| UTP-glucose-1-phosphate uridylyltransferase [Roseovarius sp. TM1035] (297 aa)
Score = 629, Expect = 1.0e-63, Identities = 125/299 (41%), Positives = 202/299 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG--VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M+ +VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + I S+ K ++ D+FDY  +LE  L++K K +  +++++ + D   + Y+RQ +P+GLGHA+  A+R I NEPFA++L DDVI     ++KP L Q +E FEE   +IV   EV       YGI+D  E +      +  K M+EKP    +PSN A++GRY+LTP++ ++L   Q    GEI++T + ++ A+++G  VY   F G+R+D GSK G+L+AT+  +L++ D+RDEL  Y+  +V + K
  S:     1 MRSKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFITSRGKGALEDYFDYAPQLEAELRRKGKDDLLEILKSTNMDSGEVAYMRQHKPLGLGHAVWCARRLISNEPFAVILPDDVIA----AEKPCLAQMVEAFEETQGNIVAAMEVPDAMTKSYGILDIKEDMG---SIVSTKGMVEKPAAGTAPSNLAVIGRYILTPTVLQKLNRKQAGAGGEIQLTDA-IDAAREDGEEVYGFRFQGQRFDCGSKAGFLQATVAFALARDDLRDELWNYISDVVHSEK 294
>gi|33594287|ref|NP_881931.1| putative UTP--glucose-1-phosphate uridylyltransferase [Bordetella pertussis Tohama I] >gi|33564362|emb|CAE43666.1| putative UTP--glucose-1-phosphate uridylyltransferase [Bordetella pertussis Tohama I] (302 aa)
Score = 629, Expect = 1.1e-63, Identities = 135/270 (50%), Positives = 181/270 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATL 274
           V KAV P AGMGTRFLPATKAMPKEMLP++DKP IQ+ VEEAVA+GI D++ +  + K +I DHFD   ELE  L+ K K E   LVR+I   AH++  YIRQ  P+GLGHA+  A   +GNEPFA+LL DD+I     +D P LKQ I++   +  S++GVQEV  ++  KYGI+   + VD +T+  RV +++EKP P  +P+  A++GRYVL  +IF  L  T V    EI++T  +  L ++  VYA  + GKRYD GSK G  +AT+
  S:    27 VRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILP-AHVNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLI----DADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVAS-QPVDARTE--RVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATV 290
>gi|91784465|ref|YP_559671.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] >gi|91688419|gb|ABE31619.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] (293 aa)
Score = 629, Expect = 1.1e-63, Identities = 125/289 (43%), Positives = 196/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P + Q IE+F+  + S++GV+E+  +E   YGI+D  E  D     +++  ++EKP+P+++PSN  ++GRYVL P IF+ L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +  EY++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELQARGKDKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLY----GTPPVMAQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWED---SIIKMSGIVEKPEPNVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLR 285
>gi|187923963|ref|YP_001895605.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phytofirmans PsJN] >gi|187715157|gb|ACD16381.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phytofirmans PsJN] (305 aa)
Score = 629, Expect = 1.2e-63, Identities = 122/295 (41%), Positives = 193/295 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETN 298
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ +NK +   LVR+I        Y+RQ E +GLGHA+  A++ +G  PFA++L DD++     S KP + Q ++ F   + S++GV+ +  ++   YG++D  E  D     +++  ++EKP P  +PSN  ++GRYVL P+IFK +   +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++ +L  P+V+ +   Y++  ++ N
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEKLVGESPFAVILADDLL----HSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWED---NVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLTEEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKADFEAYLQAYMQGN 291
>gi|163733019|ref|ZP_02140463.1| UTP--glucose-1-phosphate uridylyltransferase [Roseobacter litoralis Och 149] >gi|161393554|gb|EDQ17879.1| UTP--glucose-1-phosphate uridylyltransferase [Roseobacter litoralis Och 149] (304 aa)
Score = 629, Expect = 1.2e-63, Identities = 126/299 (42%), Positives = 201/299 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE-GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M ++VTKA+ P AGMGTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GI++ + + S+ K ++ D+FD+  +LE+ L+ K K E  +++ N + +   I YIRQ + +GLGHA+  A+R I +EPFA++L DDVI      DKP L+Q +E +EE   ++V   EV  ++ S YG++D    ++    SM RVK M+EKP    +PSN A++GRY+L P++   L + +    GE+++T ++     KE GVY   F G+R+D GSK G+L+AT+   L++ D+RD+L EY+  +V  +K
  S:     8 MTRKVTKAIFPVAGMGTRFLPATKSVPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHAPQLEQSLRDKGKTELLEMLENTNMESGAIAYIRQHKALGLGHAVWCARRLIADEPFAVILPDDVIA----GDKPCLQQMVEAYEETGGNMVAAMEVPPEKASSYGMLD----IETDMGSMVRVKGMVEKPPAGKAPSNLAVIGRYILAPAVLTNLNDMKKGAGGEVQLTDAIATEINKESGVYGYRFQGQRFDCGSKSGFLQATVSFGLARDDLRDDLSEYIHDIVSMSK 301
>gi|167925766|ref|ZP_02512857.1| UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE [Mycoplasma mycoides subsp. mycoides LC str. GM12] (290 aa)
Score = 629, Expect = 1.3e-63, Identities = 136/292 (46%), Positives = 195/292 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           + KAVIP AG GTRFLP TK+  KEMLPI+D PTI++IV+EA+ SGI++ILI+++  K+ IM++F    ELE  L  K+K+ + + ++   D A IHYI Q EP+GLGHAI++ K FI NE FA+LLGDD+     +   PA+KQ ++L+EEK+ +I+G   ++ K+  KYGI       D      +V +++EKPD   +PSN AI GRY+LTP IF  L+       GEIE+T S+L   +    YAKV  GKRYDIG+K+GYL+A +D + ++ D ++E ++ +K L E
  S:     3 IRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAIDSGIKEILIVLNDKKSEIMNYFSRNIELERFLYNKDKINELEQIKTKYD-ADIHYIMQDEPLGLGHAISLCKGFINNESFAVLLGDDLF----KCQTPAIKQLMDLYEEKHSTILGTILIDKKDCKKYGICKTESSND---NVYKVCSVVEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGETGEIELTDSILRTIKDVDCYAKVIDGKRYDIGNKLGYLEAFVDFASNRDDTKNEFIKIVKKLNE 286
>gi|186475842|ref|YP_001857312.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phymatum STM815] >gi|184192301|gb|ACC70266.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phymatum STM815] (300 aa)
Score = 628, Expect = 1.4e-63, Identities = 122/289 (42%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I        Y+RQ E +GLGHA+  A++ +G  PFA++L DD++     S+KP +KQ ++ F   + S+VGV+ +  +    YG++D  E    +   +++  ++EKP P  +PSN  ++GRYVL P+IFK +   +    GE+++T +L +L  +E V A  + G R+D GSK+GYLKAT++ +L  P+VR +  ++++
  S:     6 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEQLLDLVRSIKPSNVDCFYVRQAEALGLGHAVLCAEKLVGGSPFAVILADDLL----HSEKPVMKQLVDTFNHYHSSVVGVETIAREASRSYGVVDGKE---WEEDVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDALQSLLTEEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVRADFEDFLQ 288
>gi|21221618|ref|NP_627397.1| UTP-glucose-1-phosphate uridylyltransferase [Streptomyces coelicolor A3(2)] >gi|6138866|emb|CAB59678.1| UTP-glucose-1-phosphate uridylyltransferase [Streptomyces coelicolor A3(2)] (303 aa)
Score = 628, Expect = 1.4e-63, Identities = 129/288 (44%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG----VYAKVFTGKRYDIGSKIGYLKATLDISLSK----PDVRDELLEYM 291
           R++KAVIPAAG+GTRFLPATKA PKEMLP++DKP IQ++VEEAV +G+ D+L++  + K  + DHFD  +ELE  L++K        V+  SD+A +HY+RQ +P GLGHA+  A   +G+EPFA+LLGDD+I        P L++ I++ E+   S++ + EV  +++  YG        D  +  ++V  ++EKPDP+ +PSNYAI+GRYVL P +F  L +T+    GEI++T +L  LA+ E     V+  VF G+RYD G +  YL+A + ++  +    PD R  L  Y+
  S:     7 RISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVTAGLGDVLMVTGRNKRPLEDHFDRNYELESALQKKGDASRLAKVQESSDLAMMHYVRQGDPKGLGHAVLCAAPHVGHEPFAVLLGDDLI----DPRDPLLQRMIDVQEQYGGSVIALMEVAPEQIHLYGCAAVESTAD--SDVVKVGGLVEKPDPADAPSNYAIIGRYVLDPHVFDILRKTEPGRGGEIQLTDALQQLAEDESVGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLRSYV 296
>gi|33598073|ref|NP_885716.1| putative UTP--glucose-1-phosphate uridylyltransferase [Bordetella parapertussis 12822] >gi|33602965|ref|NP_890525.1| putative UTP--glucose-1-phosphate uridylyltransferase [Bordetella bronchiseptica RB50] >gi|33566631|emb|CAE38840.1| putative UTP--glucose-1-phosphate uridylyltransferase [Bordetella parapertussis] >gi|33568596|emb|CAE34354.1| putative UTP--glucose-1-phosphate uridylyltransferase [Bordetella bronchiseptica RB50] (279 aa)
Score = 627, Expect = 2.1e-63, Identities = 135/270 (50%), Positives = 181/270 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATL 274
           V KAV P AGMGTRFLPATKAMPKEMLP++DKP IQ+ VEEAVA+GI D++ +  + K +I DHFD   ELE  L+ K K E   LVR+I   AH++  YIRQ  P+GLGHA+  A   +GNEPFA+LL DD+I     +D P LKQ I++   +  S++GVQEV  ++  KYGI+   + VD +T+  RV +++EKP P  +P+  A++GRYVL  +IF  L  T V    EI++T  +  L ++  VYA  + GKRYD GSK G  +AT+
  S:     4 VRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILP-AHVNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLI----DADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVAS-QPVDARTE--RVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATV 267
>gi|124515946|gb|EAY57455.1| UDP-glucose pyrophosphorylase [Leptospirillum sp. Group II UBA] (307 aa)
Score = 627, Expect = 2.1e-63, Identities = 126/290 (43%), Positives = 192/290 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++V KAV P AG GTRFLP TK+ PKEMLPI+DKP +Q++VEEAV SGI  I+++  + K +I DHFD  +ELE+ L++KNK++    ++ I+ ++ I YIRQKE +GLGHA+  ++  +GNEPFA+ LGD+++       K  L Q +E++EE    ++G+Q V   EVS YGI+D      ++    RV  ++EKP    +PS+YAI+GRY+LTP ++  L   +    GEI++T +L  LA++  VYA    G R+D G K+G+LKAT+  +L + D+ +E   +++
  S:     2 QKVRKAVFPLAGHGTRFLPMTKSSPKEMLPIIDKPVVQYVVEEAVESGIRQIVMVTGRGKRAIEDHFDISYELEDVLRKKNKLDILAELQRIASLSEITYIRQKEALGLGHAVLCSEMVVGNEPFAVALGDEILY----GPKSGLAQLLEVYEELQAPVIGLQRVPRSEVSHYGIVD---GTPVRDGLFRVDRLVEKPKTQDAPSDYAIIGRYILTPDVYGILGTQKPGVGGEIQLTDALNTLARQRPVYAMEIQGDRFDTGDKMGFLKATVHFALKRGDLSEEFRLFLE 284
>gi|152980167|ref|YP_001353754.1| UTP--glucose-1-phosphate uridylyltransferase [Janthinobacterium sp. Marseille] >gi|151280244|gb|ABR88654.1| UTP--glucose-1-phosphate uridylyltransferase [Janthinobacterium sp. Marseille] (291 aa)
Score = 626, Expect = 2.3e-63, Identities = 133/291 (45%), Positives = 183/291 (62%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           ++ KAV P AG+G+RFLPATKA PKEMLP++DKP IQ+ VEEAVA+GI D++ I  + K +I DHFD  +ELE  L+  NK    +LVRN I    +  YIRQ  P+GLGHA+  A+  IGN+PFA+LL DD  +  ++  KP L Q  ++F+ +  SI+ VQ+V   E  +YGI+        + Q   V  ++EKP P ++PS  A++GRYVL+  IF  LE       GEI++T  +  L Q E V A  + G+RYD GSK+GYLKA + + L  P+      EY+K L
  S:     3 KIRKAVFPVAGLGSRFLPATKAQPKEMLPVVDKPLIQYAVEEAVAAGITDMVFITGRNKRAIEDHFDTAYELEAELEAANKNALLELVRNVIPKNINCIYIRQSAPLGLGHAVLCARPVIGNDPFAVLLADD-FMDTDEGVKPVLAQMTDVFQREGHSILAVQDVPRAETKQYGIV---SATAYQPQLELVNAIVEKPQPDVAPSTLAVVGRYVLSNKIFDYLETIGKGAGGEIQLTDGIAALMQAEKVLAYRYNGQRYDCGSKLGYLKAMVAMGLKHPETGAGFTEYLKTL 290
>gi|42560669|ref|NP_975120.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492165|emb|CAE76762.1| UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE [Mycoplasma mycoides subsp. mycoides SC str. PG1] (290 aa)
Score = 626, Expect = 2.3e-63, Identities = 139/292 (47%), Positives = 195/292 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           + KAVIP AG GTRFLP TK+  KEMLPI+D PTI++IV+EAV SGI++ILII++  K+ IM++F    +LE  L  K K+ + + ++   D A IHYI Q EP+GLGHAI++ K FI NE FA+LLGDD+     +   PA+KQ ++L+EEK  +I+G   ++ K+  KYGI   +E  D      +V ++IEKPD   +PSN AI GRY+LTP IF  L+       GEIE+T S+L        YAKV  GKRYDIG+K+GYL+A +D +L++ D ++E ++ +K + E
  S:     3 IRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAVDSGIKEILIILNDKKSEIMNYFSRNIQLEGFLYNKGKIAELEQIKTKYD-ASIHYIIQDEPLGLGHAISLCKGFINNESFAVLLGDDLF----KCQTPAIKQLMDLYEEKQSTILGTILIDKKDCKKYGICK-IESSD--DNVYKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGETGEIELTDSILKTISDVDCYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNEFIKLVKKINE 286
>gi|84489895|ref|YP_448127.1| UDP-glucose pyrophosphorylase [Methanosphaera stadtmanae DSM 3091] >gi|84373214|gb|ABC57484.1| predicted UDP-glucose pyrophosphorylase [Methanosphaera stadtmanae DSM 3091] (283 aa)
Score = 626, Expect = 2.6e-63, Identities = 131/286 (45%), Positives = 193/286 (67%)
  Q:     7 KAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           KA+IPAAG+GTRFLPATKA PKEMLP+ +KPTIQ++VEEAV SGI+DILII  + K +I DHFD  FELE  L +K K +  + V+ I+DMA I+Y+RQK+  GLG AI+ A++ IG + FA+LLGD +      S  P  KQ ++++E+   S + ++E+   ++ +YGI+D      L     +V +++EKP    +PSN  I GRY+LT  IF +L   +    GEI++T +   + +++ VYA  F G  YDIG+ + +LK+++D++L+  DVR ELL++MK
  S:     2 KAIIPAAGLGTRFLPATKAQPKEMLPVFNKPTIQYVVEEAVNSGIDDILIITGKGKRTIEDHFDRSFELEYSLNEKGKYDYLQEVQEITDMADIYYVRQKKQNGLGDAISCAEKHIGGDAFAVLLGDTI----TYSQTPCTKQLLDVYEKYGGSTIAIEELPESKIERYGIVDGHH---LSDNIYKVDSLVEKPKLEEAPSNLGITGRYILTSDIFDKLRTIEAGVGGEIQLTDA---INEQDDVYATTFEGTIYDIGNTMEWLKSSIDMALTHEDVRLELLQHMK 277
>gi|167566384|ref|ZP_02359300.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia oklahomensis EO147] >gi|167573497|ref|ZP_02366371.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia oklahomensis C6786] (295 aa)
Score = 626, Expect = 2.8e-63, Identities = 123/289 (42%), Positives = 195/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR+I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E +E   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF  L +T+    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  +   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRSIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREESRSYGVVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFDHLRKTKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALQHPEVGRDFEAYLR 285
>gi|170695886|ref|ZP_02887026.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia graminis C4D1M] >gi|170139184|gb|EDT07372.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia graminis C4D1M] (293 aa)
Score = 626, Expect = 2.9e-63, Identities = 124/289 (42%), Positives = 195/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P + Q IE+F+  + S++GV+E+  +E   YGI+D  E  D     +++  ++EKP+P+++PSN  ++GRYVL P IF  +   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +  EY++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLY----GTPPVMTQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWED---SIIKMSGIVEKPEPNVAPSNLGVVGRYVLKPRIFDHIRSIKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLR 285
>gi|167924963|ref|ZP_02512054.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (292 aa)
Score = 625, Expect = 3.0e-63, Identities = 135/293 (46%), Positives = 198/293 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++ KA+IP AG GTRFLP TK+  KEMLPI+DKPTI++IV+EA+ SGIE+ILII+   KN+I +HF+  FELE  L++KNK+ + +L+    + A I+Y  Q+E +GLGHAI++AK FI NEPFAILLGDD+     +   PA+KQ I+++++ + +++G   ++ ++  KYGI    +   +     +V ++IEKP   ++PSN AI GRYVL P IFK L+       GEIE+T S+L    +   YAK+  G RYDIG+KIGYL A LD  L + D++D+ L  ++  ++
  S:     2 KIRKAIIPCAGFGTRFLPFTKSQAKEMLPIIDKPTIEYIVKEAIDSGIEEILIIIRVGKNNIANHFNRNFELEHFLEEKNKLSELELISEKYN-ATIYYQMQEEQLGLGHAISLAKDFIKNEPFAILLGDDLF----KCKTPAIKQLIDVYDKYHQNVLGTIYIDKQDSKKYGICKVKQ---ISNDIYKVDSVIEKPSVEVAPSNIAIGGRYVLLPEIFKYLDMHIKGKSGEIELTDSILKTINESNCYAKIIDGSRYDIGNKIGYLDAILDFGLEREDLKDQFLNLIETKIQ 286
>gi|71907365|ref|YP_284952.1| UDP-glucose pyrophosphorylase [Dechloromonas aromatica RCB] >gi|71846986|gb|AAZ46482.1| UDP-glucose pyrophosphorylase [Dechloromonas aromatica RCB] (289 aa)
Score = 625, Expect = 3.2e-63, Identities = 137/292 (46%), Positives = 183/292 (62%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPA-LKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K+V KAV P AGMGTRFLPATKA PKEMLPI+DKP IQF VEEAVA+GI D++ +  + K SI DHFD  +ELE  L+ + K E    VRN I    +  YIRQ E +GLGHA+  AK  IG+EPFA++L DD++       KPA +KQ  + ++    S++GVQ+V   +   YGI+D     +   Q   V  ++EKP P  +PS  A++GRY+LTP IF  LE  +    GEI++T  + +L  +E V A  + G RYD GSK+GYL+AT+      P+V      Y+K L
  S:     2 KKVRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQFAVEEAVAAGITDMVFVTGRSKRSIEDHFDKAYELESELQARGKDELLDFVRNMIPKNINCIYIRQAEALGLGHAVLCAKPVIGDEPFAVILADDLL-----DGKPAVMKQMTDTYDYYRCSVLGVQDVPRADTRSYGIVDARPVAERVEQ---VNAIVEKPKPEDAPSTLAVVGRYILTPRIFHHLENVKPGAGGEIQLTDGIASLLSEEQVLAYRYHGTRYDCGSKLGYLQATVVFGQRHPEVGPAFDAYLKTL 287
>gi|167563009|ref|ZP_02355925.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia oklahomensis EO147] >gi|167570199|ref|ZP_02363073.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia oklahomensis C6786] (293 aa)
Score = 625, Expect = 3.6e-63, Identities = 125/294 (42%), Positives = 194/294 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVRNI   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++      D P +KQ +++F+  + S++GV+E+  ++   YGI+D  E  D     +++  ++EKP P ++PSN  ++GRYVL P IF  L   +    GE+++T ++  L   E V A  + G R+D GSK+GYLKAT++ +L  P+V+ E   Y++   ET
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLDLVRNIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLL----DGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWED---SIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLADEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFEAYLRSRSET 290
>gi|91778371|ref|YP_553579.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] >gi|91691031|gb|ABE34229.1| UDP-glucose pyrophosphorylase [Burkholderia xenovorans LB400] (293 aa)
Score = 625, Expect = 3.8e-63, Identities = 129/291 (44%), Positives = 198/291 (68%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV----RDELLEYMKLL 294
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P + Q IE+F+  + S++GV+E+  ++   YGI+D  E    +   +++  ++EKP+PS +PSN  ++GRYVL P IFK L   +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++ ++  P+V    R+ L EY+ LL
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKDKLLQLVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVGDSPFAVILADDLLY----GSPPVMTQMIEVFDHYHSSVIGVEEIPAQDTKSYGIVDGKE---WEQSIIKMSGIVEKPEPSAAPSNLGVVGRYVLKPRIFKHLRTIKPGAGGELQLTDAIESLLADEQVLAYKYRGTRFDCGSKIGYLKATVEFAVRHPEVGVEFREYLEEYLSLL 291
>gi|34499356|ref|NP_903571.1| UTP-glucose-1-phosphate uridylyltransferase [Chromobacterium violaceum ATCC 12472] >gi|34105206|gb|AAQ61562.1| UTP-glucose-1-phosphate uridylyltransferase [Chromobacterium violaceum ATCC 12472] (290 aa)
Score = 624, Expect = 4.0e-63, Identities = 134/292 (45%), Positives = 192/292 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQS-MRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++TKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+G+ +++ I  + K SI DHFD  +ELE  L+ KNK +  +LV+  I       YIRQ E +GLGHA+  A+  +G+EPFA++L DD+I    +    A++Q + LF+E + SI+GV+ V  +E   YGI+    +V    Q   RV++++EKP P  +PSN A++GRY+LTP IF +L  T     GEI++T  +  L + E V A  F G RYD GSK+GYLKAT++  L   +V  +   +++ L
  S:     2 KKITKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGMTELIFITGRNKRSIEDHFDKAYELETELEYKNKQKLLQLVQEIIPPSVSCIYIRQTEALGLGHAVLCARPVVGDEPFAVILADDLI----EGAPGAMEQMVRLFDETHSSILGVETVAPEETGSYGIV----KVAANAQGHQRVEHIVEKPRPEEAPSNLAVVGRYILTPRIFDKLVNTAAGAGGEIQLTDGIAALMKNEPVLALPFKGTRYDCGSKLGYLKATVNYGLKHNEVAGDFAAFLREL 287
>gi|121597783|ref|YP_991263.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei SAVP1] >gi|124381835|ref|YP_001025674.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10229] >gi|126446751|ref|YP_001077750.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10247] >gi|194315883|ref|YP_002011600.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 10399] >gi|194524752|ref|YP_002060283.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei FMH] >gi|194530697|ref|YP_002066217.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei JHU] >gi|121225581|gb|ABM49112.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei SAVP1] >gi|124289855|gb|ABM99124.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10229] >gi|126239605|gb|ABO02717.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10247] >gi|147748762|gb|EDK55837.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei FMH] >gi|147754707|gb|EDK61771.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei JHU] >gi|160697599|gb|EDP87569.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 10399] (325 aa)
Score = 624, Expect = 4.4e-63, Identities = 123/289 (42%), Positives = 194/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YGI+   E  + +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:    33 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIV---EGREWEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLR 315
>gi|167563926|ref|ZP_02356842.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia oklahomensis EO147] >gi|167571060|ref|ZP_02363934.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia oklahomensis C6786] (294 aa)
Score = 624, Expect = 4.6e-63, Identities = 125/288 (43%), Positives = 195/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPA-LKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I    H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++       +P+ L+Q I++F   + S++GV+E+  ++   YG+ID      L+    ++ +++EKP+P+I+PSN+ ++GRYVL P IF  L   +    GE+++T +L +L + E V A  + G R+D GSKIGYLKAT++ +L  P+V  E   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPR-HVDCFYVRQAEALGLGHAVLCAEKLVGDSPFAVVLADDLL-----DGRPSVLRQMIDVFNHYHTSVIGVEEIALQDSKSYGVIDGKR---LEDDLFKLSDIVEKPEPAIAPSNFGVVGRYVLKPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAYRYDGTRFDCGSKIGYLKATVEFALRHPEVATEFERYL 284
>gi|91775632|ref|YP_545388.1| UDP-glucose pyrophosphorylase [Methylobacillus flagellatus KT] >gi|91709619|gb|ABE49547.1| UDP-glucose pyrophosphorylase [Methylobacillus flagellatus KT] (291 aa)
Score = 624, Expect = 4.8e-63, Identities = 138/296 (46%), Positives = 203/296 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI--SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K++TKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+  EEAVA+G  +++ I+ + K +I DHFD  FELE  L+   K +  + +RNI   +++ I YIRQ E +GLGHA+ +AK  +G+EPF+++L DD+I     +DKPA++Q  ELF+++ VSI+GV++VE  E + YGI+D  E        +++  ++EKP P  +PSN A++GRY+LTP IF+ LE  +    GEI++T  +  L +K+ + A  F GKRYD GSK+GY+KA ++ SL   +   E  +Y++ L +
  S:     1 MAKKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAAEEAVAAGATELIFIIGRNKRTIPDHFDKSFELEATLEASKKTKVLEEIRNILPKNVSCI-YIRQAEALGLGHAVLLAKSVVGSEPFSVILADDLI----DADKPAMQQMTELFDQEGVSILGVEDVEPSETASYGIVDATEVSG--PNVLQLNGIVEKPQPEEAPSNLAVVGRYILTPEIFECLENVKPGKGGEIQLTDGIAALMEKQKILAYRFDGKRYDCGSKLGYVKANVEYSLKHEEFGKEFAQYLRDLTK 291
>gi|83720234|ref|YP_443149.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis E264] >gi|167582161|ref|ZP_02375035.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis TXDOH] >gi|167620318|ref|ZP_02388949.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis Bt4] >gi|83654059|gb|ABC38122.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis E264] (294 aa)
Score = 623, Expect = 5.5e-63, Identities = 124/294 (42%), Positives = 195/294 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++      D P +KQ +++F+  + S++GV+E+  ++   YGI+D  E  D     +++  ++EKP P ++PSN  ++GRYVL P IF  L   +    GE+++T ++  L   E V A  + G R+D GSK+GYLKAT++ +L  P+V+ E   Y++   ET
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLL----DGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWED---SIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLADEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFEAYLRSRSET 290
>gi|76818894|ref|YP_335908.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710b] >gi|194574195|ref|YP_002109080.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei 2002721280] >gi|76583367|gb|ABA52841.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710b] >gi|148028434|gb|EDK86394.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei 2002721280] (327 aa)
Score = 623, Expect = 6.1e-63, Identities = 123/289 (42%), Positives = 194/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YGI+   E  + +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:    35 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIV---EGREWEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLR 317
>gi|186476350|ref|YP_001857820.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phymatum STM815] >gi|184192809|gb|ACC70774.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phymatum STM815] (293 aa)
Score = 622, Expect = 6.7e-63, Identities = 124/289 (42%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P ++Q IE+F+  + S++GV+E+   E   YGI+D  E  D     +++  ++EKP P ++PSN  ++GRYVL P IF  +   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +  EY++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKAKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLY----GKPPVMQQMIEVFDHYHSSVIGVEEIPPSETKSYGIVDGKEWED---AIIKMSGIVEKPAPEVAPSNLGVVGRYVLKPRIFDHIRALKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLR 285
>gi|194506559|ref|YP_002036129.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1655] >gi|184210580|gb|EDU07623.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1655] (292 aa)
Score = 622, Expect = 6.9e-63, Identities = 124/294 (42%), Positives = 194/294 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++      D P +KQ +++F+  + S++GV+E+  ++   YGI+D  E  D     +++  ++EKP P ++PSN  ++GRYVL P IF  L   +    GE+++T ++  L   E V A  + G R+D GSK+GYLKAT++ +L  P+V+ E   Y++   ET
