>gi|26553620|ref|NP_757554.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma penetrans HF-2] >gi|38257609|sp|Q8EWN6|GIDA_MYCPE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|26453626|dbj|BAC43958.1| glucose inhibited division protein [Mycoplasma penetrans HF-2] (616 aa)
Score = 3103, Expect = 0.0e+00, Identities = 616/616 (100%), Positives = 616/616 (100%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT
  S:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
>gi|185178729|ref|ZP_02964544.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024346|ref|ZP_02997018.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039297|ref|ZP_02998083.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 8] >gi|188518461|ref|ZP_03003948.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524182|ref|ZP_03004246.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530742|ref|ZP_03005069.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188592608|ref|ZP_03005916.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 10] >gi|184209330|gb|EDU06373.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018610|gb|EDU56650.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998104|gb|EDU67201.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659997|gb|EDX53377.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (614 aa)
Score = 1724, Expect = 0.0e+00, Identities = 335/613 (54%), Positives = 451/613 (73%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           MKKYD +VIGAGHAGLEAAF  +    + AL  LD+K +G MPCNPSIGGPAKGIVTREIDALGG+Q  AAD T +QMK+LNSSKG G WA+RAQIDK+ Y +WF  +I++ + +DLI  EV+ +   N  V GV   D +  +++Y+I+TTGT+L S  H G   + +G D    +  L+  + +L F+ IRLKTGTP RI K+SID++ + +EPGTN+K +FSH+   +  ++KQ  C++ +TN + H+II  NL+KSAMY G I+G GPRYCPSIEDK+V+F++K RHQ+FVEPES  LD++YLGG S+S+P DVQE++++++ G E+  I KYAYAIEYDAI+P QLYP+LE+K +  LFFAGQINGTSGYEEAA QGLMA INV  + +N+EP+VL R++AYIGV+I+D++ K + +PYRLLTSRAE+RL LRNDNAD RL+K G+E+GL+    +D+Y  NL+  N  L  L+T+T+  + + K+ + KTN+ L + LKRP+    D+  +   K   DE   +KV I +K+ GYIK+Q++ +   K ++NIKL  I DYK+VPNISLE  DKLNK+KPL L QASR+SG+NL D+  IK YLE  K
  S:     1 MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRWFKQQIKQQKNLDLIIAEVSDLLVENNIVKGVILSDQKIIQADYVIITTGTYLKSITHRGSVCVDEGADGTKNAKFLSDVLVKLGFELIRLKTGTPARIKKDSIDFTNMVLEPGTNQKIAFSHYHPVYKPYDKQLPCHIIYTNEQTHQIIRENLNKSAMYGGMISGIGPRYCPSIEDKIVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLEDCEILKYAYAIEYDAIDPTQLYPSLESKLVNNLFFAGQINGTSGYEEAAAQGLMAAINVSQKHKNKEPIVLGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFEIGLLKPEVYDQYLNNLKQINEVLNWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEVKLNDLLIYCPIK-IEDEQIINKVQIQVKFEGYIKNQEENLKQLKRLNNIKLHGIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIK 612
>gi|171920648|ref|ZP_02931885.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195867356|ref|ZP_03079360.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903380|gb|EDT49669.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195660832|gb|EDX54085.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (614 aa)
Score = 1723, Expect = 0.0e+00, Identities = 334/613 (54%), Positives = 448/613 (73%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           MKKYD +VIGAGHAGLEAAF  +    + AL  LD+K +G MPCNPSIGGPAKGIVTREIDALGG+Q  AAD T +QMK+LNSSKG G WA+RAQIDK+ Y +WF  +I++ + +DLI  EV+ +   N  V GV   D +   ++Y+I+TTGT+L S  H G   + +G D    +  L+  + +L F+ IRLKTGTP RI K+SID++ + +EPGTN+K +F+H+   +  + +Q  C++ +TN   H+II  NLDKSAMY G I+G GPRYCPSIEDK+V+F++K RHQ+FVEPES  LD++YLGG S+S+P DVQE++++++ G E+  I KYAYAIEYDAI+P QLYP+LE+K +  LFFAGQINGTSGYEEAA QGLMA INV  + +N+EP+VL R++AYIGV+I+D++ K + +PYRLLTSRAE+RL LRNDNAD RL+K G+E+GL+    +D+Y  NL+  N  L  L+T+T+  + + K+ + KTN+ L + LKRP+    D+  +   K   DE   +KV I +K+ GYIK+Q++ +   K ++NIKL  I DYK+VPNISLE  DKLNK+KPL L QASR+SG+NL D+  IK YLE  K
  S:     1 MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRWFKQQIKQQKNLDLIIAEVSDLLVENNIVKGVILSDQKIIHADYVIITTGTYLKSITHRGSVCVDEGADGTKNAKFLSNSLAKLGFELIRLKTGTPARIKKDSIDFTNMIVEPGTNQKIAFNHYHPTYKPYEEQVPCHIIYTNETTHQIIRENLDKSAMYGGMISGIGPRYCPSIEDKIVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLEDCEILKYAYAIEYDAIDPTQLYPSLESKLVNNLFFAGQINGTSGYEEAAAQGLMAAINVSQKHKNKEPIVLGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFEIGLLKPEVYDQYLNNLKQINEVLNWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEVKLNDLLIYCPIK-IEDEQIINKVQIQVKFEGYIKNQEENLKKLKRLNNIKLHGIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIK 612
>gi|183508643|ref|ZP_02958143.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182676109|gb|EDT88014.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 14 str. ATCC 33697] (614 aa)
Score = 1720, Expect = 0.0e+00, Identities = 334/613 (54%), Positives = 449/613 (73%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           MKKYD +VIGAGHAGLEAAF  +    + AL  LD+K +G MPCNPSIGGPAKGIVTREIDALGG+Q  AAD T +QMK+LNSSKG G WA+RAQIDK+ Y +WF  +I++   +DLI  EV+ +   N  V GV   D +  +++Y+I+TTGT+L S  H G   + +G D    +  L+  + +L F+ IRLKTGTP RI K+SID++ + +EPGTN+K +FSH+   +  +++Q  C++ +TN + H+II  NL+KSAMY G I+G GPRYCPSIEDK+V+F++K RHQ+FVEPES  LD++YLGG S+S+P DVQE++++++ G EN  I KYAYAIEYDAI+P QLYP+LE+K +K LFFAGQINGTSGYEEAA QGLMA INV  + +N+EP++L R++AYIGV+I+D++ K + +PYRLLTSRAE+RL LRNDNAD RL+K G+E+GL+    +D+Y  NL      L  L+T+T+  + + K+ + KTN+ L + LKRP+    D+  +   K   DE   +KV I +K+ GYIK+Q++ +   K ++NIKL  I DYK+VPNISLE  DKLNK+KPL L QASR+SG+NL D+  IK YLE  K
  S:     1 MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRWFKQQIKQQINLDLIIAEVSDLLVENNIVKGVILRDQKIIQADYVIITTGTYLKSITHRGSVCVDEGADGTKNAKFLSDALVKLGFELIRLKTGTPARIKKDSIDFTNMILEPGTNQKIAFSHYHPVYKPYDEQLPCHIIYTNEQTHQIIRENLNKSAMYGGMISGIGPRYCPSIEDKIVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLENCEILKYAYAIEYDAIDPTQLYPSLESKSVKNLFFAGQINGTSGYEEAAAQGLMAAINVNQKYQNKEPVILGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFEIGLLKPEVYDQYLNNLRQIKEILSWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEIKLNDLLIYCPIK-IEDEQIINKVQIQVKFEGYIKNQEENLKQLKRLNNIKLHGIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIK 612
>gi|13357595|ref|NP_077869.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762033|ref|YP_001752118.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189039365|sp|B1AI24|GIDA_UREP2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|13626942|sp|Q9PRA6|GIDA_UREPA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|11277859|pir||D82942 glucose inhibited division protein UU039 [imported] - Ureaplasma urealyticum >gi|6898986|gb|AAF30444.1|AE002103_9 glucose inhibited division protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827610|gb|ACA32872.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 3 str. ATCC 27815] (614 aa)
Score = 1716, Expect = 0.0e+00, Identities = 333/613 (54%), Positives = 451/613 (73%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           MKKYD +VIGAGHAGLEAAF  +    + AL  LD+K +G MPCNPSIGGPAKGIVTREIDALGG+Q  AAD T +QMK+LNSSKG G WA+RAQIDK+ Y +WF  +I++ + +DLI  EV+ +   N  V GV   D +  +++Y+I+TTGT+L S  H G   + +G D    +  L+  + +L F+ IRLKTGTP RI K+SID++ + +EPGTN+K +FSH+   +  +++Q  C++ +TN + H+II  NL+KSAMY G I+G GPRYCPSIEDK+V+F++K RHQ+FVEPES  LD++YLGG S+S+P DVQE++++++ G EN  I KYAYAIEYDAI+P QLYP+LE+K +  LFFAGQINGTSGYEEAA QGLMA INV  + +N+EP++L R++AYIGV+I+D++ K + +PYRLLTSRAE+RL LRNDNAD RL+K G+E+GL+    +D+Y  NL+     L  L+T+T+  + + K+ + KTN+ L + LKRP+    D+  +   K   DE   +KV I +K+ GYIK+Q++ +   K ++NIKL +I DYK+VPNISLE  DKLNK+KPL L QASR+SG+NL D+  IK YLE  K
  S:     1 MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRWFKQQIKQQKNLDLIIAEVSDLLVENNIVKGVVLSDQKIIQADYVIITTGTYLKSITHRGSVCVDEGADGTKNAKFLSDALVKLGFELIRLKTGTPARIKKDSIDFTNMILEPGTNQKIAFSHYHPVYKPYDEQLPCHIIYTNEQTHQIIRENLNKSAMYGGMISGIGPRYCPSIEDKIVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLENCEILKYAYAIEYDAIDPTQLYPSLESKLVNNLFFAGQINGTSGYEEAAAQGLMAAINVNQKYQNKEPVILGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFEIGLLKPEVYDQYLNNLKQIKEILNWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEIKLNDLLIYCPIK-IEDEQIINKVQIQVKFEGYIKNQEENLKQLKRLNNIKLHAIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIK 612
>gi|171920380|ref|ZP_02931708.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701825|ref|ZP_02971495.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|171902814|gb|EDT49103.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701112|gb|EDU19394.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma parvum serovar 6 str. ATCC 27818] (614 aa)
Score = 1714, Expect = 0.0e+00, Identities = 333/613 (54%), Positives = 451/613 (73%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           MKKYD +VIGAGHAGLEAAF  +    + AL  LD+K +G MPCNPSIGGPAKGIVTREIDALGG+Q  AAD T +QMK+LNSSKG G WA+RAQIDK+ Y +WF  +I++ + +DLI  EV+ +   N  + GV   D +   +NY+I+TTGT+L S  H G   + +G D    +  L+  + +L F+ IRLKTGTP RI K+SID++ + +EPGTN+K +FSH+   +  +++Q  C++ +TN + H+II  NL+KSAMY G I+G GPRYCPSIEDK+V+F++K RHQ+FVEPES  LD++YLGG S+S+P DVQE++++++ G E+  I KYAYAIEYDAI+P QLYP+LE+K +K LFFAGQINGTSGYEEAA QGLMA INV  + +N+EP++L R++AYIGV+I+D++ K + +PYRLLTSRAE+RL LRNDNAD RL+K G+E+GL+    +D+Y  NL+     L  L+T+T+  + + K+ + KTN+ L + LKRP+    D+  +   K   DE   +KV I +K+ GYIK+Q++ +   K ++NIKL +I DYK+VPNISLE  DKLNK+KPL L QASR+SG+NL D+  IK YLE  K
  S:     1 MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCNPSIGGPAKGIVTREIDALGGIQGKAADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRWFKQQIKQQKNLDLIIAEVSDLLVENNIIKGVILSDQKIIYANYVIITTGTYLKSITHRGSVCVDEGADGTKNAKFLSDALVKLGFKLIRLKTGTPARIKKDSIDFTNMILEPGTNQKIAFSHYHPVYKPYDEQLPCHIIYTNEQTHQIIRENLNKSAMYGGMISGIGPRYCPSIEDKIVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLESCKILKYAYAIEYDAIDPTQLYPSLESKLVKNLFFAGQINGTSGYEEAAAQGLMAAINVNQKYQNKEPVILGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFEIGLLKSEVYDQYLNNLKQIKEILNWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEIKLNDLLIYCPIK-IEDEQIINKVQIQVKFEGYIKNQEENLKQLKRLNNIKLHTIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIK 612
>gi|188568794|ref|ZP_03005531.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Ureaplasma urealyticum serovar 2] (614 aa)
Score = 1710, Expect = 0.0e+00, Identities = 333/613 (54%), Positives = 449/613 (73%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           MKKYD +VIGAGHAGLEAAF  +    + AL  LD+K +G MPCNPSIGGPAKGIVTREIDALGG+Q   AD T +QMK+LNSSKG G WA+RAQIDK+ Y +WF  +I++ + +DLI  EV+ +   N  V GV   D +  +++Y+I+TTGT+L S  H G   + +G D    +  L+  + +L F+ IRLKTGTP RI K+SID+  + +EPGTN+K +FSH+   +  ++KQ  C++ +TN + H+II  NL+KSAMY G I+G GPRYCPSIEDK+V+F++K RHQ+FVEPES  LD++YLGG S+S+P DVQE++++++ G EN  I KYAYAIEYDAI+P QLYP+LE+K +K LFFAGQINGTSGYEEAA QGLMA INV  + +N+EP++L R++AYIGV+I+D++ K + +PYRLLTSRAE+RL LRNDNAD RL+K G+++GL+    +D+Y  NL+     L  L+T+T+  + + K+ + KTN+ L + LKRP+    D+  +   K   DE   +KV I +K+ GYIK+Q++ +   K ++NIKL  I DYK+VPNISLE  DKLNK+KPL L QASR+SG+NL D+  IK YLE  K
  S:     1 MKKYDVIVIGAGHAGLEAAFATSNLNLQTALITLDEKGIGMMPCNPSIGGPAKGIVTREIDALGGIQGKVADATTMQMKILNSSKGPGVWAIRAQIDKIAYQRWFKQQIKQQKNLDLIIAEVSDLLVENNIVKGVILSDQKIIQADYVIITTGTYLKSITHRGSVCVDEGADGTKNAKFLSDALVKLGFELIRLKTGTPARIKKDSIDFINMVLEPGTNQKIAFSHYHPVYKPYDKQLPCHIIYTNEQTHQIIRENLNKSAMYGGMISGIGPRYCPSIEDKIVKFSEKPRHQIFVEPESYELDSMYLGGFSTSMPIDVQEKMIRSLPGLENCEILKYAYAIEYDAIDPTQLYPSLESKLVKNLFFAGQINGTSGYEEAAAQGLMAAINVNQKYQNKEPVILGRDQAYIGVMIDDIVTKGVVEPYRLLTSRAEHRLALRNDNADDRLMKIGFKIGLLKPEVYDQYLNNLKQIKEILNWLKTTTVGQIDDLKFTTLKTNSYLIDYLKRPEIKLNDLLIYCPIK-IEDEQIINKVQIQVKFEGYIKNQEENLKQLKRLNNIKLHGIVDYKEVPNISLETIDKLNKIKPLDLEQASRISGVNLTDIAMIKYYLERIK 612
>gi|31544847|ref|NP_853425.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma gallisepticum R] >gi|81170557|sp|Q7NAK6|GIDA_MYCGA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|31541693|gb|AAP56993.1| GidA [Mycoplasma gallisepticum R] (622 aa)
Score = 1618, Expect = 6.2e-178, Identities = 336/604 (55%), Positives = 438/604 (72%)