  S:     2 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLL----DGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWED---SIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLADEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFETYLRSRSET 289
>gi|53719593|ref|YP_108579.1| UTP--glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei K96243] >gi|53725446|ref|YP_102653.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 23344] >gi|67642676|ref|ZP_00441429.1| COG1210: UDP-glucose pyrophosphorylase [Burkholderia mallei GB8 horse 4] >gi|76810031|ref|YP_333246.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710b] >gi|121601211|ref|YP_992790.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei SAVP1] >gi|124383577|ref|YP_001026422.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10229] >gi|126439841|ref|YP_001058709.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 668] >gi|126450693|ref|YP_001080306.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10247] >gi|126451502|ref|YP_001065961.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106a] >gi|134282369|ref|ZP_01769074.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 305] >gi|161356355|ref|ZP_02102233.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106b] >gi|161369559|ref|ZP_02109128.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710a] >gi|167001553|ref|ZP_02267348.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei PRL-20] >gi|167719903|ref|ZP_02403139.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei DM98] >gi|167738901|ref|ZP_02411675.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 14] >gi|167816122|ref|ZP_02447802.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 91] >gi|167824494|ref|ZP_02455965.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 9] >gi|167846031|ref|ZP_02471539.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei B7210] >gi|167894602|ref|ZP_02482004.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 7894] >gi|167903005|ref|ZP_02490210.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei NCTC 13177] >gi|167911244|ref|ZP_02498335.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 112] >gi|167919266|ref|ZP_02506357.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei BCC215] >gi|194313670|ref|YP_002009521.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 10399] >gi|194510076|ref|YP_002022606.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei Pasteur 52237] >gi|194514839|ref|YP_002050223.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei S13] >gi|194525176|ref|YP_002060706.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei FMH] >gi|194529342|ref|YP_002064863.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei JHU] >gi|194571392|ref|YP_002106392.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 406e] >gi|194575567|ref|YP_002110451.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei 2002721280] >gi|52210007|emb|CAH35980.1| UTP--glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei K96243] >gi|52428869|gb|AAU49462.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 23344] >gi|76579484|gb|ABA48959.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710b] >gi|121230021|gb|ABM52539.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei SAVP1] >gi|124291597|gb|ABN00866.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10229] >gi|126219334|gb|ABN82840.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 668] >gi|126225144|gb|ABN88684.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106a] >gi|126243563|gb|ABO06656.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei NCTC 10247] >gi|134246407|gb|EBA46496.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 305] >gi|147749186|gb|EDK56260.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei FMH] >gi|147753352|gb|EDK60417.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei JHU] >gi|148027819|gb|EDK85840.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei 2002721280] >gi|157807479|gb|EDO84649.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 406e] >gi|157936229|gb|EDO91899.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei Pasteur 52237] >gi|160699046|gb|EDP89016.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 10399] >gi|169654447|gb|EDS87140.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei S13] (293 aa)
Score = 622, Expect = 7.0e-63, Identities = 124/294 (42%), Positives = 194/294 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++      D P +KQ +++F+  + S++GV+E+  ++   YGI+D  E  D     +++  ++EKP P ++PSN  ++GRYVL P IF  L   +    GE+++T ++  L   E V A  + G R+D GSK+GYLKAT++ +L  P+V+ E   Y++   ET
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLL----DGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWED---SIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLADEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFETYLRSRSET 290
>gi|169182095|ref|ZP_02842614.1| UTP-glucose-1-phosphate uridylyltransferase [Thauera sp. MZ1T] >gi|169010790|gb|EDS57553.1| UTP-glucose-1-phosphate uridylyltransferase [Thauera sp. MZ1T] (301 aa)
Score = 622, Expect = 7.2e-63, Identities = 125/289 (43%), Positives = 182/289 (62%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+VTKA+ P AGMGTRFLPATKA PKEMLPI+DKP IQ+ VEEAVA+GI D++ I  + K SI DHFD  +ELE  L+ + K +  ++VR  +    +  YIRQ E +GLGHA+  A   + +E FA++L DD++  +N+   P LKQ ++++     S++G   V  +E   YGI+        K Q  R+  ++EKP P  +P+  A++GRY+LTP IF  +   +    GE ++T ++ +L ++E V A  F G RYD GSK+GYLKAT++  L  P+   +   Y+
  S:     2 KKVTKAIFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVAAGITDMIFITGRTKRSIEDHFDKAYELETELEARGKKQLLEIVRQTVPKGVNCIYIRQSEALGLGHAVRCASHVVSDEAFAVILADDLL--DNKDGTPVLKQMVDVYNYHRCSVLGTMNVPREETRSYGIVSTESD---KGQVQRMTGIVEKPKPEEAPTTQAVVGRYILTPRIFDHIRALKPGAGGEYQLTDAIASLLKEEAVLAFQFDGVRYDCGSKLGYLKATIEFGLRHPETGGDFAAYL 286
>gi|116671410|ref|YP_832343.1| UDP-glucose pyrophosphorylase [Arthrobacter sp. FB24] >gi|116611519|gb|ABK04243.1| UDP-glucose pyrophosphorylase [Arthrobacter sp. FB24] (301 aa)
Score = 622, Expect = 7.8e-63, Identities = 133/287 (46%), Positives = 194/287 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLA----QKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           V KAVIPAAG+GTRFLPATKAMPKEMLP++DKP IQ++VEEAV  G+ DIL+I  + K ++ DHFD    LE  L+ K      + ++  S++  IHY+RQ +PMGLGHA+  AK+ +G+EPFA+LLGDD+I   ++     L + IE+  +   S+V + EVE  ++S YG  D +++ D+    +R++ ++EKPD + +PSN A++GRYVL P++F  LE T+    GEI++T +L  LA    +  GVY  VF G+RYD G K+ YLKA + ++    D+   L E++
  S:     8 VRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVNVGLTDILMITGRNKRALEDHFDRVPSLEATLEAKGDTAKLEAIQAASNLGDIHYVRQGDPMGLGHAVLRAKQHVGHEPFAVLLGDDLIDARDE----LLSKMIEVQAKTGGSVVALIEVEPSQISAYGCAD-IDETDMNG-FVRIRKLVEKPDAAEAPSNLAVIGRYVLHPAVFDVLERTEPGRGGEIQLTDALQELAAGEGEGYGVYGVVFRGRRYDTGDKLSYLKACVQLACDSDDLGPGLREWL 292
>gi|59710949|ref|YP_203725.1| glucose-1-phosphate uridylyltransferase [Vibrio fischeri ES114] >gi|163730493|ref|ZP_02137966.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio fischeri MJ11] >gi|59479050|gb|AAW84837.1| glucose-1-phosphate uridylyltransferase [Vibrio fischeri ES114] >gi|161396127|gb|EDQ20423.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio fischeri MJ11] (289 aa)
Score = 622, Expect = 8.2e-63, Identities = 128/269 (47%), Positives = 179/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+S+MDHFD  +ELE ++   NK E  + VR + D AH  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   Q     L Q + L+++   SIV V+EV   E  KYG+I       +K    RV NM+EKP+P  +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +LL  AQ   V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAINAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTNKEELLEDVRELIDSAHFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEEQG---VLAQMVALYKQFRCSIVAVEEVPDNETHKYGVISGEM---IKDDLYRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAQSGCVLAYKFKGKRFDCGSVEGYIEAT 264
>gi|167743423|ref|ZP_02416197.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 14] (295 aa)
Score = 622, Expect = 8.3e-63, Identities = 123/289 (42%), Positives = 194/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YGI++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALQHPEVGREFEAYLR 285
>gi|194513388|ref|YP_002025911.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei Pasteur 52237] >gi|157933940|gb|EDO89610.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei Pasteur 52237] (294 aa)
Score = 621, Expect = 8.9e-63, Identities = 123/289 (42%), Positives = 194/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YGI++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     2 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLR 284
>gi|53716318|ref|YP_106267.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 23344] >gi|53722702|ref|YP_111687.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei K96243] >gi|126443256|ref|YP_001063416.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 668] >gi|126456586|ref|YP_001076316.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106a] >gi|134278133|ref|ZP_01764847.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 305] >gi|161355787|ref|ZP_02101666.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106b] >gi|161368483|ref|ZP_02108054.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1710a] >gi|166999460|ref|ZP_02265299.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei PRL-20] >gi|167724464|ref|ZP_02407700.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei DM98] >gi|167820612|ref|ZP_02452292.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 91] >gi|167828968|ref|ZP_02460439.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 9] >gi|167850446|ref|ZP_02475954.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei B7210] >gi|167899038|ref|ZP_02486439.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 7894] >gi|167908478|ref|ZP_02495683.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei NCTC 13177] >gi|167915726|ref|ZP_02502817.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 112] >gi|167923565|ref|ZP_02510656.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei BCC215] >gi|194501405|ref|YP_002030985.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1655] >gi|194519016|ref|YP_002054218.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei S13] >gi|194567391|ref|YP_002102400.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 406e] >gi|52213116|emb|CAH39155.1| putative UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei K96243] >gi|52422288|gb|AAU45858.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia mallei ATCC 23344] >gi|126222747|gb|ABN86252.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 668] >gi|126230354|gb|ABN93767.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1106a] >gi|134249917|gb|EBA49997.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 305] >gi|157811283|gb|EDO88453.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 406e] >gi|169651132|gb|EDS83825.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei S13] >gi|184215614|gb|EDU12595.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei 1655] (295 aa)
Score = 621, Expect = 8.9e-63, Identities = 123/289 (42%), Positives = 194/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YGI++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLR 285
>gi|169174679|ref|ZP_02836569.1| UTP-glucose-1-phosphate uridylyltransferase [Arthrobacter chlorophenolicus A6] >gi|169017099|gb|EDS63580.1| UTP-glucose-1-phosphate uridylyltransferase [Arthrobacter chlorophenolicus A6] (296 aa)
Score = 621, Expect = 9.3e-63, Identities = 130/295 (44%), Positives = 195/295 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           M + VTKAVIPAAG+GTRFLPATKAMPKEMLP++D+P IQ++VEEA+ SG+ D+L+I  + K ++ DHFD    LE  L+QK   +  + ++  S++  IHY+RQ E  GLGHA+   K+ +GNEPFA+LLGDD+I       +  L   I++ ++   S++ + EV+  ++S YG  D + +V+     +RV +++EKP  + +PSN A++GRYVL P++F  LE T      EI++T +L  LA  E    GVY  VF G+R+D G K+ YLKA + I+  + +  ++L  ++K  V
  S:     3 MGRAVTKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVEEAIKSGLNDVLMITGRSKRALEDHFDRAPGLERLLEQKGDKDRLQSIQAASELGPIHYVRQGEAKGLGHAVLCGKQHVGNEPFAVLLGDDLI----DEAEDLLSTMIDVQQKTGGSVIALIEVDPSQISAYGCAD-ISRVE-GEDYVRVNSLVEKPAAADAPSNLAVIGRYVLHPAVFGILENTAPGRGNEIQLTDALQTLAAGEGEGSGVYGVVFKGRRFDTGDKLSYLKAVITIASERVEFGEDLKTWLKGFV 295
>gi|29654177|ref|NP_819869.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii RSA 493] >gi|153208008|ref|ZP_01946542.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii 'MSU Goat Q177'] >gi|154707388|ref|YP_001424297.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|161831598|ref|YP_001596855.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii RSA 331] >gi|29541443|gb|AAO90383.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii RSA 493] >gi|120576208|gb|EAX32832.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii 'MSU Goat Q177'] >gi|154356674|gb|ABS78136.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|161763465|gb|ABX79107.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii RSA 331] (295 aa)
Score = 621, Expect = 9.6e-63, Identities = 126/292 (43%), Positives = 195/292 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM-KLL 294
           K+VT AV P AG+GTRFLP TKA PKEMLPI+DKP IQ++VEEA+A+GI  ++ + S  K +I D+FD  +ELE RL+   K++  KL++N +     I Y+RQ  P+GLG A+  AK  +G++PFA+LL DD+I   +  +K  L+  +E FE+   +I+ V++V   +  KYGI+  +++  +K    R+  M+EKP    + S++A+ GRY+L+P +F  L+       GEI++T +++ L Q+E V A  F G RYD GS++G+L+AT+  +L +P+ ++ L EY+ KLL
  S:     2 KKVTTAVFPVAGLGTRFLPVTKAGPKEMLPIVDKPIIQYVVEEAIAAGITHLVFVTSSSKRAIEDYFDSNYELETRLRSSRKLDALKLIQNLLPKEVRISYVRQAHPLGLGDAVLSAKHVVGDQPFAVLLPDDII---DCGEKSCLQLMMEAFEKHQRNIIAVEQVPLNQTDKYGIVSVVDEHQVK----RITGMVEKPPLGSALSDWAVTGRYILSPRVFDHLDAISCGVGGEIQLTDAIVALLQEEQVLAFPFKGHRYDCGSRLGFLQATIAYALKRPEFKEPLREYLFKLL 288
>gi|117923650|ref|YP_864267.1| UDP-glucose pyrophosphorylase [Magnetococcus sp. MC-1] >gi|117607406|gb|ABK42861.1| UDP-glucose pyrophosphorylase [Magnetococcus sp. MC-1] (293 aa)
Score = 621, Expect = 1.0e-62, Identities = 124/289 (42%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATK +PKEML ++D P IQ+ VEEA  +GIE++++I  + K+ +MD FD+ +ELE+ L+++ K     +    I     +   RQ++P+GLGHA+  A+  +G+EPFA++L DD++     + KP LKQ +E FEE   SIV V EV   + +KYGI+D   +   +    R+K ++EKPDPS+SPSN AI+GRY+LTP IF  LE       GEI++T ++  L + + +Y   F G R+D G K G+  A+L +S+ +P+++D++L +++
  S:     3 KVRKAVFPVAGLGTRFLPATKVVPKEMLSVVDTPLIQYAVEEAWDAGIEEVILITGRGKSLLMDQFDHMYELEDTLRRQGKEVLLSVSHEPIPFPGTVVATRQQDPLGLGHAVWCARYLVGDEPFAVILPDDLV----HAQKPVLKQMVERFEELQSSIVAVMEVAPDQTNKYGILDSEPE---QNGVWRIKGLVEKPDPSVSPSNLAIIGRYILTPEIFCLLESIPRGAGGEIQLTDAMAALLKHQSIYGMRFEGTRFDCGDKAGFQMASLALSMERPELKDQMLAFIQ 285
>gi|171060296|ref|YP_001792645.1| UTP-glucose-1-phosphate uridylyltransferase [Leptothrix cholodnii SP-6] >gi|170777741|gb|ACB35880.1| UTP-glucose-1-phosphate uridylyltransferase [Leptothrix cholodnii SP-6] (288 aa)
Score = 621, Expect = 1.1e-62, Identities = 125/291 (42%), Positives = 189/291 (64%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI--SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           +V KA+ P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA A+G+ +++ +  ++K  I DHFD  FELE  L+Q NK+E  ++VR++   DM  I Y+RQ + +GLGHA+   +R +GNEPFA+LL DD+++     + P L Q  E ++E   SI+ VQEV  +   +YGI+       +  + M V  ++EKP P  +PS + + GRY+LTP +F E+        GEI++T  +  L ++E V+A  + GKRYD GSK G+L+A ++++L   ++ D    Y++ L
  S:     2 QVKKAIFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGVREMIFVTGRHKRPIEDHFDMTFELEVALEQANKLELLEVVRSVKPKDMECI-YVRQAQALGLGHAVLCGQRLVGNEPFAVLLADDLMI----GEPPVLAQMAEQYKEWRASILAVQEVPAEHTKRYGIV---AGTLVNDRVMDVTKIVEKPSPEEAPSRWGVAGRYILTPGVFHEIATQPRGVGGEIQLTDGIAALLRREKVFAYRYEGKRYDCGSKEGWLQANVELALQHRELGDHFRSYLRQL 286
>gi|89075306|ref|ZP_01161733.1| UTP--glucose-1-phosphate uridylyltransferase [Photobacterium sp. SKA34] >gi|89048987|gb|EAR54555.1| UTP--glucose-1-phosphate uridylyltransferase [Photobacterium sp. SKA34] (290 aa)
Score = 620, Expect = 1.1e-62, Identities = 126/269 (46%), Positives = 179/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ V+EA+ +G+  I I+  + KN++MDHFD  +ELE ++   NK E    +R+I D A+  YIRQ+E  GLGHAI   +  +GNEPFA++L DD+ V  ++  +  L Q  EL+++   SIV V+EV  ++  KYG+I       L+    RV NM+EKP+P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F GKR+D GS  GY+ AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGMNRICIVTGRGKNTLMDHFDKNYELEHQISGTNKEELLVDIRDIIDSAYFTYIRQREMKGLGHAILTGRELVGNEPFAVVLADDLCV-TDEEQQGVLAQMAELYKQFRCSIVAVEEVPEEDTHKYGVISGQM---LRDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDIIEQTEPGKGGEIQITDALMQQAQTGCVLAYKFKGKRFDCGSVEGYIDAT 266
>gi|77165743|ref|YP_344268.1| UTP--glucose-1-phosphate uridylyltransferase [Nitrosococcus oceani ATCC 19707] >gi|76884057|gb|ABA58738.1| UDP-glucose pyrophosphorylase [Nitrosococcus oceani ATCC 19707] (297 aa)
Score = 620, Expect = 1.2e-62, Identities = 135/295 (45%), Positives = 196/295 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI--SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           M K +TKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEAV +GI+ ++ +  + K  I DHFD  +ELE  L+++ K +  KLV++I   D+  + YIRQ+E +GLGHA+  A   +G EPFA++L DD+I   +   +  L Q ++ F + + S+VGV+EV      +YGII P    D   +  +V+ ++EKP+P+ +PS+ A++GRY+LTP IF  LE T     GEI++T +L  L  +E ++A  F GKRYD GSK+GYL+AT++  L   ++ D   +Y+  LV
  S:     1 MTKPITKAVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGIKVMVFVTGRNKRPIPDHFDMAYELEAELERRGKNKLLKLVQDIIPRDVTCV-YIRQEETLGLGHAVLCAAPVVGEEPFAVILADDLI---DAGMEGCLSQMVKQFSKHHCSLVGVEEVASDSTDQYGIIQPGLAED---REYKVEGIVEKPEPAEAPSSLAVVGRYILTPRIFSLLEATPHGVGGEIQLTDALATLLSEEYMFAYRFEGKRYDCGSKLGYLQATVEYGLKHTELGDPFRDYLCGLV 290
>gi|83855398|ref|ZP_00948928.1| UDP-glucose pyrophosphate [Sulfitobacter sp. NAS-14.1] >gi|83941922|ref|ZP_00954384.1| UDP-glucose pyrophosphate [Sulfitobacter sp. EE-36] >gi|83843241|gb|EAP82408.1| UDP-glucose pyrophosphate [Sulfitobacter sp. NAS-14.1] >gi|83847742|gb|EAP85617.1| UDP-glucose pyrophosphate [Sulfitobacter sp. EE-36] (299 aa)
Score = 620, Expect = 1.2e-62, Identities = 121/296 (40%), Positives = 203/296 (68%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSL-LNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           M K+VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + + S+ K ++ D+FD+   LE+ L+ K K E  +++++ + D   I YIRQ + +GLGHA+  A+R IGNEPFA++L DDVI     +DKP L+Q IE + E   ++V   EV  ++ S YG++D +++     + ++VK M+EKP    +PSN A++GRY+L+P++ K L + +    GEI++T ++   L Q   VY   F G+R+D GSK G+L+AT+   L++ ++RD+L  Y++ +++
  S:     1 MAKKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHSPVLEQELRSKGKTELMEILKSTNMDSGAIAYIRQHKALGLGHAVWCARRLIGNEPFAVMLPDDVIA----ADKPCLQQMIEAYNETGGNMVAAMEVNPEKSSSYGMLD-IDEGQTDGELVKVKGMVEKPKAEDAPSNLAVIGRYILSPNVLKNLNQLKSGSGGEIQLTDAIAAELTQGNDVYGYRFKGQRFDCGSKSGFLQATVSFGLAREELRDDLRAYLQDIMQ 293
>gi|184200334|ref|YP_001854541.1| UTP--glucose-1-phosphate uridylyltransferase [Kocuria rhizophila DC2201] >gi|183580564|dbj|BAG29035.1| UTP--glucose-1-phosphate uridylyltransferase [Kocuria rhizophila DC2201] (302 aa)
Score = 620, Expect = 1.2e-62, Identities = 132/295 (44%), Positives = 193/295 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID--PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQK----EGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           KRV KAVIPAAG+GTRFLPATKAMPKEMLP++D+P IQ++V+EAV +G++D+L+I  + K ++ DHFD    LE +LK+  K      V + S++  IHY+RQ++P GLGHA+  AK  +G +PFA+LLGDD+I       +  L + IE+ E    S+V + EV  + +S YG  D   LE  D     +R+  ++EKP P  +PSN AI+GRYVL P IF+ LE T      EI++T ++  +A +     G+Y  VF G+R+D G K+ YLKA ++++  + D+   L  ++K   +T
  S:     7 KRVHKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVQEAVDAGLDDVLMITGRSKRALEDHFDRVPALEAQLKESGKDALLAGVEHASELGEIHYLRQQDPKGLGHAVLRAKTHVGQDPFAVLLGDDLI----DEKEDLLSRMIEVQERTGGSVVALMEVPRENISAYGCADVTVLEGED----HVRINGLVEKPAPEDAPSNLAIIGRYVLHPEIFEILENTAPGRGDEIQLTDAMQTIADRGDSAHGMYGVVFKGRRFDTGDKLSYLKANIELACEREDLGPGLRSWIKDYAQT 299
>gi|148273630|ref|YP_001223191.1| putative UTP-glucose-1-phosphate uridylyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831560|emb|CAN02527.1| putative UTP-glucose-1-phosphate uridylyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (298 aa)
Score = 620, Expect = 1.2e-62, Identities = 129/297 (43%), Positives = 192/297 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M   +TKAVIPAAG+GTRFLPATKAMPKEMLP++D+P IQ++VEEAV +G+ D+L+I  + K ++ +HFD   ELE  L+ K      + V   +D+A +HY+RQ +P GLGHA+  A+  +G EPFA+LLGDD+I + +      L + IE+  ++  S+V + EV+  +   YG+   +E+ D     +R+  M+EKP    +PSN AI+GRYVL P +F  L +T+    GEI++T +L  +A       GVY  VF G+RYD G ++ YLKA + + +   D+ + L E++   V+T
  S:     1 MVTHITKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVEEAVGAGLHDVLMITGRNKTALENHFDRNAELEATLQLKGDDAKLRKVNESTDLADMHYVRQGDPKGLGHAVLRAEMHVGREPFAVLLGDDIIDKRDV----LLSRMIEVQLQRGCSVVALLEVDPSQTHLYGVAT-VEETD-DDDVVRITGMVEKPAAGTAPSNLAIIGRYVLRPEVFDVLHKTEPGKGGEIQLTDALEKMAAAPEWTGGVYGVVFRGRRYDTGDRLDYLKAIVQLGVDHEDLGEGLREWLPEFVKT 295
>gi|187920942|ref|YP_001889974.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phytofirmans PsJN] >gi|187719380|gb|ACD20603.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia phytofirmans PsJN] (293 aa)
Score = 620, Expect = 1.4e-62, Identities = 123/288 (42%), Positives = 194/288 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKA+ P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P + Q IE+F+  + S++GV+E+  +E   YGI+D  +  D     +++  ++EKP+PS++PSN  ++GRYVL P IF+ L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +   Y+
  S:     3 KVTKAIFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVMCAEKLVGDNPFAVILADDLLY----GTPPVMTQMIEVFDHYHSSVIGVEEIPAEETRSYGIVDGKKWED---SIIKMSRIVEKPEPSMAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLADEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEGYL 284
>gi|110677773|ref|YP_680780.1| UTP--glucose-1-phosphate uridylyltransferase [Roseobacter denitrificans OCh 114] >gi|109453889|gb|ABG30094.1| UTP--glucose-1-phosphate uridylyltransferase [Roseobacter denitrificans OCh 114] (297 aa)
Score = 620, Expect = 1.4e-62, Identities = 124/299 (41%), Positives = 201/299 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE-GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M ++VTKA+ P AGMGTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GI++ + + S+ K ++ D+FD+  +LE+ L+ K K +  +++ N + +   I YIRQ + +GLGHA+  A+R I +EPFA++L DDVI      DKP L+Q +E +EE   ++V   EV  ++ S YG++D    ++    SM RVK M+EKP    +PSN A++GRY+L PS+   L + +    GE+++T ++    +K+ GVY   F G+R+D GSK G+L+AT+   L++ D+RD+L  Y+  +V  +K
  S:     1 MTRKVTKAIFPVAGMGTRFLPATKSVPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHAPQLEQSLRDKGKTKLLEMLENTNMESGAIAYIRQHKALGLGHAVWCARRLIADEPFAVILPDDVIA----GDKPCLQQMVEAYEETGGNMVAAMEVPPEKASSYGMLD----IETDMGSMVRVKGMVEKPPEGKAPSNLAVIGRYILAPSVLSNLNDMKKGAGGEVQLTDAIATEIEKDHGVYGYRFQGQRFDCGSKSGFLQATVSFGLARDDLRDDLSRYIHEIVSMSK 294
>gi|83717901|ref|YP_438898.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis E264] >gi|83651726|gb|ABC35790.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis E264] (294 aa)
Score = 620, Expect = 1.4e-62, Identities = 122/289 (42%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E  +   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     2 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIERDDSRSYGVVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATIELALQHPEVGREFEAYLR 284
>gi|167577272|ref|ZP_02370146.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis TXDOH] >gi|167615411|ref|ZP_02384046.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis Bt4] (295 aa)
Score = 620, Expect = 1.4e-62, Identities = 122/289 (42%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E  +   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIERDDSRSYGVVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATIELALQHPEVGREFEAYLR 285
>gi|167840354|ref|ZP_02467038.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia thailandensis MSMB43] (295 aa)
Score = 619, Expect = 1.5e-62, Identities = 122/289 (42%), Positives = 194/289 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGVVEGRE---WEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALQHPEVGREFEAYLR 285
>gi|165918932|ref|ZP_02219018.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii RSA 334] >gi|165917402|gb|EDR36006.1| UTP-glucose-1-phosphate uridylyltransferase [Coxiella burnetii RSA 334] (295 aa)
Score = 619, Expect = 1.8e-62, Identities = 126/292 (43%), Positives = 195/292 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM-KLL 294