  Q:     7 LVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDR-KFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +V+GAGHAGLEAAFIL+K   KV L VLD+K V N PCNPS+GGPAKGIVTREIDALGG+QA+AAD+T LQ K+LNSSKG G   LR QIDK+ Y KWFL +I+ NE I+L++ EV  +        GV     +  E+  +I+TTGT+L S    G  V  +GP+ F  S  L++  K   F+ IRLKTGTPPRI K+SIDYS LQIEPG   +  FSH+ + K++D+  +  CYL  T  +IH+IIN+NL  SAMYSG ITG GPRYCPSIEDK+VRF++K RHQ+F+EPES  LDT+YLGG S+SL   VQ++I++ + G + A + KY YAIEYDAINPIQLYP+LE+K IK LFFAGQINGTSGYEEAA QGL+AGIN   +++N+EPL+L R+EAYIGV+I+D++NK +TDPYRLLTSRAEYRL LRNDN   RL++ GYE+G IS+   D YN+NLE  N  ++ L+   +      K ++  TN +LYE LKRP+   I++   ++ + +  D      ++I +KY GYIK + +I+N  KN+++IK+     Y  V N+S+EA DKLNK+KPL L QA R+SGINL D+I++K +LE
  S:    16 IVVGAGHAGLEAAFILSKLNNKVYLCVLDRKYVANCPCNPSVGGPAKGIVTREIDALGGIQALAADSTALQRKILNSSKGPGVQCLRFQIDKVYYKKWFLEQIDNNENIELVEGEVTEVIKNGDTATGVMIDGVKKLEAGAVIITTGTYLKSLTFSGKDVKNEGPEGFKNSNNLSEWFKVNGFELIRLKTGTPPRIKKDSIDYSNLQIEPGNGTELYFSHWSKNKYIDY--ELPCYLIHTTEEIHKIINDNLHLSAMYSGNITGVGPRYCPSIEDKIVRFSNKPRHQIFLEPESLELDTVYLGGFSTSLDISVQDKIIRLLPGLKKAEVIKYGYAIEYDAINPIQLYPSLESKLIKNLFFAGQINGTSGYEEAAGQGLIAGINANQKIKNKEPLILSRDEAYIGVMIDDIVNKGVTDPYRLLTSRAEYRLLLRNDNVLDRLIQKGYEIGTISKEQIDLYNQNLEKKNKLIEFLKDKKVGMYTLLKAHTNNTNFSLYEFLKRPEIKLIELLKLIEFDYSNYDLELLKNIEITVKYEGYIKKESRIVNSLKNLESIKIPKDLIYDKVQNLSIEAIDKLNKIKPLNLAQAQRISGINLADIISLKTHLE 619
>gi|7109686|gb|AAF36757.1| glucose inhibited division protein A [Mycoplasma gallisepticum] >gi|28212475|gb|AAO37614.1| glucose inhibited division protein A [Mycoplasma gallisepticum] (611 aa)
Score = 1600, Expect = 8.5e-176, Identities = 331/604 (54%), Positives = 435/604 (72%)
  Q:     7 LVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDR-KFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +V+GAGHAGLEAAFIL+K   KV L VLD+K V N PCNPS+GGPAKGIVTREIDALGG+QA+AAD+T LQ K+LNSSKG G   LR QIDK+ Y KWFL +I+ NE I+L++ EV  +        GV     +  E+  +I+TTGT+L S    G  V  +GP+ F  S  L++  K   F+ IRLKTGTPPRI K+SIDYS LQIEPG   +  FSH+ + K++D+  +  CYL  T  +IH+IIN+NL  SAMYSG ITG GPRYCPSIEDK+VRF +K RHQ+F+EPES  L T+YLGG S+SL   VQ++I++ + G + A + KY YAIEYDAINPIQLYP+LE+K +K LFFAGQINGTSGYEEAA QGL+AGIN   +++N+EPL+L R+EAYIGV+I+D++ K +TDPYRLLTSRAEYRL LRNDN   RL++ GYE+G IS+   D YN+NLE  N  ++ L+   +      + ++  TN +LYE LKRP+   I++   ++ + +  D      ++I +KY GYIK + +++N  KN+++IK+     Y  V N+S+EA DKLNK+KPL L QA R+SGINL D+I++K +LE
  S:     5 IVVGAGHAGLEAAFILSKLNNKVYLCVLDRKYVANCPCNPSVGGPAKGIVTREIDALGGIQALAADSTALQRKILNSSKGPGVQCLRFQIDKVYYKKWFLEQIDNNENIELVEGEVTEVIKNGDTATGVMIDGVKKLEAGAVIITTGTYLKSLTFSGKDVKNEGPEGFKNSNNLSEWFKVNGFELIRLKTGTPPRIKKDSIDYSNLQIEPGNGTELYFSHWSKNKYIDY--ELPCYLIHTTEEIHKIINDNLHLSAMYSGNITGVGPRYCPSIEDKIVRFPNKPRHQIFLEPESLELGTVYLGGFSTSLDISVQDKIIRLLPGLKKAEVIKYGYAIEYDAINPIQLYPSLESKLVKNLFFAGQINGTSGYEEAAGQGLIAGINANQKIKNKEPLILSRDEAYIGVMIDDIVTKGVTDPYRLLTSRAEYRLLLRNDNVLDRLIQKGYEIGTISKKQIDLYNQNLEKKNKLIEFLKDKKVGMYTLLRAHTNNTNFSLYEFLKRPEIKLIELLKLIEFDYSNYDLELLKNIEITVKYEGYIKKESRLVNSLKNLESIKIPQDLIYDKVQNLSIEAIDKLNKIKPLNLAQAQRISGINLADIISLKTHLE 608
>gi|160916053|ref|ZP_02078260.1| hypothetical protein EUBDOL_02080 [Eubacterium dolichum DSM 3991] >gi|158431777|gb|EDP10066.1| hypothetical protein EUBDOL_02080 [Eubacterium dolichum DSM 3991] (619 aa)
Score = 1549, Expect = 6.7e-170, Identities = 304/611 (49%), Positives = 418/611 (68%)
  Q:     5 DCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           D +VIG GHAG+EAA   A+ K K  L+ ++  ++ +MPCNPS+GGPAKGIV REIDALGG    AAD T LQ K+LN++KG G   LR Q DKL Y K+  + +   E +++ +  V  +   N KV GV   D     S  +IVT+GT++ S I +GH     GPD    +  L++ +++L   T RLKTGTP R+  +SID+SK +++PG++   +FS   +    F+KQ +CYL +TN K H+II +NLDKSAMYSG + G GPRYCPSIEDK+VRF DKERHQ+F+EPES+ LDT Y+ G S+S+P DVQE ++ ++ G E+  I+KYAYAIEYDAI+P+Q  PTLE K ++ L+ AGQINGTSGYEEAA QGLMAGIN   +L+++ PL+L R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNADQRL++YG+ELGLIS+  +  Y + L++  +T   LET       E         Y+  K   +  E+LKRP+ +   + P+L  K  +D     +++I IKY GYI   ++     +++DN+ L +   Y +V N+SLEAR KL KV PLT+GQASR+SG+N  D+  + +YLE +K++
  S:     3 DVIVIGGGHAGVEAALACARMKKKTLLYSMNIDMIASMPCNPSVGGPAKGIVVREIDALGGEMGKAADATALQFKMLNTNKGPGVQCLRVQSDKLAYKKYMQDVVLSCENLEVREMCVEKVLAENGKVKGVLQKDGHEEYSQAVIVTSGTYMSSCILVGHTSTPSGPDQEPTTNALSQSLRDLGITTFRLKTGTPARVKTSSIDFSKTEVQPGSDAFLAFSTETKSIRPFDKQALCYLTYTNAKTHQIIRDNLDKSAMYSGLVKGVGPRYCPSIEDKLVRFADKERHQIFLEPESEQLDTTYIQGFSTSMPHDVQEDMLHSLAGLEHCEIEKYAYAIEYDAIDPLQCKPTLENKLVENLYTAGQINGTSGYEEAAGQGLMAGINACLKLDHKAPLILHRDEAYIGVLIDDLVTKGTQEPYRLLTSRAEYRLLLRHDNADQRLMRYGHELGLISEERYARYKQKLKDIEDTKAYLETVRFTPKSEINMFLKANGYDELKEGVSARELLKRPNVTMYMLMPYLDRK--VDAEVSRQLEIDIKYEGYILKAKRDAKHLRDMDNVVLPTDICYDEVANLSLEARQKLAKVMPLTMGQASRISGVNPADIAVLAVYLEQRKRK 618
>gi|110004173|emb|CAK98511.1| probable glucose inhibited division protein a [Spiroplasma citri] (626 aa)
Score = 1506, Expect = 6.8e-165, Identities = 308/610 (50%), Positives = 419/610 (68%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS----------TLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           MKKYD +VIGAGHAG+EA+   A+ + K  L  L K  +  MPCNPSIGGPAKGIV REIDA+GG  A AAD T LQMKLLNSS+G   WALRAQ DK++Y+K+    IE+ + +DL +  V S+   +   C GV   D   F +  +I+TTGT++ S +  G     +GPD    +  L+ Q+K L F+  RLKTGTP R+L  SIDYSK Q E G++ + +FS+  + F    +QE+C+L  +  K H I+ NNL  SAMYSG + GTGPRYCPS EDK+VRF DK RHQ+F+EPESK L+TIY+ G S+S+P DVQE++++++ GFEN  + K+AYAIEYDA+ P QL  TLETKKIK L+ AGQINGTSGYEEAACQGLMAGIN +  ++ +EP +L+R++AYIGVLI+DLI K   +PYRLLTSRAEYRL LRNDN+++RL  Y Y+LGLI Q  W EY  N++++N  ++ L+ +           L N+   K   R +    Y +LKRP+     +E  L   N L  + K  + I I++ GYIK +Q+I   T  ++N  + +  +Y  V N++LEAR+K  K++P+++GQA+R+SGIN  D+  +  +L+
  S:     1 MKKYDVIVIGAGHAGVEASLAAARMQKKTLLVTLHKDKIALMPCNPSIGGPAKGIVVREIDAIGGEMAKAADATALQMKLLNSSRGPAVWALRAQSDKIQYAKYMQKVIEKQDNLDLYEGAVQSLLVDDDNNCYGVMLKDQTQFFAKKVILTTGTYMQSLVLQGMTKKAEGPDGDITTAGLSTQLKHLGFELFRLKTGTPARVLNTSIDYSKAQPEQGSDLQLAFSYSTKTFTPLEEQELCWLIHSTPKTHSIVQNNLTASAMYSGNVKGTGPRYCPSFEDKIVRFADKPRHQIFLEPESKSLNTIYVQGFSTSMPIDVQEKMLRSLPGFENVEVLKWAYAIEYDAVVPTQLKHTLETKKIKNLYTAGQINGTSGYEEAACQGLMAGINAVLSIDQKEPFILRRDQAYIGVLIDDLITKGTEEPYRLLTSRAEYRLLLRNDNSEERLKNYAYQLGLIDQKSWTEYQNNVQSYNEVMQLLKETYFTAKSPLIQKLANLGVTKITERISG---YNLLKRPNIELKYLEDELPPLNNLKSFLKQNLLINIRFEGYIKKEQEIALKTIKLENKLIPANLNYDLVDNLALEAREKFKKIRPISIGQANRISGINPADIQMLLFHLK 618
>gi|39938754|ref|NP_950520.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Onion yellows phytoplasma OY-M] >gi|81170563|sp|Q6YQV5|GIDA_ONYPE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|39721863|dbj|BAD04353.1| glucose inhibited division protein A [Onion yellows phytoplasma OY-M] (617 aa)
Score = 1498, Expect = 5.2e-164, Identities = 316/607 (52%), Positives = 419/607 (69%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKE-------LETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +VIGAGHAG+EAA ILAKK +   L     K V ++PCNPSIGGPAKG+V REIDALGG+ A AAD  Q+Q+K+LNSSKG    ALRAQIDKLEY +     +++   + L++  VN++   N +V GV  +D     +  +I+TTGT+L S I IG      GP+    +Y ++ Q+KEL F+ IRLKTGTPPR+ KNSIDYS+ +I+ G N +  FS   +   +   QE C+L  TN   H++I  +L++SAMY G++ GTGPRYCPSIEDKVVRF DK  HQ+F+EPES  LD +YL GLS+S+P+ VQ +I+K I G +NA I KYAYAIEYDA NP QL  +LETKKI+ LF AGQ+NGTSGYEEAACQGLMAGIN   +L+N+ P VLKRNEAYIGVLI+DLI K   +PYRLLTSRAE+RL LR+DNAD RL  YGY+LGLI +  ++ +       N  L++       + +  L  +K+ K  S    TTL ++LKRP+ +F  ++ FL+ K   D+   ++V+I IKY GYI   QK       ++  K+ S  +Y D+ N+S EA++KL+ +KP TLGQA+R+ G+N VD+  + +YLE
  S:     3 YDSIVIGAGHAGVEAALILAKK-HNTLLITGSLKQVASLPCNPSIGGPAKGVVVREIDALGGVMAKAADLAQIQIKMLNSSKGPAVRALRAQIDKLEYPQIIFEILQKTLNLTLLEGLVNNLVIQNNQVQGVCLIDGTKINAKTVIITTGTYLASQILIGDTKKSSGPNGVPTTYGISTQLKELGFEVIRLKTGTPPRVKKNSIDYSQTKIQMGDNLEQIFSFVPQT--NQRPQEPCFLTHTNQTTHQVIQKHLNQSAMYGGYVEGTGPRYCPSIEDKVVRFCDKNSHQIFIEPESLSLDEMYLQGLSTSMPQHVQHEILKTIPGLQNAQITKYAYAIEYDAFNPNQLKHSLETKKIQNLFLAGQMNGTSGYEEAACQGLMAGINASLKLQNKPPFVLKRNEAYIGVLIDDLITKGAKEPYRLLTSRAEFRLLLRHDNADLRLKDYGYQLGLIDEKDYNNFQNKKAKINLLLEKSKNYEILVNSDNLSYLKQQKSASLGEKTTLAQLLKRPELNFCTLQHFLQEK--ADKTIYEQVEIQIKYEGYIAKAQKEAQKLARLEQKKIPSKINYADIKNLSKEAQEKLDLIKPQTLGQATRILGVNQVDISILLVYLE 611
>gi|13508296|ref|NP_110246.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma pneumoniae M129] >gi|2494735|sp|P75221|GIDA_MYCPN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|1673956|gb|AAB95933.1| NADH-binding oxidoreductase GidA [Mycoplasma pneumoniae M129] (612 aa)
Score = 1491, Expect = 3.6e-163, Identities = 302/606 (49%), Positives = 404/606 (66%)
  Q:     8 VIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           VIG GHAGLEAAFI +K   KV L VLD   VG+ PCNP+IGGPAKGIVTREID LGGMQ  AAD T LQ KLLNSSKG    A+RAQIDK+ Y KWF  +I++   I+LI  E   I   N KV GV   D     S+ +IVTTGT+L +  + G    ++GPD    S  L+  + +  F+T+RLKTGTPPRIL+ S+D+S++ +E  T    +FS   + +L   +Q +C+L  TN +IH++I  NL +SA+++G I   GP YCPSIEDKV RF DKERHQ+FVEPES  L+T+YL G S+S P +VQE IV+ + GF+NA  +KY YAIEYDA + IQL  TLETK I+ L+FAGQINGTSGYEEAA QGL+AGIN   +L+ +   VL+RNEAY+GV+I DL+ KEI+DPYRLLTSRAE+RL LRNDN  +RL++    LGL+    +  Y +  +     +  L+T+T+  +   K N + T  TL++  KR +   +D+   L  +  LD    +++DI IKY GYIK  +K      N+ ++K+    +Y  VPN++ EA  KL+K++P  L  AS+V+GIN  D++ IK +L+N +
  S:     7 VIGGGHAGLEAAFIASKLGLKVNLLVLDPNHVGSCPCNPAIGGPAKGIVTREIDVLGGMQGKAADATALQYKLLNSSKGPAVQAIRAQIDKIAYQKWFRQQIDQTPNIELIAGEAVDILESNGKVKGVVLADGSELASDAVIVTTGTYLKAKTYCGSLSKEEGPDRAKRSEYLSTNLIKRGFKTLRLKTGTPPRILRESLDFSQMAVEANTTPHLAFSFTTKNYLPLEQQVICHLIHTNPQIHQLILANLKQSAVFNGSIKANGPLYCPSIEDKVFRFQDKERHQIFVEPESLSLETVYLAGFSTSFPPEVQEHIVRLLPGFKNARFQKYGYAIEYDAFSSIQLKSTLETKLIQNLYFAGQINGTSGYEEAAGQGLIAGINAALKLQRKPEFVLQRNEAYLGVMINDLVTKEISDPYRLLTSRAEHRLWLRNDNLQERLIEKSRALGLVEADVYANYLEQQQKKKQLIDYLQTTTVGQIAALKLNFKNTAQTLFDFTKRAEIKLVDLVQLLPKRFDLDVQSLNQIDIDIKYAGYIKKSEKYFKSLNNLSSVKIPLKLNYHKVPNLASEAIVKLSKIRPTDLSVASQVAGINFNDILAIKHFLDNHE 612
>gi|85057733|ref|YP_456649.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789838|gb|ABC65570.1| glucose inhibited division protein A [Aster yellows witches'-broom phytoplasma AYWB] (634 aa)
Score = 1471, Expect = 8.0e-161, Identities = 308/607 (50%), Positives = 416/607 (68%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKE-------LETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +VIGAGHAG+E+A ILAKK +   L     K V ++PCNPSIGGPAKG+V REIDALGG+ A A D  Q+Q+K+LNSSKG    ALRAQIDKLEY +  L  ++    + L++  VN++     +V GV  +D +   +  +I+TTGT+L S I IG      GP+    +Y ++ Q+KE+ F+ IRLKTGTPPR+ KNSIDYS+ +I+ G N + +F     +      QE C+L  TN   H++I  +L++SAMY G++ G GPRYCPSIEDKVVRF DK  HQ+F+EPES +L+ +YL GLS+S+P+ VQ +I+K I G +NA I KYAYAIEYDA NP QL  +LETKKI+ LF AGQ+NGTSGYEEAACQGLMAGIN   +L+N+ P VLKRNEAYIGVLI+DLI K   +PYRLLTSRAE+RL LR+DNAD RL  YGY+LGLI +  ++ +       N  L++       + +  L  +K+    S    TTL +++KRP+ +F  ++ FL+ K   D+   ++V+I IKY GYI   QK       ++  K+ S  +Y D+ N+S EA++KL+ +KP TLGQA+R+ G+N VD+  + +YLE
  S:    19 YDSIVIGAGHAGIESALILAKK-HNTLLITGSLKQVASLPCNPSIGGPAKGVVVREIDALGGIMAKATDLAQIQIKMLNSSKGPAVRALRAQIDKLEYPQIILEILQNTPNLTLLEGLVNNLIIQKNQVQGVCLIDGRKINAKTVIITTGTYLASQILIGDTKKASGPNGVPTTYGISTQLKEIGFEVIRLKTGTPPRVKKNSIDYSQTKIQMGDNLEQTFGFLTPQTTK-RPQEPCFLTHTNQTTHQVIRKHLNQSAMYGGYVEGIGPRYCPSIEDKVVRFCDKNSHQIFIEPESLYLNEMYLQGLSTSMPQHVQHEILKTIPGLQNAKITKYAYAIEYDAFNPNQLKHSLETKKIQNLFLAGQMNGTSGYEEAACQGLMAGINASLKLQNKPPFVLKRNEAYIGVLIDDLITKGAKEPYRLLTSRAEFRLLLRHDNADLRLKDYGYQLGLIDKKDYNSFQNKKAKINLLLEKSKNYEILVNSDNLSYLKQQNSASLGEKTTLAQLIKRPELNFCTLQHFLQEK--ADKTIYEQVEIQIKYEGYIAKAQKEAQKLARLEQKKIPSKINYADIKNLSKEAKEKLDLIKPQTLGQATRILGVNQVDISILLVYLE 628
>gi|169351491|ref|ZP_02868429.1| hypothetical protein CLOSPI_02271 [Clostridium spiroforme DSM 1552] >gi|169291713|gb|EDS73846.1| hypothetical protein CLOSPI_02271 [Clostridium spiroforme DSM 1552] (620 aa)
Score = 1468, Expect = 1.7e-160, Identities = 294/609 (48%), Positives = 421/609 (69%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET------STLKNVKEFKYNSR-KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           YD +V+G GHAG+EAA   A+ K K  L   +   VG++PCN SIGGPAKGI+ REIDALGG  A  AD T LQMK+LN++KG G  +LRAQ DK  Y ++    +++ + +D+I+  V  +   +  V GV   + Q      +I+TTGT+L + I  G +    GPDD      L+ ++KEL  +  RLKTGTPPR+  NS+DYSK  ++PG++ K +FS+   KF+  ++Q  CYL +TN K H+II  NL +S+MY G+++G GPRYCPSIEDK+V+F+DK +HQ+F+EPESK ++TIY+ G S+SLP DVQE++++ I G E+  I KYAYAIEYDAI+P+QL+P+LETK IK LF AGQINGTSGYEEAA QGL+AGIN   + +N+EPL+LKR+EAYIGV+I+DL+ K   +PYR+LTSRAEYRL +R+DNAD+RL+KYG+++GLIS   + +Y   + N  N +  L+T        + +V E   ++R     +  E++KRP+  +  + PF+   + L+E  + ++ I IKY GYI    +     K ++  K+    DY ++ N++LEA+ KL+ ++PLT+GQASR+SGIN  D+  + +YL+ K