           K+VT AV P AG+GTRFLP TKA PKEMLPI+DKP IQ++VEEA+A+GI  ++ + S  K +I D+FD  +ELE RL+   K++  KL++N +     I Y+RQ  P+GLG A+  AK  +G++PFA+LL DD+I   +  +K  L+  +E FE+   +I+ V++V   +  KYGI+  +++  +K    R+  M+EKP    + S++A+ GRY+L+P +F  L+       GEI++T +++ L Q+E V A  F G RYD GS++G+L+AT+  +L +P+ ++ L EY+ KLL
  S:     2 KKVTTAVFPVAGLGTRFLPVTKAGPKEMLPIVDKPIIQYVVEEAIAAGITHLVFVTSSSKRAIEDYFDSNYELETRLRSSRKLDALKLIQNLLPKEVRISYVRQAHPLGLGDAVLSAKHVVGDQPFAVLLPDDII---DCGEKSCLQLMMEAFEKHQRNIIAVEQVPLNQTDKYGIVSVVDEHQVK----RITGMVEKPPLGSALSDWAVNGRYILSPRVFDHLDAISCGVGGEIQLTDAIVALLQEEQVLAFPFKGHRYDCGSRLGFLQATIAYALKRPEFKEPLREYLFKLL 288
>gi|194343819|gb|EDX24785.1| UTP:glucose-1-phosphate uridylyltransferase [Streptomyces sp. Mg1] (300 aa)
Score = 619, Expect = 1.8e-62, Identities = 128/291 (43%), Positives = 190/291 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGI--IDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEG----VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           + KAVIPAAG+GTRFLPATKA PKEMLP++DKP IQ++VEEAV++G++D+L+I  + K  + DHFD  +ELE  L  K   +  K V+  SD+A +HY+RQ +P GLGHA+  A+  +G EPFA+LLGDD+I        P L+  ++L      ++V + EV+   +  YG   ++P +   +    +RV  ++EKPD + +PSNYA++GRYVL P+IF  L ET+    GEI++T +L  LA  E     V+  VF G+RYD G +  YL+A + ++  + D+  E   +++  V
  S:     8 IKKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVSAGLDDVLMITGRNKRPLEDHFDRNYELESALIAKGDDDRLKKVQESSDLATMHYVRQGDPRGLGHAVLCAEPHVGREPFAVLLGDDLI----DPRDPLLRDMVDLQARTGGTVVALMEVDPSSIHLYGCAAVEPTDDPAV----VRVTGLVEKPDAADAPSNYAVIGRYVLNPAIFGILRETEPGRGGEIQLTDALQKLAADESVGGPVHGVVFRGRRYDTGDRGDYLRAIVRLACEREDLGPEFRTWLRRYV 296
>gi|42561506|ref|NP_975957.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42493005|emb|CAE77599.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (290 aa)
Score = 619, Expect = 1.8e-62, Identities = 138/292 (47%), Positives = 195/292 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           + KAVIP AG GTRFLP TK+  KEMLPI+D PTI++IV+EAV SGI++ILII++  K+ IM++F    +LE  L  K K+ + + ++   D A+IHYI Q EP+GLGHAI++ K FI NE FA+LLGDD+     +   PA+KQ ++L+EEK  +I+G   ++ K+  KY I   +E  D      +V ++IEKPD   +PSN AI GRY+LTP IF  L+       GEIE+T S+L        YAKV  GKRYDIG+K+GYL+A +D +L++ D ++E ++ +K + E
  S:     3 IRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAVDSGIKEILIILNDKKSEIMNYFSRNIQLEGFLYNKGKIAELEQIKTKYD-ANIHYIIQDEPLGLGHAISLCKGFINNESFAVLLGDDLF----KCQTPAIKQLMDLYEEKQSTILGTILIDKKDCKKYEICK-IESSD--DNVYKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGETGEIELTDSILKTISDVDCYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNEFIKLVKKINE 286
>gi|170780502|ref|YP_001708834.1| UTP-glucose-1-phosphate uridylyltransferase [Clavibacter michiganensis subsp. sepedonicus] >gi|169155070|emb|CAQ00168.1| UTP-glucose-1-phosphate uridylyltransferase [Clavibacter michiganensis subsp. sepedonicus] (298 aa)
Score = 619, Expect = 1.9e-62, Identities = 129/297 (43%), Positives = 191/297 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           M   +TKAVIPAAG+GTRFLPATKAMPKEMLP++D+P IQ++VEEAV +G+ D+L+I  + K ++ +HFD   ELE  L+ K      + V   +D+A +HY+RQ +P GLGHA+  A+  +G EPFA+LLGDD+I + +      L + IE+  ++  S+V + EV+  +   YG+   +E  D     +R+  M+EKP    +PSN AI+GRYVL P +F  L +T+    GEI++T +L  +A       GVY  VF G+RYD G ++ YLKA + + +   D+ + L E++   V+T
  S:     1 MVTHITKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVEEAVGAGLHDVLMITGRNKTALENHFDRNAELEATLQLKGDDAKLRKVNESTDLADMHYVRQGDPKGLGHAVLRAEMHVGREPFAVLLGDDIIDKRDV----LLSRMIEVQLQRGCSVVALLEVDPAQTHLYGVAT-VEATD-DDDVVRITGMVEKPAAGTAPSNLAIIGRYVLRPEVFDVLHKTEPGKGGEIQLTDALEKMAAAPEWTGGVYGVVFRGRRYDTGDRLDYLKAIVQLGVDHEDLGEGLREWLPEFVKT 295
>gi|51243874|ref|YP_063758.1| UTP-glucose-1-phosphate uridylyltransferase [Desulfotalea psychrophila LSv54] >gi|50874911|emb|CAG34751.1| probable UTP-glucose-1-phosphate uridylyltransferase [Desulfotalea psychrophila LSv54] (288 aa)
Score = 618, Expect = 1.9e-62, Identities = 125/291 (42%), Positives = 190/291 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           RV KA+ P AG+GTRFLPATKAMPKEMLP++DKP IQ+ VEEA+ASGIE ++ +    K+++ +HFD  ++LE+ L+++ K E  + V + +     I Y RQ +P+GLGHAI  A+  +G+EPFA+LL DD+I    +S+KP L+Q I  F+    S+V   EV  +E ++YGI   LE   +    +++ +M+EKP P  +PSN A +GRY+ TP IF  L + Q    GEI++T +++ L  ++ ++   F G R+D G K+G+ KA +  +L  P++   L EY++ L
  S:     2 RVKKAIFPVAGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEALASGIEQLIFVTGSGKSALENHFDSSYQLEDTLRKRGKDELLRTVESLVPASGSIIYTRQSQPLGLGHAIWCARDVVGDEPFAVLLADDLI----KSEKPVLQQMIHQFDRLRASMVATIEVPREETNRYGI---LEGETVYDGILQISSMVEKPKPEDAPSNLAAIGRYIFTPRIFDFLGKQQTGAGGEIQVTDAMVALLAEQPIFGVGFEGTRFDCGDKVGFQKANIAFALEHPEIGGPLREYLQGL 286
>gi|62425798|ref|ZP_00380929.1| COG1210: UDP-glucose pyrophosphorylase [Brevibacterium linens BL2] (303 aa)
Score = 617, Expect = 3.0e-62, Identities = 134/296 (45%), Positives = 193/296 (65%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE---GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           ++ V KAVIP AG+GTRFLPATKA PKEMLP++DKP IQ++VEEA  +G++D+L+I  + K  + DHFD    LE  L +K   +    VR+ S++A IHY+RQ +P GLGHA+   ++ +G EPFA+LLGDD+I + +    P L + IE+ EE   S+V + EV  + +  YG    +E  D   + ++V  ++EKP+   +PSN AI+GRYVL P IF  LE T+     EI++T +L  LA++E   GVY  +F G RYD G K+ YLKA + I+ S+ D+  +L  ++K  V T
  S:     9 QRTVRKAVIPVAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAADAGLQDLLMITGRNKRPLEDHFDRVDGLEAALAKKGDDKKLAAVRHASELADIHYVRQGDPKGLGHAVLKGRQHVGKEPFAVLLGDDLIDERS----PILPKMIEVAEETGGSVVALMEVPPEAIHLYGCA-AVEATD-DDEVVKVTGLVEKPETGEAPSNLAIIGRYVLAPEIFDVLETTEPGRGNEIQLTDALQVLAEQEGGNGVYGVIFKGARYDTGDKLDYLKAVVQIASSREDLGADLNSWLKEYVAT 301
>gi|114764087|ref|ZP_01443326.1| UDP-glucose pyrophosphate [Roseovarius sp. HTCC2601] >gi|114543445|gb|EAU46460.1| UDP-glucose pyrophosphate [Roseovarius sp. HTCC2601] (297 aa)
Score = 617, Expect = 3.0e-62, Identities = 124/299 (41%), Positives = 197/299 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M  +VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + + S+ K+++ D+FD+  +LE+ L+ K K +   ++++   D   I YIRQ + +GLGHA+  A+R IG+EPFA++L DDVI     +DKP L+Q +E ++E   ++V   EV   + S YGI+D  E +      + VK M+EKP    +PSN A++GRY+L+P I + L+       GEI++T ++   +   EGVY   F G+RYD GSK G+L+AT+   LS+ D+RD+L  Y+  +V   K
  S:     1 MSNKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSRGKSALEDYFDHAPQLEQELEAKGKDKLLGVLKDTYMDSGEIAYIRQHKALGLGHAVWCARRLIGDEPFAVMLPDDVIA----ADKPCLQQMVEAYQETGGNMVAAMEVPADKASAYGILDVQEDMG---SMVSVKGMVEKPKAGEAPSNLAVIGRYILSPKILENLDAKTTGAGGEIQLTDAIAKEINGDEGVYGYRFNGQRYDCGSKAGFLQATVAFGLSRDDLRDDLEAYLHEVVSARK 294
>gi|170702109|ref|ZP_02893021.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria IOP40-10] >gi|170132984|gb|EDT01400.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria IOP40-10] (294 aa)
Score = 617, Expect = 3.1e-62, Identities = 122/289 (42%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P ++PSN  ++GRY+L P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKAKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIVKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGTEFDAYLR 285
>gi|118052730|ref|ZP_01521276.1| UTP-glucose-1-phosphate uridylyltransferase [Comamonas testosteroni KF-1] >gi|117999860|gb|EAV14018.1| UTP-glucose-1-phosphate uridylyltransferase [Comamonas testosteroni KF-1] (288 aa)
Score = 616, Expect = 3.5e-62, Identities = 130/284 (45%), Positives = 188/284 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI--SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           +VTKAV P AGMGTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI++++ +  + K SI DHFD  +ELE  L+++ K E    VR++  SDM  + +IRQ E +GLGHA+  A+  +GNEPFA+LL DD++      +   ++Q +++++    S++GVQ+V  ++   YGI+D      LK     V  ++EKP P  +PS  A++GRYVLTP IF  L        GEI++T  +  L ++E V A  + GKRYD GSKIGYL+ATL ++   P+V ++ 
  S:     2 KVTKAVFPVAGMGTRFLPATKASPKEMLPVVDKPLIQYAVEEALAAGIKEMVFVTGRSKRSIEDHFDKAYELENELERRGKTEMLNYVRSLMPSDMKCV-FIRQAEALGLGHAVLCAQPVVGNEPFAVLLADDLL----DGEPAVMRQMVDVYDYYKCSVLGVQQVPREDTRSYGIVD---SKPLKEGLEAVHAIVEKPKPEEAPSTLAVVGRYVLTPRIFHHLAHLGKGAGGEIQLTDGIAALMKEEQVLAYRYQGKRYDCGSKIGYLEATLAMARKHPEVGEQF 279
>gi|78060498|ref|YP_367073.1| UDP-glucose pyrophosphorylase [Burkholderia sp. 383] >gi|77965048|gb|ABB06429.1| UDP-glucose pyrophosphorylase [Burkholderia sp. 383] (294 aa)
Score = 616, Expect = 3.7e-62, Identities = 119/290 (41%), Positives = 192/290 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKL 293
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G++PFA++L DD++        P L+Q I++F+  + S++GV+E+  +    YG+ID     D      ++  ++EKP+P+ +PSN+ ++GRYVL P +F+ L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +   Y+ +
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIDAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKP-SHVDCFYVRQAEALGLGHAVLCAEKLVGDQPFAVILADDLL----DGPTPVLRQMIDVFDHYHASVIGVEEIAPEASKSYGVIDGKRWED---NLFKLSGIVEKPEPAKAPSNFGVVGRYVLKPKVFEHLRALRPGAGGELQLTDAIQSLLTDEQVLAHRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFESYLAM 286
>gi|83319439|ref|YP_424059.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283325|gb|ABC01257.1| UTP-glucose-1-phosphate uridylyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (292 aa)
Score = 616, Expect = 3.8e-62, Identities = 136/293 (46%), Positives = 199/293 (67%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++ KA+IP AG GTRFLP TK+  KEMLPI+DKP I+FIV+EA+ SGIE+ILII+   KN I +HF+   ELE  L +KNK+ + +L+    + A I+Y+ Q+E +GLGHAI++AK FI +EPFA+LLGDD+     +   PA+KQ IE++++ + +++G   ++ +   KYGI     Q +L ++ + +V  ++EKP+P  SPSN AI GRYVL P +FK L+       GEIE+T S+L    +   YAK+  G RYDIG+K+GYL A LD  L + D+++E L+ ++  VE
  S:     2 KIRKAIIPCAGFGTRFLPFTKSQAKEMLPIIDKPAIEFIVKEAINSGIEEILIIIRAGKNHIANHFNRNIELEYFLAEKNKISELQLISEKYN-ATIYYLIQEEQLGLGHAISLAKDFIKDEPFAVLLGDDLF----KCKIPAIKQLIEIYDKYHQNVLGTIYIDKQNSKKYGIC----QGNLVSKDVYKVDLVVEKPEPENSPSNIAIGGRYVLLPEVFKYLDMKIKGKSGEIELTDSILKTMDESECYAKIIDGSRYDIGNKLGYLDAILDFGLEREDLKEEFLDLIETKVE 286
>gi|56479082|ref|YP_160671.1| UDP-glucose pyrophosphorylase EpsT [Azoarcus sp. EbN1] >gi|56315125|emb|CAI09770.1| UDP-glucose pyrophosphorylase EpsT [Azoarcus sp. EbN1] (290 aa)
Score = 616, Expect = 3.8e-62, Identities = 129/289 (44%), Positives = 181/289 (62%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLV-RNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+VTKAV P AGMGTRFLPATKA PKEMLPI+DKP IQ+ VEEAVA+GI D++ I  + K SI DHFD  +ELE  L+ + K E   LV R +    +  YIRQ E +GLGHA+  A   IG+E FA++L DD++  +N      ++Q + ++     S++G   V  +E  +YGI+    Q   +    RV  +IEKP P  +P+  A++GRY+LTP IF  +   Q    GE ++T ++  L + E V +  F G RYD GSK+GYLKAT+++ L  P++ +E   Y+
  S:     2 KKVTKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVAAGITDMIFITGRTKRSIEDHFDKAYELETELEARGKKEMLALVQRTVPKGVNCIYIRQSEALGLGHAVLCAAPVIGDEAFAVILADDLL--DNPDSASIMEQMVGVYNYNRCSVLGTMNVPREETRQYGIVSTEAQ---QGDVQRVTGIIEKPKPEDAPTTQAVVGRYILTPRIFDHIRALQPGAGGEYQLTDAIAALLKDEAVLSYQFKGVRYDCGSKLGYLKATIELGLRHPEIGEEFAAYL 286
>gi|172065198|ref|YP_001815910.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MC40-6] >gi|171997440|gb|ACB68357.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MC40-6] (294 aa)
Score = 616, Expect = 4.0e-62, Identities = 119/288 (41%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ +GN+PFA++L DD++        P L+Q I++F+  + S++GV+E+  +    YG+I      D      ++  ++EKP+P+ +PSN+ ++GRYVL P +F+ L   ++   GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIDAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKP-SHVDCFYVRQAEALGLGHAVLCAEKLVGNQPFAVILADDLL----DGPTPVLRQMIDVFDHYHASVIGVEEIAPEASKSYGVIAGKRWED---NLFKLSGIVEKPEPAKAPSNFGVVGRYVLKPKVFEHLRALRLGAGGELQLTDAIQSLLADEQVLAHRYEGTRFDCGSKLGYLKATVEFALRHPEVAADFESYL 284
>gi|121727258|ref|ZP_01680417.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae V52] >gi|147673562|ref|YP_001218663.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae O395] >gi|153223243|ref|ZP_01953740.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae MAK 757] >gi|153802213|ref|ZP_01956799.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae MZO-3] >gi|153818260|ref|ZP_01970927.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae NCTC 8457] >gi|121630377|gb|EAX62772.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae V52] >gi|124118340|gb|EAY37083.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae MAK 757] >gi|124122237|gb|EAY40980.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae MZO-3] >gi|126511219|gb|EAZ73813.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae NCTC 8457] >gi|146315445|gb|ABQ19984.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae O395] (307 aa)
Score = 616, Expect = 4.0e-62, Identities = 128/272 (47%), Positives = 178/272 (65%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           K  + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ V+EA+ +GI  + I+  + K+SIMDHFD  +ELE +++  NK E    +R I + A+  +IRQ+E  GLGHAI   K  +G+EPFA++L DD+ V   Q     L Q + L+++   SIV VQEV   E  KYG+I       +K    RV NM+EKP+P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +LL  A+   V A  F GKR+D GS  GY++AT
  S:    16 KMMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQG---VLAQMVALYKQFRCSIVAVQEVPENETHKYGVI---AGEMIKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEAT 281
>gi|62423448|ref|ZP_00378611.1| COG1210: UDP-glucose pyrophosphorylase [Brevibacterium linens BL2] (292 aa)
Score = 616, Expect = 4.3e-62, Identities = 129/291 (44%), Positives = 185/291 (63%)
  Q:     7 KAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNL---AQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           KAVIP AG+GTRFLPATKA PKEMLP++DKP IQ++VEEA  +G+ D+++I  + K  + DHFD    LE  L QK   +    V++ +D+A IHY+RQ +P GLGHA+   ++ +GNEPFA+LLGDD+I + N    P L + IE+ E+   S+V + EV  + +  YG        D   + +++ N++EKP    +PSN A++GRYVL P +F  LE T+     EI++T +L  L   A   GVY  VF G RYD G K+ YLKA + I+  + D+ D+L  +++  V T
  S:     3 KAVIPVAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEATEAGLRDVVMITGRNKRPLEDHFDRVDGLEVALAQKGDEKKLAAVQHSTDLADIHYVRQGDPKGLGHAVLKGRQHVGNEPFAVLLGDDLIDERN----PILPKMIEVAEKTGGSVVALMEVPSEAIHLYGCAAVETTSD--DEVVKINNLVEKPATEDAPSNLAVIGRYVLAPEVFDVLETTKPGRGNEIQLTDALQELAGNADGNGVYGVVFKGARYDTGDKLDYLKAVMQIACDREDLGDDLKAWLREFVPT 290
>gi|10880965|gb|AAG24457.1|AF312223_1 putative UTP-glucose-1-phosphate uridylyltransferase [Burkholderia pseudomallei] (295 aa)
Score = 615, Expect = 4.4e-62, Identities = 122/289 (42%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ V EA+ +GI +++ +  + K +I DHFD  FE+E  L+ + K +  +LVR I   +H+   Y+RQ   +GLGHA+  A++ +  EPFA++L DD++      D+P LKQ +++F   + S++GV+ +E ++   YGI+   E  + +   +++  +IEKP P  +PSN  ++GRYVL PSIF+ L + +    GE+++T ++ +L  +E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVAEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELVRGIKP-SHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLL----HGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIV---EGREWEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLLQIKRGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLR 285
>gi|134291891|ref|YP_001115660.1| UDP-glucose pyrophosphorylase [Burkholderia vietnamiensis G4] >gi|134135080|gb|ABO59405.1| UDP-glucose pyrophosphorylase [Burkholderia vietnamiensis G4] (294 aa)
Score = 615, Expect = 4.4e-62, Identities = 121/288 (42%), Positives = 190/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ +G+ PFA++L DD++        P L+Q I++F+  + S++GV+E+   +   YG+ID     D      ++  ++EKP+P+ +PSN+ ++GRYVL P IFK L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKP-SHVDCFYVRQAEALGLGHAVLCAEKLVGDNPFAVILADDLL----DGPTPVLRQMIDVFDHYHASVIGVEEIAPADSKSYGVIDGKRWED---DLFKLSGIVEKPEPAQAPSNFGVVGRYVLKPKIFKHLRGLKPGAGGELQLTDAIQSLLTDEQVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFERYL 284
>gi|171319521|ref|ZP_02908622.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MEX-5] >gi|171095261|gb|EDT40251.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MEX-5] (294 aa)
Score = 615, Expect = 4.6e-62, Identities = 123/289 (42%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  +IEKP P ++PSN  ++GRY+L P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIVKMSAIIEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGTEFDAYLR 285
>gi|163855221|ref|YP_001629519.1| UTP--glucose-1-phosphate uridylyltransferase [Bordetella petrii DSM 12804] >gi|163258949|emb|CAP41248.1| UTP--glucose-1-phosphate uridylyltransferase [Bordetella petrii] (278 aa)
Score = 615, Expect = 4.7e-62, Identities = 131/270 (48%), Positives = 176/270 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATL 274
           + KAV P AGMGTRFLPATKAMPKEMLP++DKP IQ+ VEEAVA+GI D++ +  + K +I DHFD   ELE  L+ K K E   +VR I   AH++  YIRQ  P+GLGHA+  A   +GNEPFA+LL DD+I     +D P LKQ I+     + S++GVQ+V  ++  KYGI+     +D +T   R+ +++EKP P  +PS  A++GRYVL P IF  L  TQ+    EI++T  +  L     V A  +TG+RYD GSK G  +AT+
  S:     4 IRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDSAPELEADLESKGKHELLAMVRGILP-AHVNCLYIRQAAPLGLGHAVLTAAPAVGNEPFAVLLADDLI----DADTPVLKQLIDASYAHDASVLGVQDVPREDTRKYGIV-AARPIDDRTA--RITHIVEKPAPEEAPSTLAVVGRYVLEPEIFDHLRATQIGAGNEIQLTDGIAALMGARPVLAHRYTGQRYDCGSKAGMFQATV 267
>gi|121606065|ref|YP_983394.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Polaromonas naphthalenivorans CJ2] >gi|120595034|gb|ABM38473.1| UDP-glucose pyrophosphorylase [Polaromonas naphthalenivorans CJ2] (301 aa)
Score = 615, Expect = 5.4e-62, Identities = 125/290 (43%), Positives = 190/290 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII--DPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++VTKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA A+GI +++ + SQ K SI DHFD  +ELE  L ++ K E  +LV+ I   AH++  Y+RQ E +GLGHA+  A+  +GN PFA+LL DD++     +  P L+Q ++++E+   S+V V+ ++  +   YG++  D   Q   + Q+  +  ++EKP P  +PS+  ++GRYVL   IF +L        GEI++T  +  L ++  V A ++ G RYD GSK+GYLKA++D +L  P++  E   +++
  S:     4 QKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFVTSQSKRSIEDHFDRSWELESLLIKRQKNEMLELVQKIKP-AHVNCIYVRQAEALGLGHAVLCAESVVGNAPFAVLLADDLL----DATTPVLRQMLQIYEQYQASVVAVERIQPAQTRSYGVVAGDAARQCK-QGQAFAISGIVEKPSPEEAPSDLGVVGRYVLDARIFDKLRNLNPGSGGEIQLTDGIEALLKENAVMAYLYEGVRYDCGSKLGYLKASVDFALRHPELDTEFAAFLQ 291
>gi|115351373|ref|YP_773212.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria AMMD] >gi|172060411|ref|YP_001808063.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MC40-6] >gi|115281361|gb|ABI86878.1| UDP-glucose pyrophosphorylase [Burkholderia ambifaria AMMD] >gi|171992928|gb|ACB63847.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MC40-6] (294 aa)
Score = 614, Expect = 6.0e-62, Identities = 121/289 (41%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P ++PSN  ++GRY+L P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVNKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKAKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIVKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGTEFDAYLR 285
>gi|134094554|ref|YP_001099629.1| glucose-1-phosphate uridylyltransferase [Herminiimonas arsenicoxydans] >gi|133738457|emb|CAL61502.1| Glucose-1-phosphate uridylyltransferase [Herminiimonas arsenicoxydans] (291 aa)
Score = 614, Expect = 6.0e-62, Identities = 132/291 (45%), Positives = 181/291 (62%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII------DPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           ++ KAV P AG+G+RFLPATKA PKEMLPI+DKP IQ+ VEEAVA+GI +++ I  + K +I DHFD  +ELE  L+   K    + V+N I    +  YIRQ  P+GLGHA+  A+  +GNEPFA+LL DD  +       P L Q +E+FE +  SI+ VQ+V   E  +YGI+      D LEQVD          ++EKP P  +PS  A++GRY+L+  IF  LE       GEI++T  +  L + + V A  + G+RYD GSK+GYLKA +D+    P+      EY+K L
  S:     3 KIRKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVAAGITEMIFITGRNKRAIEDHFDTAYELERELEAAGKTALLEFVQNVIPKHVNCIYIRQSAPLGLGHAVLCARPVVGNEPFAVLLADD-FMDTPAGTAPVLAQMVEIFEREGSSILAVQDVPRAETRQYGIVSATPYQDRLEQVDA---------IVEKPQPEDAPSTLAVVGRYILSGRIFDYLENVSQGAGGEIQLTDGIAALMRDQKVLAYRYEGQRYDCGSKLGYLKAMVDMGRKHPETGAAFTEYLKTL 290
>gi|124266327|ref|YP_001020331.1| UDP-glucose pyrophosphorylase [Methylibium petroleiphilum PM1] >gi|124259102|gb|ABM94096.1| UDP-glucose pyrophosphorylase [Methylibium petroleiphilum PM1] (288 aa)
Score = 614, Expect = 6.1e-62, Identities = 124/290 (42%), Positives = 183/290 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           + KA+ P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA A+GI +++ +  + K  I DHFD  +ELE  L+   K E  +LVR +  D     Y+RQ + +GLGHA+  A+R + NEPFA+LL DD++V     DKP L Q +E F+E   SI+ VQEV   +  +YGI+       +  + M V  ++EKP P+ +PS   + GRY+L P +F E+        GEI++T  +  L +++ V+A  + GKRYD GSK G+L+A +++ ++ P +   + EY+K L
  S:     3 INKAIFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGIREMIFVTGRSKRPIEDHFDMAYELEVELEAAGKAELLELVRQVKPDDMECVYVRQSKMLGLGHAVLCAERLVRNEPFAVLLADDLMV----GDKPILTQMVEQFDEWRASILAVQEVPEDQTRRYGIV---AGTPVNDRMMDVSRIVEKPAPADAPSRLGVAGRYILMPDVFTEIRNQPRGVGGEIQLTDGIAGLLRRQKVFAYTYEGKRYDCGSKEGFLQANIELGMAHPQIGASVREYLKTL 286
>gi|118050797|ref|ZP_01519346.1| UTP-glucose-1-phosphate uridylyltransferase [Comamonas testosteroni KF-1] >gi|118001468|gb|EAV15623.1| UTP-glucose-1-phosphate uridylyltransferase [Comamonas testosteroni KF-1] (295 aa)
Score = 614, Expect = 6.3e-62, Identities = 131/293 (44%), Positives = 186/293 (63%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS--DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID------PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           + RV KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA  +GI D++ +  + K +I DHFD  +ELE  L+   K     LVR++S  DM  + ++RQ   +GLGHA+  A+  +GNEPFA++L DD++   N      + Q    F+++  S++ VQEV  +   +YGI+       PL         MR+  ++EKP P  +PS   + GRYVLTP+IF ++        GEI++T ++  L Q E VYA  + GKRYD GSK G+L+AT++++L  PDV D   EY+K L
  S:     4 QTRVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMVFVTGRSKRAIEDHFDTSYELENELENAGKQAMLDLVRSVSPADMNCL-FVRQPRSLGLGHAVLCAEPLVGNEPFAVILADDLMTGEN-GGPGVMAQMTAAFQKQGRSLLAVQEVPLEHTKRYGIVKGEPAGGPL---------MRIDEIVEKPAPEKAPSRMGVAGRYVLTPAIFDQIRNQPQGVGGEIQLTDAIERLMQHEAVYAFQYAGKRYDCGSKEGFLQATVELALQHPDVGDSFREYLKNL 293
>gi|171464034|ref|YP_001798147.1| UTP-glucose-1-phosphate uridylyltransferase [Polynucleobacter necessarius STIR1] >gi|171193572|gb|ACB44533.1| UTP-glucose-1-phosphate uridylyltransferase [Polynucleobacter necessarius STIR1] (294 aa)
Score = 614, Expect = 6.7e-62, Identities = 126/290 (43%), Positives = 195/290 (67%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           K VTKAV P AG+GTRFLPATKA PKEML ++DKP IQ+ VEEA+++GI +++ +  + K +I DHFD  +ELE  L+ KNK    ++VR++   +H+   Y+RQ E +GLGHA+  A++ + +EPFAI+L DD++        P  KQ +++FEE+N S+V V++++  + S YGI+   E   +     R+  ++EKP P  +PSN A++GRYVL+  IF  +   + S  GEI++T ++ +L ++E V+A  + G RYD GSK+GYLKA+++ +L  P+V  +   Y+K
  S:     6 KAVTKAVFPVAGLGTRFLPATKANPKEMLNVVDKPLIQYAVEEAISAGITEMIFVTGRSKRAIEDHFDKAYELEAELEAKNKQALLEIVRSVKP-SHVDCVYVRQPEVLGLGHAVLCAEKLVRDEPFAIILADDLL----DGQPPVFKQMLKVFEEQNGSVVAVEKIDPAKSSSYGIVSGAE---VAKGIYRLNGIVEKPQPKDAPSNLAVVGRYVLSSDIFTHIRNLKPSAGGEIQLTDAIASLLKEEPVFAYEYDGVRYDCGSKLGYLKASVEFALRHPEVSTDFAAYLK 289
>gi|153884083|ref|ZP_02005242.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Ralstonia pickettii 12D] >gi|187925984|ref|YP_001892329.1| UTP-glucose-1-phosphate uridylyltransferase [Ralstonia pickettii 12J] >gi|151579116|gb|EDN43513.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Ralstonia pickettii 12D] >gi|187727738|gb|ACD28902.1| UTP-glucose-1-phosphate uridylyltransferase [Ralstonia pickettii 12J] (317 aa)
Score = 614, Expect = 6.7e-62, Identities = 122/291 (41%), Positives = 188/291 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M +++TKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA A+GI +++ I  + K +I DHFD  +ELE  L  KNK     +V++I        Y+RQ E +GLGHA+  A++ + +EPFA++L DD++      + P ++Q  EL++    SIVGV+ +  +    YG++   E  D   + +++  ++EKP PS +PSN  ++GRY+LTP IF  L   +    GE+++T ++ +L  +E + A  + G+R+D GSK GYL+AT++ +L  P+VR +   Y+
  S:     1 MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGRAKRAIEDHFDKAYELETELAAKNKQALLDMVQSIKPAGVECFYVRQPETLGLGHAVLCAQKLVRDEPFAVILADDLL----DHEPPVMQQMTELYDHYRCSIVGVETIAPEATRSYGVVAGREWDD---RLVKLDGIVEKPAPSEAPSNLGVVGRYILTPRIFDHLRNLRPGAGGELQLTDAIQSLLAEEQILAYRYRGQRFDCGSKFGYLQATVEFALRHPEVRADFETYL 285
>gi|194289746|ref|YP_002005653.1| UTP--glucose-1-phosphate uridylyltransferase [Cupriavidus taiwanensis] >gi|193223581|emb|CAQ69586.1| UTP--glucose-1-phosphate uridylyltransferase [Cupriavidus taiwanensis] (298 aa)
Score = 614, Expect = 6.9e-62, Identities = 123/292 (42%), Positives = 187/292 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M  RV+KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  FELE  L+ KNK     +VR+I        Y+RQ E +GLGHA+  A + +G+ PFA++L DD+I  N     P +KQ ++ ++  N S++GV+E+  ++   YG+++  E  +     ++V  ++EKP P  +PSN  ++GRY+LTP IF  L   +    GE ++T ++ +L  +E V A  + G RYD GSK+GYLKAT++ +L   +   +   Y++