  S:     2 YDVIVVGGGHAGIEAALAPARMKQKTVLITANFDNVGSLPCNTSIGGPAKGIIVREIDALGGQMAKTADETYLQMKMLNTAKGPGVQSLRAQADKKAYPRYMQAVLKKQDNLDIIEGMVEDLMVEDNCVKGVILANGQEIIGKTVILTTGTYLKAEILCGDQKHASGPDDQEECKYLSTRLKELGLRIQRLKTGTPPRVEINSVDYSKTSLQPGSDAKLAFSYQTNKFIPIDEQVPCYLTYTNEKTHKIIKENLHRSSMYGGYVSGVGPRYCPSIEDKIVKFSDKPQHQIFLEPESKEMNTIYVQGFSTSLPHDVQEEMIRTIPGLEHCKILKYAYAIEYDAIDPLQLWPSLETKIIKNLFTAGQINGTSGYEEAASQGLIAGINATLKNQNKEPLILKRDEAYIGVMIDDLVTKGTEEPYRMLTSRAEYRLLIRHDNADERLMKYGHDVGLISDDIYQQYLNKMSNIFNEIARLDTIRFTPKHPINDVLEQLGSTRLNEGISAKELIKRPELDYEKILPFIDAPD-LNEEERKRITILIKYKGYIDKAMRQAEKQKKMEEKKIPEDVDYNEISNLALEAKQKLSSIRPLTIGQASRISGINPADISVLLIYLKQK 616
>gi|194246538|ref|YP_002004177.1| Glucose-inhibited division protein A [Candidatus Phytoplasma mali] >gi|193806895|emb|CAP18324.1| Glucose-inhibited division protein A [Candidatus Phytoplasma mali] (624 aa)
Score = 1454, Expect = 7.0e-159, Identities = 312/607 (51%), Positives = 424/607 (69%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-NVKEFKYNSR------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA ILAKK  K  L     + +G +PCNP+IGGPAKG+V REIDALGG+   AAD +Q+QMK+LNSSKG    ALRAQIDKL+Y K  L  +++   + L++  V  +   N ++ GV   +        +I+TTGT+L S I IG   I  GP++   +Y ++KQ+K+ +F+ IRLKTGTPPRI KN+IDYSK +I+ G +   +FS FD       KQE C+L +TN K ++IIN  L +S+MY G+I G GPRYCPSIEDKVVRF +K +HQ+F+EPES  L+ +YL GLS+S+P+ VQ +I+K I G ENA I KY YAIEYDA+NP QLY +LETKKIK LFFAGQINGTSGYEEAACQGL+AGIN   ++EN+ P +LKRNEAYIGVLI+DLINK   +PYRLLTSRAE+RL LR+DNAD RL ++ Y++ LIS+ ++ ++        + LK++E   ++ N K   Y S          T+L ++LKRP+ +F  ++ F   +  +D Y  ++V+I IKY GYIK  QK ++    ++   +S+  +Y  + N+S EA++KL+ +KP  LGQASR+SGIN  D+  + +YLE
  S:     3 YDSIVVGGGHAGIEAALILAKKNKKTLLITGSLEQIGCLPCNPAIGGPAKGVVVREIDALGGIMGKAADLSQIQMKMLNSSKGPAVRALRAQIDKLKYPKVILEILKKTNNLTLLEGLVEELIINNNQIEGVKLKNKSIIFGKTVIITTGTYLSSKIFIGEDKILSGPNNNPTNYGISKQLKQNNFEIIRLKTGTPPRIKKNTIDYSKTKIQYGNDVFQTFS-FDSPIKTIGKQEPCFLTYTNQKTNDIINKYLKQSSMYGGYIEGKGPRYCPSIEDKVVRFCNKNQHQVFIEPESLKLNEMYLQGLSTSMPKHVQHKILKTIPGLENAEIVKYGYAIEYDALNPNQLYHSLETKKIKNLFFAGQINGTSGYEEAACQGLIAGINASLKMENKPPFILKRNEAYIGVLIDDLINKGTHEPYRLLTSRAEFRLLLRHDNADLRLKEHAYKMALISEENYQKFKTKKNKIKDVLKQIENLQIEPNKKNLNYLSNFQSSLISEKTSLSQLLKRPEINFHFLKYFF--QENIDHYIFEQVEIQIKYQGYIKKAQKEVDKLLKLEGKIISTNIEYSKINNLSKEAQEKLDLIKPYNLGQASRISGINPTDISILMIYLE 613
>gi|167754941|ref|ZP_02427068.1| hypothetical protein CLORAM_00445 [Clostridium ramosum DSM 1402] >gi|167704991|gb|EDS19570.1| hypothetical protein CLORAM_00445 [Clostridium ramosum DSM 1402] (620 aa)
Score = 1450, Expect = 2.3e-158, Identities = 290/609 (47%), Positives = 416/609 (68%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET------STLKNVKEFKYNSRKTN-TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           YD +V+G GHAG+EAA   A+   K  L   +   VG++PCN SIGGPAKGI+ REIDALGG     AD T LQMK+LN++KG G  +LRAQ DK  Y ++    +++ E +D+I+  V  +   +  V GV   + Q  E   +I+TTGT+L + I  G +    GPD    S  L++++  L  +  RLKTGTPPR+  NS+DYSK  ++PGT+   +FS+   +F+   +Q  CYL +TN K H+II +NL +S+MYSG + G GPRYCPSIEDK+V+F+DK +HQ+F+EPES  +DTIY+ G S+SLP DVQE++++ I G EN  I KYAYAIEYDAI+P+QL+P+LETK IK LF AGQINGTSGYEEAA QGL+AGIN   + + +EPL+LKR+EAYIGV+I+DL+ K   +PYR+LTSRAEYRL +R+DNAD+RL+KYG+++GL+S   +  Y   +      +  L+T        + +  E   ++R T   +  E++KRP+ ++  + P+++    L E  + +V I IKY GYI   ++  +    ++  K+ +  DY+D+ N++LEA+ KL+K++PLT+GQASR+SGIN  D+  + +YL+ K
  S:     2 YDIIVVGGGHAGIEAALAPARMNQKTVLVTSNFDNVGSLPCNTSIGGPAKGIIVREIDALGGQMPKTADKTYLQMKMLNTAKGPGVQSLRAQADKKVYPRYMQEVLKKQENLDIIEGMVEDLIVEDNCVKGVILDNGQTIEGRMVILTTGTYLKAEILCGDQKHASGPDQQKESKYLSEKLANLGMRIQRLKTGTPPRVEINSVDYSKTSLQPGTDANLAFSYQTNEFIPIEEQTPCYLTYTNEKTHQIIRDNLHRSSMYSGIVKGIGPRYCPSIEDKIVKFSDKPQHQIFLEPESAEMDTIYVQGFSTSLPHDVQEEMIRTIPGLENCKILKYAYAIEYDAIDPLQLWPSLETKIIKNLFTAGQINGTSGYEEAAGQGLIAGINATLKNQGKEPLILKRDEAYIGVMIDDLVTKGTDEPYRMLTSRAEYRLLIRHDNADERLMKYGHDVGLVSDQIYQAYLDKMSEIFAEIDRLDTIRFTPKHEINDALEHFGSARLTEGISAKELIKRPELTYEKILPYVEAPK-LSEEQRKRVTILIKYKGYIDKARRQADKQVKMEEKKIPADIDYEDISNLALEAKQKLSKIRPLTIGQASRISGINPADISVLLIYLKQK 616
>gi|12045240|ref|NP_073051.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma genitalium G37] >gi|1346131|sp|P47619|GIDA_MYCGE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|3844967|gb|AAC71606.1| glucose-inhibited division protein A [Mycoplasma genitalium G37] >gi|166078798|gb|ABY79416.1| glucose-inhibited division protein A [synthetic Mycoplasma genitalium JCVI-1.0] (612 aa)
Score = 1449, Expect = 2.6e-158, Identities = 308/603 (51%), Positives = 407/603 (67%)
  Q:     8 VIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           VIGAGHAGLEAAFI++K   KV L VLD   +G+ PCNPSIGGPAKGIVTREID LGGMQAIAADN  LQ KLLNSSKG    A+RAQIDK+ Y  WF ++++ N+ I+LI  E  ++   N+K+ GV   D     S+ +I+TTGT+L S  + G+ V  +GPD    S  L+  +    F+TIRLKTGTPPRILK S+DY+++++E   N+  +FS  ++ FL   KQ  CYL  TN KIH++I  NL KSAM++G I+  GP YCPSIEDKV +F+ K RHQ+FVEPES  LDTIYL GLS+S   ++Q++I++ + GF+NA IKK+ YAIEYDA    QL PTLETK I+ L+FAGQINGTSGYEEAA QGLMAGIN   +L  + P +L+RNEAYIGV+I DL+ K I+DPYRLLTSRAEYRL LRNDN  +RL+K  +ELGL  +  ++ + K  +     +  L+ + +  VK  K+ ++ T  +LY+  KR + +   +   L  K  LD     +++I IKY GYIK  +K       +  IK+    DY  V N++ EA  KL+  KP  L  AS+++G+N  D+I IK +L+
  S:     7 VIGAGHAGLEAAFIVSKFNIKVNLLVLDINHLGSCPCNPSIGGPAKGIVTREIDVLGGMQAIAADNNALQYKLLNSSKGPAVQAIRAQIDKIGYKNWFQSQVKLNKNINLIQSEAINLIVRNEKIKGVILKDGSELLSDAVIITTGTYLRSKTYCGNTVKNQGPDQSKNSEKLSTNLINRGFKTIRLKTGTPPRILKTSLDYNQMELEINNNQNLAFSTTNKNFLPLEKQIPCYLVHTNQKIHDLILKNLKKSAMFNGSISAQGPLYCPSIEDKVFKFSQKPRHQIFVEPESLSLDTIYLAGLSTSFTPEIQKEIIQLLPGFQNAEIKKFGYAIEYDAFLSNQLKPTLETKLIENLYFAGQINGTSGYEEAAGQGLMAGINAALKLLKKPPFILQRNEAYIGVMINDLVTKTISDPYRLLTSRAEYRLWLRNDNVQERLIKKSFELGLTDKKTYELFLKKEKKKQELISFLKNTQVGKVKALKFTNKNTAQSLYDFNKRSEINLDKLIKDLPEKYQLDSETLKQIEIEIKYEGYIKKNEKYFKGLDKLSKIKIPHTFDYHKVKNLASEAIFKLSNFKPSNLAIASQIAGVNFNDIIAIKHFLK 609
>gi|171854013|emb|CAM11978.1| Glucose inhibited division protein A [Candidatus Phytoplasma australiense] (614 aa)
Score = 1442, Expect = 1.6e-157, Identities = 306/611 (50%), Positives = 416/611 (68%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET----STLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG+EAA ILAKK ++  L     K + ++ CNPSIGGPAKG+V REIDALGG+   AAD  Q+QMK+LN SKG    ALRAQIDK++Y K  L  ++    +DL++  VN +   N ++ GV  +D +   +  +I+TTGT+L S I IG      GP+    +Y +++Q+K+L F+ IRLKTGTPPRI K +IDY++ +I+ G     +FS FD        QE C+L  TN K H++I  +L+KSAMY G+I GTGPRYCPSIEDKVVRF DK+ HQ+F+EPES  LD +YL GLS+S+P+++Q +I+K I G +NA I KY YAIEYDA NP QL   LETKKI  LFFAGQ+NGTSGYEEAACQGLMAGIN   +L+N+ P VLKRNEAYIGVLI+DLI K   +PYRLLTSRAE+RL LR+DNAD RL +Y    GLI   +++ + K  E+    LK  +     S  KN+ ++   +    TTL+++LKRP++++  ++ FLK K     Y  ++ +I IKY GYI   +K       ++  K+    +Y ++ N+S EA++KL  +KP TLGQASR+ G+N VD+  + +YL  ++
  S:     2 EYDSIVVGAGHAGVEAALILAKK-HQTLLISGSLKKIASLHCNPSIGGPAKGVVVREIDALGGVMGKAADLAQIQMKMLNFSKGPAVRALRAQIDKIQYPKIILKMLQTAPNLDLLEGLVNHLLIKNNQIQGVCLLDGRKIYAKTVIITTGTYLSSQILIGETKTASGPNGTPTTYGISQQLKDLGFEIIRLKTGTPPRIKKATIDYAQTKIQLGDTDLQTFS-FDSDIKKLGSQEACFLTHTNEKTHQVIQKHLNKSAMYGGYIKGTGPRYCPSIEDKVVRFFDKKSHQIFIEPESVSLDEMYLQGLSTSMPQNIQHEILKTIPGLQNAEIAKYGYAIEYDAFNPSQLKHNLETKKINNLFFAGQMNGTSGYEEAACQGLMAGINASLKLQNKSPFVLKRNEAYIGVLIDDLITKGTKEPYRLLTSRAEFRLLLRHDNADLRLKEYSNHFGLIDAKNYEAFKKKKESLQLILKMSQNHEILSEEKNL-DYLKTTLTGKTTLFQLLKRPEFNYQTLQHFLKIKADQKTY--EQAEIQIKYEGYIAKAKKEAEKLLKLEQKKIPEKINYSEIKNLSKEAQEKLTLIKPETLGQASRILGVNQVDISILLIYLGKER 611
>gi|50365486|ref|YP_053911.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mesoplasma florum L1] >gi|81170555|sp|Q6F0E6|GIDA_MESFL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|50364042|gb|AAT76027.1| glucose inhibited division protein A [Mesoplasma florum L1] (626 aa)
Score = 1440, Expect = 2.9e-157, Identities = 298/610 (48%), Positives = 401/610 (65%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLEN 611
           K +D +VIG GHAG+EAA   A+   K AL  L K  +  MPCNPS+GGPAKGIV REIDALGG  A AAD T LQ KLLNSS+G G WALR Q DK EYSK+    +EE   + LI+     +   N  V GV   D +  +S  +++TTGT+L S I  GH+    GP++   S  +++ +K+   +  R KTGTPPRI KNS+D SK   EPGT+ K +FS    ++    KQE+CYL  ++++  +II +NL KSAMYSG +   GPRYCPS EDK+VRF+ KE HQ+F+EPES   D  Y+ G S+S+P DVQ  +++++ GFE A +K +AYAIEYD +NP+QL P+LE K I  LF AGQINGTSGYEEAA QGL+AGIN   +++  +PL+L+R+EAYIGV+I+DLINK + +PYRLLTSRAE+RL LRNDNA+ RL + GYE+GLI Q+ ++EY K  E  NN +KELE       +     +KE          +  EILK P      M P++ +   L       + I  ++ GY+K+++K +     ++  K+ S  DY  V N++ EAR KL KVKPL +GQASR++G+N  D+  +  YL+N
  S:     3 KHFDVIVIGGGHAGVEAALASARLNKKTALINLYKDRIAAMPCNPSVGGPAKGIVVREIDALGGEMAKAADKTALQTKLLNSSRGPGVWALRVQSDKEEYSKYMQKIVEEQINLQLIESIATDLIIENNTVTGVLLKDGEILKSKCVVLTTGTYLKSEILTGHEKFSSGPNEEPTSNGISESLKKSGVELFRFKTGTPPRIYKNSVDLSKAIKEPGTDAKLAFSFSTNEYTPIEKQELCYLIHSSSETKKIIEDNLTKSAMYSGKVESIGPRYCPSFEDKIVRFSSKETHQIFIEPESISGDAWYIQGFSTSMPTDVQLLMIRSLPGFEKAEVKTWAYAIEYDCVNPMQLNPSLEIKNINNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLDPLILRRDEAYIGVMIDDLINKGVWEPYRLLTSRAEHRLLLRNDNAEHRLKEKGYEIGLIKQAEYNEYLKYTEEINNAIKELEEIRFTPKSELAIKLKELGQADLSHGYSGIEILKIPTVDIEVMIPYISSLQNLKNNQLQSIVIETRFAGYVKTERKTVERLVKLEKKKIPSDIDYDKVENLATEARQKLKKVKPLNIGQASRITGVNPADIQMLLFYLKN 619
>gi|163764993|ref|ZP_02172042.1| NAD/FAD-utilizing enzyme apparently involved in cell division-like protein [Bacillus selenitireducens MLS10] >gi|160354531|gb|EDP81195.1| NAD/FAD-utilizing enzyme apparently involved in cell division-like protein [Bacillus selenitireducens MLS10] (628 aa)
Score = 1430, Expect = 4.7e-156, Identities = 284/613 (46%), Positives = 405/613 (66%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           K+D +V+GAGHAG+EA    A+      +  L+   V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK  Y       IE+ + + L    V  +   + +V GV T     +E++ +I+TTGT+L   + IG    + GP++   S  L+  +KEL F+ +R KTGTPPR+  +SIDYS+ +I+PG  +  +FS+    F+    Q  C+L +T+ + HE+IN NL +S MYSG I GTGPRYCPSIEDK+VRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ +I+K + G E+  + +  YAIEYDAI P QL+P+LETK+I GLF AGQINGTSGYEEAA QGLMAGIN   +++ +EPL+L R+EAYIGVLI+DL+ K   +PYRLLTSRAE+RL LR+DNAD RL + GYE+GL++Q+ ++ + +        +K L  + +K   E          +  K   +   ++KRP+ S+  ++  +  +  L +  K++V+I IKY GYI  Q + +  +  ++N K+    DY  +  +++EAR KLN+V+P+++GQASRVSG+N  D+  + +YLE  + Q
  S:     7 KFDVIVVGAGHAGVEAGLASARMGANTLMLTLNLDAVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFMYQHEMKKVIEDTDNLLLRQGMVEELIVEDDQVKGVITQTGARYEADSVIITTGTYLRGKVIIGELSYESGPNNMQPSVNLSHHMKELGFEMVRFKTGTPPRVNGHSIDYSQTEIQPGDEEPRAFSYETTAFI--TDQLPCWLTYTSPETHELINANLHRSPMYSGMIEGTGPRYCPSIEDKIVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQHEILKTVPGLESVRMMRPGYAIEYDAIVPTQLWPSLETKRISGLFTAGQINGTSGYEEAAGQGLMAGINAALKVQEKEPLILDRSEAYIGVLIDDLVTKGTNEPYRLLTSRAEFRLLLRHDNADLRLTEKGYEIGLVNQNRFEGFEQKKAEIAKEIKRLRKAIIKATPENNQVLEDLGASPLKEAMSADVLIKRPELSYSLVDALVPAETVLTDDVKEQVEIQIKYEGYIAKQLEQVERSLKMENRKIPEDIDYLSINGLAIEARQKLNEVRPISVGQASRVSGVNPSDISVLLVYLEQGRLQ 624
>gi|162446948|ref|YP_001620080.1| glucose inhibited division protein A [Acholeplasma laidlawii PG-8A] >gi|189039327|sp|A9NEC4|GIDA_ACHLI tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|161985055|gb|ABX80704.1| glucose inhibited division protein A [Acholeplasma laidlawii PG-8A] (617 aa)
Score = 1422, Expect = 3.3e-155, Identities = 295/609 (48%), Positives = 409/609 (67%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-FKYNSRKTNTTLYE------ILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           YD +++GAGHAG+EAA  +AK K    L   D   V  +PCNPSIGGPAKGIV REIDALGG  A +AD +Q+QMK+LN SKG    ALRAQIDKL+Y K  L+ ++    + L+   V+++   +  V GV   D     +  +I+TTGT+L S I IGH+    GP+    +  ++ Q+K L F+ +RLKTGTPPRI ++SIDYSK   +PG     +FSH D    D   QE  YL  T+    +II NNLD SAMY G + G GPRYCPSIEDK VRF DK+RHQ+F+EPES  L+ +Y+ GLS+S+P+ +QEQ+V+++ G ENA I +YAYAIEYDAINP QLY +LETK I  LF AGQINGTSGYEEAA QGLMAGIN   +++ ++PLVLKR+EAYIGVLI+DLI K  ++PYRLLTSRAE+RL LRNDNAD RL  YGY++GL+  + ++ +          ++  +++ +   +E   Y +   ++ +YE      +L+RP+     ++ FL +    + Y  ++++IYIKY GYI+  ++  +     ++  + +  +Y  + NIS EA++KL+K+KP TLGQA+R+ G+   D+  + +YLE K
  S:     3 YDGIIVGAGHAGVEAALAMAKMKLNTLLITGDLTKVATLPCNPSIGGPAKGIVVREIDALGGQMAKSADLSQIQMKMLNPSKGPAVRALRAQIDKLKYPKVMLDVLQNTPNLTLLQGFVDTLIVEDNTVKGVNLEDGSQVFAQTVIITTGTYLGSQILIGHEKTSSGPNGERTTRGISNQLKNLGFEMLRLKTGTPPRIARDSIDYSKTVPQPGDGVFQTFSH-DSPITDLGHQEFSYLIHTSPDTKDIIFNNLDASAMYGGVVEGVGPRYCPSIEDKFVRFKDKDRHQIFIEPESMDLNEMYIQGLSTSMPKHIQEQMVRSLPGMENARIVRYAYAIEYDAINPRQLYQSLETKVIHNLFCAGQINGTSGYEEAAGQGLMAGINAGLKVQGKKPLVLKRDEAYIGVLIDDLITKGTSEPYRLLTSRAEHRLLLRNDNADIRLRDYGYQIGLVDDATYERFEHKKIALKEMIERAKSTKINPTEENLNYLASVNSSPIYEGVTVFKLLERPELKIETLKHFLPSDYNHEIY--EQLEIYIKYDGYIEKARREADKLLRYESRFIPNDINYHSIHNISAEAKEKLSKIKPETLGQATRILGVGPTDVSMLLVYLEAK 615
>gi|167937963|ref|ZP_02525038.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus AH1134] (629 aa)
Score = 1393, Expect = 7.5e-152, Identities = 289/610 (47%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +  V + VC GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   +E +VL R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GLI +  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K ++N K+    DY  + +I+ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLSLFQGMVERL-IVEEGVCKGVVTQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKEEVVLGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGRKIGLIKEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSIASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|196041933|ref|ZP_03109220.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus NVH0597-99] >gi|196027188|gb|EDX65808.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus NVH0597-99] (629 aa)
Score = 1392, Expect = 1.2e-151, Identities = 284/610 (46%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLI++  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQSGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGHEIGLITEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|187603416|ref|ZP_02989628.1| glucose inhibited division protein A [Exiguobacterium sp. AT1b] >gi|187484191|gb|EDU22183.1| glucose inhibited division protein A [Exiguobacterium sp. AT1b] (628 aa)
Score = 1392, Expect = 1.2e-151, Identities = 282/614 (45%), Positives = 397/614 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           ++D +VIGAGHAG+EAA   A+   K A+  ++  +VG M CNPSIGGPAKGIV REIDALGG    A D T +QMK+LN+SKG    ALRAQ DK +Y       +E+   + L    V  +   + +V GV T     + +  +IVTTGTF+   I IG    + GP++   S  L+K ++EL    +R KTGTPPRI   +IDYSK +I+PG ++  SF  +    L+  +Q  C+L +T+ + H++I+ NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE +  + IY+ G S+S+PEDVQ Q+++ I G EN+ + +  YAIEYDA+ P QL+PTLETK + GLF AGQINGTSGYEEAA QG+MAGIN  C++  ++P++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYE+GL+S+      N+        +K L +  +K   E          +  K  T    +LKRP+ S+  +   + +   L    K++V+I +KY GYI  Q + +   + ++  ++    DY  +  ++ EA+ KL +V+PL++GQASR+SG+N  D+  + +Y+E  +  T
  S:     7 EFDVIVIGAGHAGIEAALASARMGAKTAMLTMNPDMVGFMYCNPSIGGPAKGIVVREIDALGGEMGRAIDATYIQMKMLNTSKGPAVRALRAQADKFQYQNHMKKVLEDEPNLLLRQALVERLLIEDGEVRGVVTNTGSEYRAKAVIVTTGTFMRGQIIIGELAYESGPNNQMPSVELSKHLEELGLDLVRFKTGTPPRIDGKTIDYSKTEIQPG-DENPSFFSYTSTDLNPIEQIPCWLTYTSERTHQLIDENLHRSPMYSGAIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRDTEEIYVQGFSTSMPEDVQHQMLRTIPGLENSEMMRPGYAIEYDAVVPTQLWPTLETKAVPGLFTAGQINGTSGYEEAAGQGIMAGINAACKVLGKDPVILDRSQAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLSDIGYEIGLLSEDRHTHLNEKRVAIEKEVKRLASLVVKPTPEVNAMLESVGAHPLKEATHANILLKRPEVSYEALMTVVPSTEELSYEVKEQVEIQVKYEGYISKQLEQVEKMRRMEEKRIPENLDYDAIGGLATEAKQKLKQVRPLSIGQASRISGVNPADVSILLVYIEQGQYAT 626
>gi|172059048|ref|YP_001815508.1| glucose inhibited division protein A [Exiguobacterium sibiricum 255-15] >gi|171991569|gb|ACB62491.1| glucose inhibited division protein A [Exiguobacterium sibiricum 255-15] (628 aa)
Score = 1391, Expect = 1.6e-151, Identities = 282/608 (46%), Positives = 394/608 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTN---TTLYE------ILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           ++D +VIGAGHAG+EA+   A+   K  +  ++  +VG M CNPSIGGPAKGIV REIDALGG  A A D T +QMK+LN+SKG    ALRAQ DK EY       +E+   + L    V  +   +    GV T     + +  +I+TTGTF+   I IG    + GP++   S  L+K ++EL F+  R KTGTPPRI   +IDYSK +I+PG      FSH   + +   +Q  C+L +T    H++I+ NL +S M+SG I GTGPRYCPSIEDKVVRF+DK RHQ+F+EPE +  + +Y+ GLS+SLPEDVQ  I+++I G E + + +  YAIEYDA+ P QL+PTLETK+I GLF AGQINGTSGYEEAA QG+MAGIN   +++ R+PL+L R++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GY+LGLI+++   +  +  E+    +K LE   +K   E   N R T    + L E      +LKRP+ ++  +         L E   ++V+I +KY GYI  Q   +     ++  ++    DY  +  +++EA+ KLN+V+PL++GQASR+SG+N  D+  + +Y+E
  S:     7 EFDVIVIGAGHAGIEASLAAARMGSKTVMLTMNPDMVGFMYCNPSIGGPAKGIVVREIDALGGEMARAIDATYIQMKMLNTSKGPAVRALRAQADKFEYQNRMKKALEDEPNLLLRQALVERLIIEDDTCVGVVTNTGAEYRAKAVIITTGTFMRGKIIIGELSYESGPNNQMPSVNLSKHLEELGFELARFKTGTPPRIDGKTIDYSKTEIQPGDAVALPFSHETTQMI--TEQIPCWLTYTTEYTHQLIDANLHRSPMFSGMIKGTGPRYCPSIEDKVVRFSDKPRHQIFLEPEGRDTEEVYVQGLSTSLPEDVQHDILRSIPGLEKSEMMRPGYAIEYDAVVPTQLWPTLETKRIAGLFTAGQINGTSGYEEAAGQGIMAGINAALKVQERDPLILSRSQGYIGVMIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLSDIGYDLGLINETRHAKLAEKKEDIQREMKRLEKVVIKATSEV--NERLTEIGVSPLKEALHAITLLKRPEITYAMIADMTPPPVALSEEAAEQVEIQVKYAGYIDKQLDQVERMMRMEKKRIPERLDYDVISGLAIEAKQKLNQVRPLSIGQASRISGVNPSDISILLVYIE 619
>gi|30265501|ref|NP_847878.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. Ames] >gi|47531069|ref|YP_022418.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188320|ref|YP_031573.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. Sterne] >gi|49481136|ref|YP_039473.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65317464|ref|ZP_00390423.1| COG0445: NAD/FAD-utilizing enzyme apparently involved in cell division [Bacillus anthracis str. A2012] >gi|118480510|ref|YP_897661.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus thuringiensis str. Al Hakam] >gi|165873038|ref|ZP_02217659.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0488] >gi|167635097|ref|ZP_02393414.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0442] >gi|167641741|ref|ZP_02399984.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0193] >gi|170689473|ref|ZP_02880663.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0465] >gi|170707574|ref|ZP_02898027.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0389] >gi|177655265|ref|ZP_02936819.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0174] >gi|166222907|sp|A0RLR1|GIDA_BACAH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|38372308|sp|Q81JH3|GIDA_BACAN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|81170518|sp|Q6HAF3|GIDA_BACHK tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|30260179|gb|AAP29364.1| glucose-inhibited division protein A [Bacillus anthracis str. Ames] >gi|47506217|gb|AAT34893.1| glucose-inhibited division protein A [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182247|gb|AAT57623.1| glucose-inhibited division protein A [Bacillus anthracis str. Sterne] >gi|49332692|gb|AAT63338.1| glucose-inhibited division protein A [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118419735|gb|ABK88154.1| glucose-inhibited division protein A [Bacillus thuringiensis str. Al Hakam] >gi|164711250|gb|EDR16806.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0488] >gi|167510295|gb|EDR85698.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0193] >gi|167529571|gb|EDR92321.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0442] >gi|170127570|gb|EDS96444.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0389] >gi|170666575|gb|EDT17348.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0465] >gi|172080192|gb|EDT65284.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis str. A0174] (629 aa)
Score = 1391, Expect = 1.6e-151, Identities = 284/610 (46%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLI++  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGHEIGLITEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|15828724|ref|NP_326084.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma pulmonis UAB CTIP] >gi|21263679|sp|Q98QV8|GIDA_MYCPU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|14089666|emb|CAC13426.1| GLUCOSE INHIBITED DIVISION PROTEIN A [Mycoplasma pulmonis] (611 aa)
Score = 1390, Expect = 1.8e-151, Identities = 292/614 (47%), Positives = 405/614 (65%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTN-TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           K +D +VIG GHAG+EA F LAK   KVAL  + K  +G MPCNPSIGGPAKGI+T+EIDALGG+Q   AD   +Q+K+LN SKG    A+RAQIDK +YS+  +  + +NE + + +     +   N ++ GV    N+   SN +++TTGT+++S I  G  +   GP+       L+K ++ L F+ IRLKTGTPPRI  +SID+SK++ E      Y FS   R  +  +KQ  CYL +TN K H+II +N++KSAMYS  I GTGPRYCPS+EDK+++F DKERHQ+F EPE+   D +Y+ GLS+S P +VQ+QIVK I G ENA +K + YAIEYDAINP+QL  +LE+KKIKGLF AGQINGTSGYEEAA QGL+AGIN   + +  + +V++RN  YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDN D RL  YG +  LISQ  + +  +  +  +  ++EL+T  + +  +F    +  N  + ++ L RPD   I+    +K+   L+E     + I I+  GYIK Q       + ++N+K+    DY  + N++ EAR+K NK++P T+GQASR+SGIN  D+  +  YL+ KK +
  S:     4 KNFDVIVIGGGHAGVEATFALAKMNLKVALITIYKDKIGAMPCNPSIGGPAKGIITKEIDALGGVQGYYADKAMIQVKMLNESKGPSVRAIRAQIDKEKYSEIIVKDLLQNENVTIFEDFATDLIVENDQIVGVELEKNKTISSNLVVMTTGTYMNSRILRGSDIEHTGPNGEKTGIGLSKALERLGFELIRLKTGTPPRIYSDSIDFSKVEEEVLDVNGYVFS--PRSNVKIDKQIHCYLTYTNEKTHKIIQDNINKSAMYSQLIEGTGPRYCPSVEDKIMKFADKERHQIFFEPETSRQDIMYINGLSTSFPVEVQKQIVKTIPGLENARVKIWGYAIEYDAINPLQLKKSLESKKIKGLFLAGQINGTSGYEEAAAQGLIAGINAGLKFKGEDEIVIQRNHGYIGVLIDDLVTKGTQEPYRMLTSRAEYRLLLRNDNVDIRLAHYGLKAHLISQQDYQKILEKYKKIDEKIEELKTKFVSSKTDFAQKYKIENGISYFQALTRPD---IEPSDLIKDFEFLNE-----MTIQIRLEGYIKKQNNAAAKMERLENLKIPEKIDYSQILNLANEAREKFNKIRPQTIGQASRISGINPADIQMLLFYLDLKKSK 608
>gi|166997076|ref|ZP_02263535.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus AH820] >gi|196036098|ref|ZP_03103498.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus W] >gi|195991265|gb|EDX55233.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus W] (629 aa)
Score = 1390, Expect = 2.0e-151, Identities = 284/610 (46%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLI++  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGHEIGLITEERYERFTNKKLQIEQEKARLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|190569302|ref|ZP_03022196.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis Tsiankovskii-I] >gi|190559609|gb|EDV13600.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus anthracis Tsiankovskii-I] (629 aa)
Score = 1388, Expect = 2.9e-151, Identities = 284/610 (46%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLI++  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPTVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGHEIGLITEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|124520289|ref|ZP_01695472.1| glucose inhibited division protein A [Bacillus coagulans 36D1] >gi|124497779|gb|EAY45332.1| glucose inhibited division protein A [Bacillus coagulans 36D1] (629 aa)
Score = 1388, Expect = 3.0e-151, Identities = 279/610 (45%), Positives = 397/610 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EA    A+   K  +  ++  ++  MPCNPSIGGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK+EY +     IE  E + L+   V  +   +    GV T     + +  +++TTGTFL   I IG      GP++   S  LA++++EL F  +R KTGTPPR+   +IDYSK +I+PG  +  +FS+   K +    Q  C+L +TN + H II+ NL ++ M+SG I GTGPRYCPSIEDKVVRF+DK RHQLF+EPE +H + +Y+ GLS+S+PE+VQ +I+ +I G E+A + +  YAIEYDAI P QL+PTLETKK+K L+ AGQINGTSGYEEAA QG++AGIN   +   +E LVL R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY++GLIS+  + ++    +     +K L++  LK        ++E   +  K      ++LKRP+  +  ++  +  +  L    +++V+I IKY GYI    + +   K +++ K+ S  DY  +  ++ EAR KLNKV+P+++ QASR+SG+N  D+  + +Y+E  K