  S:     1 MTSRVSKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKAFELEVELEAKNKRALLDVVRSIKPANVECFYVRQSEALGLGHAVLCAAKLVGDAPFAVMLADDLIDGN----PPVMKQMVDAYDHYNCSVLGVEEILPEQSRSYGVVEGREWGE---GVIKVSGIVEKPAPEEAPSNLGVVGRYILTPRIFDHLRALKPGAGGEFQLTDAIQSLLSQEQVLAYRYHGTRYDCGSKLGYLKATVEFALKHQETGAQFRSYLE 286
>gi|161525047|ref|YP_001580059.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] >gi|189350210|ref|YP_001945838.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] >gi|160342476|gb|ABX15562.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] >gi|189334232|dbj|BAG43302.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] (294 aa)
Score = 614, Expect = 6.9e-62, Identities = 123/289 (42%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E  D     +++  ++EKP P ++PSN  ++GRYVL P IF  L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  +   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKEWED---SIIKMSAIVEKPAPDVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIEALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGADFETYLR 285
>gi|194563574|ref|YP_002098597.1| UDP-glucose pyrophosphorylase [Burkholderia dolosa AUO158] >gi|124895198|gb|EAY69078.1| UDP-glucose pyrophosphorylase [Burkholderia dolosa AUO158] (294 aa)
Score = 614, Expect = 7.1e-62, Identities = 123/289 (42%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P ++PSN  ++GRYVL P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPTETKSYGIVDGKE---WEESIIKMSAIVEKPAPDVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIEALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGTEFDAYLR 285
>gi|126724647|ref|ZP_01740490.1| UTP-glucose-1-phosphate uridylyltransferase [Rhodobacterales bacterium HTCC2150] >gi|126705811|gb|EBA04901.1| UTP-glucose-1-phosphate uridylyltransferase [Rhodobacterales bacterium HTCC2150] (297 aa)
Score = 614, Expect = 7.2e-62, Identities = 124/299 (41%), Positives = 201/299 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQK-EGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           MK+RVTKAV P AG+GTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GI++ + + S+ K+++ D+FD+  ELE  L++K K E  K +++ + +   I Y+RQ + +GLGHA+  A+R IGNEPFA++L DDVI     ++KP L+Q +E   E   ++V   EV   + S YG++D  + +      + V+ M+EKP P  +PSN A++GRY+LTP I + L + +    GEI++T ++    +K + VY   F G+R+D GSK GYL+AT+   L++ ++ DEL +Y++ +V   +
  S:     1 MKRRVTKAVFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTSRGKSALEDYFDHAPELESSLRKKGKKELLKTLKSTNMESGAIAYMRQHKALGLGHAVWCARRLIGNEPFAVILPDDVIA----AEKPCLQQMVEAHAETGGNMVAAMEVAPDKSSSYGVLDIAKDMG---SMVSVRGMVEKPAPEEAPSNLAVIGRYILTPEIMRNLNKMKSGAGGEIQLTDAIAQEIEKSDNVYGYRFRGQRFDCGSKAGYLQATVAFGLARDELCDELSDYLESMVNMRR 294
>gi|82617371|emb|CAI64283.1| UTP-glucose-1-phosphate uridylyltransferase, putative [uncultured archaeon] (294 aa)
Score = 614, Expect = 7.3e-62, Identities = 145/291 (49%), Positives = 203/291 (69%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +KR+ KAVIPAAG+GTRFLPATK+MPKEMLPI+D P IQF+VEEA+A+GI+DI+II  + K +I D+FD   ELE  L +  K    + +++IS +  IHYIRQKEP GLG A+  A++ +GNEPFAILLGDD+I    +++ P +KQ   LF   N SI+ V+EV  ++VS YGII   E   +     R++ +IEKP    +PSN   +GRYVLTP+IF  ++ET+     EI++T ++  L +KE V+A  F GKRYD G K GY+KA +D +L K D++ E+++Y++
  S:     6 EKRIRKAVIPAAGLGTRFLPATKSMPKEMLPIIDTPIIQFVVEEAIAAGIDDIIIITGRGKKAIEDYFDTSPELEIHLFKNKKYALLREIKDISTLVDIHYIRQKEPKGLGDAVLKAEKHVGNEPFAILLGDDII----KAEIPCIKQLTNLFGHYNKSIIAVEEVPKEKVSIYGIIKGRE---IDEFIYRIEEIIEKPSIEEAPSNIGTVGRYVLTPAIFDCIKETKPGSGNEIQLTDAIKLLMEKEEVFAYSFKGKRYDAGDKTGYVKAIIDFALEKEDLKAEIVQYLQ 289
>gi|160944125|ref|ZP_02091355.1| hypothetical protein FAEPRAM212_01627 [Faecalibacterium prausnitzii M21/2] >gi|158444801|gb|EDP21805.1| hypothetical protein FAEPRAM212_01627 [Faecalibacterium prausnitzii M21/2] (291 aa)
Score = 613, Expect = 8.2e-62, Identities = 134/295 (45%), Positives = 193/295 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQ-KEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           K+VTKAVIPAAG+GTR LPATKAMPK MLPI+DKP IQ++VEEAV SGI DILII+ + ++ I DHFD   ELEE+L +  K +  +    I++MA+I ++RQKE +GLGHA+N AK F G++PF ++ GDDVI      + P   Q I  +EE    + GV  V  ++VS+Y     L+   +      V +MIEKP      SNY+ILGR +LTP I++ L  T+    GEI++T ++   A+ + G+ A  FTGK YD+G+K+  ++A ++++L  P++ +E   Y+K   +T
  S:     2 KKVTKAVIPAAGLGTRVLPATKAMPKGMLPIVDKPAIQYLVEEAVRSGITDILIILGRNQSIIEDHFDRSPELEEKLAKPGKEKMLEECLGIANMANILFVRQKETLGLGHAVNTAKAFTGDDPFVVIYGDDVI----WGEDPVCAQLIRAYEEFGRPVAGVSAVPWEDVSRYC---SLKTTPIHDNYFFVDDMIEKPKKGQEFSNYSILGRVLLTPEIYEILAHTKPGAGGEIQLTDAMAEYARTRGGMTAVEFTGKHYDMGNKLKVVEAQVELALQHPEIGEEFRAYLKEFCKT 290
>gi|107022513|ref|YP_620840.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia AU 1054] >gi|116689462|ref|YP_835085.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia HI2424] >gi|170732768|ref|YP_001764715.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia MC0-3] >gi|194556625|ref|YP_002091651.1| Glucose-1-phosphate thymidylyl transferase [Burkholderia cenocepacia PC184] >gi|105892702|gb|ABF75867.1| UDP-glucose pyrophosphorylase [Burkholderia cenocepacia AU 1054] >gi|116647551|gb|ABK08192.1| UDP-glucose pyrophosphorylase [Burkholderia cenocepacia HI2424] >gi|124870416|gb|EAY62132.1| Glucose-1-phosphate thymidylyl transferase [Burkholderia cenocepacia PC184] >gi|169816010|gb|ACA90593.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia MC0-3] (294 aa)
Score = 613, Expect = 8.3e-62, Identities = 123/289 (42%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P ++PSN  ++GRYVL P IF  L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIVKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGAEFETYLR 285
>gi|163813334|ref|ZP_02204906.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Dehalococcoides sp. VS] >gi|157403036|gb|EDO69184.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Dehalococcoides sp. VS] (300 aa)
Score = 613, Expect = 8.7e-62, Identities = 122/292 (41%), Positives = 184/292 (63%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M  R+ KAV P AG+GTRFLPATK +PKEMLPI+D+P IQ+ V+EA+ +G + ++ I ++YK+++ D+FD  +ELE +L++  K E  +L+RN+        ++ Q E +GLGHA+  AK  IGNEPFA+LL DD+I   N+    ALKQ  +  E    S + VQ+V  ++   YGI+      +   +  R+  ++EKP P ++PSN A++GRYVL P IF+ LE T     GEI++T ++  L Q+E V A  F G R+D G+ IG ++AT+  +L    + D   + M+
  S:     1 MAARIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNRYKHAVADYFDKAYELEHKLERSGKTEQLELIRNVLPPGVRAVFVTQAEALGLGHAVLCAKDVIGNEPFAVLLPDDLIW--NRGGAGALKQMADAAEASGASTIAVQDVPREQTGSYGIV---ATSNFDARQGRITAIVEKPKPEVAPSNLAVVGRYVLNPRIFELLENTTPGAGGEIQLTDAIATLLQQEAVNAYRFQGTRFDCGTHIGLIEATIRYALDHEKLSDSARQMMQ 288
>gi|15640422|ref|NP_230049.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587599|ref|ZP_01677364.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae 2740-80] >gi|153215382|ref|ZP_01949980.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae 1587] >gi|153822261|ref|ZP_01974928.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae B33] >gi|153825667|ref|ZP_01978334.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae MZO-2] >gi|153829319|ref|ZP_01981986.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae 623-39] >gi|194535730|ref|YP_002070899.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae RC385] >gi|194536866|ref|YP_002072019.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae V51] >gi|9654816|gb|AAF93568.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548172|gb|EAX58244.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae 2740-80] >gi|124114753|gb|EAY33573.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae 1587] >gi|125621479|gb|EAZ49813.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae V51] >gi|126520217|gb|EAZ77440.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae B33] >gi|148875219|gb|EDL73354.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae 623-39] >gi|149740697|gb|EDM54804.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae MZO-2] >gi|150420524|gb|EDN12817.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae RC385] >gi|150422756|gb|EDN14709.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio cholerae AM-19226] (291 aa)
Score = 613, Expect = 9.3e-62, Identities = 127/269 (47%), Positives = 177/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ V+EA+ +GI  + I+  + K+SIMDHFD  +ELE +++  NK E    +R I + A+  +IRQ+E  GLGHAI   K  +G+EPFA++L DD+ V   Q     L Q + L+++   SIV VQEV   E  KYG+I       +K    RV NM+EKP+P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +LL  A+   V A  F GKR+D GS  GY++AT
  S:     3 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQG---VLAQMVALYKQFRCSIVAVQEVPENETHKYGVI---AGEMIKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEAT 265
>gi|162147682|ref|YP_001602143.1| UTP--glucose-1-phosphate uridylyltransferase [Gluconacetobacter diazotrophicus PAl 5] >gi|161786259|emb|CAP55841.1| UTP--glucose-1-phosphate uridylyltransferase [Gluconacetobacter diazotrophicus PAl 5] (293 aa)
Score = 612, Expect = 1.0e-61, Identities = 117/290 (40%), Positives = 194/290 (66%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           K + KAV+P AG+GTRFLPATKAMPKEMLP++D+P IQ+ ++EA A+GIE+  +I  + K+S++D+FD  FELE  L+++NK++  + +   S +   +  +RQ+EP+GLGHAI  A+ FIG++PFAILL DDV+    +SD P LKQ ++++ +   +++ V EV  +  ++YGI+   E      + + VK ++EKP P  +PSN +I+GRY+LT  +   L + +    GE+++T ++  +      +   + G+R+D G+K+GYL+A +  S+ +PD+ D +  ++K
  S:     6 KPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDEARAAGIEEFCLITGRGKDSLIDYFDVAFELETTLRERNKLDALEALGPTSIEAGALSAVRQQEPLGLGHAIWCARSFIGDDPFAILLPDDVV----KSDVPCLKQLVDVYNQTGGNVLAVTEVPREHTNRYGILKTGED---DGRLVEVKGLVEKPKPEDAPSNLSIIGRYILTADVMPHLSKLERGAGGEVQLTDAMAKVIGHAPFHGLRYEGRRFDCGNKVGYLEAQIAFSIDRPDLGDAVRAFLK 289
>gi|167587405|ref|ZP_02379793.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ubonensis Bu] (294 aa)
Score = 612, Expect = 1.0e-61, Identities = 122/289 (42%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P ++PSN  ++GRY+L P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIIKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIEALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGTEFDAYLR 285
>gi|83593452|ref|YP_427204.1| UDP-glucose pyrophosphorylase [Rhodospirillum rubrum ATCC 11170] >gi|83576366|gb|ABC22917.1| UDP-glucose pyrophosphorylase [Rhodospirillum rubrum ATCC 11170] (292 aa)
Score = 612, Expect = 1.1e-61, Identities = 125/285 (43%), Positives = 185/285 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYK-LVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRD 285
           M +RV KAV P AGMGTRFLPATK M KEMLP++DKP IQ+ VEEA A+GI+  + I  + K+ +MDHFD+  ELE  LK++ K +  + L+ ++     +   RQ++P+GLGHA+  A+ FIG+EPFA+LL DD+++    +D P +KQ I+   +   ++V V++V  +  +KYGI+D +E  D  T + R K ++EKPD   +PS  AI+GRYVL P IF  LE       GEI++T ++    +    +   + G RYD G K+G+L+A +  +L +PD+RD
  S:     1 MSRRVRKAVFPVAGMGTRFLPATKTMAKEMLPVVDKPLIQYAVEEAAAAGIDHFIFITGRGKSVLMDHFDHMPELEALLKERGKTDVLENLLGSMPSPGKVFSTRQQQPLGLGHAVWCARAFIGDEPFAVLLPDDLVL----ADTPCIKQLIDAHAQTGGNVVAVEDVPRERTNKYGILDVVE--DNGTLA-RAKGLVEKPDSDKAPSTLAIIGRYVLDPGIFDLLENQNRGAGGEIQLTDAMNAQIKDVPFHGLRYEGARYDCGDKVGFLQANIAFALERPDMRD 279
>gi|27364813|ref|NP_760341.1| UDP-glucose pyrophosphorylase [Vibrio vulnificus CMCP6] >gi|37681139|ref|NP_935748.1| UDP-glucose pyrophosphorylase [Vibrio vulnificus YJ016] >gi|27360958|gb|AAO09868.1|AE016801_187 UDP-glucose pyrophosphorylase [Vibrio vulnificus CMCP6] >gi|37199890|dbj|BAC95719.1| UDP-glucose pyrophosphorylase [Vibrio vulnificus YJ016] (290 aa)
Score = 612, Expect = 1.1e-61, Identities = 126/269 (46%), Positives = 177/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+SIMDHFD  +ELE ++   NK    + VR + D A+  YIRQ+E  GLGHAI   +  +G++PFA++L DD+ V   Q     L Q + LF++   SIV VQEV   E  KYG+I       +K    RV NM+EKP+P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMDGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEALLEDVRALIDSANFTYIRQREMKGLGHAILTGRELVGDQPFAVVLADDLCVNEEQG---VLAQMVALFKQFRCSIVAVQEVPENETHKYGVISGEM---IKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGRRFDCGSVEGYIEAT 264
>gi|159154692|gb|ABW93677.1| UTP-glucose-1-phosphate uridylyltransferase [Neisseria meningitidis] >gi|159154709|gb|ABW93693.1| UTP-glucose-1-phosphate uridylyltransferase [Neisseria meningitidis] (287 aa)
Score = 612, Expect = 1.1e-61, Identities = 131/293 (44%), Positives = 187/293 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           +++ KAV P AGMGTRFLPATKA  KEMLPI+DKP IQ+  EEAVA+G  +++ I  + K +I DHFD  +ELE  L+ + K +    V+ I  D     +IRQ E +GLGHA+  A+  +GNEPFA++L DD+I     + + ALKQ ++++ +   SI+GV+ V+  +   YGI++ +EQ+       RV N++EKP P  +PSN A++GRY+LTP IF  L        GEI++T  +  L   E V A  F GKRYD GSK+GYL+AT+   L  P+++D+  E +K  V
  S:     2 QKIRKAVFPVAGMGTRFLPATKASAKEMLPIVDKPLIQYAAEEAVAAGCTELIFITGRNKRNIEDHFDKAYELETELEMREKHKLLGYVQKILLDHVSCIFIRQAEALGLGHAVLCARPAVGNEPFAVILADDLI----DAPQGALKQMVDIYNQSGNSILGVETVDPSQTGSYGIVE-VEQL---KSYQRVTNIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTNLPRGAGGEIQLTDGIARLLDHEFVLAHAFEGKRYDCGSKLGYLEATVAYGLKHPELKDDFKELLKQFV 287
>gi|160872615|ref|ZP_02062747.1| UTP-glucose-1-phosphate uridylyltransferase [Rickettsiella grylli] >gi|159121414|gb|EDP46752.1| UTP-glucose-1-phosphate uridylyltransferase [Rickettsiella grylli] (293 aa)
Score = 612, Expect = 1.2e-61, Identities = 132/292 (45%), Positives = 190/292 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSM-RVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K++TKA+ P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+A+GI +++ I S  K +I DHFD  +ELE +L + NK E   +V+NI  +     Y+RQ + +GLGHAI  A+  I N+ FA+LL DD+I     S  P LKQ + +++EK  +I+ VQ +  +E  +YG+I      +LK   +  V ++IEKP    +PS+ A++GRY+LTP+IF  L +       EI++T ++    + E VYA  F G RYD G+K+GYLKAT   +L  P+++D    Y+K L
  S:     5 KKITKALFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGINELIFITSSSKRAIEDHFDSNYELETKLAKTNKKELLAIVKNILPEGVSCVYLRQPDTLGLGHAILCARPLINNDAFAVLLADDLI----DSKTPCLKQMLAIYQEKQNTIIAVQAIAPEESEQYGVIG----YNLKEGPLSEVNSIIEKPPYQNAPSHLAVVGRYILTPTIFSYLSKISCGKNDEIQLTDAIACQLKDERVYAWEFEGTRYDCGNKLGYLKATFAHALKHPEIKDLFTNYLKNL 290
>gi|115360930|ref|YP_778067.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria AMMD] >gi|115286258|gb|ABI91733.1| UDP-glucose pyrophosphorylase [Burkholderia ambifaria AMMD] (294 aa)
Score = 611, Expect = 1.3e-61, Identities = 119/288 (41%), Positives = 188/288 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR I   +H+   Y+RQ E +GLGHA+  A++ +GN+PFA++L DD++        P L+Q I++F+  + S++GV+E+       YG+I      D      ++  ++EKP+P+ +PSN+ ++GRYVL P +F+ L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  +   Y+
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIDAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLSLVRGIKP-SHVDCFYVRQAEALGLGHAVLCAEKLVGNQPFAVILADDLL----DGPTPVLRQMIDVFDHYHASVIGVEEIAPDASKSYGVIAGKRWED---NLFKLSGIVEKPEPAKAPSNFGVVGRYVLKPKVFEHLRALRPGAGGELQLTDAIQSLLADEQVLAHRYEGTRFDCGSKLGYLKATVEFALRHPEVAADFESYL 284
>gi|119944822|ref|YP_942502.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Psychromonas ingrahamii 37] >gi|119863426|gb|ABM02903.1| UDP-glucose pyrophosphorylase [Psychromonas ingrahamii 37] (275 aa)
Score = 611, Expect = 1.4e-61, Identities = 126/269 (46%), Positives = 181/269 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+PI++KP I+F V+EA+ +G+ ++ I+  + K+S+MDHFD  +ELE ++    K +  K +R I D A+  YIRQ+E  GLGHAI + K  IG+EPFA++L DD+ + +       LKQ ++L+++   SIV V+EV   ++ KYG+I   +   +K    RV +M+EKP P  +PSN AI+GRY+LTP IF  +EET     GEI+IT +LL  A++  V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPIVNKPLIEFGVDEALEAGMTNMCIVTGRGKHSLMDHFDLNYELEHQINGTPKEDKLKDIRLIMDRANFTYIRQREMKGLGHAILVGKELIGDEPFAVVLADDLCINHANG---VLKQMVDLYKQFRCSIVAVEEVPEDQIHKYGVI---KGEMIKDNIYRVDDMVEKPAPGTAPSNLAIIGRYILTPDIFDIIEETTPGKGGEIQITDALLTQAKRGCVLAYKFKGKRFDCGSVPGYIEAT 264
>gi|194564654|ref|YP_002099676.1| UDP-glucose pyrophosphorylase [Burkholderia dolosa AUO158] >gi|124898314|gb|EAY70157.1| UDP-glucose pyrophosphorylase [Burkholderia dolosa AUO158] (295 aa)
Score = 610, Expect = 1.6e-61, Identities = 119/289 (41%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  ++   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L   +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIAREDSRSYGVVEGRE---WEEDVIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRRLKPGAGGELQLTDAIQSLLANEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLR 285
>gi|171318609|ref|ZP_02907757.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MEX-5] >gi|171096207|gb|EDT41126.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MEX-5] (295 aa)
Score = 610, Expect = 2.0e-61, Identities = 120/289 (41%), Positives = 192/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR I   +H+   Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  +E   YG++   E  + +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L + +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKP-SHVSCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIPREESRSYGVV---EGREWEEDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLANEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLR 285
>gi|78062956|ref|YP_372864.1| UDP-glucose pyrophosphorylase [Burkholderia sp. 383] >gi|77970841|gb|ABB12220.1| UDP-glucose pyrophosphorylase [Burkholderia sp. 383] (295 aa)
Score = 610, Expect = 2.1e-61, Identities = 119/289 (41%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR I   +H++  Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  ++   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L + +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKP-SHVNCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGRE---WEEDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLANEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLR 285
>gi|107026734|ref|YP_624245.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia AU 1054] >gi|116692074|ref|YP_837607.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia HI2424] >gi|170735934|ref|YP_001777194.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia MC0-3] >gi|105896108|gb|ABF79272.1| UDP-glucose pyrophosphorylase [Burkholderia cenocepacia AU 1054] >gi|116650074|gb|ABK10714.1| UDP-glucose pyrophosphorylase [Burkholderia cenocepacia HI2424] >gi|169818122|gb|ACA92704.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia cenocepacia MC0-3] (295 aa)
Score = 609, Expect = 2.3e-61, Identities = 119/289 (41%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR I   +H++  Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  ++   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L + +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKP-SHVNCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGRE---WEEDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLANEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLR 285
>gi|27597154|dbj|BAC55148.1| UDP-glucose pyrophosphorylase EpsT [Methylobacillus sp. 12S] (299 aa)
Score = 609, Expect = 2.6e-61, Identities = 126/286 (44%), Positives = 183/286 (63%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDEL 287
           +K VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEAVA+GI D++ I  + K SI DHFD  +ELE  L++  K +   +V+NI     +  YIRQ + +GLGHA+ +AK  + ++PFA++L DD+I     +  P +KQ ++ ++    S++GVQEV   +   YGI+      +   Q   V  ++EKP P  +PSN  ++GRY+LTP IF  LE  Q    GE+++T ++ +L  +E + A  F G RYD GSK G+L+AT+ + L  P+   +L
  S:     3 QKNVTKAVFPVAGLGTRFLPATKANPKEMLPVVDKPLIQYAVEEAVAAGITDLIFITGRNKRSISDHFDMAYELENELERNGKKQLLSVVQNIVPKNVNCIYIRQNQALGLGHAVKLAKPVVNDDPFAVILADDLI----DAKVPVVKQMVDAYQYYRCSLLGVQEVPRDQTKSYGIVATHPMSNGIEQ---VAGIVEKPKPEEAPSNLGVVGRYILTPRIFHHLENLQAGSGGELQLTDAIASLLSEEQILAYRFEGTRYDCGSKSGFLEATVRLGLKHPECGKDL 282
>gi|91226616|ref|ZP_01261340.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio alginolyticus 12G01] >gi|91189090|gb|EAS75372.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio alginolyticus 12G01] (292 aa)
Score = 609, Expect = 2.6e-61, Identities = 124/269 (46%), Positives = 178/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+S+MDHFD  +ELE ++   +K      +R++ D A   YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V     DK  L Q +EL+++   SIV VQEV   E  KYG+I       +K    R+ NM+EKP+P  +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +L+  AQ   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTSKEALLDDIRSLIDSASYTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCV---NGDKGVLAQMVELYKQFRCSIVAVQEVPESETHKYGVI---AGEMIKDDIFRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALMQQAQSGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|169177661|ref|ZP_02839182.1| UTP-glucose-1-phosphate uridylyltransferase [Arthrobacter chlorophenolicus A6] >gi|169014406|gb|EDS60960.1| UTP-glucose-1-phosphate uridylyltransferase [Arthrobacter chlorophenolicus A6] (301 aa)
Score = 609, Expect = 2.7e-61, Identities = 131/288 (45%), Positives = 191/288 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLA----QKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           RV KAVIPAAG+GTRFLPATKAMPKEMLP++DKP IQ++VEEAV  G+ D+L+I  + K ++ DHFD    LE  L  K   +  + ++  S++  IHY+RQ +P GLGHA+  A++ +GNEPFA+LLGDD+I   ++     L   I++  +   S+V + EV+  ++S YG  D +E++D     +R+  ++EKP    +PSN A++GRYVL P++F  LEET     GEI++T +L  LA    +  GVY  VF G+RYD G K+ YLKA + +++   D+   L E++
  S:     7 RVRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVGVGLNDVLMITGRNKRALEDHFDRVPSLESTLSDKGDTKKLESIQAASNLGDIHYVRQGDPNGLGHAVLRARQHVGNEPFAVLLGDDLIDARDE----LLGTMIDVQAKTGGSVVALIEVDPSQISAYGCAD-IEEID-GEGYVRINRLVEKPAADEAPSNLAVIGRYVLHPAVFDVLEETGPGRGGEIQLTDALQELATGEGEGYGVYGVVFRGRRYDTGDKLSYLKACVQLAVDSDDLGPGLREWL 292
>gi|154151306|ref|YP_001404924.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Candidatus Methanoregula boonei 6A8] >gi|153999858|gb|ABS56281.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Candidatus Methanoregula boonei 6A8] (295 aa)
Score = 608, Expect = 2.8e-61, Identities = 125/294 (42%), Positives = 190/294 (64%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           + V KAVIPAAG+GTRFLP TKA PKEMLP++DKP IQ++VEEA+ SGI+DILII  + K +I DHFD  FELE +   + K    + ++ ++D   +H+IRQ+E  GLG A+N+A R   NEPFA+LLGD + +   + +KP  +Q ++ FE    SI+ V+ V   ++  YGIID  E   ++     + +++EKP P  +PSN   +GRYVLTP IF  L +      GEI++T +L  L +  G+   V   +RYDIG K+G++K++++++L + +   E+  ++  L++
  S:     5 QHVRKAVIPAAGLGTRFLPITKAQPKEMLPVVDKPVIQYVVEEAIQSGIDDILIITGRNKRAIEDHFDRCFELEVKFSHRKKDPFTESLQALADFPDLHFIRQREQKGLGDAVNLAGRHCDNEPFAVLLGDTICISPAK-EKPCTRQMMDAFERHRRSIIAVEPVAGNKIQDYGIIDGRE---IEKGVYEIDDIVEKPAPEHAPSNLGAIGRYVLTPEIFFLLADATPGVGGEIQLTDALRRLDRPLGL---VTNCRRYDIGDKLGWMKSSIELTLEREEFAGEIRPFLSKLLK 291
>gi|83749699|ref|ZP_00946678.1| UTP--glucose-1-phosphate uridylyltransferase [Ralstonia solanacearum UW551] >gi|83723624|gb|EAP70823.1| UTP--glucose-1-phosphate uridylyltransferase [Ralstonia solanacearum UW551] (319 aa)
Score = 608, Expect = 2.9e-61, Identities = 121/292 (41%), Positives = 189/292 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M +++TKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA A+GI +++ I  + K +I DHFD  +ELE  L  KNK    ++V++I        Y+RQ E +GLGHA+  A++ + +EPFA++L DD++      + P ++Q  EL++    SIVGV+ +  +    YG++   E  D   + +++  ++EKP P  +PSN  ++GRY+LTP IF+ L        GE+++T ++ +L  +E + A  + G+R+D GSK GYL+AT++++L  P+V  E   Y++
  S:     1 MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGRAKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYVRQPETLGLGHAVLCAQKLVRDEPFAVILADDLL----DHEPPVMQQMTELYDHYRCSIVGVETIAPQASRSYGVVAGREWDD---RLIKLDGIVEKPAPEQAPSNLGVVGRYILTPRIFEHLRNLAPGSGGELQLTDAIQSLMAEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGVEFEAYLR 286
>gi|134295510|ref|YP_001119245.1| UDP-glucose pyrophosphorylase [Burkholderia vietnamiensis G4] >gi|134138667|gb|ABO54410.1| UDP-glucose pyrophosphorylase [Burkholderia vietnamiensis G4] (294 aa)
Score = 608, Expect = 3.1e-61, Identities = 122/289 (42%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P  +PSN  ++GRY+L P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIVKMSAIVEKPAPEDAPSNLGVVGRYILKPRIFQHLRALKPGAGGELQLTDAIQALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGAEFEAYLR 285
>gi|115358117|ref|YP_775255.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria AMMD] >gi|170702377|ref|ZP_02893268.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria IOP40-10] >gi|172062902|ref|YP_001810553.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MC40-6] >gi|115283405|gb|ABI88921.1| UDP-glucose pyrophosphorylase [Burkholderia ambifaria AMMD] >gi|170132712|gb|EDT01149.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria IOP40-10] >gi|171995419|gb|ACB66337.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ambifaria MC40-6] (295 aa)