  S:     9 YDVIVVGAGHAGCEAGLAAARIGAKTLMITINLDMIAYMPCNPSIGGPAKGIVVREIDALGGEMGRNIDKTYIQMRMLNTGKGPAVQALRAQADKVEYQREMKKTIENQENLTLLQGMVEELVLEDGVCKGVVTKTGAKYTAKTVVLTTGTFLRGEIIIGELKYSSGPNNQQPSIALAEKLEELGFDLVRFKTGTPPRVNGKTIDYSKTEIQPGDLEPRAFSYETTKMI--TDQLPCWLTYTNERTHAIIDANLGRAPMFSGMIKGTGPRYCPSIEDKVVRFHDKPRHQLFLEPEGRHTEEVYVQGLSTSMPEEVQREILASIEGLEHAKMMRPGYAIEYDAITPTQLWPTLETKKVKNLYTAGQINGTSGYEEAAGQGIIAGINAAQRAMGKEELVLGRSDAYIGVLIDDLVTKGTREPYRLLTSRAEYRLLLRHDNADLRLTEIGYQIGLISEERYRKFTAKKQAIEAEIKRLKSVILKPDEKTQTLIREAGGSELKDGIHAADLLKRPEMRYEHIKALVPPEMELSPEVEEQVEIQIKYEGYIAKSLQQVERMKKLEDKKIPSDIDYDAIHGLATEARQKLNKVRPISIAQASRISGVNPADISILLVYIEQGK 623
>gi|47458989|ref|YP_015851.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma mobile 163K] >gi|81170559|sp|Q6KID6|GIDA_MYCMO tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|47458317|gb|AAT27640.1| glucose inhibited division protein a [Mycoplasma mobile 163K] (611 aa)
Score = 1388, Expect = 3.4e-151, Identities = 302/611 (49%), Positives = 411/611 (67%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIE--PGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS--TLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           K YD +VIG GHAG+EAAFIL+KK + VAL  L++  + +MPCNPSIGGPAKGI+TREIDALGG QA  AD   +Q+K+LN+SKG    A+RAQIDK +YS+  L  ++E + IDLI+  V  I+  + K+ GV T  N   E+   I+T GT+LDS I  G +    GPD    S  L+  + +L F+ +RLKTGTPPRI  NSID+S+++ E  P +N  +S  H  +     +KQ  CYL +T+ K H+II +N++KS+MYSG I G GPRYCPS+EDK+VRF DKERHQ+F EPE+   D +Y+ GLS+S+P DVQ+Q++K+I G +NA + KYAYAIEYDAI+P+QL  +LE+K+I+ LFFAGQINGTSGYEEAA QGL+AGIN   +LENRE L LKR+++YIGVLI+DL  K   +PYR+LTSRAEYRL LRNDNAD RLLKY      ++           +     + ELE    ++ +    KYN    +T+  +++ R +   ID++  + N   L+E     +   ++  GYIK Q    +    ++N+KL    +Y +V N++ EAR KL  +KPLT+GQASR+SGIN  D+  +  +L  K
  S:     4 KIYDAIVIGGGHAGVEAAFILSKKNFNVALISLNQNRLASMPCNPSIGGPAKGIITREIDALGGKQAYFADQAMIQIKMLNTSKGPAVRAIRAQIDKEKYSQIILKAVQETKNIDLIEDMVFEIQTKDNKISGVITEKNGLLETKTAIITAGTYLDSYILRGEEKYSSGPDGEKTSNSLSNSLIKLGFKLLRLKTGTPPRIYANSIDFSEVEEEILPESNLNFSIYHSKK----LSKQIHCYLTYTSEKTHQIILDNINKSSMYSGLIKGIGPRYCPSVEDKIVRFKDKERHQIFFEPETIKADIMYINGLSTSMPIDVQDQMIKSINGLKNAKVAKYAYAIEYDAIDPLQLKKSLESKEIENLFFAGQINGTSGYEEAAGQGLLAGINASLKLENREALNLKRSDSYIGVLIDDLTTKGTKEPYRMLTSRAEYRLLLRNDNADIRLLKYAKYAKTLTDKEIATTEAKYDLITKKIAELENQYISINDPLAKKYN-LANSTSFLQLISRHE---IDIKEIVGNFPFLEE-----LSTNVRLDGYIKKQLSQADKMLRLENLKLPEDLNYDNVVNLAFEARQKLKMIKPLTIGQASRISGINPADIQMLMFHLNLK 605
>gi|149182298|ref|ZP_01860777.1| glucose-inhibited division protein A [Bacillus sp. SG-1] >gi|148849990|gb|EDL64161.1| glucose-inhibited division protein A [Bacillus sp. SG-1] (629 aa)
Score = 1387, Expect = 4.2e-151, Identities = 281/611 (45%), Positives = 396/611 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           ++D +VIGAGHAG+EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IE+   + L+   V S+   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+   +IDYSK +I+PG +   +FS+   K++    Q  C+L +TN + H++I++NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE K+   +Y+ GLS+SLPEDVQ +I+  I G E A + +  YAIEYD+I P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+  ++E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G+++GLIS   ++ +             L+T  LK        +KE   +  K      +IL+RP+ ++  ++  +  +  L E  +++V+I IKY GYI+   + ++  K ++N K+    DY  +  ++ EAR KL +V+PL+L QASR+SG+N  D+  + +Y+E  K
  S:     7 QFDVIVIGAGHAGVEAGLAAARMGAKTLMVTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFAYQHEMKKTIEDEPNMTLLQGMVESLIIEDDECKGVVTQTGAEYRAKTVVITTGTFLRGEIILGDLRYSSGPNNQQPSIKLSEHLQELGFDMVRFKTGTPPRVNSKTIDYSKTEIQPGDDVPRAFSYETTKYI--TDQLPCWLTYTNAETHQLIDDNLGRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGKNTQEVYVQGLSTSLPEDVQMKILATIPGLEKAQLMRAGYAIEYDSIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRALDKEEVILNRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDIGHKIGLISDERYERFLTKKALVEEEKARLQTIRLKPNEETQNVIKEAGGSELKDGILASDILRRPEMNYSHIKALIPREEPLTEDIEEQVEIQIKYEGYIEKSLQQVDKMKKMENKKIPDFIDYDAINGLASEARQKLKEVRPLSLAQASRISGVNPADVSILLVYIEQGK 622
>gi|152977682|ref|YP_001377199.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189039328|sp|A7GVP6|GIDA_BACCN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|152026434|gb|ABS24204.1| glucose inhibited division protein A [Bacillus cereus subsp. cytotoxis NVH 391-98] (629 aa)
Score = 1386, Expect = 4.9e-151, Identities = 283/610 (46%), Positives = 395/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +  V   VC GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F+ +R KTGTPPR+  N+IDYSK +I+PG ++  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ +++K I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QG+MAGIN  C+   ++ ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLI +  ++ Y++  E        LE   +K   E +   R       K      ++L+RP+ ++  +     ++  +++   ++V+I IKY GYI+   + +   K +++ K+    DY  +  I+ EAR KL +V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFLYQHELKKTIEETPNLTLRQGMVERL-IVEDGVCKGVITQSGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFELVRFKTGTPPRVNSNTIDYSKTEIQPGDDQPRAFSFETTKFI--LDQIPCWLTYTSEETHRLIDKNLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQREMLKTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGIMAGINAACRSLGKKEVILGRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLIPEERYERYSQKKEQIEQEKARLEGIIIKPRPEVQELIRSVGGSELKDGIRASDLLRRPEMTYEHIRLLAPSELEINDEVAEQVEIQIKYEGYIEKSLQQVERMKKMESKKIPVDIDYDAISGIASEARQKLKEVRPLSVGQASRISGVNPADISILLVYIEQGK 622
>gi|52145291|ref|YP_086748.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus E33L] >gi|196045512|ref|ZP_03112743.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus 03BB108] >gi|81824093|sp|Q630B9|GIDA_BACCZ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|51978760|gb|AAU20310.1| glucose-inhibited division protein A [Bacillus cereus E33L] >gi|196023719|gb|EDX62395.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus 03BB108] (629 aa)
Score = 1386, Expect = 5.3e-151, Identities = 284/610 (46%), Positives = 392/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GLI++  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGREIGLITEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|168137558|ref|ZP_02580787.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus B4264] (629 aa)
Score = 1385, Expect = 7.5e-151, Identities = 287/610 (47%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +  V + VC GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ +VL R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GLI +  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K +++ K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFAYQHELKKTIEETPNLTLFQGMVERL-IVEEGVCKGVVTQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVVLGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGREIGLIKEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMESKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|30023507|ref|NP_835138.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus ATCC 14579] >gi|38372296|sp|Q814F7|GIDA_BACCR tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|29899068|gb|AAP12339.1| Glucose inhibited division protein A [Bacillus cereus ATCC 14579] (629 aa)
Score = 1384, Expect = 8.1e-151, Identities = 287/610 (47%), Positives = 393/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +  V + VC GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ +VL R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GLI +  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +  K++V+I IKY GYI+   + +   K +++ K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFAYQHELKKTIEETPNLTLFQGMVERL-IVEEGVCKGVVTQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVVLGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGREIGLIKEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMAYEHIHLLVPSEVELSDEVKEQVEIQIKYEGYIEKSLQQVERMKKMESKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|15616623|ref|NP_244929.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus halodurans C-125] >gi|12643249|sp|Q9RCA8|GIDA_BACHD tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|10176686|dbj|BAB07780.1| glucose-inhibited division protein [Bacillus halodurans C-125] (632 aa)
Score = 1381, Expect = 2.0e-150, Identities = 285/611 (46%), Positives = 391/611 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEY---------------WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           ++D +V+GAGHAG+EA    A+      +  L+   V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK  Y       IEE E + L    V  +   + +  GV T     + +  ++VTTGT+L   I IG    + GP++   S  L+  ++EL F+ +R KTGTPPR+   +IDY K +I+PG     +FS+   K++    Q  C+L +T +K H+IIN+NL +S MYSG I GTGPRYCPSIEDK+VRFNDK RHQ+F+EPE +H   +Y+ GLS+SLPEDVQ  ++K+I G E A + +  YAIEYDAI P QL+PTLETKK+ GLF AGQINGTSGYEEAA QG+MAGIN   +++ ++ L+L R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GLI++  ++ + +         K LE+ T+K  KE        N  L E+   P    +    FLK      E+                 ++V+I IKY GYI    + +   K +++ K+    DY  +  ++ EA+ KL++V+PL++GQASRVSG+N  D+  + +YLE  +
  S:     7 EFDVIVVGAGHAGVEAGLAAARMGANTLMLTLNLDAVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFLYQHEMKKTIEEEENLLLRQGMVERLIIEDGECRGVITNTGAEYRAKAVVVTTGTYLRGKIIIGDLAYESGPNNMQPSINLSYHLQELGFEMVRFKTGTPPRVNGETIDYDKTEIQPGDEVPRAFSYETTKYI--TDQLPCWLTYTGDKTHQIINDNLGRSPMYSGMIEGTGPRYCPSIEDKIVRFNDKPRHQIFLEPEGRHTSEVYVQGLSTSLPEDVQLDVLKSIPGLEKARMMRPGYAIEYDAIVPTQLWPTLETKKVPGLFTAGQINGTSGYEEAAGQGIMAGINAALRVQGKDGLILDRSEAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEKGYEIGLIARERYERFCEKKAQIAAEKKRLESITVKPSKE-------VNALLEEVGSAPLKEAVQANVFLKRPEVTYEHVAKVIPAPEQELSADVAEQVEIQIKYEGYISKMLQQVERAKKMNDKKIPEDLDYDAINGLATEAKQKLSEVRPLSVGQASRVSGVNPSDISILLVYLEQGR 623
>gi|47568682|ref|ZP_00239379.1| glucose inhibited division protein A [Bacillus cereus G9241] >gi|47554670|gb|EAL13024.1| glucose inhibited division protein A [Bacillus cereus G9241] (629 aa)
Score = 1381, Expect = 2.2e-150, Identities = 283/610 (46%), Positives = 391/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GLI++  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +   ++V+I IKY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGREIGLITEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVTEQVEIQIKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSVGQASRISGVNPADISILLVYIEQGK 622
>gi|157149984|ref|YP_001449347.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus gordonii str. Challis substr. CH1] >gi|189039364|sp|A8AU87|GIDA_STRGC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|157074778|gb|ABV09461.1| glucose inhibited division protein A [Streptococcus gordonii str. Challis substr. CH1] (639 aa)
Score = 1380, Expect = 2.5e-150, Identities = 288/613 (46%), Positives = 393/613 (64%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D + +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    +N I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    +  LA  +++L F+  R KTGTPPR+  +SI+Y   +I+PG  K   FS+  R   D+ K +V C+L +TN + HEII NNL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ +V +I G ENA + +  YAIEYD I P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ R  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K LE+  LK VK       E  +       T  E ++RP+ S+ D+  F+      LDE   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 ESYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKNIDKSYIQMKMLNTGKGPAVRALRAQADKEVYSKEMRKTVENQENLTLRQTMINEILVEDGKVIGVKTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLAAIPLADNLRDLGFEIGRFKTGTPPRVKASSINYDVTEIQPGDEKANHFSYTSRD-EDYVKDQVPCWLTYTNAESHEIIQNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLVHSIKGLENAEMMRTGYAIEYDMIMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGRPELILKRSDGYIGVMIDDLVTKGTVEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLESIKLKPVKETNAKVEELGFKPLTDAVTAKEFMRRPEVSYQDVVQFIGPAAEELDEKIIELIETEIKYEGYISKALDQVEKMKRMEEKRIPANIDWDDIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGKAR 627
>gi|125719133|ref|YP_001036266.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus sanguinis SK36] >gi|166200625|sp|A3CRB1|GIDA_STRSV tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|125499050|gb|ABN45716.1| Glucose inhibited division protein A, putative [Streptococcus sanguinis SK36] (635 aa)