Score = 608, Expect = 3.5e-61, Identities = 118/289 (40%), Positives = 193/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VT+AV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR I   +H++  Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  ++   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L + +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++++L  P+V  E   Y++
  S:     3 KVTRAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKP-SHVNCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGRE---WEEDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLANEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLR 285
>gi|126734470|ref|ZP_01750217.1| UTP--glucose-1-phosphate uridylyltransferase [Roseobacter sp. CCS2] >gi|126717336|gb|EBA14200.1| UTP--glucose-1-phosphate uridylyltransferase [Roseobacter sp. CCS2] (297 aa)
Score = 607, Expect = 3.8e-61, Identities = 117/291 (40%), Positives = 191/291 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQK-EGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M ++V+KA+ P AGMGTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GIED + + S+ K+++ D+FD   +LE  L+   K E  +++RN + D   I Y+RQ + +GLGHA++ A++ IG+EPFA++L DDVI      +KP L+Q +E ++E   ++V   EV   + S YG++D  +Q     + +  + M+EKP    +PSN A++GRY+LTP +    +       GEI++T ++    Q    V+   F G+RYD GSK G+L+AT+  +L++ D+RDEL  ++
  S:     1 MNRKVSKAIFPVAGMGTRFLPATKSVPKEIMTLVDRPLIQYAIDEARAAGIEDFIFVTSRGKSALEDYFDLAPDLEASLEASGKTELLEILRNTNMDSGTIAYLRQHKALGLGHAVSCARKLIGDEPFAVILPDDVIA----GEKPCLQQMVEAYQETGGAMVATMEVSPAQTSSYGVLDVADQ---SPRIVTARGMVEKPAAGTAPSNLAVIGRYILTPQVLANFDNIGRGAGGEIQLTDAIAEEIQSGRDVFGYRFEGERYDCGSKAGFLQATVAFALARDDLRDELDAFL 286
>gi|167590244|ref|ZP_02382632.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia ubonensis Bu] (295 aa)
Score = 607, Expect = 4.2e-61, Identities = 119/289 (41%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +   LVR+I   +H+   Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F   + S++GV+ +  ++   YG+I+  E    +   +++  +IEKP P  +PSN  ++GRYV  P++F  L + +    GE+++T ++ +L   E V A  + G R+D GSKIGYLKAT++++L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFNHYHSSVIGVETIAREDSRSYGVIEGRE---WEEDIIKLSGIIEKPSPEDAPSNLGVVGRYVFMPTLFDHLRKIKPGAGGELQLTDAVQSLLAHEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLR 285
>gi|149189058|ref|ZP_01867346.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio shilonii AK1] >gi|148837021|gb|EDL53970.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio shilonii AK1] (289 aa)
Score = 607, Expect = 4.7e-61, Identities = 125/269 (46%), Positives = 178/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+SIMDHFD  +ELE ++   NK E    +R+I D A   YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V  +Q     L Q + L+++   SIV VQEV   E  KYG+I       +K    RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMDGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIRDIIDSAQFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEDQG---VLAQMVALYKQFRCSIVAVQEVPEDETHKYGVISGEM---IKDDLFRVDDMVEKPEQGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|119964525|ref|YP_948561.1| UTP-glucose-1-phosphate uridylyltransferase [Arthrobacter aurescens TC1] >gi|119951384|gb|ABM10295.1| UTP-glucose-1-phosphate uridylyltransferase [Arthrobacter aurescens TC1] (310 aa)
Score = 606, Expect = 5.1e-61, Identities = 130/287 (45%), Positives = 194/287 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLA----QKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           V KAVIPAAG+GTRFLPATKAMPKEMLP++DKP IQ++VEEAV  G+ D+L+I  + K ++ DHFD    LE  L +K      + +++ +++  IHY+RQ +P GLGHA+  AK+ +G EPFA+LLGDD+I     + +  L + I + ++   S+V + EVE  ++S YG  D   + + +   +R+K ++EKP P  +PSN A++GRYVL P++F+ LE+T     GEI++T +L  LA    +  GVY  VF G+RYD G K+ YLKA ++++  + D+  EL E++
  S:    17 VRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVKVGLHDVLMITGRSKRALEDHFDRVPALEATLAEKGDTAKLEAIQSATNLGDIHYVRQGDPNGLGHAVLRAKQHVGYEPFAVLLGDDLI----DAREDLLSEMIAVQQKTGGSVVALIEVEPSKISAYGCADV--EDNGEDGYVRIKQLVEKPSPEEAPSNLAVIGRYVLHPAVFEVLEKTAPGRGGEIQLTDALEVLAAGEGEGYGVYGVVFRGRRYDTGDKLSYLKACIELACEREDLGPELREWL 301
>gi|51247039|ref|YP_066922.1| UTP-glucose-1-phosphate uridylyltransferase [Desulfotalea psychrophila LSv54] >gi|50878076|emb|CAG37932.1| probable UTP-glucose-1-phosphate uridylyltransferase [Desulfotalea psychrophila LSv54] (288 aa)
Score = 606, Expect = 6.2e-61, Identities = 124/291 (42%), Positives = 185/291 (63%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           ++ KAV P AG+GTRFLPATKAMPKEMLPI+DKP IQ+ VEEA+ SGIE ++ +    K+S+ +HFD  +ELE+ L ++ K E  + V + +     I Y RQ +P+GLGHAI  A+  +G+EPFA+LL DD++    +S++P L+Q I  F+    S+V   EV  +E  +YGI   LE   +    +R+ +M+EKP P  +PSN A +GRY+ TP IF  L   Q    GEI++T +++ L  ++ ++   F G R+D G K+G+  A +  +L  P++   L EY++ L
  S:     2 KIKKAVFPVAGLGTRFLPATKAMPKEMLPIVDKPLIQYAVEEALDSGIEQLIFVTGSGKSSLENHFDSSYELEDTLSKRGKDELLRTVESLVPASGSIIYTRQSQPLGLGHAIWCARDVVGDEPFAVLLADDLV----KSERPVLQQMIHQFDRLRASMVATIEVPREETGRYGI---LEGEQVYEGVLRLSSMVEKPRPEDAPSNLAAIGRYIFTPRIFDFLGRQQSGAGGEIQVTDAMVALLAEQPIFGVNFEGTRFDCGDKVGFQMANIAFALEHPEIGGPLREYLQNL 286
>gi|89052709|ref|YP_508160.1| UDP-glucose pyrophosphorylase [Jannaschia sp. CCS1] >gi|88862258|gb|ABD53135.1| UDP-glucose pyrophosphorylase [Jannaschia sp. CCS1] (297 aa)
Score = 605, Expect = 6.2e-61, Identities = 119/291 (40%), Positives = 194/291 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           MKK+VTKA+ P AG+GTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GI++ + + S+ K+++ D+FD+  ELE  L++K K +  +++++ + D   I Y+RQ + +GLGHA+  A+R +GNEPFA++L DDVI     +D P L+Q +E   E   ++V   EV   + S YGI+D  E +      + VK M+EKP    +PSN A++GRY+L+P +   L + +    GEI++T ++   +   + VY   F G+R+D GSK G+L+AT+   L++ D+RDE  +Y+
  S:     1 MKKKVTKAIFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTSRGKSALEDYFDHTPELENTLRKKGKTDMLEMLKSTNMDSGAIAYMRQHKALGLGHAVWCARRLLGNEPFAVILPDDVIA----ADTPCLQQMVEAHAELGGNMVAAMEVPDDKTSSYGILDVKEDMG---SVVSVKGMVEKPPQDKAPSNLAVIGRYILSPDVMGHLNKIKSGAGGEIQLTDAIAQEIVSADNVYGYRFKGQRFDCGSKAGFLQATVAFGLARDDLRDEFQDYL 286
>gi|78066055|ref|YP_368824.1| UDP-glucose pyrophosphorylase [Burkholderia sp. 383] >gi|77966800|gb|ABB08180.1| UDP-glucose pyrophosphorylase [Burkholderia sp. 383] (294 aa)
Score = 605, Expect = 6.5e-61, Identities = 121/289 (41%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+A+GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ + + PFA++L DD++  N     P +KQ +++F+  + S++GV+E+   E   YGI+D  E    +   +++  ++EKP P ++PSN  ++GRY+L P IF+ L   +    GE+++T ++  L   E V A  + G RYD GSK+GYLKAT++ +L   +V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGN----PPVMKQMVDVFDHYHSSVIGVEEIPPSETKSYGIVDGKE---WEESIVKMSAIVEKPAPEVAPSNLGVVGRYILKPRIFEHLRALKPGAGGELQLTDAIQALLADEQVLAYKYQGTRYDCGSKLGYLKATVEFALRHAEVGAEFDTYLR 285
>gi|1628575|gb|AAB17376.1| UDP-glucose pyrophosphorylase [Xanthomonas campestris] (324 aa)
Score = 604, Expect = 9.3e-61, Identities = 119/278 (42%), Positives = 187/278 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M KR+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + +     ++ Q E +GLGHA+  AK  +G+EPFA+LL DD++   N+ D  AL Q  ++ E    S++ V++V H + + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF+ LE T     GEI++T ++  L ++E V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMW--NRGDA-ALTQMADVAEASGGSVIAVEDVPHDKTASYGIV---STDAFDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAELLKQEQVDAFRFEGRRFDCGAHIGLIEATVHFAL 273
>gi|161521148|ref|YP_001584575.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] >gi|189352675|ref|YP_001948302.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] >gi|160345198|gb|ABX18283.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] >gi|189336697|dbj|BAG45766.1| UTP-glucose-1-phosphate uridylyltransferase [Burkholderia multivorans ATCC 17616] (295 aa)
Score = 604, Expect = 9.7e-61, Identities = 118/289 (40%), Positives = 191/289 (66%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIH--YIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +V KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR+I   +H+   Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  ++   YG+I+  E    +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++++L  P+V  E   Y++
  S:     3 KVNKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKP-SHVDCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIAREDSRSYGVIEGRE---WEEDVIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRRLKPGAGGELQLTDAVQSLLANEQVLAYRYYGTRFDCGSKLGYLKATVELALQHPEVSREFEAYLR 285
>gi|153834368|ref|ZP_01987035.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio harveyi HY01] >gi|148869293|gb|EDL68311.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio harveyi HY01] (292 aa)
Score = 603, Expect = 1.2e-60, Identities = 124/269 (46%), Positives = 177/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P++ KP I++ VEEA+ +G++ + I+  + K+S+MDHFD  +ELE ++   +K      +R++ D A   YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   QS    L Q +EL+++   SIV VQEV   E  KYG+I       +K    R+ NM+EKP+P  +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +L+  AQ   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVSKPLIEYGVEEAIEAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTSKEALLDDIRSLIDSASYTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEEQS---VLAQMVELYKQFRCSIVAVQEVPETETHKYGVI---AGEMIKDDIFRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALMKQAQSGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|134293173|ref|YP_001116909.1| UDP-glucose pyrophosphorylase [Burkholderia vietnamiensis G4] >gi|134136330|gb|ABO57444.1| UDP-glucose pyrophosphorylase [Burkholderia vietnamiensis G4] (295 aa)
Score = 602, Expect = 1.5e-60, Identities = 117/289 (40%), Positives = 187/289 (64%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           +VTKAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ +  + K +I DHFD  +E+E  L+ + K +  +LVR I        Y+RQ E +GLGHA+  A++ +  EPFA++L DD++      ++P LKQ +++F+  + S++GV+ +  ++   YG+++  E    +   +++  +IEKP P  +PSN  ++GRYV  P+IF  L   +    GE+++T ++ +L   E V A  + G R+D GSK+GYLKAT++ +L  P+V  E   Y++
  S:     3 KVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSNVDCFYVRQPEALGLGHAVLCAEKLVHGEPFAVILADDLL----HGEQPVLKQLVDVFDHYHSSVIGVETIAREDSRSYGVVEGRE---WEEDIIKLAGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRRIKPGAGGELQLTDAVQSLLANEQVLAYRYYGTRFDCGSKLGYLKATVEFALQHPEVSREFEAYLR 285
>gi|37678550|ref|NP_933159.1| UDP-glucose pyrophosphorylase [Vibrio vulnificus YJ016] >gi|37197290|dbj|BAC93130.1| UDP-glucose pyrophosphorylase [Vibrio vulnificus YJ016] (276 aa)
Score = 602, Expect = 1.6e-60, Identities = 126/273 (46%), Positives = 178/273 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           M   + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+++MDHFD  +ELE ++   +K      +R + D A   +IRQ+E  GLGHAI   K  +G+EPFA++L DD+ V  NQ D+  L Q + LF +   SIV VQEV   E  KYG+I       +K    RV NM+EKP+P  +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     1 MLNMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMNGMCIVTGRGKHALMDHFDKNYELEHQISGTSKEALLGDIRQLIDSASYTFIRQREMKGLGHAILTGKELVGDEPFAVVLADDLCV--NQ-DEGVLAQMVALFNQFRCSIVAVQEVPEDETHKYGVISGEM---IKDGICRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAKSGCVLAYKFKGQRFDCGSVEGYIEAT 267
>gi|28897011|ref|NP_796616.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|153840327|ref|ZP_01992994.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus AQ3810] >gi|28805219|dbj|BAC58500.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|149746008|gb|EDM57138.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus AQ3810] (292 aa)
Score = 602, Expect = 1.7e-60, Identities = 123/269 (45%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+S+MDHFD  +ELE ++   +K      +R++ D A   YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   Q     L Q +EL+++   SIV VQEV   E  KYG+I       +K    R+ NM+EKP+P  +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +L+  AQ   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMNGMCIVTGRGKHSLMDHFDKNYELEHQISGTSKEALLDDIRSLIDSASYTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEEQG---VLAQMVELYKQFRCSIVAVQEVPETETHKYGVI---AGEMIKDDIFRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALMQQAQSGCVIAYKFKGQRFDCGSVEGYIEAT 264
>gi|87161812|ref|YP_495073.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus USA300] >gi|88196436|ref|YP_501260.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|168727838|ref|ZP_02760115.1| UTP--glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87127786|gb|ABD22300.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203994|gb|ABD31804.1| UTP-glucose-1-phosphate uridylyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] (260 aa)
Score = 601, Expect = 2.0e-60, Identities = 127/265 (47%), Positives = 182/265 (68%)
  Q:    30 MLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           MLPILDKPTIQ+IVEEA  +GIEDI+I+  ++K +I DHFD   ELE  LK+K K E  + V+  +++A+I Y+RQKE  GLGHAI+ A++FIGNEPFA+LLGDD++    +S+ PA+KQ I+++EE   S++GVQEV   +  +YGIIDPL +     +   VK  +EKP    +PSN AI+GRYVLTP IF  L+  +     EI++T ++  +     VYA  F G+RYD+G K+G++K T++ +L    +R+EL  ++K L
  S:     1 MLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIV----ESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTK---NGRQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKAL 258
>gi|28899485|ref|NP_799090.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839892|ref|ZP_01992559.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus AQ3810] >gi|28807721|dbj|BAC60974.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|149746589|gb|EDM57577.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus AQ3810] (290 aa)
Score = 600, Expect = 2.8e-60, Identities = 126/269 (46%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+SIMDHFD  +ELE ++   NK E    +R I + A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   +     L Q + LF++   SIV VQEV   E  KYG+I       +K    RV +M+EKP+P  +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +LL  A+   V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEEEG---VLAQMVALFKQFRCSIVAVQEVPADETHKYGVISGEM---IKDDIYRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEAT 264
>gi|99079856|ref|YP_612010.1| UDP-glucose pyrophosphorylase [Silicibacter sp. TM1040] >gi|99036136|gb|ABF62748.1| UDP-glucose pyrophosphorylase [Silicibacter sp. TM1040] (297 aa)
Score = 600, Expect = 2.9e-60, Identities = 120/294 (40%), Positives = 199/294 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLL-NLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           M ++VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA A+GI++ + + S+ K ++ D+FD+   LE+ L++K K +  ++++  +     I YIRQ + +GLGHA+  A+R IG+EPFA++L DDVI     +DKP L+Q +E + E   ++V   EV  ++ S YGI+D     D K   M +  MIEKP P  +PSN A++GRY+L+PS+ + L + +    GEI++T ++  ++A+   V    F G+R+D GSK G+L+AT+  +L + ++RD+L+EY+  L
  S:     1 MPRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEARAAGIKEFIFVTSRGKGALEDYFDHAPVLEQELRKKGKDQLLEVLKATNMGSGDIAYIRQHKALGLGHAVWCARRLIGDEPFAVMLPDDVIA----ADKPCLQQMVEAYAETGGNMVAAMEVAPEKTSSYGILD---VKDSKDAVMPINAMIEKPSPEEAPSNLAVIGRYILSPSVLQNLNKRKQGAGGEIQLTDAIAEDIARDVPVCGYRFKGRRFDCGSKSGFLQATVAFALEREELRDDLMEYLSTL 289
>gi|114776904|ref|ZP_01451947.1| UTP-glucose-1-phosphate uridylyltransferase [Mariprofundus ferrooxydans PV-1] >gi|114552990|gb|EAU55421.1| UTP-glucose-1-phosphate uridylyltransferase [Mariprofundus ferrooxydans PV-1] (287 aa)
Score = 599, Expect = 3.5e-60, Identities = 120/286 (41%), Positives = 188/286 (65%)
  Q:     7 KAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           K + PAAGMGTRFLPATKA PKEML I+DKP IQ+ VEEA+A+G++ I+++  + K +I DHFD   ELE  LK   K + YK V  +S MA + Y+RQK+ +GLGHA+  A+ ++ +EPF + L D++IV N     PA++Q  E++E    S++G+ +V   +VS+YGI+D + +   ++  +R+ +M+EKP P  +PS+ AI+GRY+ TP++   L++ Q    GEI++T ++  LA++E +Y  +  G+R+D G+  G+LKA   + L      D   + +K
  S:     6 KIIFPAAGMGTRFLPATKASPKEMLTIVDKPLIQYGVEEALAAGMDHIIMVTGRGKRAIEDHFDISAELEANLKSAGKSKLYKAVSRVSRMAEVVYVRQKQALGLGHAVLCAEHWLNDEPFGVSLADELIVGN----IPAMQQLREVYEATGCSVLGLMQVPEDQVSRYGIVDYIAE---ESGLLRLTDMVEKPAPEDAPSHLAIVGRYIFTPALMALLKDVQPGKGGEIQLTDAIATLAKQEPIYGVLLDGQRFDAGTPEGFLKANAVLGLQHAVYGDAFRQALK 284
>gi|21243027|ref|NP_642609.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas axonopodis pv. citri str. 306] >gi|21108536|gb|AAM37145.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas axonopodis pv. citri str. 306] (297 aa)
Score = 599, Expect = 3.8e-60, Identities = 120/278 (43%), Positives = 185/278 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M +R+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + D     ++ Q E +GLGHA+  AK  +GNEPFA+LL DD++   N+ D  AL Q   + E    S++ V++V H + + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF  LE T     GEI++T ++  L ++E V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPDGVRAIFVTQAEALGLGHAVLCAKAVVGNEPFAVLLPDDLMW--NRGDA-ALTQMANVAEASGGSVIAVEDVPHDKTASYGIV---STDAFDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAELLKEEQVDAFRFEGRRFDCGAHIGLIEATVHFAL 273
>gi|55275412|gb|AAV49509.1| UDP-glucose pyrophosphorylase [Acidithiobacillus ferrooxidans] (298 aa)
Score = 599, Expect = 3.9e-60, Identities = 125/292 (42%), Positives = 188/292 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI--SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           V KAV P AG+GTRFLPATKA  KEM+PI+DKP IQ+ VEEA+A+G + ++ I  + K +I DHFD  +ELE  L+++ K +  K V+ I  S ++ I ++RQ  P+GLGHA+ MA+  +G+EPFA+LL DD+++    S+ P L Q +E +      I+GV+E+  +  ++YG++D     D   Q   V  ++EKP P  +PSN  ++GRY+L   IF  LE+TQ    GEI++T ++ +L  +  V A +F+G+R+D G K+GYLKAT+      P+V  +   YM  + E
  S:     4 VRKAVFPVAGLGTRFLPATKASAKEMMPIVDKPLIQYAVEEAIAAGCDQLIFISGRGKRAIEDHFDVSYELEIELEKRGKADLLKQVQGILPSHVSTI-FLRQPYPLGLGHAVLMARPVVGDEPFAVLLADDLML----SESPVLAQMVEQYRRYQTGILGVEEIPREHSTRYGVVDARPWDDRIYQ---VSGIVEKPKPEDAPSNLGVVGRYILPARIFHFLEQTQQGAGGEIQLTDAIAHLLNERQVLAYLFSGQRFDCGDKLGYLKATIAFGKLHPEVGADFTRYMDSICE 289
>gi|21231627|ref|NP_637544.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66768251|ref|YP_243013.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|21113320|gb|AAM41468.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66573583|gb|AAY48993.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. campestris str. 8004] (297 aa)
Score = 599, Expect = 4.0e-60, Identities = 119/278 (42%), Positives = 187/278 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M KR+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + +     ++ Q E +GLGHA+  AK  +G+EPFA+LL DD++   N+ D  AL Q  ++ E    S++ V++V H + + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF+ LE T     GEI++T ++  L ++E V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVMCAKAVVGDEPFAVLLPDDLMW--NRGDA-ALTQMADVAEASGGSVIAVEDVPHDKTASYGIV---STDAFDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAELLKQEQVDAFRFEGRRFDCGAHIGLIEATVHFAL 273
>gi|163802886|ref|ZP_02196774.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio campbellii AND4] >gi|159173293|gb|EDP58119.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio campbellii AND4] (290 aa)
Score = 598, Expect = 4.0e-60, Identities = 128/269 (47%), Positives = 178/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+SIMDHFD  +ELE ++   NK E    +R I D A+  YIRQ+E  GLGHAI   +  IG+EPFA++L DD+ V  N+ D   L Q + LF++   SIV VQEV  +E  KYG+I       +K    RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIDSANFTYIRQREMKGLGHAILTGRELIGDEPFAVVLADDLCV--NEQDG-VLAQMVALFKQFRCSIVAVQEVPEEETHKYGVISGEM---IKDDIYRVDDMVEKPESGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAGCVLAYKFKGRRFDCGSVEGYIEAT 264
>gi|119898291|ref|YP_933504.1| UTP-glucose-1-phosphate uridylyltransferase [Azoarcus sp. BH72] >gi|119670704|emb|CAL94617.1| UTP-glucose-1-phosphate uridylyltransferase [Azoarcus sp. BH72] (301 aa)
Score = 598, Expect = 4.2e-60, Identities = 125/289 (43%), Positives = 183/289 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLV-RNISDMAHIHYIRQKEPMGLGHAINMAKRFIG-NEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K+VTKAV P AGMGTRFLPATKA PKEMLP++DKP IQ+ VEEAVA+GI D++ I  + K +I DHFD  +ELE  L+ + K E  ++V + +    +  YIRQ E +GLGHA+  A   +G +EPFA++L DD++  +N   KP + Q  E++     S++G   V  +E  +YGI+    Q        RV  ++EKP P  +P+  A++GRY+LTP IF+ L   +    GE+++T ++ +L ++E V +  + G RYD GSK+GYLKA ++  L   +V  E   Y+
  S:     2 KKVTKAVFPVAGMGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGITDMIFITGRTKRAIEDHFDKAYELETELEARGKKELLEVVAKTVPKGMNCVYIRQSEALGLGHAVLCASAVVGDDEPFAVILADDLL--DNHGGKPVMAQMSEVYNYHRCSVLGTMNVPRQETRQYGIVSTESQ---SGNIQRVTGIVEKPKPEEAPTTQAVVGRYILTPRIFEHLRALKPGAGGELQLTDAIASLLKEEAVLSYQYEGVRYDCGSKLGYLKAAVEFGLRHHEVGAEFAAYL 287
>gi|74316643|ref|YP_314383.1| UDP-glucose pyrophosphorylase [Thiobacillus denitrificans ATCC 25259] >gi|74056138|gb|AAZ96578.1| UTP--glucose-1-phosphate uridylyltransferase [Thiobacillus denitrificans ATCC 25259] (289 aa)
Score = 598, Expect = 4.3e-60, Identities = 121/290 (41%), Positives = 185/290 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++V KAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA+ +GI DI+ + S+ K ++ DHFD  +ELE  L  + K  D +LV++I     +  YIRQ E +GLGHA+  A+  +G EPFA++L DD++          +KQ ++ +     S++GVQ+V  ++ + YGI+D     D   +  RV  ++EKP P  +PS   ++GRY+LTP IF  +++      GE+++T ++  L +++ V A  + G RYD GSK+GYL+AT++ +L   +V  +   Y+K
  S:     2 QQVRKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMDAGITDIIFVSSRTKRTVEDHFDKAYELETELAARGKNRDLELVQSIRPAGVNFIYIRQAEALGLGHAVLCARPVVGEEPFAVILADDLL----DGATSVMKQMVDQYSYYQCSVLGVQQVAPEDTASYGIVDATPLAD---RVSRVNAIVEKPKPEEAPSTLGVVGRYILTPRIFDHIQQITPGAGGELQLTDAIAGLLKEQQVLAYAYDGVRYDCGSKLGYLQATVEYALKHKEVAADFEAYLK 285
>gi|182705040|ref|ZP_02957433.1| UTP-glucose-1-phosphate uridylyltransferase [Methylocella silvestris BL2] >gi|172065889|gb|EDT52030.1| UTP-glucose-1-phosphate uridylyltransferase [Methylocella silvestris BL2] (295 aa)
Score = 598, Expect = 4.4e-60, Identities = 119/283 (42%), Positives = 174/283 (61%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYK-LVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV 283
           M KR+ KAV P AG+GTRFLPATK++PKEML I+D+P +Q +VEEA  +GIE  + +  + K  I DHFD  +EL++ L+++ K++++  L   +       + RQ+ P+GLGHAI  A+  +G+EPFA+LL D V +   QS    L QCIE + +   +I+ V+EV  +E  +YGI+           S  +  M+EKP    +PSN  I GRY+L P IFK LE+ +    GEI++T  +  LA  +  +   F GK YD GSK+G+L A +  +LS PD+
  S:     1 MTKRIRKAVFPVAGLGTRFLPATKSIPKEMLTIVDRPVLQHVVEEAAEAGIEHFIFVTGRGKAVIEDHFDIAYELDDTLQKRGKLKEFNALKEQLPAAGATSFTRQQAPLGLGHAIWCARELVGDEPFAVLLPDMVTMAGPQSSGRCLSQCIEAYAKHGGNIIAVEEVAPEETHQYGIVSIGRDFG---SSFEITGMVEKPPQGTAPSNCIISGRYLLGPEIFKILEKVEKGAGGEIQLTDGMKELAATQSFHGVRFDGKTYDCGSKLGFLSANVAFALSNPDI 281
>gi|188991387|ref|YP_001903397.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. campestris] >gi|167733147|emb|CAP51345.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. campestris] (297 aa)
Score = 598, Expect = 5.1e-60, Identities = 119/278 (42%), Positives = 187/278 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M KR+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + +     ++ Q E +GLGHA+  AK  +G+EPFA+LL DD++   N+ D  AL Q  ++ E    S++ V++V H + + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF+ LE T     GEI++T ++  L ++E V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMW--NRGDA-ALTQMADVAEASGGSVIAVEDVPHDKTASYGIV---STDAFDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAELLKQEQVDAFRFEGRRFDCGAHIGLIEATVHFAL 273
>gi|77463120|ref|YP_352624.1| UDP-glucose pyrophosphorylase [Rhodobacter sphaeroides 2.4.1] >gi|77387538|gb|ABA78723.1| UDP-glucose pyrophosphorylase [Rhodobacter sphaeroides 2.4.1] (312 aa)
Score = 597, Expect = 5.6e-60, Identities = 122/294 (41%), Positives = 189/294 (64%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEG-VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++VT A+ P AGMGTRFLPATK++PKE+L ++DKP IQ+ VEEA  +GIED + + S+ K ++ D FD    LE  L+   K E    +   + D  H+ Y+RQ E +GLGHA+  A+R +G+EPFA++L DD++V    +DKP L Q IE  EE   SI+   EV  ++ S YG++D  E+   +   +R + ++EKP    +PSN A++GRY+L P + + L+   V   GEI++T ++ + LA   G V+   F G+R+D GSK G+L+AT+ ++L + D+R E   +++ + E
  S:     4 QKVTTAIFPIAGMGTRFLPATKSIPKEILTLVDKPLIQYAVEEAREAGIEDFIFVTSRGKGALEDFFDVNQTLERALRAAGKTELLATLEATNIDSGHVTYVRQHEALGLGHAVWCARRLVGDEPFAVILPDDMVV----ADKPCLAQMIEAHEEVGGSIIATMEVPAEKASSYGVLDIEER---QGALIRPRGIVEKPKAGTAPSNMAVIGRYILGPRVMQHLDRRTVGAGGEIQLTDAIAHELATHPGSVHGFRFQGERFDCGSKAGFLQATVALALEREDLRGEFSTFLRAIAE 293
>gi|121595218|ref|YP_987114.1| UDP-glucose pyrophosphorylase [Acidovorax sp. JS42] >gi|120607298|gb|ABM43038.1| UDP-glucose pyrophosphorylase [Acidovorax sp. JS42] (295 aa)
Score = 597, Expect = 5.7e-60, Identities = 128/291 (43%), Positives = 183/291 (62%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQS-----MRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           RV KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA  +GI D++ +  + K +I DHFD  +ELE  L+   K E   LVR+I+ D  +  ++RQ   +GLGHA+  A+  +GNEPFA++L DD++          + Q    F ++  S++ VQEV  +   +YGI+        K +S     +RV  ++EKP P  +PS   + GRYVLTP IF+E+        GEI++T ++  L Q E VYA  + GKRYD GSK G+L+AT++++L  P V  +  EY++ L
  S:     6 RVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMVFVTGRSKRAIEDHFDTAYELENELENAGKREMLALVRSIAPDDMNCLFVRQPRSLGLGHAVLCAEPLVGNEPFAVILADDLMT-GEPGGPGVMAQMTAAFAKQGRSLLAVQEVPLEHTKRYGIV--------KGESAGGALIRVDEIVEKPAPEKAPSRMGVAGRYVLTPRIFEEIRNQPQGVGGEIQLTDAIARLMQHETVYAYQYAGKRYDCGSKEGFLEATVELALQHPQVGPQFREYLQSL 293
>gi|146282465|ref|YP_001172618.1| UTP--glucose-1-phosphate uridylyltransferase [Pseudomonas stutzeri A1501] >gi|145570670|gb|ABP79776.1| UTP--glucose-1-phosphate uridylyltransferase [Pseudomonas stutzeri A1501] (279 aa)
Score = 597, Expect = 5.9e-60, Identities = 123/269 (45%), Positives = 174/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+A+G+  I ++  + K S+ DHFD  +ELE +++  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ +  N    P L Q ++L+ +   SIV +QEV  +E SKYG+I       ++    RV +M+EKP P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTQIAMVTGRGKRSLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIGDEPFAVVLADDLCI--NLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVI---AGEMIRDDIFRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQDGCVLAYKFKGQRFDCGSAEGYIEAT 265
>gi|69936128|ref|ZP_00630988.1| Nucleotidyl transferase [Paracoccus denitrificans PD1222] >gi|119385028|ref|YP_916084.1| nucleotidyl transferase [Paracoccus denitrificans PD1222] >gi|119374795|gb|ABL70388.1| UDP-glucose pyrophosphorylase [Paracoccus denitrificans PD1222] (296 aa)
Score = 597, Expect = 6.8e-60, Identities = 118/299 (39%), Positives = 195/299 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M ++VTKA+ P AG+GTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GIE+ + + S+ K ++ D+FD+  ELE  LK+  K E  +++R+ + D   I Y+RQ + +GLGHA+  A+R +G+EPFA++L DDVI+     + P L+Q +E + E   S+V   EV   +   YG++D  E +      +R + M+EKP  +  PSN A++GRY+L PS+   L + +    GEI++T ++ + +A+   V+   F G+R+D GSK G+L+AT+   L++ D++DE  +Y+  L    K
  S:     1 MTRKVTKAIFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIEEFIFVTSRGKGALEDYFDHAHELESSLKKSGKTELLEILRSTNMDSGAIAYVRQHKALGLGHAVWCARRLVGDEPFAVILTDDVIM----GEPPCLQQMVEAYNETGGSMVATMEVPLDKTRAYGVLDVAEDMG---AIVRARGMVEKPKEN-PPSNLAVIGRYILAPSVLNNLNKLKQGSGGEIQLTDAIADEIAEGRDVFGLRFRGQRFDCGSKAGFLQATVAFGLARDDLKDEFADYLSDLQAMRK 293
>gi|84394371|ref|ZP_00993091.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio splendidus 12B01] >gi|84375000|gb|EAP91927.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio splendidus 12B01] (290 aa)
Score = 596, Expect = 6.9e-60, Identities = 122/269 (45%), Positives = 177/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+S+MDHFD  +ELE ++   NK +    +R   + A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   Q     L Q + L+++   SIV VQEV   E  KYG+I       +K    RV +M+EKP+P  +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTNKEDLLINIRETIEAANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEQQG---VLAQMVALYKQFRCSIVAVQEVPENETHKYGVISGEM---IKDDLFRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|152993519|ref|YP_001359240.1| UTP--glucose-1-phosphate uridylyltransferase [Sulfurovum sp. NBC37-1] >gi|151425380|dbj|BAF72883.1| UTP--glucose-1-phosphate uridylyltransferase [Sulfurovum sp. NBC37-1] (275 aa)
Score = 596, Expect = 8.8e-60, Identities = 124/269 (46%), Positives = 170/269 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKA PKEMLP+L KP IQ+ VEEA+ +GI  + ++  + K +I DHFD  +ELE ++K  +K      +R +       Y RQ E  GLGHAI   +  IGNEPFA++L DD+   NN  + P LKQ + ++E+   S++ ++EV   +  KYGII     VD    + RV +M+EKPDP  +P+N AI+GRY+LTP IF  L  TQ    GEI+IT +LL  A++  V A  F GKR+D GS  G+++AT
  S:     2 IKKCLFPAAGYGTRFLPATKATPKEMLPVLTKPLIQYGVEEALEAGITTMAVVTGRGKRAIEDHFDISYELEHQIKGTSKEPLLNEIRELIAQCTFSYTRQTEMKGLGHAILTGETLIGNEPFAVILADDLC--NNNGNDPVLKQMVAVYEKYQCSVIAIEEVPMDQTDKYGIIAG-NLVDNTDDTYRVTDMVEKPDPEDAPTNMAIIGRYILTPDIFNILRNTQPGKGGEIQITDALLEQAKQGKVIAYKFKGKRFDCGSVNGFVEAT 267
>gi|153834002|ref|ZP_01986669.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio harveyi HY01] >gi|148869646|gb|EDL68632.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio harveyi HY01] (290 aa)
Score = 596, Expect = 8.8e-60, Identities = 125/269 (46%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+SIMDHFD  +ELE ++   NK E    +R I D A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   +     L Q + LF++   SIV VQEV  +E  KYG+I       +K    RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIDSANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEQEG---VLAQMVALFKQFRCSIVAVQEVPEEETHKYGVISGEM---IKDDIYRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|162447697|ref|YP_001620829.1| UDP glucose pyrophosphorylase [Acholeplasma laidlawii PG-8A] >gi|161985804|gb|ABX81453.1| UDP glucose pyrophosphorylase [Acholeplasma laidlawii PG-8A] (286 aa)
Score = 596, Expect = 8.9e-60, Identities = 142/287 (49%), Positives = 198/287 (68%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           + KAV+PAAG GTRFLP TKA+PKEMLPI+DKP + +I+EEAVASGIE+ILII+S  K +I  +F++  ELE+ LK+KNK++D KL++N S  A I Y  Q+E +GLGHA+  A++FI  EPFA+LLGDDV V     +KPAL Q I+ + +K  SI+G  EV  ++   YGI  P  + D     + ++ ++EKP  S  PS+ AI GRYVLTP IF+ L++ +     EI++T S+L L   E V++    GKRYDIGSKIGY++A +D  L + D++ +L E +
  S:     2 IKKAVVPAAGWGTRFLPITKAVPKEMLPIIDKPALSYIIEEAVASGIEEILIIISSNKGAIQSYFEHNVELEQFLKEKNKLDDIKLIKNTSYGAKIFYTTQEEQLGLGHAVLQAEKFINGEPFAVLLGDDVYV---SEEKPALLQLIDAYNDKKSSILGTMEVPLEDTKLYGICIP--KKDSVKPIVELEGVVEKPK-SNPPSHSAISGRYVLTPKIFQLLKDQKRGAGNEIQLTDSILRLMDYEKVFSFDMIGKRYDIGSKIGYIEAIIDFGLKRDDLKKDLNEIL 282
>gi|177670696|ref|ZP_02943786.1| UTP-glucose-1-phosphate uridylyltransferase [Micrococcus luteus NCTC 2665] >gi|172072124|gb|EDT58161.1| UTP-glucose-1-phosphate uridylyltransferase [Micrococcus luteus NCTC 2665] (304 aa)
Score = 595, Expect = 9.3e-60, Identities = 125/291 (42%), Positives = 188/291 (64%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID----PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           + R  KAVIPAAG+GTRFLPATKAMPKEMLP++D+P I+++V EA  +G+ D+L+I  + K ++ DHFD    LE  L++K   +    +     +  IHY+RQ E +GLGHA+N A+R +G EPFA+LLGDD+I       +  L++ I++ +    S++ + EV  + VS YG+      P E  D+    +RV +++EKP    +PS  AI+GRYVL P +F  L+ET     GEI++T +L  LA ++    GV+A VF G+RYD G K+GYL+A ++      D+  +L  +++
  S:     8 RPRTRKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIEYVVTEARRAGLADVLMITGRNKRALEDHFDRHPALEAVLERKGDAKRLAQIHESDLVGDIHYVRQGEALGLGHAVNCARRHVGEEPFAVLLGDDII----GDGEALLERMIDVQQRLGGSVIALMEVPEEAVSAYGVAAVEAVPGEGDDV----VRVTDLVEKPAREDAPSTLAIIGRYVLAPQVFDVLDETPPGRGGEIQLTDALQRLATEDGEGRGVHAVVFDGRRYDTGDKLGYLQAVIEFGTRHEDLGADLRAWLR 298
>gi|86147859|ref|ZP_01066165.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio sp. MED222] >gi|85834386|gb|EAQ52538.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio sp. MED222] (290 aa)
Score = 595, Expect = 9.3e-60, Identities = 122/269 (45%), Positives = 178/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+S+MDHFD  +ELE ++   NK +    +R   + A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   Q     L Q + L+++   SIV VQEV  +E  KYG+I       +K    RV +M+EKP+P  +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTNKEDLLINIRETIEAANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEQQG---VLTQMVALYKQFRCSIVAVQEVPEEETHKYGVISGEM---IKDDLFRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|91789569|ref|YP_550521.1| UDP-glucose pyrophosphorylase [Polaromonas sp. JS666] >gi|91698794|gb|ABE45623.1| UDP-glucose pyrophosphorylase [Polaromonas sp. JS666] (299 aa)
Score = 595, Expect = 9.7e-60, Identities = 124/290 (42%), Positives = 184/290 (63%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVD--LKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           K  + KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA A+GI  ++ +  + K +I DHFD  +ELE  L+   K E   LVR++  D  +  Y+RQ   +GLGHA+  A+  +G+EPFA+LL DD++V       P L Q    ++E + S++ VQEV      +YGI+   E +      + M+V+ ++EKP P ++PS   + GRY+LTP+IF+ +        GEI++T  + +L  +E VYA  + GKRYD GSK G+L+AT++++L  P+V     +Y+
  S:     3 KFTLNKAVFPVAGLGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRNKRAIEDHFDTAYELENELEVAQKQELLALVRSVQPDDMNFSYVRQPRSLGLGHAVLCAEHLVGDEPFAVLLADDLMV-GPPGGLPVLAQMAAQYQELHQSVLAVQEVPLAHTRRYGIV-AAEAISPGANPRLMKVQKIVEKPAPEVAPSRMGVAGRYILTPAIFEHIRRQASGVGGEIQLTDGISSLLAEEAVYALQYQGKRYDCGSKEGFLEATVELALQHPEVGQHFRQYL 293
>gi|90580140|ref|ZP_01235947.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio angustum S14] >gi|90438442|gb|EAS63626.1| UTP--glucose-1-phosphate uridylyltransferase [Vibrio angustum S14] (290 aa)
Score = 595, Expect = 9.7e-60, Identities = 127/269 (47%), Positives = 179/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ V+EA+ +G+  I I+  + KN++MDHFD  +ELE ++   NK E    +R+I D A+  YIRQ+E  GLGHAI   +  +GNEPFA++L DD+ V  ++  +  L Q  EL+++   SIV V+EV  +E  KYG+I       L+    RV NM+EKP+P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F GKR+D GS  GY+ AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIQAGMNRICIVTGRGKNTLMDHFDKNYELEHQISGTNKEELLVDIRDIIDSAYFTYIRQREMKGLGHAILTGRELVGNEPFAVVLADDLCV-TDEEQQGVLAQMAELYKQFRCSIVAVEEVPEEETHKYGVISGQM---LRDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDIIEQTEPGKGGEIQITDALMQQAQTGCVLAYKFKGKRFDCGSVEGYIDAT 266
>gi|160897658|ref|YP_001563240.1| UTP-glucose-1-phosphate uridylyltransferase [Delftia acidovorans SPH-1] >gi|160363242|gb|ABX34855.1| UTP-glucose-1-phosphate uridylyltransferase [Delftia acidovorans SPH-1] (295 aa)
Score = 595, Expect = 1.1e-59, Identities = 129/293 (44%), Positives = 186/293 (63%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS--DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII--DPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           + RV KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA  +GI D++ +  + K +I DHFD  +ELE  L+   K    +LVR+IS  DM  + ++RQ   +GLGHA+  A+  +GNEPFA+LL DD++V         + Q    F ++  S++ VQEV  ++  +YGI+  +P          MR++ ++EKP P  +PS   + GRYVLTP+IF+E+        GEI++T ++  L   E VYA  + GKRYD GSK G+L+AT++++L   DV     EY++ L
  S:     4 QTRVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMIFVTGRSKRAIEDHFDTAYELENELENAGKQAMLELVRSISPADMNCL-FVRQPRSLGLGHAVLCAEPLVGNEPFAVLLADDLMV-GEPGGPGVMAQMTSAFHKQGRSLLAVQEVPLEQTKRYGIVAGEP-----AGGSLMRIEKIVEKPAPEKAPSRMGVAGRYVLTPAIFEEIRNQPKGVGGEIQLTDAIERLMAHEAVYAFQYQGKRYDCGSKEGFLQATVELALQHEDVGASFREYLQGL 293
>gi|91225641|ref|ZP_01260715.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio alginolyticus 12G01] >gi|91189761|gb|EAS76035.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio alginolyticus 12G01] (290 aa)
Score = 595, Expect = 1.1e-59, Identities = 125/269 (46%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+SIMDHFD  +ELE ++   NK E    +R I + A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   +     L Q + LF++   SIV VQEV  +E  KYG+I       +K    RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +LL  A+   V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEQEG---VLAQMVALFKQFRCSIVAVQEVPAEETHKYGVISGEM---IKDDIYRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEAT 264
>gi|17548227|ref|NP_521567.1| UTP--glucose-1-phosphate uridylyltransferase UDP-glucose pyrophosphorylase protein [Ralstonia solanacearum GMI1000] >gi|17430473|emb|CAD17157.1| probable utp--glucose-1-phosphate uridylyltransferase udp-glucose pyrophosphorylase protein [Ralstonia solanacearum] (321 aa)
Score = 594, Expect = 1.2e-59, Identities = 120/291 (41%), Positives = 185/291 (63%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M +++TKAV P AG+GTRFLPATKA PKEMLPI+DKP IQ+ VEEA A+GI +++ I  + K +I DHFD  +ELE  L  KNK    ++V++I        Y+RQ E +GLGHA+  A++ + +EPFA++L DD++      +   ++Q  EL++    SIVGV+ +  +    YG++   E  D   + +++  ++EKP P  +PSN  ++GRY+LTP IF  L        GEI++T ++  L  +E + A  + G+R+D GSK GYL+AT++++L  P+V  +   Y+
  S:     1 MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGRAKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYVRQPETLGLGHAVLCAQKLVRDEPFAVILADDLL----DHEPSVMQQMTELYDHYRCSIVGVETIAPQASRSYGVVAGREWDD---RLIKLDGIVEKPAPEHAPSNLGVVGRYILTPRIFDHLRNLAPGTGGEIQLTDAIQRLMAEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGADFEAYL 285
>gi|190574014|ref|YP_001971859.1| putative UTP--glucose-1-phosphate uridylyltransferase [Stenotrophomonas maltophilia K279a] >gi|190011936|emb|CAQ45557.1| putative UTP--glucose-1-phosphate uridylyltransferase [Stenotrophomonas maltophilia K279a] (292 aa)
Score = 594, Expect = 1.3e-59, Identities = 120/283 (42%), Positives = 187/283 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV 283
           M KR+ KAV P AG+GTRFLPATK +PKEMLPI+D+P IQ+ V+EA+ +G + ++ I ++YK+++ D+FD  +ELE++L++  K E  +L+R++  +     ++ Q E +GLGHA+  AK  IG+EPFA+LL DD+I     S   ALKQ  +L E    S++ V++V H + + YGI+   E  D   +  R+  ++EKP P  +PS+ A++GRYVL+P IF+ LE+T     GEI++T ++  L + E V A  F G R+D G+ +G ++AT+  +L  P +
  S:     1 MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNRYKHAVADYFDKAYELEQKLERAGKQEQLELIRHVLPNGVRAIFVTQAEALGLGHAVLCAKAVIGDEPFAVLLPDDLIWNRGDS---ALKQMADLNEASGASVIAVEDVPHDKTASYGIV-ATEAFD--GRKGRISQIVEKPKPEDAPSDLAVVGRYVLSPKIFELLEQTGSGAGGEIQLTDAIAQLLKTEEVDAYRFEGTRFDCGTHLGLVEATIRFALDNPKL 278
>gi|193787990|dbj|BAG50499.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio parahaemolyticus] (292 aa)
Score = 594, Expect = 1.3e-59, Identities = 122/269 (45%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+S+MDHFD  +ELE ++   +K      +R++ D A   YIRQ+E  GLGHAI   +  + +EPFA++L DD+ V   Q     L Q +EL+++   SIV VQEV   E  KYG+I       +K    R+ NM+EKP+P  +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +L+  AQ   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTSKEALLDDIRSLIDSASYTYIRQREMKGLGHAILTGRELVDDEPFAVVLADDLCVNEEQG---VLAQMVELYKQFRCSIVAVQEVPETETHKYGVI---AGEMIKDDIFRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALMQQAQSGCVIAYKFKGQRFDCGSVEGYIEAT 264
>gi|194365430|ref|YP_002028040.1| UTP-glucose-1-phosphate uridylyltransferase [Stenotrophomonas maltophilia R551-3] >gi|194348234|gb|ACF51357.1| UTP-glucose-1-phosphate uridylyltransferase [Stenotrophomonas maltophilia R551-3] (292 aa)
Score = 594, Expect = 1.3e-59, Identities = 119/283 (42%), Positives = 188/283 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV 283
           M KR+ KAV P AG+GTRFLPATK +PKEMLPI+D+P IQ+ V+EA+ +G + ++ I ++YK+++ D+FD  +ELE++L++  K+E  +L+R++  +     ++ Q E +GLGHA+  AK  IG+EPFA+LL DD+I   N+ D  ALKQ  +L E    S++ V++V H + + YGI+          +  R+  ++EKP P  +PS+ A++GRYVL+P IF+ LE+T     GEI++T ++  L + E V A  F G R+D G+ +G ++AT+  +L  P +
  S:     1 MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNRYKHAVADYFDKAYELEQKLERAGKLEQLELIRHVLPNGVRAIFVTQAEALGLGHAVLCAKAVIGDEPFAVLLPDDLIW--NRGDG-ALKQMADLNEASGASVIAVEDVPHDKTASYGIV---ATDAFDGRKGRISQIVEKPKPEDAPSDLAVVGRYVLSPKIFELLEQTGSGAGGEIQLTDAIAQLLKTEEVDAYRFEGTRFDCGTHLGLVEATIRFALDNPKL 278
>gi|15793818|ref|NP_283640.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis Z2491] >gi|121051779|emb|CAM08085.1| putative UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis Z2491] (289 aa)
Score = 594, Expect = 1.5e-59, Identities = 132/280 (47%), Positives = 178/280 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPD 282
           K + KAV P AGMGTRFLPATKA PKEMLPI+DKP IQ+ VEEAV +G  +++ +  + K SI DHFD  +ELE  L+ ++K +  + VRNI        YIRQ E +GLGHA+  A+  IG+EPFA++L DD+I     + K ALKQ +E++E    SI+GV+ VE  +   YGI++  EQ+    Q  R+  ++EKP P  +PSN A++GRY+LTP IF  L         EI++T  +  L   E V A  F G RYD GSK+GYL+AT+   L  P+
  S:     2 KPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRNKRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARAAIGDEPFAVILADDLI----DAQKGALKQMVEVYERSGNSILGVETVEPSQTGSYGIVET-EQL---KQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPE 274
>gi|124483408|emb|CAM32577.1| UTP-glucose-1-phosphate uridylyltransferase protein [Herbaspirillum seropedicae] (297 aa)
Score = 594, Expect = 1.5e-59, Identities = 128/292 (43%), Positives = 184/292 (63%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLE-QVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M K++ KAV P AG+G+RFLPATKA PKEMLPI+DKP I + VEEAVA+GI +++ I  + K +I DHFD  +ELE  L+   K +  ++V+N +    +  +IRQ  P+GLGHA+  A+  +G EPFA+LL DD  +  +   KP L Q  E++E + +S++ VQEV   +  +YGI+     Q +L+    RV  ++EKP P  +PS  A++GRYVL   IF  LE       GEI++T  +  L Q E V A  + G+RYD GSK+GYLKAT+ + +  P+      E++K
  S:     2 MIKKIKKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIHYAVEEAVAAGITEMVFITGRNKRAIEDHFDKAYELESELEAAGKKKLLEIVQNVVPKSVNCIFIRQSVPLGLGHAVLCARPVVGEEPFAVLLADD-FMDTDAGVKPVLAQMTEIYEREGMSMLAVQEVPQSDTKQYGIVSATPYQPNLE----RVNAIVEKPAPEEAPSTLAVVGRYVLNNRIFDYLENIGRGAGGEIQLTDGIAKLMQAESVLAYRYQGQRYDCGSKLGYLKATVAMGMKHPETGAAFSEFLK 290
>gi|156975941|ref|YP_001446848.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|156527535|gb|ABU72621.1| hypothetical protein VIBHAR_03707 [Vibrio harveyi ATCC BAA-1116] (297 aa)
Score = 593, Expect = 1.5e-59, Identities = 125/269 (46%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+SIMDHFD  +ELE ++   NK E    +R I D A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   +     L Q + LF++   SIV VQEV  +E  KYG+I       +K    RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     9 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIDSANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEQEG---VLAQMVALFKQFRCSIVAVQEVPEEETHKYGVISGEM---IKDDIYRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAGCVLAYKFKGQRFDCGSVEGYIEAT 271
>gi|194539622|ref|YP_002074669.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio sp. Ex25] >gi|151938177|gb|EDN57017.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrio sp. Ex25] (290 aa)
Score = 593, Expect = 1.6e-59, Identities = 125/269 (46%), Positives = 175/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G+  + I+  + K+SIMDHFD  +ELE ++   NK E    +R I + A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   +     L Q + LF++   SIV VQEV   E  KYG+I       +K    RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E T+    GEI+IT +LL  A+   V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEEEG---VLAQMVALFKQFRCSIVAVQEVPEDETHKYGVISGEM---IKDDIYRVDDMVEKPEKGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEAT 264
>gi|149909392|ref|ZP_01898047.1| UTP--glucose-1-phosphate uridylyltransferase [Moritella sp. PE36] >gi|149807502|gb|EDM67451.1| UTP--glucose-1-phosphate uridylyltransferase [Moritella sp. PE36] (288 aa)
Score = 593, Expect = 1.7e-59, Identities = 123/268 (45%), Positives = 177/268 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKA 272
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ V+EA+ +G+  + I+  + K+S+MDHFD  +ELE+++K  NK E    +R I + AH  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V      K  L+Q + L+++   SIV V+EV   ++ KYG+I   +   ++    RV +M+EKP     PSN AI+GRY+LTP IF+ +E TQ    GEI+IT +LL  AQ+  V A  F GKR+D GS  GY+ A
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEAIEAGMNGMCIVTGRGKHSLMDHFDKNYELEDQIKGTNKEELLDDIREIIESAHFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEG---KGVLEQMVALYKQFRCSIVAVEEVPAGDIHKYGVIAGDQ---IRDDLYRVTDMVEKPAKGTEPSNLAIIGRYILTPDIFEYIENTQPGKGGEIQITDALLKQAQEGCVIAYKFKGKRFDCGSVEGYIDA 263
>gi|126461992|ref|YP_001043106.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Rhodobacter sphaeroides ATCC 17029] >gi|126103656|gb|ABN76334.1| UDP-glucose pyrophosphorylase [Rhodobacter sphaeroides ATCC 17029] (339 aa)
Score = 593, Expect = 1.7e-59, Identities = 121/294 (41%), Positives = 188/294 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEG-VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           ++VT A+ P AGMGTRFLPATK++PKE+L ++DKP IQ+ VEEA  +GIED + + S+ K ++ D FD    LE  L+   K E    +   + D  H+ Y+RQ E +GLGHA+  A+R +G+EPFA++L DD++V    +DKP L Q I   EE   SI+   EV  ++ S YG++D  E+   +   +R + ++EKP    +PSN A++GRY+L P + + L+   V   GEI++T ++ + LA   G V+   F G+R+D GSK G+L+AT+ ++L + D+R E   +++ + E
  S:    31 QKVTTAIFPIAGMGTRFLPATKSIPKEILTLVDKPLIQYAVEEAREAGIEDFIFVTSRGKGALEDFFDVNQTLERALRAAGKTELLATLEATNIDSGHVTYVRQHEALGLGHAVWCARRLVGDEPFAVILPDDMVV----ADKPCLAQMIAAHEEVGGSIIATMEVPAEKASSYGVLDIEER---QGALIRPRGIVEKPKAGTAPSNMAVIGRYILGPRVMQHLDRRTVGAGGEIQLTDAIAHELATHPGSVHGFRFQGERFDCGSKAGFLQATVALALEREDLRGEFSTFLRAIAE 320
>gi|124485721|ref|YP_001030337.1| UDP-glucose pyrophosphorylase [Methanocorpusculum labreanum Z] >gi|124363262|gb|ABN07070.1| UDP-glucose pyrophosphorylase [Methanocorpusculum labreanum Z] (312 aa)
Score = 593, Expect = 1.8e-59, Identities = 126/279 (45%), Positives = 182/279 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKP 281
           K+V KAVIPAAG GTRF P TKAMPKEM+P++DKP IQ++VEEAVASG +DILII  + K +I DHFD   EL E L+    ++       ++D+A IH+IRQKE  GLG AI  AK+ +G+EPF +LLGD + + + ++ KP   Q I++++   + ++GV+ V   ++  YGIID    + L+ +  ++K++IEKP P  +PSN   +GRY+LTP IF  LE+T+   +GEI++T +L +     G  AK     RYDIG   G++ + L + L  P
  S:    25 KQVRKAVIPAAGWGTRFFPITKAMPKEMVPVVDKPVIQYVVEEAVASGCDDILIITGKNKRAIEDHFDNSQELNEHLRNSGDLKLLAESEKLADLADIHFIRQKEQKGLGDAILCAKQHVGDEPFTVLLGDTICIPDAEA-KPCTAQLIDIYKRYKLPVIGVETVPEHKIKDYGIID---GILLEERLYQIKDIIEKPTPEEAPSNVGAMGRYLLTPEIFAILEDTKPGRKGEIQLTDALRHYDASLGYVAK---NTRYDIGDIPGWMVSNLQLLLKHP 296
>gi|195952986|ref|YP_002121276.1| UTP-glucose-1-phosphate uridylyltransferase [Hydrogenobaculum sp. Y04AAS1] >gi|195932598|gb|ACG57298.1| UTP-glucose-1-phosphate uridylyltransferase [Hydrogenobaculum sp. Y04AAS1] (292 aa)
Score = 592, Expect = 2.2e-59, Identities = 130/294 (44%), Positives = 192/294 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETN 298
           V KAVIP+AG GTRFLPATKAMPKEM PI+DKP IQFIVEE + S IE+I+ +  ++K  +  HFD   +LE  L++ NK +  + ++ +S + +  YIRQKE +GLGHA+  A+  +G EPF + LGD VI    Q+D   + +   L+++   SIV V EV  +EV KYGI+   E   ++     ++NM+EKPD   +PSN AILGRY+ TP+IF++L+ T+    GEI++T ++  L + E VYA     + YD G+K+ YLK  ++ +L + D++DE   ++K +V+ N
  S:     3 VRKAVIPSAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEELLMSSIENIIFVTGRHKRPLEHHFDVNTDLEIFLEKNNKKDLLENIKTVSHLINPIYIRQKEQLGLGHAVLTAEPVVGAEPFVVSLGDIVI----QTDVNIISEMKNLYKKFGKSIVAVYEVPREEVYKYGIVSGKE---IEDDIFLIENMVEKPDVETAPSNLAILGRYLFTPTIFEKLKNTKPGKGGEIQLTDAMKMLLEDEAVYAYKVKARVYDTGNKLDYLKTIVEFALQREDLKDEFFSFLKDVVKNN 289
>gi|71735884|ref|YP_274469.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556437|gb|AAZ35648.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] (279 aa)
Score = 592, Expect = 2.4e-59, Identities = 123/269 (45%), Positives = 175/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+A+G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IGNE FA++L DD+ V  N      L Q ++L +    SI+ +QEV+ +E +KYG+I   E   +K    RV NM+EKP P  +PSN AI+GRY+LTP IF+++E+T+    GEI+IT +L+  A +  V A  F G+R+D G   GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTEISIVTGRGKRALEDHFDISYELEHQIKGTDKEKYLVGIRKLIDECSFSYTRQTEMKGLGHAILSGRPLIGNEAFAVVLADDLCV--NPDGDGVLAQMVKLHKHYGCSIIAIQEVDPQETNKYGVIAGEE---IKPGLFRVTNMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAEGNVLAYKFKGERFDCGGAEGYIQAT 265
>gi|111225736|ref|YP_716530.1| UTP--glucose-1-phosphate uridylyltransferase [Frankia alni ACN14a] >gi|111153268|emb|CAJ65020.1| UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) (General stress protein 33) (GSP33) [Frankia alni ACN14a] (310 aa)
Score = 591, Expect = 2.6e-59, Identities = 126/288 (43%), Positives = 192/288 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQV----DLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLA--------QKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           VTKAVIPAAG+GTRFLPATKA+PKEMLP++D+P I+++VEEA   G+ D+L++ S+ K +I DHFD   ++E  L++K      + VR  +++A +H +RQ  P GLGHAI  A   +G+EPFA+LLGDD+I + +    P L + + +      S++ + EV  ++VS YG+   +E V    D +   +R+ +++EKP  + +PSN AI+GRYVL P IF+ L  T+    GEI+IT +L  LA          + V+  VFTG+RYD G +I YLKA + ++  + D+  +L  +++
  S:     3 VTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEASRVGLRDVLLVTSRTKKAIEDHFDREADIEAALERKGDETRLRRVRASAELAEVHSVRQPSPRGLGHAILCAAAHVGDEPFAVLLGDDLIDERD----PLLAEMLAVQARFGGSVIALMEVPREQVSMYGVAT-VESVPTGPDDRYGIVRILDLVEKPPVAEAPSNLAIIGRYVLAPEIFEVLRRTEPGRGGEIQITDALRTLALNAVAGGTDAQPVHGVVFTGRRYDTGDRIDYLKAVIRLACERADLGPDLYPWLE 297
>gi|66046211|ref|YP_236052.1| UTP--glucose-1-phosphate uridylyltransferase and type [Pseudomonas syringae pv. syringae B728a] >gi|63256918|gb|AAY38014.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Pseudomonas syringae pv. syringae B728a] (279 aa)