Score = 1380, Expect = 2.7e-150, Identities = 287/613 (46%), Positives = 394/613 (64%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D + +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    +N I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    +  LA  +++L F+  R KTGTPPR+  +SI+Y   +I+PG  K   FS+  R   D+ K +V C+L +TN + HEII NNL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ +V +I G ENA + +  YAIEYD I P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ ++ L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K LE+  LK VKE         +       T  E ++RP+ S+ D+  F+      LDE   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 ESYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKNIDKSYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMINEILVEDGKVIGVKTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLAAIPLADNLRDLGFEIGRFKTGTPPRVKASSINYDVTEIQPGDEKANHFSYTSRD-EDYVKDQVPCWLTYTNAESHEIIQNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLVHSIKGLENAEMMRTGYAIEYDMIMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKQELILKRSDGYIGVMIDDLVTKGTVEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLESIKLKPVKETNAKVEALGFKPLTDAVTAKEFMRRPEVSYQDVVQFIGPAAEELDEKIIELIETEIKYEGYISKALDQVEKMKRMEEKRIPANIDWDDIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGKSR 627
>gi|56965873|ref|YP_177607.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus clausii KSM-K16] >gi|81170520|sp|Q5WAG4|GIDA_BACSK tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56912119|dbj|BAD66647.1| glucose inhibited division protein A [Bacillus clausii KSM-K16] (629 aa)
Score = 1380, Expect = 2.8e-150, Identities = 284/610 (46%), Positives = 387/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-----KYNSRKTNTTL--YEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +VIGAGHAG+EA    A+      +  L+   V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IEE E + L    V+ +   + +  GV T     + +  ++VTTGT+L   I +G    + GP++   S  L+  +KEL F  +R KTGTPPR+  N+IDY K +I+PG +K  +FS+   KF+    Q  C+L +T+   H+II+ NL +S MYSG I GTGPRYCPSIEDK+VRF+DK RHQ+F+EPE +    +Y+ GLS+SLPEDVQ  ++K I G E   + +  YAIEYDAI P QL+PTLETKKI GLF AGQINGTSGYEEAA QG+MAGIN   +   +E ++L R+EAYIGVLI+DL+ K   +PYRLLTSRAE+RL LR+DNAD RL + GYELGLIS+  +  +    E      + +    +K   E      +  SR     L    +LKRP+ ++      +   +  LD+   ++V+I +KY GYI+ Q + I   K ++  ++    DY  +  I+ EAR KL +V+PL++GQASRVSG+N  D+  + +YLE  +
  S:     8 FDVIVIGAGHAGVEAGLAAARMGANTLMLTLNLDAVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFRYQQEMKRTIEEQENLLLRQGMVDRLIIEDGECRGVITNTGAQYRAKAVVVTTGTYLRGKIILGELSYESGPNNMQPSIKLSDHLKELGFDLVRFKTGTPPRVHGNTIDYKKTEIQPGDDKPRAFSYETTKFI--TDQLPCWLTYTSENTHQIISANLGRSPMYSGMIEGTGPRYCPSIEDKIVRFSDKPRHQIFLEPEGRDTSEVYVQGLSTSLPEDVQLSMLKTIPGLEEVRMMRPGYAIEYDAIVPTQLWPTLETKKISGLFTAGQINGTSGYEEAAGQGIMAGINAAQKAFGKEGVILDRSEAYIGVLIDDLVTKGTNEPYRLLTSRAEFRLILRHDNADLRLTEKGYELGLISEERYSRFKAKQEAIEQEKQRISALVVKPSDEVNQLLERLGSRSMTEALKATAVLKRPEMTYDHFLKIIPRPDVELDDEVYEQVEIQVKYEGYIEKQWQQIERLKKMEQKRIPEDLDYDAIQGIATEARQKLKQVRPLSVGQASRVSGVNPADISILLVYLEQGR 623
>gi|52082647|ref|YP_081438.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus licheniformis ATCC 14580] >gi|52788046|ref|YP_093875.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus licheniformis ATCC 14580] >gi|81170519|sp|Q65CN2|GIDA_BACLD tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|52005858|gb|AAU25800.1| glucose-inhibited division protein [Bacillus licheniformis ATCC 14580] >gi|52350548|gb|AAU43182.1| GidA [Bacillus licheniformis DSM 13] (628 aa)
Score = 1379, Expect = 3.3e-150, Identities = 280/611 (45%), Positives = 394/611 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG+EAA   A++  K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM+LLN+ KG    ALRAQ DK +Y       +E    + ++   V  +   + +  GV T     + S  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  +SIDYSK +I+PG     +FS+   +++    Q  C+L +T+ + HEII+NNL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ +++  I G EN  + +  YAIEYDAI P QL+PTLETKKI GLF AGQINGTSGYEEAA QG+MAGIN   +   +E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY++GLIS+  + ++ +         K L +  +K  KE +   R       K      +++KRP+ ++  +      +  +     ++V+I IKY GYI+   + +   K ++N K+    DY  +  I+ EAR KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     7 QYDVVVVGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMAKNIDKTHIQMRLLNTGKGPAVRALRAQADKFQYQHEMKKTLENEPNLTMLQGMVERLLIEDGECRGVITQTGAEYRSKTVVLTTGTFLRGKIILGDLSYSSGPNNQQPSIKLSEHLEELGFDLVRFKTGTPPRVNSHSIDYSKTEIQPGDEVPRAFSYETVEYI--TDQLPCWLTYTSPETHEIIDNNLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRKMLSTIPGLENVQMMRAGYAIEYDAIVPTQLWPTLETKKIPGLFTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGYQIGLISEERYQKFQEKKAAIEAEKKRLHSVIIKPTKENQEYIRSLGGSELKDGIRATDLMKRPEMNYETVTALAPPEQKVAGDVAEQVEIQIKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEARQKLKEVRPLSVAQASRISGVNPADISILLVYLEQGR 622
>gi|70727674|ref|YP_254590.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus haemolyticus JCSC1435] >gi|81170579|sp|Q4L2Z3|GIDA_STAHJ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|68448400|dbj|BAE05984.1| glucose inhibited division protein A [Staphylococcus haemolyticus JCSC1435] (625 aa)
Score = 1378, Expect = 4.1e-150, Identities = 283/615 (46%), Positives = 404/615 (65%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK------NVKEFKYNSRKTNTTL-YEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++YD +VIGAGHAG+EA    A++  K  +  ++   +  MPCNPS+GGPAKGIV REIDALGG  A A D T +QM++LN+ KG    ALRAQ DK+ Y +     IE+ + +D++   V+ +   + +V GV T     + +  +++TTGTFL   I +G+     GP+    S  LA  ++EL F+ +R KTGTPPR+   +IDYSK +I+PG +   +FS    +++    Q  C+L +TN++ H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDAI P QL+PTLETK IK L+ AGQINGTSGYEEAA QG+MAGIN   ++      +L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYELG+IS+  +  +N+  +   + ++ L    +K      +V E    SR  +  L  ++L+RP+ ++  +   L+  + L E  +++V+I  KY GYI    + +   K ++  K+    DY  V +++ EAR+KL +VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:     2 VQEYDVIVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKAIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEDNLDIMQGMVDELIIEDNEVKGVRTNIGTEYRAQAVVITTGTFLRGEIILGNMKYSSGPNHQLPSITLADNLRELGFEVVRFKTGTPPRVNAKTIDYSKTEIQPGDDVGRAFSFETTEYI--LDQLPCWLTYTNDRTHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGIMAGINAAGKVLGTGEKILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDVGYELGMISEERYARFNEKRQQIQDEIQRLTDIRIKPNEHTQSVIEANGGSRLKDGILAIDLLRRPEMTYNTILEILEESHQLPEAVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKVDSLATEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQGKLQ 621
>gi|75761489|ref|ZP_00741453.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168143814|ref|ZP_02587043.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus G9842] >gi|74491028|gb|EAO54280.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Bacillus thuringiensis serovar israelensis ATCC 35646] (629 aa)
Score = 1377, Expect = 5.2e-150, Identities = 284/610 (46%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   +    GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  SFS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ +VL R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GLI +  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +   ++V+I IKY GYI+   + +   K +++ K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGMCKGVVTQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRSFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVVLGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGREIGLIKEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVTEQVEIQIKYEGYIEKSLQQVERMKKMESKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADISILLVYIEQGK 622
>gi|42784679|ref|NP_981926.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus ATCC 10987] >gi|166982563|ref|ZP_02253995.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus AH187] >gi|168160940|ref|ZP_02596173.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus cereus H3081.97] >gi|81170515|sp|Q72WU4|GIDA_BACC1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|42740611|gb|AAS44534.1| glucose-inhibited division protein A [Bacillus cereus ATCC 10987] (629 aa)
Score = 1377, Expect = 5.8e-150, Identities = 282/610 (46%), Positives = 391/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-NKNL--ENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLI +  ++ + NK L  E     L  +       V+E   N      K      ++L+RP+ ++  +   + ++  L +   ++V+I IKY GYI+   + +   K +++ K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGMVERLIVEDGECKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRDMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGREDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLIKEERYERFTNKKLQIEQEKERLSSIIIKPRPEVQELIRNIGGSELKDGIRASDLLRRPEMTYEHIHLLVPSEVELSDEVTEQVEIQIKYEGYIEKSLQQVERMKKMESKKIPVDIDYDAISSLASEARQKLKDVRPLSVGQASRISGVNPADISILLVYIEQGK 622
>gi|83319255|ref|YP_424798.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535456|sp|Q2SR15|GIDA_MYCCT tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|83283141|gb|ABC01073.1| glucose inhibited division protein A [Mycoplasma capricolum subsp. capricolum ATCC 27343] (629 aa)
Score = 1376, Expect = 7.5e-150, Identities = 281/609 (46%), Positives = 407/609 (66%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV-NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL-------ETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           YD +V+G GHAG+EAA   A+   K AL  L +  +  MPCNPS+GGPAKGIV REIDALGG  A AAD T LQ KLLNSS+G G WALR Q DK EYSK+  N I++ + +DLI K    + +  N+ V G+Y  D     +  +I+TTGT+L S I  G    + GP++   +  ++K + +L  + +R KTGTP R+ ++S+D S+  IEPGT+ K +FS     +    KQ+ CYL  +  +  +II +NL+KSAMYSG +   GPRYCPS EDKVVRF +K+ HQ+F+EPE+ + DT Y+ G S+S+P +VQE ++K++ GFEN  +K +AYAIEYD I+P+QL P+LE K ++ LF AGQINGTSGYEEAA QGL+AGIN   +++  +P++L+R+EAYIGV+I+DLINK + +PYRLLTSRAE+RL LRNDNA+ RL +YG E+GLIS + W++Y   ++     +KEL       ++    N+K  K        + YEI+K P     ++  F+ +   L       + I I++ GY+K ++++++    ++  K+    +Y  V N++ EA+DKL K++PL +GQASR++G+N  D+  +  YL+ +
  S:     5 YDVIVVGGGHAGVEAALASARLNKKTALINLYEDKIATMPCNPSVGGPAKGIVVREIDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSDKEEYSKYMRNVIKKQKNLDLITKACTGLVYDDNKSVTGIYLDDEIILNAKAVIITTGTYLKSEILKGIDRYESGPNNEKTTKGISKSLIDLGIKLMRFKTGTPARVYRDSVDLSRAIIEPGTDMKLAFSFSTNTYTPIEKQQPCYLIHSTLETKKIIEDNLEKSAMYSGTVESIGPRYCPSFEDKVVRFKEKDTHQIFIEPETLNGDTWYVQGFSTSMPIEVQELMLKSLPGFENVRVKHWAYAIEYDCIDPMQLSPSLELKDVRNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLDPIILRRDEAYIGVMIDDLINKGVWEPYRLLTSRAEHRLLLRNDNAETRLKQYGREIGLISDTEWEQYLIYVKEIEQAIKELKEIRFTPKSQLAINLKNKKQADLSHGYSGYEIIKIPTVDINELIEFIPSLQKLKTNQLQSIVIEIRFEGYVKKERQLVDKLVKLERKKIPLDINYSKVDNLATEAKDKLEKIRPLNIGQASRITGVNPADIQMLLFYLKKQ 621
>gi|163943163|ref|YP_001648047.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus weihenstephanensis KBAB4] >gi|163865360|gb|ABY46419.1| glucose inhibited division protein A [Bacillus weihenstephanensis KBAB4] (629 aa)
Score = 1376, Expect = 7.5e-150, Identities = 281/610 (46%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EA    A+   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE   + L    V  +  +   VC GV T     + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  N+IDYSK +I+PG +K  +FS    KF+    Q  C+L +T+ + H +I+ NL +SAMYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ  +++ I G EN  + +  YAIEYDAI P QL+PTLETKKIK L+ AGQINGTSGYEEAA QGLMAGIN  C+   ++ ++L R +AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GLI +  ++ +           + LE+  +K   E +   R       K      ++L+RP+ ++  +   + ++  L +   ++V+I  KY GYI+   + +   K ++N K+    DY  + +++ EAR KL  V+PL++GQASR+SG+N  D+  + +Y+E  K