Score = 591, Expect = 2.7e-59, Identities = 123/269 (45%), Positives = 175/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+A+G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IGNE FA++L DD+ V  N      L Q ++L +    SI+ +QEV+ +E +KYG+I   E   +K    RV NM+EKP P  +PSN AI+GRY+LTP IF+++E+T+    GEI+IT +L+  A +  V A  F G+R+D G   GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTEISIVTGRGKRALEDHFDISYELEHQIKGTDKEKYLVGIRKLIDECSFSYTRQTEMKGLGHAILSGRPLIGNEAFAVVLADDLCV--NPEGDGVLAQMVKLHKHYGCSIIAIQEVDPQETNKYGVIAGEE---IKPGLFRVTNMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAEGNVLAYKFKGERFDCGGAEGYIQAT 265
>gi|84684600|ref|ZP_01012501.1| UDP-glucose pyrophosphate [Rhodobacterales bacterium HTCC2654] >gi|84667579|gb|EAQ14048.1| UDP-glucose pyrophosphate [Rhodobacterales bacterium HTCC2654] (298 aa)
Score = 591, Expect = 2.8e-59, Identities = 125/299 (41%), Positives = 192/299 (64%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM--AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M  +VTKA+ P AG+GTRFLPATK++PKE++ ++D+P IQ+ ++EA A+GIE+ + + S+ K S+ D+FD    LEE LK+K K +    V N ++M    I YIRQ + +GLGHAI  A R IG+EPFA++L DDVI  N +S    L+Q +E +EE   ++V   EV   + S YGI+D   +     +  +VK M+EKP     P+N A++GRY+LTP +   L   +    GEI++T ++ + + Q   V+   F G+R+D GSK GYL+AT+   L + ++ DEL+E+++ +V   +
  S:     1 MTNKVTKAIFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIEEFIFVTSRGKGSLEDYFDRAPILEEDLKEKGK-DKLLDVLNATNMESGAIAYIRQHKALGLGHAIYCAHRLIGDEPFAVILPDDVIATNGKS---CLQQMVEAYEETGGAMVACMEVPEDKASSYGILDVESE---NGRLAKVKAMVEKPAAGTQPTNLAVIGRYILTPDVLNNLGSFKKGAGGEIQLTDAIADEITQGRAVHGYRFDGQRFDCGSKAGYLQATVSFGLEREELHDELMEHLEQIVAMKR 295
>gi|15676538|ref|NP_273681.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis MC58] >gi|161869571|ref|YP_001598738.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis 053442] >gi|7225867|gb|AAF41061.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis MC58] >gi|161595124|gb|ABX72784.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis 053442] (289 aa)
Score = 591, Expect = 2.9e-59, Identities = 131/280 (46%), Positives = 177/280 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPD 282
           K + KAV P AGMGTRFLPATKA PKEMLPI+DKP IQ+ VEEAV +G  +++ +  + K SI DHFD  +ELE  L+ ++K +  + VRNI        YIRQ E +GLGHA+  A+  IG+EPFA++L DD+I     + K ALKQ +E++     SI+GV+ VE  +   YGI++  EQ+    Q  R+  ++EKP P  +PSN A++GRY+LTP IF  L         EI++T  +  L   E V A  F G RYD GSK+GYL+AT+   L  P+
  S:     2 KPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRNKRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARAAIGDEPFAVILADDLI----DAPKGALKQMVEVYGRSGNSILGVETVEASQTGSYGIVET-EQL---KQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTNLPRGAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPE 274
>gi|148292201|dbj|BAF62916.1| putative UDP-glucose pyrophosphorylase [uncultured bacterium] (285 aa)
Score = 591, Expect = 3.1e-59, Identities = 119/287 (41%), Positives = 181/287 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           + KA+ P  G+GTRFLPATKAMPKEMLP++DKP IQ+ VEEAVA+GIE+ + +  + K++I DHFD+  ELE  L+ K K +  + V+  + +   + Y+RQ+EP GLGHA+  A+  IGNEP A+LL DD+I+      KPAL + ++ ++  N  +V V  V   E   YGII P E        + VK ++EKP P  +PS  A++GRY++ P +F  L E +    GEI++T +L +   +       F+G+R+D GSK+G++KA +  +L +  +  EL +++
  S:     3 IKKAIFPVGGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGIEEFIFVTGRNKSAIEDHFDHSTELEHVLQAKGKTDALRTVQQMMREPGSVSYVRQQEPAGLGHAVWCARHQIGNEPVAVLLADDLIL-----GKPALAEMVDAYQGGN--MVAVMTVARAETGSYGIITPGED---SGNQIEVKGLVEKPAPGDAPSTLAVVGRYIIEPGVFSTLSEGKKGAGGEIQLTDALASRIGQAPFTGLKFSGQRFDCGSKLGFIKANMAFALQRDGLGAELKQWL 280
>gi|163797880|ref|ZP_02191824.1| UTP--glucose-1-phosphate uridylyltransferase [alpha proteobacterium BAL199] >gi|159176842|gb|EDP61410.1| UTP--glucose-1-phosphate uridylyltransferase [alpha proteobacterium BAL199] (285 aa)
Score = 591, Expect = 3.1e-59, Identities = 113/286 (39%), Positives = 188/286 (65%)
  Q:     7 KAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVR-NISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           KA+ P  G+GTRFLPATK+MPKEML ++DKP IQ+ VEEA  +GIE+++ I  + K +I DHFD+ +EL++ L  + K E  +LV+  I     + + RQ+EP+GLGHA+   + F+G+EP A+LL DD+I+    S+K  LKQ I+++ +   ++V + EV  ++ S YG++ P    D+  + + ++ ++EKP    +PSN A++GRY+L P +F++L   +    GEI++T +L      +     +F G+R+D G+K+G+L+A L  +L + D+RD++  ++K
  S:     3 KAIFPVGGLGTRFLPATKSMPKEMLTVVDKPLIQYAVEEAREAGIEELIFITGRGKTAIEDHFDHAYELQDMLVARGKDEALRLVKETIPKPGQLAFTRQQEPLGLGHAVWCGRNFVGSEPVAVLLADDLIL----SEKGCLKQMIDMYNQVGGNMVALMEVPKEQTSSYGVVKP---GDITDRLVEIRGLVEKPKAEEAPSNLAVIGRYILQPKVFEDLGRMEKGAGGEIQLTDALARQLGLQPFNGYLFEGRRFDCGNKVGFLEANLAFALDRADMRDDITAFLK 282
>gi|78048046|ref|YP_364221.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78036476|emb|CAJ24167.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] (297 aa)
Score = 591, Expect = 3.2e-59, Identities = 118/278 (42%), Positives = 185/278 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M +R+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + +     ++ Q E +GLGHA+  AK  +G+EPFA+LL DD++   N+ D  AL Q   + E    S++ V++V H + + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF  LE T     GEI++T ++  L ++E V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMW--NRGDA-ALTQMANVAEASGGSVIAVEDVPHDKTASYGIV---STDAFDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFDLLEATGAGAGGEIQLTDAIAELLKEEQVDAFRFEGRRFDCGAHIGLIEATVHFAL 273
>gi|110635073|ref|YP_675281.1| UDP-glucose pyrophosphorylase [Mesorhizobium sp. BNC1] >gi|110286057|gb|ABG64116.1| UDP-glucose pyrophosphorylase [Mesorhizobium sp. BNC1] (294 aa)
Score = 590, Expect = 3.9e-59, Identities = 120/294 (40%), Positives = 187/294 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVE 296
           K++ KAV P AG+GTRFLPATKA+PKEML ++DKP IQ++V+EA  +GIE  + +  + K +I DHFD   EL E L ++ K E  + ++ +  +     Y RQ+ P+GLGHA+  A+  +GNEPFA+LL D ++    QS+   +KQ +EL+ E   +I+ V+E +  E  KYGI+   ++         + +M+EKP P  +PSN+ I GRY+L P IF  LE+ +    GEI+IT ++L L  KE  YA +F G+ +D GS  G++KA + ++L +  ++ ++L ++K  +E
  S:     2 KKIRKAVFPVAGLGTRFLPATKALPKEMLTVVDKPVIQYVVDEAREAGIEHFIFVTGRNKTAIEDHFDVAVELYETLSRRGKTEILERLKAMQPEPGQTGYTRQQVPLGLGHAVWCARELVGNEPFALLLPDMIM----QSEPGCMKQMVELYMETGGNILAVEECDPAETQKYGIVGRGKETH---GGFEITSMVEKPKPKDAPSNFYINGRYILQPEIFSLLEDQETGAGGEIQITDAMLRLHAKEPFYAHIFRGRTFDCGSPEGFIKANIALALQQETLKPQVLGFLKDFLE 289
>gi|163737929|ref|ZP_02145345.1| putative aminotransferase [Phaeobacter gallaeciensis BS107] >gi|161388545|gb|EDQ12898.1| putative aminotransferase [Phaeobacter gallaeciensis BS107] (297 aa)
Score = 590, Expect = 4.2e-59, Identities = 115/299 (38%), Positives = 199/299 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLL-NLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M+++VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA  +GI++ + + S+ K ++ D+FD+   LE+ L++K K +   +++  + D   I YIRQ + +GLGHA+  A+R I NEPFA++L DDVI     ++ P LKQ +E +EE   ++V   EV  ++ S YG++D  + +      + V  M+EKP    +PSN A++GRY+L PS+ + L + +    GEI++T ++  ++A    VY   F G+R+D GSK G+L+AT+  +L++ ++RD+L+ Y+  + + +K
  S:     1 MRRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSRGKGALEDYFDHSPMLEQELRKKGKDDLLDILKATNMDSGAIAYIRQHQALGLGHAVWCARRLIANEPFAVILPDDVIA----AETPCLKQMVEAYEETGGNMVAAMEVPPEQTSSYGVLDVRDDMG---SVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQLTDAIAEDIAADVPVYGYRFRGQRFDCGSKAGFLQATVAFALAREELRDDLMCYINQIAQVDK 294
>gi|166712372|ref|ZP_02243579.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas oryzae pv. oryzicola BLS256] (297 aa)
Score = 590, Expect = 4.3e-59, Identities = 118/278 (42%), Positives = 187/278 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M +R+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + +     ++ Q E +GLGHA+  AK  +G+EPFA+LL DD++   N+ D  AL Q  ++ E    S++ V++V  ++ + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF+ LE T     GEI++T ++  L +KE V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMW--NRGDA-ALTQMADVAEASGGSVIAVEDVPQEKTASYGIV---STDAFDGRKGRINAIVEKPKPEVAPSNLAVVGRYVLSPKIFEFLEATGAGAGGEIQLTDAIAELLKKEQVDAFRFQGRRFDCGAHIGLIEATVHFAL 273
>gi|59800673|ref|YP_207385.1| putative UTP--glucose-1-phosphate uridylyltransferase [Neisseria gonorrhoeae FA 1090] >gi|194097934|ref|YP_002000980.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria gonorrhoeae NCCP11945] >gi|59717568|gb|AAW88973.1| putative UTP--glucose-1-phosphate uridylyltransferase [Neisseria gonorrhoeae FA 1090] >gi|193933224|gb|ACF29048.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria gonorrhoeae NCCP11945] (289 aa)
Score = 590, Expect = 4.4e-59, Identities = 131/280 (46%), Positives = 178/280 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPD 282
           K + KAV P AGMGTRFLPATKA PKEMLPI+DKP IQ+ VEEAV +G  +++ +  + K SI DHFD  +ELE +L+ ++K +  + VRNI        YIRQ E +GLGHA+  A+  IG+EPFA++L DD+I     + K ALKQ +E++     SI+GV+ VE  +   YGI++  EQ+    Q  R+  ++EKP P  +PSN A++GRY+LTP IF  L         EI++T  +  L   E V A  F G RYD GSK+GYL+AT+   L  P+
  S:     2 KPIKKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRNKRSIEDHFDKAYELETKLEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARAAIGDEPFAVILADDLI----DAPKGALKQMVEVYGRSGNSILGVETVEPSQTGSYGIVET-EQL---KQFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPE 274
>gi|78356563|ref|YP_388012.1| UDP-glucose pyrophosphorylase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218968|gb|ABB38317.1| UDP-glucose pyrophosphorylase [Desulfovibrio desulfuricans G20] (290 aa)
Score = 589, Expect = 4.7e-59, Identities = 125/291 (42%), Positives = 184/291 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           + K VIP AG GTR LPATK +PKEMLP+ +KP +Q++VEEA+ SG+ D++ + ++ K  I DHFDY  +LE  L++  K E  + VR +++M +IH +RQK  +GLGHA+  A+  + NEPFA+++GDD+        +P ++Q I +   + + +VGV EV   +VS+YGII   E   +     RV +++EKP  S +PS  AI+GRY+LTP IFK LE       GEI++T  L  LAQ  G+ A    G R+D G    YL A +  +L + D+RDEL+E ++ L+
  S:     3 IRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAMRSGLTDVVFVTNRDKTIIEDHFDYNLQLESVLERAGKTEMLRQVREVAEMVNIHSVRQKRQLGLGHAVLCAREVVHNEPFAVMVGDDL----QFGMEPGIQQLINVAVAERLPVVGVMEVPADKVSRYGIISGEE---ISPGIFRVHDLVEKPAVSEAPSRLAIVGRYILTPDIFKVLENLSPGHGGEIQLTDGLKVLAQGRGLLAVKLRGMRFDAGDWAEYLTANIYFALQEEDLRDELVERLRPLL 286
>gi|118589198|ref|ZP_01546605.1| probable utp--glucose-1-phosphate uridylyltransferase protein [Stappia aggregata IAM 12614] >gi|118438527|gb|EAV45161.1| probable utp--glucose-1-phosphate uridylyltransferase protein [Stappia aggregata IAM 12614] (297 aa)
Score = 589, Expect = 4.7e-59, Identities = 120/295 (40%), Positives = 186/295 (63%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           M K + KA++P AG+GTRFLPATKA+PKEML I+D+P IQ++V+EA A+GIE I+ +  + K+ I DHFD  +ELE+ L+ +NK    +L+     +     + RQ+ P+GLGHAI  A+  IGNEPFAILL D +I    +S    LKQ ++L+++   +I+ V+EV   +  +YGI++   ++     + ++ NM+EKP P  +PSN  I GRY+L P IF  L        GEI++T S+L L +++   +  F G+ YD G+K G+L A +   +  P +  EL+ +M+ ++
  S:     1 MNKPIRKAILPVAGLGTRFLPATKAVPKEMLTIVDRPIIQYVVDEARAAGIEHIVFVTGRNKHVIEDHFDMAYELEDTLRSRNKTAALELLEKHRPVPGATSFTRQQAPLGLGHAIWCARDIIGNEPFAILLPDVII----KSQVSCLKQMVDLYQDTGGNIIAVEEVPEDQTDQYGIVELAGEI--SANAHKISNMVEKPAPGTAPSNLMITGRYILQPEIFDLLSNQGKGAGGEIQLTDSMLALMKEQNFASLKFEGRSYDCGNKAGFLSANIAFGMDDPKLARELVPFMEEII 290
>gi|167034532|ref|YP_001669763.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas putida GB-1] >gi|166861020|gb|ABY99427.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas putida GB-1] (279 aa)
Score = 589, Expect = 4.9e-59, Identities = 123/269 (45%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ V  N      L Q + L+++   SIV +QEV+ +E +KYG+I   E   +K    RV +M+EKP P  +PSN AI+GRY+LTP IF+++E+T+    GEI+IT +L+  A +  V A  F GKR+D G   GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRRLLDECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADDLCV--NLEGDGVLAQMVALYKKYRCSIVAIQEVDPQETNKYGVIAGEE---IKDGIFRVDSMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAEGNVIAYKFKGKRFDCGGAEGYIEAT 265
>gi|148244947|ref|YP_001219641.1| UTP--glucose-1-phosphate uridylyltransferase [Candidatus Vesicomyosocius okutanii HA] >gi|146326774|dbj|BAF61917.1| UTP--glucose-1-phosphate uridylyltransferase [Candidatus Vesicomyosocius okutanii HA] (277 aa)
Score = 589, Expect = 5.0e-59, Identities = 123/269 (45%), Positives = 177/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG+GTRFLPATKA+PKEMLPIL KP +Q+ VEEA+++ I +I I+ ++ K +I DHFD   ELE ++K   K E  K +  + + A   Y+RQK+ +GLG+AI   K  IGNEPFA+ L DD+    ++     L Q I+++ +   SIV ++EV   ++ KYG+I   + +D    + RV NM+EKP P  +P+N AI+GRY+LTP IF  L++T+    GEI+IT +LL  +++  V A  F GKR+D GS  GY+KAT
  S:     2 IKKCLFPAAGLGTRFLPATKAVPKEMLPILTKPLLQYAVEEALSANITNIAIVTNKNKRAIEDHFDQALELELQIKGTQKEELLKEINTVCNYATFTYVRQKQMLGLGYAILTGKALIGNEPFAVHLADDLC--TSEEGNSVLYQMIKIYNKYQCSIVAIEEVPMNQIHKYGVIVG-DLIDNTNNTYRVTNMVEKPTPKNAPTNMAIIGRYILTPDIFNILKQTKPDKGGEIQITDALLTQSKQGNVIAYKFKGKRFDCGSIQGYIKAT 267
>gi|58581809|ref|YP_200825.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84623713|ref|YP_451085.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58426403|gb|AAW75440.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84367653|dbj|BAE68811.1| UTP-glucose-1-phosphate uridylyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] (297 aa)
Score = 589, Expect = 5.0e-59, Identities = 118/278 (42%), Positives = 187/278 (67%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISL 278
           M +R+ KAV P AG+GTRFLPATK +PKEMLPI+DKP IQ+ V+EA+ +G + ++ + ++YK+SI D+FD  +ELE++L++  K+E  +LVR+ + +     ++ Q E +GLGHA+  AK  +G+EPFA+LL DD++   N+ D  AL Q  ++ E    S++ V++V  ++ + YGI+          +  R+  ++EKP P ++PSN A++GRYVL+P IF+ LE T     GEI++T ++  L +KE V A  F G+R+D G+ IG ++AT+  +L
  S:     1 MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMW--NRGDA-ALTQMADVAEASGGSVIAVEDVPQEKTASYGIV---STDAFDGRKGRITAIVEKPKPEVAPSNLAVVGRYVLSPKIFEFLEATGAGAGGEIQLTDAIAELLKKEQVDAFRFQGRRFDCGAHIGLIEATVHFAL 273
>gi|157737090|ref|YP_001489773.1| UTP--glucose-1-phosphate uridylyltransferase [Arcobacter butzleri RM4018] >gi|157698944|gb|ABV67104.1| UTP--glucose-1-phosphate uridylyltransferase [Arcobacter butzleri RM4018] (285 aa)
Score = 589, Expect = 5.7e-59, Identities = 127/273 (46%), Positives = 179/273 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPA---LKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           MK  + K + PAAG GTRFLPATKA PKEMLP+L KP IQ+ VEEA+A+G++ + I+  + K +I DHFD  +ELE ++K  NK      +R++       Y RQ E  GLGHAI   +  IG++PFA+LL DD+       D P    L Q +EL+++ + SIV ++EV  +E +KYG+I   E   ++     +K+M+EKP+P ++PSN AI+GRY+LTP IF  ++ET+    GEI+IT +LL  A+K  V A  F G+R+D GS  GY+KAT
  S:     1 MKNPIKKCLFPAAGYGTRFLPATKATPKEMLPVLTKPLIQYGVEEAIAAGMDTMAIVTGRGKRAIEDHFDISYELEHQIKGTNKEHYLTEIRSVITKCTFSYTRQIEMKGLGHAILCGETLIGDQPFAVLLADDL------CDAPTNGVLSQMVELYKKYHCSIVAIEEVPKEETNKYGVIAGNE---IEPGIYMIKDMVEKPEPEVAPSNLAIIGRYILTPDIFDIIKETKPGKGGEIQITDALLTQAKKGMVLAYKFEGQRFDCGSVDGYVKAT 267
>gi|148977875|ref|ZP_01814430.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrionales bacterium SWAT-3] >gi|145962944|gb|EDK28215.1| UTP-glucose-1-phosphate uridylyltransferase [Vibrionales bacterium SWAT-3] (290 aa)
Score = 588, Expect = 6.3e-59, Identities = 124/269 (46%), Positives = 179/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIID-PLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+P+++KP I++ VEEA+ +G++ + I+  + K+SIMDHFD  +ELE ++   NK +    +R   + A+  YIRQ+E  GLGHAI   +  +G+EPFA++L DD+ V   Q     L Q + L+++   SIV VQEV  +E  KYG+I   L + DL     RV +M+EKP+   +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +LL  A+   V A  F G+R+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMDGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEDLLINIRETIEAANFTYIRQREMKGLGHAILTGRELVGDEPFAVVLADDLCVNEQQG---VLAQMVALYKQFRCSIVAVQEVPEEETHKYGVISGELIKDDL----FRVDDMVEKPEQGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAKAGCVLAYKFKGQRFDCGSVEGYIEAT 264
>gi|146329538|ref|YP_001209247.1| UTP--glucose-1-phosphate uridylyltransferase [Dichelobacter nodosus VCS1703A] >gi|146233008|gb|ABQ13986.1| UTP--glucose-1-phosphate uridylyltransferase [Dichelobacter nodosus VCS1703A] (296 aa)
Score = 588, Expect = 6.8e-59, Identities = 125/291 (42%), Positives = 189/291 (64%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI--SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           ++  AV P AG GTRFLPATK+ PKEMLP++DKP IQ+ VEEA  +GI +++ +  + K SI +H+D  FELE  L+ KNK E  +LVR I   DM ++ +IRQ+  +GLGHA+  A+  + N PFA+LL DD++   N    P +KQ +EL+E+    ++GVQE+  +   +YGII    ++D +T SM +  ++EKP+P ++PS  AI+GRY+L   I + L+ T     GEI++T ++  L Q++ + A  F GKRYD G K+GYL+A ++  L+ P    +   Y++ L
  S:     5 KINLAVFPVAGFGTRFLPATKSTPKEMLPVVDKPLIQYAVEEAYDAGIRNMVFVTGRNKWSITEHYDVAFELESELQAKNKTEFLQLVRQIKPKDM-NVIFIRQEMMLGLGHAVLCAEPVVRNRPFAVLLADDLVA--NPDGAPVMKQMVELYEKHQQGVIGVQEILPEHTKRYGIITEAAKLDERT-SM-IAGVVEKPEPEVAPSRLAIIGRYILPGQIMEVLKTTPKGAGGEIQLTDAIAVLIQQKTLLAYRFLGKRYDCGDKLGYLQANVEFGLAHPQFGSDFKAYLQSL 292
>gi|121608021|ref|YP_995828.1| UTP-glucose-1-phosphate uridylyltransferase GalU [Verminephrobacter eiseniae EF01-2] >gi|121552661|gb|ABM56810.1| UDP-glucose pyrophosphorylase [Verminephrobacter eiseniae EF01-2] (296 aa)
Score = 588, Expect = 6.9e-59, Identities = 124/290 (42%), Positives = 182/290 (62%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS--DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII------DPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           + KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA A+GI  ++ +  + K +I DHFD  +ELE  L+   K E   LVR++   DM    ++RQ   +GLGHA+  A+  +G EPFA+LL DD++V      +P L+Q    F ++  S++ VQEV   +V +YGI+       PL         +R++ ++EKP    +PS   + GRY+LTP+IF+++        GEI++T  +  L   E VYA  + GKRYD GSK G+L+AT++++L  P V     +Y++ L
  S:     7 IRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRSKRAIEDHFDTAYELEAELEAAGKHELLALVRSVQPEDM-DCAFVRQPRSLGLGHAVLCAEPLVGQEPFAVLLADDLMVP-PPGGQPVLQQMAAAFGQQGRSVIAVQEVPADQVHRYGIVAGEPAGGPL---------IRIERIVEKPKAHAAPSRMGVAGRYILTPAIFEQIRHQPQGVGGEIQLTDGIARLLHSEAVYAFQYQGKRYDCGSKQGFLQATVELALQHPQVGAPFRDYLRAL 293
>gi|121634430|ref|YP_974675.1| UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis FAM18] >gi|120866136|emb|CAM09875.1| putative UTP--glucose-1-phosphate uridylyltransferase [Neisseria meningitidis FAM18] (289 aa)
Score = 587, Expect = 8.3e-59, Identities = 131/280 (46%), Positives = 177/280 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNI-SDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPD 282
           K + KAV P AGMGTRFLPATKA PKEMLPI+DKP IQ+ VEEAV +G  +++ +  + K SI DHFD  +ELE  L+ ++K +  + VRNI        YIRQ E +GLGHA+  A+  IG+EPFA++L DD+I     + K ALKQ +E++     SI+GV+ VE  +   YGI++  EQ+    Q  R+  ++EKP P  +PSN A++GRY+LTP IF  L         EI++T  +  L   E V A  F G RYD GSK+GYL+AT+   L  P+
  S:     2 KPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRNKRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARAAIGDEPFAVILADDLI----DAPKGALKQMVEVYGRSGNSILGVETVEASQTGSYGIVET-EQL---KQFQRIIGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDHEFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPE 274
>gi|104781412|ref|YP_607910.1| glucose-1-phosphate uridylyltransferase [Pseudomonas entomophila L48] >gi|95110399|emb|CAK15107.1| glucose-1-phosphate uridylyltransferase [Pseudomonas entomophila L48] (279 aa)
Score = 587, Expect = 8.5e-59, Identities = 123/269 (45%), Positives = 175/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+  I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ V  N   +  L Q + L+++   SIV +QEV+ +E +KYG+I   E   +K    RV  M+EKP P  +PSN AI+GRY+LTP IF+++E+T+    GEI+IT +L+  A +  V A  F GKR+D G   GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLHQISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRRLLDECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADDLCV--NLEGEGVLAQMVALYKKYRCSIVAIQEVDPQETNKYGVIAGEE---IKDGIFRVDAMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAEGNVIAYKFKGKRFDCGGAEGYIEAT 265
>gi|120610671|ref|YP_970349.1| UDP-glucose pyrophosphorylase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120589135|gb|ABM32575.1| UDP-glucose pyrophosphorylase [Acidovorax avenae subsp. citrulli AAC00-1] (305 aa)
Score = 587, Expect = 9.4e-59, Identities = 124/288 (43%), Positives = 182/288 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS--DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGII------DPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           + KAV P AG+GTRFLPATKA PKEMLP++DKP IQ+ VEEA A+GI  ++ +  + K +I DHFD  +ELE  L+   K +  +LVR+++  DM    ++RQ   +GLGHA+  A+  +G EPFA+LL DD++V      +P + Q    F ++  S++ VQEV   +V +YGI+       PL         +R+  ++EKP P  +PS   + GRY+LTP +F E+        GEI++T ++  L  +E VYA  + GKRYD GSK G+L+AT++++L  P V     EY+K
  S:    17 IRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRSKRAIEDHFDTAYELENELEAAGKKDLLQLVRSVAPNDM-DCAFVRQPRSLGLGHAVLCAEPLVGREPFAVLLADDLMV-GPPGGQPVMAQMAAAFRKQGRSLLAVQEVPQDQVRRYGIVAGEPAGGPL---------IRIDRIVEKPAPEEAPSRMGVAGRYILTPGVFDEIRNQPQGVGGEIQLTDAIARLMAREAVYAFRYEGKRYDCGSKEGFLEATVELALQHPQVGAAFREYLK 301
>gi|49083255|gb|AAT50984.1| PA2023 [synthetic construct] (280 aa)
Score = 587, Expect = 9.5e-59, Identities = 123/269 (45%), Positives = 173/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K S+ DHFD  +ELE +++  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ +  N      LKQ ++L+ +   SIV +QEV  +E +KYG+I       ++    RV  M+EKP P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKRSLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIGDEPFAVVLADDLCL--NLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVI---AGEMIRDDIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQDGCVLAYKFKGKRFDCGSAEGYIEAT 265
>gi|116671754|ref|YP_832687.1| UDP-glucose pyrophosphorylase [Arthrobacter sp. FB24] >gi|116611863|gb|ABK04587.1| UDP-glucose pyrophosphorylase [Arthrobacter sp. FB24] (323 aa)
Score = 587, Expect = 9.5e-59, Identities = 131/295 (44%), Positives = 197/295 (66%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKE----GVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           + K V KAVIPAAG+GTRFLPATKAMPKEMLP++D+P IQ++VEEAV +G+ D+L+I  + K ++ DHFD    LE  L+ K  ++  + V++ S +A +HY+RQ +P GLGHA+  A++ +G+EPFA+LLGDD+I + ++     L   I++  +   S++ + EV+  ++S YG  D +  VD      +V  ++EKP    +PSN A++GRYVL P++F  LEET+    GEI++T +L  LA  +    GVY  VF G+RYD G K+ Y+KA + I+  + D  ++L  +MK  V
  S:    29 LGKSVRKAVIPAAGLGTRFLPATKAMPKEMLPVVDQPAIQYVVEEAVKAGLTDLLMITGRQKRALEDHFDRAPALERTLELKGDLDRLEAVQHASSLAPLHYLRQGDPKGLGHAVLCARQHVGDEPFAVLLGDDLIDERDE----LLSTMIDVQAKTGGSVIALIEVDPSQISAYGCAD-ITPVD-GENYFQVNRLVEKPSVDEAPSNLAVIGRYVLHPAVFDVLEETEPGRGGEIQLTDALQTLATSDGEGGGVYGVVFRGRRYDTGDKLSYIKAVISIASERVDFGEDLKAWMKEFV 321
>gi|114330713|ref|YP_746935.1| UTP-glucose-1-phosphate uridylyltransferase [Nitrosomonas eutropha C91] >gi|114307727|gb|ABI58970.1| UDP-glucose pyrophosphorylase [Nitrosomonas eutropha C91] (295 aa)
Score = 587, Expect = 9.6e-59, Identities = 125/288 (43%), Positives = 178/288 (61%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS--DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPA-LKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           V KAV P AG+GTRFLPATKA  KEMLP++DKP IQ+ VEEA A+GI  ++ +  + K S+ DHFD  +ELE  L+   K     + R I+  DM    Y+RQ   MGLGHA+  +K  +G+EPFA+LL DD+++      KP  + Q +E F ++  SI+ VQ+V  +   +YGI+       +    + V  +IEKP P ++P+  A+ GRYVLTP IFKELE       GEI++T  +  L Q E V+A  + G RYD GSK+G+L+AT+D+     +V  E   +++
  S:     4 VKKAVFPIAGLGTRFLPATKASAKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRTKRSVEDHFDTAYELENELELAGKTMLLDVARGIAPDDMV-CTYVRQSRAMGLGHAVLCSKELVGHEPFAVLLADDLMI-----GKPTVMAQMVEQFAKRQASILAVQDVPREHTRRYGIVSGRS---VAPDLVDVSGIIEKPAPDVAPTTLAVAGRYVLTPGIFKELENMPHGVGGEIQLTDGIARLLQHEKVFAYRYKGVRYDCGSKLGFLQATVDLGECHDEVGAEFSAWLQ 285
>gi|28870286|ref|NP_792905.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas syringae pv. tomato str. DC3000] >gi|28853533|gb|AAO56600.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas syringae pv. tomato str. DC3000] (279 aa)
Score = 587, Expect = 9.7e-59, Identities = 123/269 (45%), Positives = 173/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+A+G+ +I I+  + K S+ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IGNE FA++L DD+ V  N      L Q ++L +    SI+ +QEV+  E +KYG+I   E   +K    RV +M+EKP P  +PSN AI+GRY+LTP IF+++E+T+    GEI+IT +L+  A +  V A  F G R+D G   GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTEISIVTGRGKRSLEDHFDISYELEHQIKGTDKEKYLVGIRKLIDECSFSYTRQTEMKGLGHAILSGRPLIGNEAFAVVLADDLCV--NLEGDGVLAQMVKLHKHYGCSIIAIQEVDPSETNKYGVIAGEE---IKPGLFRVTDMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAEGNVLAYKFKGTRFDCGGAEGYIEAT 265
>gi|146277994|ref|YP_001168153.1| putative UTP-glucose-1-phosphate uridylyltransferase GalU [Rhodobacter sphaeroides ATCC 17025] >gi|145556235|gb|ABP70848.1| UDP-glucose pyrophosphorylase [Rhodobacter sphaeroides ATCC 17025] (309 aa)
Score = 586, Expect = 1.0e-58, Identities = 119/292 (40%), Positives = 186/292 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLN-LAQKEG-VYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLL 294
           K+V  A+ P AGMGTRFLPATK++PKE+L ++DKP IQ+ VEEA  +GIED + + S+ K ++ D FD    LE  L+   K E    +   + D  H+ Y+RQ E +GLGHA+  A+R +G+ PFA++L DD++V    SD+P L Q +E   E   SI+   EV  ++ S YGI+D   +   +   +R + ++EKP    +PSN A++GRY+L P + + L+   V   GEI++T ++ + LA   G V+   F+G+R+D GSK G+L+AT+ ++L + D+RDE   +++ +
  S:     4 KKVNTAIFPIAGMGTRFLPATKSIPKEILTLVDKPLIQYAVEEAREAGIEDFIFVTSRGKGALEDFFDVNQPLERALRAAGKTELLATLEATNIDSGHVAYVRQHEALGLGHAVWCARRLVGDRPFAVILPDDMVV----SDRPCLAQMMEAHAEVGGSIIATMEVAPEKASSYGILDIESR---QGALVRPRGIVEKPKAGTAPSNMAVIGRYILGPRVMRHLDRRTVGAGGEIQLTDAIAHELATHPGSVHGFRFSGERFDCGSKAGFLQATVALALQRADLRDEFAAFLEAI 291
>gi|15597219|ref|NP_250713.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa PAO1] >gi|107101452|ref|ZP_01365370.1| hypothetical protein PaerPA_01002492 [Pseudomonas aeruginosa PACS2] >gi|116049973|ref|YP_791216.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa UCBPP-PA14] >gi|152988738|ref|YP_001348625.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa PA7] >gi|194546090|ref|YP_002081118.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa C3719] >gi|194551445|ref|YP_002086472.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa 2192] >gi|13959378|sp|Q9I291|GALU1_PSEAE UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|9948027|gb|AAG05411.1|AE004628_9 UTP--glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa PAO1] >gi|115585194|gb|ABJ11209.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa UCBPP-PA14] >gi|126167036|gb|EAZ52547.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa C3719] >gi|126193838|gb|EAZ57901.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa 2192] >gi|150963896|gb|ABR85921.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas aeruginosa PA7] (279 aa)
Score = 586, Expect = 1.1e-58, Identities = 123/269 (45%), Positives = 173/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K S+ DHFD  +ELE +++  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ +  N      LKQ ++L+ +   SIV +QEV  +E +KYG+I       ++    RV  M+EKP P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F GKR+D GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKRSLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIGDEPFAVVLADDLCL--NLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVI---AGEMIRDDIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQDGCVLAYKFKGKRFDCGSAEGYIEAT 265
>gi|146307332|ref|YP_001187797.1| UDP-glucose pyrophosphorylase [Pseudomonas mendocina ymp] >gi|145575533|gb|ABP85065.1| UDP-glucose pyrophosphorylase [Pseudomonas mendocina ymp] (287 aa)
Score = 586, Expect = 1.2e-58, Identities = 121/269 (44%), Positives = 174/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           +TK + PAAG GTRFLPATK+MPKEMLP++D P IQ+ VEEA+ +G+  I I+  + K S+ DHFD  +ELE  +   +K +    +R++ +     Y RQ E  GLGHAI   +  IG+E FA++L DD+ +  N      L Q ++L+E+   SIV ++EV   EVS+YG+I       L+    RV+ M+EKP+P  +PSN AI+GRY+LTP IF+ +E+T+    GEI+IT +L+  AQ+  V A  F G+R+D GS  GY++AT
  S:     2 ITKCLFPAAGYGTRFLPATKSMPKEMLPVVDTPLIQYGVEEALEAGLTQIAIVTGRGKRSLEDHFDISYELEHEISNTSKEKSLIGIRHLIETCTFSYTRQVEMKGLGHAILTGRPLIGDEAFAVVLADDLCL--NVDGDGVLSQMVKLYEQFRCSIVAIEEVPMDEVSRYGVI---AGEALREDIFRVERMVEKPNPEDAPSNLAIIGRYILTPDIFELIEQTEPGKSGEIQITDALMKQAQQGCVLAYKFKGQRFDCGSAEGYVQAT 265
>gi|77459154|ref|YP_348660.1| UDP-glucose pyrophosphorylase [Pseudomonas fluorescens PfO-1] >gi|77383157|gb|ABA74670.1| UDP-glucose pyrophosphorylase [Pseudomonas fluorescens PfO-1] (279 aa)
Score = 586, Expect = 1.2e-58, Identities = 122/269 (45%), Positives = 174/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ V  N      L Q ++L+++   SI+ +QEV+ +E SKYG+I       ++    RV +M+EKP P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F GKR+D G   GY++AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADDLCV--NLEGDGVLTQMVKLYKQFRCSIIAIQEVDPQETSKYGVI---AGEMIRDDIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQNGCVMAYKFKGKRFDCGGAEGYIEAT 265
>gi|90418887|ref|ZP_01226798.1| UTP--glucose-1-phosphate uridylyltransferase [Aurantimonas sp. SI85-9A1] >gi|90336967|gb|EAS50672.1| UTP--glucose-1-phosphate uridylyltransferase [Aurantimonas sp. SI85-9A1] (301 aa)
Score = 585, Expect = 1.6e-58, Identities = 118/297 (39%), Positives = 189/297 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           K+V KAV P AG+GTRFLPATK++PKEML ++D+P IQ++V+EA  +GIE ++ +  + K  I D+FD   EL   L ++ K  +  L+  +        + RQ+ P+GLGHA+  A+  +G+EPFA+LL D ++    Q++K  L + + L+EE   +++ V++ + +E  KYGI+   E+V       R+  M+EKP P+ +PSNY I GRY+L P IF  LE  +     EI++T  +L LA ++  YA  F G+ +D GSK G+++A +  +L +PD+RD+++  M+ L++T K
  S:     2 KKVRKAVFPVAGLGTRFLPATKSIPKEMLTVVDRPVIQYVVDEAREAGIEHLIFVTGRNKGVIEDYFDIQVELSNTLAERGKTAELDLLDRLQPKPGTASFTRQQAPLGLGHAVWCARDLVGDEPFALLLPDMIM----QAEKGCLAEMVRLYEETGGNVISVEQCDPQETDKYGIVGRGEEVG---SGFRLDGMVEKPKPAEAPSNYYISGRYILQPQIFDILETQEKGAGNEIQLTDGMLKLADQQDFYAYPFHGRTFDCGSKEGFIEANVAFALWRPDIRDKVIGNMERLMDTVK 292
>gi|78777670|ref|YP_393985.1| UTP--glucose-1-phosphate uridylyltransferase [Sulfurimonas denitrificans DSM 1251] >gi|78498210|gb|ABB44750.1| UDP-glucose pyrophosphorylase [Sulfurimonas denitrificans DSM 1251] (279 aa)
Score = 584, Expect = 2.0e-58, Identities = 127/270 (47%), Positives = 176/270 (65%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           ++ K + PAAG GTRFLPATKA+PKEMLPIL KP +Q+ VEEA  +GI+ + I+  + K +I DHFD  FELE ++   +K    K +R+I     I Y RQ E  GLGHAI   +  IG+EPFA++L DD+   + ++    L Q ++L+E+   SIV V+E+  +  +KYG+I   E+ D     +RV NM+EKP+   +PSN AI+GRY+LTP IF  LE+T+    GEI+IT +LL  A+  GV A  F GKR+D GS  G++KAT
  S:     7 KIRKCLFPAAGYGTRFLPATKAIPKEMLPILTKPLLQYGVEEAREAGIDTMAIVTGRGKRAIEDHFDRSFELEHQIDGTSKEILMKEIRDIVKNCTISYTRQGEMKGLGHAIWTGQTLIGDEPFAVILADDLCDNDGEA---VLTQMVKLYEKYRCSIVAVEEIPLEHSNKYGVIAGHEEED---GVIRVTNMVEKPESKDAPSNLAIIGRYILTPDIFDILEDTKPGKGGEIQITDALLTQAKTGGVIAYKFKGKRFDCGSVDGFVKAT 270
>gi|144897836|emb|CAM74700.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [Magnetospirillum gryphiswaldense MSR-1] (290 aa)
Score = 583, Expect = 2.3e-58, Identities = 117/291 (40%), Positives = 182/291 (62%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYM 291
           M +RV KAV P  GMGTRFLPATKAMPKEMLP++DKP IQ+ VEEA A+G E  + +  + KN++ DHFD+  ELE  LK++ K +  + V + +     + Y RQ EP+GLGHA+  A+  + +EPFA+LL DD+I+    +  P LKQ +    E    +V V +V  +   +YGI+D +E  + +    + K ++EKPDP+++PS  +I+GRY+L P++F  L++ +    GEI++T ++         +   F G+R+D G K+G+L+A +  +L + D  D + E +
  S:     1 MARRVRKAVFPVGGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAAAAGCEHFIFVTGRGKNALEDHFDHNPELERTLKERGKFDLVEAVTSWMPKSGQMSYTRQTEPLGLGHAVWCARDLVEDEPFAVLLPDDLIL----AKTPCLKQMVAAHTELGGHVVAVTDVPREHTKRYGILD-VEHDNGRVA--KAKGLVEKPDPAVAPSTLSIIGRYILHPAVFDVLDKKEKGAGGEIQLTDAISQTIGMVPFHGLRFDGQRFDCGDKVGWLEANIAFALEREDTGDAVREAL 285
>gi|42525101|ref|NP_970481.1| UTP-glucose-1-phosphate uridylyltransferase [Bdellovibrio bacteriovorus HD100] >gi|39577312|emb|CAE81135.1| UTP-glucose-1-phosphate uridylyltransferase [Bdellovibrio bacteriovorus HD100] (294 aa)
Score = 583, Expect = 2.4e-58, Identities = 129/296 (43%), Positives = 187/296 (63%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           RV KA+IPAAG+GTRFLPATK +PKEML I+D P I ++VEEAV +GIEDI++I  + K++I D FD  +ELE++L +  K +  + V  I D A+I  IRQK+ MGLGHA+      +G EPFA+LLGD+ I      +     Q +  FEE   S + V +VE K+VSKYGI +  E+    T   +V +++EKP  S + S +A+ GRYV   +I   L+  + +  GEI++T S+  L  + G+ A  FT +R+D G K+GYL+A ++++L  P++  EL  Y+  L E  K
  S:     3 RVKKAIIPAAGLGTRFLPATKTVPKEMLTIVDAPIILYVVEEAVKAGIEDIILIAGRGKHAIEDFFDTSYELEDKLAKDGKEKLLERVTRIRDSANIISIRQKQAMGLGHAVLCGLPIVGKEPFAVLLGDE-ITMGFHGEPNVTSQLVSSFEETGTSTISVMKVEDKDVSKYGIAEIEEK---STGFFKVTSLVEKPKASETNSRWALPGRYVFDNAIMDILQNAKPTLNGEIQLTDSMKVLCAQHGLNAMTFTAQRFDAGDKLGYLQANIELALQSPELNQELKSYILSLAEKLK 294
>gi|114571035|ref|YP_757715.1| UDP-glucose pyrophosphorylase [Maricaulis maris MCS10] >gi|114341497|gb|ABI66777.1| UDP-glucose pyrophosphorylase [Maricaulis maris MCS10] (290 aa)
Score = 583, Expect = 2.4e-58, Identities = 119/282 (42%), Positives = 182/282 (64%)
  Q:     4 RVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM----AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRD 285
           RV KAV+P AG GTR LPATK++PKEMLP+ D+P IQ++V+EA+A+GIE  + +  + K +I DHFD  +ELE  L+ K    +  L+  I+        + ++RQ+ P+GLGHAI  A+  IG++PFAILL D ++    Q++   L Q I +F+E   +++ V++V   EVSKYGIIDP  +       +R++ M+EKP    +PSN +I GRY+L  SIF+ L +      GEI++T ++  L + +  +A  + G+ YD GSK+GYL+AT+  + + P + D
  S:     3 RVRKAVLPVAGFGTRVLPATKSIPKEMLPVFDRPAIQYVVDEAIAAGIEHFVFVTGRNKAAIEDHFDTAYELEASLRMKG---EEGLLAEITQSKPTPGSMSFVRQQAPLGLGHAIWCARDIIGDDPFAILLPDVLV----QAEPSCLAQMINVFDETGGNVIAVEQVPPAEVSKYGIIDPQSR---DGNRIRMRGMVEKPPVDAAPSNLSITGRYILQGSIFEYLADQAAGAGGEIQLTDAMARLMETQDFHAVEYEGQSYDCGSKLGYLRATMAYARAHPSLGD 278
>gi|86742719|ref|YP_483119.1| UDP-glucose pyrophosphorylase [Frankia sp. CcI3] >gi|86569581|gb|ABD13390.1| UDP-glucose pyrophosphorylase [Frankia sp. CcI3] (348 aa)
Score = 583, Expect = 2.4e-58, Identities = 124/293 (42%), Positives = 198/293 (67%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQV---------DLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQK-----------------EGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           VTKAVIPAAG+GTRFLPATKA+PKEMLP++D+P I+++VEEA  +G+ D+L++ S+ K +I DHFD   ++E  L++K      + VR  +++A +H +RQ+ P GLGHA+  A   +GNEPFA+LLGDD+I + +      L++ + +      S++ + EV   +VS YG+   +E V         D +   +R+++++EKP  + +PSN AI+GRY+L+P+IF  L  T+    GEI++T +L  LA +                 E V+  +FTG+RYD G ++ YLKA + ++  + D+  EL  +++  V +
  S:    27 VTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEASRAGLRDVLLVTSRTKKAIEDHFDREADIEAALERKGDDLRLRRVRVSAELAEVHSVRQQSPRGLGHAVLCAAAHVGNEPFAVLLGDDLIDERDL----LLEEMLAVQRRFGGSVIALMEVPEDQVSLYGVAT-VESVGTSAGTGSADDRYGIVRIRDLVEKPPVAQAPSNLAIIGRYILSPTIFDVLRRTEPGRGGEIQLTDALRILALRAVEPAGAAGDAGTDTAAEPVHGVIFTGRRYDTGDRVDYLKAVIRLACERADLGPELYPWIEEYVAS 340
>gi|70730763|ref|YP_260504.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas fluorescens Pf-5] >gi|68345062|gb|AAY92668.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas fluorescens Pf-5] (279 aa)
Score = 583, Expect = 2.6e-58, Identities = 122/269 (45%), Positives = 173/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ V  N      L Q ++L+++   SIV +QEV+ +E +KYG+I       ++    RV +M+EKP P  +PSN AI+GRY+LTP IF  +E+T+    GEI+IT +L+  AQ   V A  F GKR+D G   GY+ AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADDLCV--NLEGDGVLTQMVKLYKQFRCSIVAIQEVDPQETNKYGVI---AGEMIRDDIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQNGCVMAYKFKGKRFDCGGAEGYIDAT 265
>gi|90408509|ref|ZP_01216667.1| UTP--glucose-1-phosphate uridylyltransferase [Psychromonas sp. CNPT3] >gi|90310388|gb|EAS38515.1| UTP--glucose-1-phosphate uridylyltransferase [Psychromonas sp. CNPT3] (276 aa)
Score = 582, Expect = 2.9e-58, Identities = 121/269 (44%), Positives = 179/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATK+MPKEM+PI++KP I+F V+EA+ +G+  + I+  + K+S+ DHFD  +ELE ++    K +  + +R I + A   YIRQ++  GLGHAI   ++ IG+E FA++L DD+ V++  +++  L Q + L+E+   SIV V+EV   E  KYG+I   +   ++    RV +M+EKP+P  +PSN AI+GRY+LTP IF+ L+ T     GEI+IT +LL  AQK  V A  F GKR+D GS  G+++AT
  S:     2 IKKCLFPAAGYGTRFLPATKSMPKEMMPIVNKPLIEFGVDEALEAGMTGMCIVTGRGKHSLSDHFDINYELEHQISGTPKEDKLQDIRAIMEQASFTYIRQRQMKGLGHAILTGQQLIGDEAFAVVLADDLCVKDG-AEQGVLSQMVALYEKHKCSIVAVEEVPENETHKYGVI---KGSLIEDNLYRVDDMVEKPEPGTAPSNMAIIGRYILTPDIFEILKNTAPGKGGEIQITDALLEQAQKGRVLAYKFKGKRFDCGSVPGFIEAT 266
>gi|34556775|ref|NP_906590.1| UTP--glucose-1-phosphate uridylyltransferase [Wolinella succinogenes DSM 1740] >gi|34482489|emb|CAE09490.1| UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE [Wolinella succinogenes] (275 aa)
Score = 582, Expect = 3.3e-58, Identities = 127/269 (47%), Positives = 171/269 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLPI++KP IQ+ VEEA+ +GI  + I+  + K S+ DHFD  +ELE +++  +K    K +R + +     Y RQ E  GLGHAI   +  IGNEPFA++L DD+   +N   +  L Q IEL+ +   SIV ++EVE  EV KYG+I   E   +      V NMIEKP  + +PSN A++GRY+LTP IF  L +T+   +GEI+IT +LL   +K  V A  F GKRYD GS  G++ AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEALEAGITTMAIVTGRGKRSLEDHFDISYELEHQIRGTDKEIYLKDIREVMEQCTFSYTRQMEMKGLGHAILTGETLIGNEPFAVVLADDLC--DNPEGEGVLSQMIELYHKYRCSIVAIEEVEVSEVDKYGVISGRE---IDAGVYMVDNMIEKPSIAEAPSNLAVIGRYILTPDIFDILRDTKPGKKGEIQITDALLEQCKKGMVLAYKFKGKRYDCGSIDGFVMAT 265
>gi|163781631|ref|ZP_02176631.1| UDP-glucose pyrophosphorylase [Hydrogenivirga sp. 128-5-R1-1] >gi|159882851|gb|EDP76355.1| UDP-glucose pyrophosphorylase [Hydrogenivirga sp. 128-5-R1-1] (299 aa)
Score = 581, Expect = 4.0e-58, Identities = 127/296 (42%), Positives = 190/296 (64%)
  Q:     2 KKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVET 297
           +++V KAV+P AG GTRFLPATKAMPKEM PI+DKP IQFIVEE + +GIE+ + +  ++K  I  HFD   +LE  L++  K E  K +R IS M +  Y+RQK  +GLGHA+  A+  +G EPF + LGD  I+    SD   L + ++++     S++ + EV  +EV+KYGI+D  E    +   ++VK ++EKP P  +PSN AI+GRY+ TP IF++L +T+    GEI++T ++  L ++E +YA    GK YD G+ + YLK   + +L + D+  EL E++  L+ T
  S:     3 RQKVRKAVLPVAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEELLEAGIENAIFVTGRHKRPIEHHFDINTDLERHLEEAGKNEVLKNIREISHMVNPIYVRQKRQLGLGHAVLTAEPAVGQEPFIVSLGD--IILEKGSDN--LSKMLDIYNRYGRSVIALFEVPEEEVNKYGIVDVEET---EEGVLKVKELVEKPSPDEAPSNLAIVGRYIFTPGIFEKLRKTKPGKGGEIQLTDAMKLLLEEEEIYAYQIEGKVYDTGNPLDYLKTVFEFALKREDIGAELREFIANLLST 291
>gi|126738433|ref|ZP_01754138.1| UTP-glucose-1-phosphate uridylyltransferase [Roseobacter sp. SK209-2-6] >gi|126720232|gb|EBA16938.1| UTP-glucose-1-phosphate uridylyltransferase [Roseobacter sp. SK209-2-6] (297 aa)
Score = 581, Expect = 4.3e-58, Identities = 115/299 (38%), Positives = 197/299 (65%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNIS-DMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLL-NLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLVETNK 299
           M+++VTKA+ P AG+GTRFLPATK++PKE++ ++D+P +Q+ ++EA  +GI++ + + S+ K ++ D+FD+   LE+ L++K K E  ++++  + D   I Y+RQ + +GLGHA+  A+R I +EPFA++L DDVI     ++ P LKQ +E + E   ++V   EV   + S YG++D  E    + Q +    M+EKP    +PSN A++GRY+L PS+ + L++ +    GEI++T ++  ++ Q   V    F G+R+D GSK G+L+AT+  +LS+ D+RD+LL ++  +   +K
  S:     1 MRRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSRGKGALEDYFDHAPVLEQELRKKGKDELLEVLKKTTMDSGAIAYVRQHKALGLGHAVWCARRLIADEPFAVILPDDVIA----AETPCLKQMVEAYGETGGNMVAAMEVAPAQTSSYGVLDVKED---RGQVVLANGMVEKPKMEEAPSNLAVIGRYILEPSVLRNLQKMKQGTGGEIQLTDAIAEDITQGVPVSGFRFQGQRFDCGSKAGFLQATVAFALSRSDLRDDLLSFLHEVTSVDK 294
>gi|2501468|sp|Q59633|GALU2_PSEAE UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) >gi|1345068|gb|AAB01486.1| UDP-glucose pyrophosphorylase (279 aa)
Score = 581, Expect = 4.6e-58, Identities = 122/269 (45%), Positives = 174/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ +  GLGHAI   +  IG+EPFA++L DD+ V  N      L Q ++L+++   +IV V EV   E +KYG+I      D+    +RV++M+EKP P  +PSN AI+GRY+LTP IFK +EET+    GEI+IT +LL  A+   V A  F G+R+D G   GY++AT
  S:     2 IKKYLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTQMKGLGHAILTGRPLIGDEPFAVVLADDLCV--NLEGDGVLTQMVKLYQKYRCTIVAVMEVNPTETNKYGVI---AGDDIGDGLIRVRDMVEKPAPEDAPSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALLKQAKDGCVIAYKFKGQRFDCGGAEGYIEAT 265
>gi|83309676|ref|YP_419940.1| UDP-glucose pyrophosphorylase [Magnetospirillum magneticum AMB-1] >gi|82944517|dbj|BAE49381.1| UDP-glucose pyrophosphorylase [Magnetospirillum magneticum AMB-1] (291 aa)
Score = 580, Expect = 5.3e-58, Identities = 121/292 (41%), Positives = 180/292 (61%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDV----RDELLEYMK 292
           M +RV KAV P  GMGTRFLPATKAMPKEMLP++DKP IQ+ VEEA A+G E  + +  + KN++ DHFD+  ELE  LK + K +  + V + +     I Y RQ EP+GLGHA+  A+  + +EPFA+LL DD+I+    S    LKQ   +  E    +V V +V  +   +YGI+D +E  + +    R K ++EKPDP ++PS  +I+GRY+L P++F  L++ +    GEI++T ++         +   F G R+D G K+G+L+A L  +L++ D     RD +  + K
  S:     1 MTRRVRKAVFPVGGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAAAAGCEHFIFVTGRGKNALEDHFDHNPELERILKDRGKFDLVEAVTSWMPKSGQISYTRQSEPLGLGHAVWCARDLVADEPFAVLLPDDLIL----SKTACLKQMAAVHTEVGGHVVAVSDVPREHTKRYGILD-VEHDNGRLA--RAKGLVEKPDPDVAPSTLSIIGRYILHPAVFDVLDKKEKGAGGEIQLTDAISQTIGMVPFHGLRFEGNRFDCGDKVGWLEANLAFALARDDTAEAARDLITRFHK 290
>gi|114327253|ref|YP_744410.1| UTP--glucose-1-phosphate uridylyltransferase [Granulibacter bethesdensis CGDNIH1] >gi|114315427|gb|ABI61487.1| UTP--glucose-1-phosphate uridylyltransferase [Granulibacter bethesdensis CGDNIH1] (289 aa)
Score = 580, Expect = 5.3e-58, Identities = 117/292 (40%), Positives = 186/292 (63%)
  Q:     1 MKKRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDM-AHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           M K + KAV+P AG+GTRFLPATKA  KEMLP++DKP IQ+ V+EA A+GIE   ++  + K +I++HFD  +ELE  L+++NK +  KL+ +   +   I  +RQ+EP+GLGHAI  A+ FIG +PFAILL DD+++    S+ P LKQ  + ++E   ++V V EV  ++ ++YGI+   E      + + V  ++EKP P  +PSN +I+GRYVL P +  EL   +     E+++T ++  L  +   +   + G+R+D G K G+L+A +  +L +PD+   +  ++K
  S:     1 MNKPLRKAVLPVAGLGTRFLPATKATAKEMLPVVDKPLIQYAVDEARAAGIEQFCMVTGRGKTAIVEHFDVAYELESTLRERNKDDALKLLEDTQLLPGSIVTVRQQEPLGLGHAIWCARAFIGEDPFAILLPDDLVL----SETPCLKQLADAYQETGGNVVAVAEVPREQTNRYGILKTGED---DGRMVEVTGLVEKPKPEEAPSNLSIIGRYVLRPEVIAELARMERGAGNEVQLTDAMARLIGRMPFHGLRYEGRRFDCGDKAGFLEAQIAFALKRPDLAPAVRAFLK 286
>gi|15606788|ref|NP_214168.1| UDP-glucose pyrophosphorylase [Aquifex aeolicus VF5] >gi|2984025|gb|AAC07568.1| UDP-glucose pyrophosphorylase [Aquifex aeolicus VF5] (297 aa)
Score = 580, Expect = 5.3e-58, Identities = 129/293 (44%), Positives = 192/293 (65%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMKLLV 295
           + + K V+P AG GTRFLPATKAMPKEMLPI+DKP IQFIVE  +  GIE+I+ +  ++K +I DHFD+  ELEE LK+  K +  + V  IS + +  Y+RQKE +GLGHA+ MA+  +  EPF + LG D+IV+N + +   LK+ I LF +   SIV + EV  +EVSKYGI    +   L  ++  + +++EKP P  +PSN AI+GRY+ TP+IF++L+ T+    GEI++T ++  L ++E +YA       YD G+   YLK  +  +L + D+  EL+E+++ L+
  S:     2 REIRKVVLPVAGWGTRFLPATKAMPKEMLPIIDKPIIQFIVESFINIGIENIIFVTGRHKKAIEDHFDHNHELEEHLKKAGKEKLLREVVKISSLINPIYVRQKEQLGLGHAVLMAEPAVSQEPFFVALG-DIIVENEEEE---LKKMIHLFRKFGNSIVALMEVPKEEVSKYGIA---KVKKLDEETYIIVDLVEKPSPEEAPSNLAIVGRYIFTPTIFEKLKVTKPGKGGEIQLTDAMRLLLEEEAIYACKVNNTVYDTGNPKDYLKTVISFALRREDINGELIEFIRGLI 287
>gi|188527506|ref|YP_001910193.1| UDP-glucose pyrophosphorylase (galU) [Helicobacter pylori Shi470] >gi|188143746|gb|ACD48163.1| UDP-glucose pyrophosphorylase (galU) [Helicobacter pylori Shi470] (273 aa)
Score = 580, Expect = 5.5e-58, Identities = 124/269 (46%), Positives = 178/269 (66%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPA-LKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLP TK +PKEMLPI+DKP IQ+ VEEA+ +G E + I+  + K S+ D+FD  +E+E +++  NK    K +RNI +     Y+RQK+  GLGHAI   +  IGNEPFA++L DD+ + +   D P+ LKQ I L+++   SIV ++EV  +EVSKYG+I       L+     +K+M+EKP    +PSN A++GRY+LTP IF+ L ET+     EI+IT +LL  A+++ + A  F GKRYD GS  GY++A+
  S:     2 IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIGNEPFAVILADDLCISH---DHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVI---RGEWLEEGVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKRKRIIAYQFKGKRYDCGSVEGYIEAS 265
>gi|163856573|ref|YP_001630871.1| UTP-glucose-1-phosphate uridylyltransferase [Bordetella petrii DSM 12804] >gi|163260301|emb|CAP42603.1| UTP-glucose-1-phosphate uridylyltransferase [Bordetella petrii] (299 aa)
Score = 580, Expect = 5.7e-58, Identities = 121/274 (44%), Positives = 175/274 (63%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRN-ISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDI 276
           K + KAV P AG GTRFLPATKAMPKEMLPI+DKP IQ+ VEEAV +GI +++ +  ++K +I DHFD   ELE  L+ K+K    + VR+ I       Y RQ  P+GLGHA+  A   +G+EPFA+LL DD+I     +D PA+ Q I+     + S++ +Q V   +  +YGII    +VD +T   R++ ++EKP P+ +P+  A++GRYVL P IF  L  TQ    GEI++T  +  L ++  V+   + G RYD GSK+G+ +AT+++
  S:    11 KPIRKAVFPVAGQGTRFLPATKAMPKEMLPIVDKPLIQYAVEEAVEAGITELIFVTGRHKRAIEDHFDSMPELEAGLQAKHKTALLEAVRHVIPPHVACLYTRQSAPLGLGHAVLCAAPLVGDEPFAVLLADDLI----DADTPAIGQLIDAACRHDSSMLAIQNVPRAQTDQYGIISG-HRVDARTA--RLQGIVEKPLPAEAPTTLAVVGRYVLEPRIFDLLRATQAGVGGEIQLTDGIARLLRERPVHGYQYDGVRYDCGSKVGFFEATMEL 278
>gi|146307378|ref|YP_001187843.1| UDP-glucose pyrophosphorylase [Pseudomonas mendocina ymp] >gi|145575579|gb|ABP85111.1| UDP-glucose pyrophosphorylase [Pseudomonas mendocina ymp] (279 aa)
Score = 580, Expect = 6.1e-58, Identities = 123/269 (45%), Positives = 173/269 (64%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + D     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ + N Q D   L Q ++L+ +   SIV +QEV  +E SKYG+I       ++    RV +M+EKP P  +PSN AI+GRY+LTP IF  + +T     GEI+IT +L+  AQ+  V A  F G+R+D GS  GY+ AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALEAGLNEIAIVTGRGKRALEDHFDVSYELEHQIKGTDKEKYLVGIRRLIDECSFAYTRQVEMKGLGHAILCGQPLIGDEPFAVVLADDLCL-NLQGDS-VLAQMVKLYNQFRCSIVAIQEVPREETSKYGVI---AGEMIRDDIYRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFDLIRDTPPGKGGEIQITDALMRQAQQGCVMAYKFKGQRFDCGSAEGYIDAT 265
>gi|90415371|ref|ZP_01223305.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [marine gamma proteobacterium HTCC2207] >gi|90332694|gb|EAS47864.1| UTP--glucose-1-phosphate uridylyltransferase, bacterial and archaeal type [marine gamma proteobacterium HTCC2207] (298 aa)
Score = 579, Expect = 8.1e-58, Identities = 122/290 (42%), Positives = 181/290 (62%)
  Q:     3 KRVTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMA-HIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKATLDISLSKPDVRDELLEYMK 292
           ++V KAV P AGMGTRFLPATKA PKEMLP++DKP IQ+ VEEA+ +GI +++ I  + K SI DHFD  +ELE  L++ NK +   + +NI        YIRQ E +GLGHA+  A   IG+EPFA++L DD+I      ++ A+KQ ++ +E    S++ VQ+V   E+S YG+I    Q D   +   +  ++EKP    +PS+  + GRY+ TP IFK L   +    GE ++T ++  L  +E V A  + G RYD GSK+G LKA +++ L   ++ ++L  Y++
  S:     8 EKVRKAVFPVAGMGTRFLPATKANPKEMLPVVDKPLIQYAVEEAIEAGITEMIFITGRNKRSIADHFDKAYELEHELEKNNKTKLLDIAQNIVPKGVSCTYIRQNEALGLGHAVLTAAHLIGDEPFAVILADDLI----HGEQGAVKQMVQQYEFYKSSVIAVQKVPGPEISAYGVISGKRQAD---RVHLLDKIVEKPKFEDAPSDMGVTGRYIFTPQIFKHLGNLKPGAGGEFQLTDAIQTLLTEEQVLAYEYAGTRYDCGSKMGLLKANIELGLLHGEIGEDLRAYLR 291
>gi|109947603|ref|YP_664831.1| UTP-glucose-1-phosphate uridylyltransferase [Helicobacter acinonychis str. Sheeba] >gi|109714824|emb|CAJ99832.1| UTP-glucose-1-phosphate uridylyltransferase [Helicobacter acinonychis str. Sheeba] (273 aa)
Score = 577, Expect = 1.4e-57, Identities = 122/269 (45%), Positives = 176/269 (65%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLP TK +PKEMLPI+DKP +Q+ VEEA+ +G E + I+  + K S+ D+FD  +E+E +++  NK +  + VRNI +     Y+RQK+  GLGHAI   +  IGNEPFA++L DD+   +N      LKQ   L+++   SIV ++EV  +EVSKYG+I   +   L+     +K+M+EKP    +PSN A++GRY+LTP IF+ L ET+     EI+IT +LL  A+++ + A  F GKRYD GS  GY++AT
  S:     2 IKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLMQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSYEIEHQIQGTNKEKALQSVRNIIEKCCFSYVRQKQMKGLGHAILTGEALIGNEPFAVILADDLCTSHNHPS--VLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVI---KGELLEEGVYEIKDMVEKPSQQDAPSNLAVIGRYILTPDIFEILHETKPGKNNEIQITDALLTQAKRKRIIAYQFKGKRYDCGSVEGYIEAT 265
>gi|26990526|ref|NP_745951.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas putida KT2440] >gi|148547174|ref|YP_001267276.1| UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas putida F1] >gi|24985504|gb|AAN69415.1|AE016578_1 UTP-glucose-1-phosphate uridylyltransferase [Pseudomonas putida KT2440] >gi|148511232|gb|ABQ78092.1| UDP-glucose pyrophosphorylase [Pseudomonas putida F1] (279 aa)
Score = 577, Expect = 1.4e-57, Identities = 121/269 (44%), Positives = 171/269 (63%)
  Q:     5 VTKAVIPAAGMGTRFLPATKAMPKEMLPILDKPTIQFIVEEAVASGIEDILIIVSQYKNSIMDHFDYFFELEERLKQKNKVEDYKLVRNISDMAHIHYIRQKEPMGLGHAINMAKRFIGNEPFAILLGDDVIVQNNQSDKPALKQCIELFEEKNVSIVGVQEVEHKEVSKYGIIDPLEQVDLKTQSMRVKNMIEKPDPSISPSNYAILGRYVLTPSIFKELEETQVSPRGEIEITGSLLNLAQKEGVYAKVFTGKRYDIGSKIGYLKAT 273
           + K + PAAG GTRFLPATKAMPKEMLP+++KP IQ+ VEEA+ +G+ +I I+  + K ++ DHFD  +ELE ++K  +K +    +R + +     Y RQ E  GLGHAI   +  IG+EPFA++L DD+ V  N      L Q ++L+++   SIV +QEV+ +E +KYG+I       ++    RV NM+EKP P  +PSN AI+GRY+LTP IF  +  T+    GEI+IT +LL  A+   V A  F GKR+D G   GY+ AT
  S:     2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADDLCV--NPEGDGVLTQMVKLYKQYRCSIVAIQEVDPQETNKYGVI---AGEMIRDDIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIANTKPGKGGEIQITDALLQQAKDGCVIAYKFKGKRFDCGGAEGYIDAT 265