  S:     8 YDVIVIGAGHAGCEAGLAAARMGSKTLMLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFSYQHELKKTIEETPNLTLFQGLVERL-IIEDGVCKGVITQAGAEYTAKTVVITTGTFLRGEIIMGDLKYSSGPNNQQPSITLSEHLEELGFDLVRFKTGTPPRVNSNTIDYSKTEIQPGDDKPRAFSFETTKFI--MDQIPCWLTYTSTETHRLIDENLHRSAMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQRAMLRTIPGLENVEMMRTGYAIEYDAIVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGLMAGINAACRSLGKKEVILGRADAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEVGREIGLIKEDRYERFTNKKLQIEQEKERLESIFIKPRPEVQELIRSIGGSELKDGIRASDLLRRPEVTYEHIHLLVPSEVALSDEITEQVEIQTKYEGYIEKSLQQVERMKKMENKKIPVDIDYDAISSLASEARQKLKDVRPLSMGQASRISGVNPADVSILLIYIEQGK 622
>gi|146297755|ref|YP_001181526.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166222920|sp|A4XN50|GIDA_CALS8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|145411331|gb|ABP68335.1| glucose inhibited division protein A [Caldicellulosiruptor saccharolyticus DSM 8903] (626 aa)
Score = 1370, Expect = 3.8e-149, Identities = 275/612 (44%), Positives = 396/612 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +YD +V+GAGHAG EAA   A+   K  +F ++   +GNMPCNPSIGG  KG + REIDALGG    AAD T +Q+++LN +KG   ++LRAQ D+  Y  +    +E    +D+   EV  I   + KV GV       F +  +++ TGTFL   I IG  V   GPD  + +  L + +K+L  + +R KTGTP R+ + S+D+SK+QI+ G      FS F+ + L+  +Q  CYL +T  + H II  NL ++ +++G I G GPRYCPSIEDKVVRF DK RHQ+F+EP  +  + +Y+ G+SSSLPEDVQ ++ ++++G EN  I + AYAIEYD INP+QL  TL+ KKIKGLF AGQINGTSGYEEAA QG++AGIN    ++ +E LVL R++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY +GLISQ  ++++ K  +   + ++ L+ + +       K + E   +   T   L E+LKRP+ S+  +      +  L    K++V+I IKY GYIK Q + I   K ++N K+    DY  +  +S EA+ KL++++P ++GQASR+SG++  D+  + ++LE  KK
  S:     7 EYDIVVVGAGHAGCEAALACARLGLKTIVFAINLDSIGNMPCNPSIGGTGKGHLVREIDALGGEMGKAADATAIQVRILNRAKGPAVYSLRAQCDRARYKLYMKRVLESQPNLDIRQGEVCDILVEDGKVTGVKLTTGAIFRAKAVVLATGTFLGGRIIIGETVYDGGPDGMHPAKYLTESLKKLGIEMMRFKTGTPARVHRRSLDFSKMQIQLGDEVITPFS-FEHETLEI-EQVPCYLTYTTEETHRIIRENLHRAPLFTGLIQGVGPRYCPSIEDKVVRFADKPRHQVFIEPMGRDTEEMYVQGMSSSLPEDVQIKMYRSVIGLENVQIMRPAYAIEYDCINPLQLEATLQFKKIKGLFSAGQINGTSGYEEAAAQGIIAGINAAMYVKGKEMLVLDRSQAYIGVLIDDLVTKGTNEPYRIMTSRAEYRLILRQDNADLRLTEIGYRIGLISQERYEKFLKKKKMIEDEIERLKKTVIAPSDKVNKFLIEHGSSPISTGVKLSELLKRPELSYEALREIDPQRPDLPRSVKEEVEIEIKYEGYIKKQLQQIEQFKKLENKKIPEWVDYNQISGLSTEAKQKLSQIRPASIGQASRISGVSPADISVLLIWLEQAKK 623
>gi|42561530|ref|NP_975981.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42561553|ref|NP_976004.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81170560|sp|Q6MRU5|GIDA_MYCMS tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|42493029|emb|CAE77623.1| Glucose inhibited division protein A [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42493052|emb|CAE77646.1| Glucose inhibited division protein A [Mycoplasma mycoides subsp. mycoides SC str. PG1] (629 aa)
Score = 1367, Expect = 8.3e-149, Identities = 277/609 (45%), Positives = 402/609 (66%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNT-------TLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           YD +V+G GHAG+EAA   A+   K AL  L +  +  MPCNPS+GGPAKGIV REIDALGG  A AAD T LQ KLLNSS+G G WALR Q DK EYSK+  N I+  + +DLI +    + +  N+ V G+Y  D     +  +I+TTGT+L S I  G    + GP++   +  +++ + +L  + +R KTGTP R+ ++S+D S   +EPGT+ K +FS     +    KQ+ CYL  +  +  +II +NL+KSAMYSG +   GPRYCPS EDK VRF +K+ HQ+F+EPE+ + DT Y+ G S+S+P +VQE ++K++ GFEN  +K +AYAIEYD I+P+QL P+LE K +K LF AGQINGTSGYEEAA QGL+AGIN   +++  +P++L+R+EAYIGV+I+DLINK + +PYRLLTSRAE+RL LRNDNA+ RL +YG E+GLIS   W++Y   ++     +KEL+        +   N +  N        + YEI+K P     ++  F+ +   L       + I I++ GY+K ++++++    ++  K+    +Y  V N++ EA+DKL K++PL +GQASR++G+N  D+  +  YL+ +
  S:     5 YDVIVVGGGHAGVEAALASARLNKKTALINLYEDKIATMPCNPSVGGPAKGIVVREIDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSDKEEYSKYMRNVIKNQKNLDLITRACTGLVYDENKTVTGIYLDDQTILNAKAVIITTGTYLKSEILKGVDRYESGPNNEKTTKGISQSLIDLGIKLMRFKTGTPARVYRDSVDLSNAVLEPGTDMKLAFSFSTSTYTPIEKQQPCYLIHSTLETKKIIEDNLEKSAMYSGTVKSIGPRYCPSFEDKAVRFREKDTHQIFIEPETLNGDTWYVQGFSTSMPIEVQEMMLKSLPGFENVRVKHWAYAIEYDCIDPMQLSPSLELKDVKNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLDPIILRRDEAYIGVMIDDLINKGVWEPYRLLTSRAEHRLLLRNDNAETRLKQYGKEIGLISDQEWNQYLIYVKEIEQAIKELKEIRFTPKSQLAINLKNKNQADLSHGYSGYEIIKIPTVDINELIEFIPSLQKLKTNQLQSIVIEIRFEGYVKKERQLVDKLVKLERKKIPLDINYSKVDNLATEAKDKLEKIRPLNIGQASRITGVNPADIQMLLFYLKKQ 621
>gi|194016647|ref|ZP_03055261.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus pumilus ATCC 7061] >gi|194012120|gb|EDW21688.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus pumilus ATCC 7061] (628 aa)
Score = 1365, Expect = 1.4e-148, Identities = 277/610 (45%), Positives = 391/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG+EAA   A++  K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK +Y       +E    + ++   V+ +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L+  + EL F  +R KTGTPPR+  +SIDYSK +I+PG +   +FS+   +++    Q  C+L +T+ + H+II+ NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ++++  I G EN  + +  YAIEYDAI P QL+PTLETKKI GL+ AGQINGTSGYEEAA QG+MAGIN   +   +E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY +GLISQ  +  Y +  E      K L +  +K   E +   R       K      +++KRP+ ++  +      +  L     ++V+I IKY GYI+   + +   K ++N K+    DY  +  I+ EA+ KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     8 YDVIVVGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQHEMKKTMENEPNLTMLQGMVDHLIVEDDECKGVVTQTGANYRAKSVVLTTGTFLKGRIILGDLSYSSGPNNQQPSIKLSDHLAELGFDLVRFKTGTPPRVNSHSIDYSKTEIQPGDDVPRAFSYETVEYI--TDQLPCWLTYTSLETHQIIDENLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQQRMLSTIPGLENVQMMRAGYAIEYDAIVPTQLWPTLETKKISGLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTELGYHIGLISQERFQAYQQKKEAIEAEKKRLYSVIIKPTAETQEFIRSLGGSELKDGIRASDLMKRPEMNYESVVTLAPAETQLPSDVCEQVEIQIKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEAKQKLKEVRPLSVAQASRISGVNPADISILLVYLEQGR 622
>gi|27469334|ref|NP_765971.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus epidermidis ATCC 12228] >gi|57865943|ref|YP_187604.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus epidermidis RP62A] >gi|38257565|sp|Q8CMN6|GIDA_STAES tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|71152074|sp|Q5HS35|GIDA_STAEQ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|27316884|gb|AAO06059.1|AE016752_92 glucose inhibited division protein A [Staphylococcus epidermidis ATCC 12228] >gi|57636601|gb|AAW53389.1| glucose inhibited division protein A [Staphylococcus epidermidis RP62A] (625 aa)
Score = 1365, Expect = 1.5e-148, Identities = 284/615 (46%), Positives = 397/615 (64%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK------NVKEFKYNSR-KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++YD +VIGAGHAG+EA    A++  K  +  ++   +  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     +E  + +D++   V+ +   + +V GV T     + S  +I+TTGTFL   I +G+     GP+    S  LA  +++L F  +R KTGTPPR+   +IDYSK +I+PG +   +FS    +F+    Q  C+L +TN   H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDAI P QL+PTLETK IK L+ AGQINGTSGYEEAA QG+MAGIN    +      +L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYELGLIS+  +  +N+  +   + ++ L    +K       + E K  SR K      ++L+RP+ ++  +   L+  + L E  +++V+I  KY GYI    + +   K ++  K+    DY  V +++ EAR+KL +VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:     2 VQEYDVVVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVLENEDNLDIMQGMVDELIIEDNEVKGVRTNIGTEYRSKAVIITTGTFLRGEIILGNLKYSSGPNHQLPSVTLADNLRKLGFDIVRFKTGTPPRVNARTIDYSKTEIQPGDDIGRAFSFETTEFI--LDQLPCWLTYTNGDTHQVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKAIKNLYTAGQINGTSGYEEAAGQGIMAGINAAGNVLGTGEKILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGLISEERYARFNEKRQQIKDEIQRLTDVRIKPNEHTQAIIEAKGGSRLKDGILAIDLLRRPEMNYETILEILEESHQLPEAVEEQVEIQTKYEGYINKSLQQVEKVKRMEAKKIPEDLDYSKVDSLASEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQGKLQ 621
>gi|188158980|ref|ZP_02511966.2| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma mycoides subsp. mycoides LC str. GM12] (629 aa)
Score = 1365, Expect = 1.6e-148, Identities = 276/609 (45%), Positives = 402/609 (66%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV-NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNT-------TLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           YD +V+G GHAG+EAA   A+   K AL  L +  +  MPCNPS+GGPAKGIV REIDALGG  A AAD T LQ KLLNSS+G G WALR Q DK EYSK+  N I+  + +DLI +    + +  N+ V G+Y  D     +  +I+TTGT+L S I  G    + GP++   +  ++K + +L  + +R KTGTP R+ ++S+D +   +EPGT+ K +FS     +    KQ+ CYL  +  +  +II +NL+KSAMYSG +   GPRYCPS EDKVVRF +K+ HQ+F+EPE+ + DT Y+ G S+S+P +VQE ++K++ GFEN  +K +AYAIEYD I+P+QL P+LE K ++ LF AGQINGTSGYEEAA QGL+AGIN   +++  +P++L+R+EAYIGV+I+DL+NK + +PYRLLTSRAE+RL LRNDNA+ RL +YG E+GLIS   W++Y   +      +KEL+        +   N +  N        + YEI+K P     ++  F+ +   L       + I I++ GY+K ++++++    ++  K+    +Y  V N++ EA+DKL K++PL +GQASR++G+N  D+  +  YL+ +
  S:     5 YDVIVVGGGHAGVEAALASARLNKKTALINLYEDKIATMPCNPSVGGPAKGIVVREIDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSDKEEYSKYMRNVIKNQKNLDLITRACTGLVYDDNKTVTGIYLDDQTILNAKAVIITTGTYLKSEILKGVDRYESGPNNEKTTKGISKSLIDLGIKLMRFKTGTPARVYRDSVDLTNAVLEPGTDMKLAFSFSTNTYTPIEKQQPCYLIHSTLETKKIIEDNLEKSAMYSGTVESIGPRYCPSFEDKVVRFKEKDTHQIFIEPETLNGDTWYVQGFSTSMPIEVQELMLKSLPGFENVRVKHWAYAIEYDCIDPMQLSPSLELKDVRNLFTAGQINGTSGYEEAAGQGLIAGINASRKIDGLDPIILRRDEAYIGVMIDDLVNKGVWEPYRLLTSRAEHRLLLRNDNAETRLKQYGREIGLISDQEWNQYLIYVNEIEQAIKELKEIRFTPKSQLAINLKNKNQADLSHGYSGYEIIKIPTVDINELIEFIPSLQKLKTNQLQSIVIEIRFEGYVKKERQLVDKLVKLERKKIPLDINYSKVDNLATEAKDKLEKIRPLNIGQASRITGVNPADIQMLLFYLKKQ 621
>gi|168493830|ref|ZP_02717973.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC3059-06] >gi|183576020|gb|EDT96548.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC3059-06] (637 aa)
Score = 1364, Expect = 2.0e-148, Identities = 285/613 (46%), Positives = 391/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD I P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++++  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMILPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQDKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|73663752|ref|YP_302533.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123641434|sp|Q49UI5|GIDA_STAS1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|72496267|dbj|BAE19588.1| glucose inhibited division protein A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (625 aa)
Score = 1363, Expect = 2.3e-148, Identities = 282/614 (45%), Positives = 398/614 (64%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN------KNLENFNNTLKELETSTLKNVKEFKYNSR-KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++YD +VIGAGHAG+EA    A++  K  +  ++   +  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     IE+   +D++   V+ +   +  + GV T     + S  +I+TTGTFL   I +G+     GP+    S  LA  ++ L F+ +R KTGTPPR+   +IDYSK +I+PG +   +FS    +++    Q  C+L +TN   H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDA+ P QL+PTLETKKIK L+ AGQINGTSGYEEAA QG+MAGIN   +++ ++ ++L R++AYIGVLI+DLI K   +PYRLLTSRAEYRL LR+DNAD RL   GYELG+IS+  +  +N      K  +   N ++      ++ + E +  SR K      E+L+RP+ ++  +   L   + L    +++V+I  KY GYI    + +   K ++  K+    DY  V +++ EAR+KL +VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:     3 QEYDVIVIGAGHAGIEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKKVIEDEANLDIMQGMVDDLIIEDDVIKGVRTNIGTEYWSEAVIITTGTFLRGEIILGNMKYSSGPNHQLPSISLADNLRGLGFEVVRFKTGTPPRVNAKTIDYSKTEIQPGDDVGRAFSFETTEYI--LDQLPCWLTYTNGDTHQVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDALVPTQLWPTLETKKIKNLYTAGQINGTSGYEEAAGQGIMAGINAAARVQGKDEVILSRSDAYIGVLIDDLITKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDLGYELGMISEERYARFNEKRAMIKAEQERLNGIRVKPNDRVQEIIEAQGGSRLKDGILALELLRRPEMTYDLILEILDESHQLPSDVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKVDSLATEAREKLAEVKPLNIAQASRISGVNPADISILLVYLEQGKIQ 621
>gi|169833429|ref|YP_001693656.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae Hungary19A-6] >gi|168995931|gb|ACA36543.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae Hungary19A-6] (637 aa)
Score = 1362, Expect = 3.3e-148, Identities = 284/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWTRFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|168487076|ref|ZP_02711584.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC1087-00] >gi|183570028|gb|EDT90556.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC1087-00] (637 aa)
Score = 1362, Expect = 3.3e-148, Identities = 284/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEELDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|148992710|ref|ZP_01822353.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP9-BS68] >gi|168489389|ref|ZP_02713588.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP195] >gi|194397114|ref|YP_002036840.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (glucose-inhibited division protein A) [Streptococcus pneumoniae G54] >gi|147928436|gb|EDK79451.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP9-BS68] >gi|183572125|gb|EDT92653.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae SP195] >gi|194356781|gb|ACF55229.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (glucose-inhibited division protein A) [Streptococcus pneumoniae G54] (637 aa)
Score = 1362, Expect = 3.6e-148, Identities = 284/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|148987862|ref|ZP_01819325.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP6-BS73] >gi|147926326|gb|EDK77399.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP6-BS73] (637 aa)
Score = 1361, Expect = 3.9e-148, Identities = 285/613 (46%), Positives = 389/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ R  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L +  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGRPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLGSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|82752289|ref|YP_418030.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus RF122] >gi|123549493|sp|Q2YZB9|GIDA_STAAB tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|82657820|emb|CAI82275.1| glucose inhibited division protein A [Staphylococcus aureus RF122] (625 aa)
Score = 1361, Expect = 4.2e-148, Identities = 280/615 (45%), Positives = 401/615 (65%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++YD +VIGAGHAG+EA    A++  K  +  ++   +  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     IE+ E + ++   V+ +   + +V GV T     + S  +I+TTGTFL   I +G+     GP+    S  L+  ++EL F  +R KTGTPPR+   +IDYSK +I+PG +   +FS    +++    Q  C+L +TN + H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDAI P QL+PTLETK IK L+ AGQINGTSGYEEAA QGLMAGIN   ++ N    +L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYELG+IS+  +  +N+  +  +  +K L    +K        +++   +  K      ++L+RP+ ++  +   L+ ++ L+   +++V+I  KY GYI    + +   K ++  K+    DY  + +++ EAR+KL++VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:     2 VQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQGMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSITLSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYI--LDQLPCWLTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDIRIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILEILEEEHQLNADVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQGKLQ 621
>gi|15925701|ref|NP_373235.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus Mu50] >gi|15928296|ref|NP_375829.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus N315] >gi|21284358|ref|NP_647446.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus MW2] >gi|49484906|ref|YP_042130.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus MRSA252] >gi|49487488|ref|YP_044709.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus MSSA476] >gi|148269142|ref|YP_001248085.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus JH9] >gi|150395224|ref|YP_001317899.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus JH1] >gi|156981026|ref|YP_001443285.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus Mu3] >gi|166200618|sp|A7X7A7|GIDA_STAA1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|189039360|sp|A6U594|GIDA_STAA2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|189039362|sp|A5IWD6|GIDA_STAA9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|54037191|sp|P64230|GIDA_STAAN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|54037192|sp|P64231|GIDA_STAAW tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|54041306|sp|P64229|GIDA_STAAM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56748944|sp|Q6G5W5|GIDA_STAAS tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56748997|sp|Q6GD93|GIDA_STAAR tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|13702668|dbj|BAB43808.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus N315] >gi|14248486|dbj|BAB58873.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus Mu50] >gi|21205802|dbj|BAB96494.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus MW2] >gi|49243035|emb|CAG41769.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245931|emb|CAG44412.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus MSSA476] >gi|147742211|gb|ABQ50509.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus JH9] >gi|149947676|gb|ABR53612.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus JH1] >gi|156723161|dbj|BAF79578.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus Mu3] (625 aa)
Score = 1361, Expect = 4.3e-148, Identities = 280/615 (45%), Positives = 401/615 (65%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++YD +VIGAGHAG+EA    A++  K  +  ++   +  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     IE+ E + ++   V+ +   + +V GV T     + S  +I+TTGTFL   I +G+     GP+    S  L+  ++EL F  +R KTGTPPR+   +IDYSK +I+PG +   +FS    +++    Q  C+L +TN + H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDAI P QL+PTLETK IK L+ AGQINGTSGYEEAA QGLMAGIN   ++ N    +L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYELG+IS+  +  +N+  +  +  +K L    +K        +++   +  K      ++L+RP+ ++  +   L+ ++ L+   +++V+I  KY GYI    + +   K ++  K+    DY  + +++ EAR+KL++VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:     2 VQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQGMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSITLSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYI--LDQLPCWLTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDIRIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILEILEEEHQLNADVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQGKLQ 621
>gi|15900062|ref|NP_344666.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae TIGR4] >gi|111656984|ref|ZP_01407792.1| hypothetical protein SpneT_02001786 [Streptococcus pneumoniae TIGR4] >gi|148983524|ref|ZP_01816843.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP3-BS71] >gi|148996544|ref|ZP_01824262.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP11-BS70] >gi|149001778|ref|ZP_01826751.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP14-BS69] >gi|168576443|ref|ZP_02722326.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae MLV-016] >gi|21263676|sp|Q97T36|GIDA_STRPN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|14971587|gb|AAK74306.1| glucose-inhibited division protein A [Streptococcus pneumoniae TIGR4] >gi|147757119|gb|EDK64158.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP11-BS70] >gi|147760236|gb|EDK67225.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP14-BS69] >gi|147923671|gb|EDK74783.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP3-BS71] >gi|183577875|gb|EDT98403.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae MLV-016] (637 aa)
Score = 1360, Expect = 5.3e-148, Identities = 284/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEVPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|149010996|ref|ZP_01832301.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP19-BS75] >gi|147764632|gb|EDK71562.1| glucose-inhibited division protein A [Streptococcus pneumoniae SP19-BS75] (637 aa)
Score = 1360, Expect = 5.9e-148, Identities = 284/613 (46%), Positives = 391/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++++  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQDKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAIDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|168492407|ref|ZP_02716550.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC0288-04] >gi|183573419|gb|EDT93947.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC0288-04] (637 aa)
Score = 1359, Expect = 7.9e-148, Identities = 283/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   + ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMRRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|168483771|ref|ZP_02708723.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC1873-00] >gi|172042816|gb|EDT50862.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae CDC1873-00] (637 aa)
Score = 1359, Expect = 7.9e-148, Identities = 284/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + KV GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDKILVEDGKVVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDAVPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEELDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|23100945|ref|NP_694412.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Oceanobacillus iheyensis HTE831] >gi|38372364|sp|Q8EKU3|GIDA_OCEIH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|22779180|dbj|BAC15446.1| glucose-inhibited division protein A [Oceanobacillus iheyensis HTE831] (629 aa)
Score = 1358, Expect = 8.8e-148, Identities = 276/607 (45%), Positives = 404/607 (66%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSR-KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+GAGHAG+E+A+  A+   K  +  L+  ++  MPCNPSIGGPAKGIV REIDALGG+     D + +QM++LN+ KG    ALRAQ DK  Y K   + +E  E + +    VN +  V   +C GV T  +  + ++ +IVTTGTF+   + +G    + GP++   S  L++ +++  F+  R KTGTPPR+  ++IDYSK +I+PG +   SFS+   +      Q  C+L +TN   H++IN+NL+ S+MYSG   GTGPRYCPSIEDK+VRFNDK RHQ+F+EPE +  + +Y+ GLS+SLPE +Q +++K++ G E A I +  YAIEYDA+ P QL+PTLETK++ GLF AGQINGTSGYEEAA QGLMAG+N   +  N+EP++L R++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GY+ GLI++  +  + +  +      K L       T  ++++ E    SR K     Y+++KRP+ S+  ++  +++   L E  K++V I IKY GYIK  ++ ++    +++ K+    DY  +  I+ EA +KL KV+PL++GQASR+SG+N  D+  + +Y+E
  S:     8 YDVIVVGAGHAGVESAYAAARMGAKTLMLTLNLDMIAFMPCNPSIGGPAKGIVVREIDALGGIMGKVIDKSYIQMRMLNTGKGPAVQALRAQADKPIYMKEMKHLMENEENLTIRQGMVNEL-IVEDGICKGVITETHAAYYADSVIVTTGTFMRGKVLMGDLEYESGPNNQRVSIKLSEDLEKHGFEITRFKTGTPPRVNSHTIDYSKTEIQPGDDNPKSFSYETTE--QITDQIPCWLTYTNEFTHQVINDNLELSSMYSGMKRGTGPRYCPSIEDKIVRFNDKPRHQIFLEPEGRDTEEVYVQGLSTSLPESIQHEMIKSVPGLEKAEIMRAGYAIEYDAVVPTQLWPTLETKRLPGLFTAGQINGTSGYEEAAGQGLMAGMNAAAKSLNKEPIILDRSQAYIGVMIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDIGYDYGLITEERYQRFTEKKQQIEQEKKRLSKIIIKPTEDIQDIMEKAGASRLKEAIKAYDLMKRPELSYDIVDQMIESNLELSEEVKEQVAIQIKYEGYIKKAKEQVDRMLKMEDKKIPEDIDYDAINGIATEAVEKLKKVRPLSVGQASRISGVNPADVSILLVYIE 619
>gi|157694474|ref|YP_001488936.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus pumilus SAFR-032] >gi|166989734|sp|A8FJF9|GIDA_BACP2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|157683232|gb|ABV64376.1| glucose-inhibited division protein A [Bacillus pumilus SAFR-032] (628 aa)
Score = 1357, Expect = 1.1e-147, Identities = 275/610 (45%), Positives = 391/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG+EAA   A++  K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK +Y       +E    + ++   V+ +   + +  GV T     + +  +++TTGTFL   I +G      GP++   S  L+  + +L F  +R KTGTPPR+  +SIDYSK +I+PG +   +FS+   +++    Q  C+L +T+ + H+II+ NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ++++  I G EN  + +  YAIEYDAI P QL+PTLETKKI GL+ AGQINGTSGYEEAA QG+MAGIN   +   +E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY +GLISQ  +  + +  E      K L +  +K   E +   R       K      +++KRP+ ++  +      +  L     ++V+I IKY GYI+   + +   K ++N K+    DY  +  I+ EA+ KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     8 YDVIVVGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQHEMKKTMENEPNLTMLQGMVDHLIVKDDECKGVVTQTGANYRAKSVVLTTGTFLKGRIILGDLSYSSGPNNQQPSIKLSDHLADLGFDLVRFKTGTPPRVNSHSIDYSKTEIQPGDDVPRAFSYETVEYI--TDQLPCWLTYTSLETHQIIDENLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQQRMLSTIPGLENVQMMRAGYAIEYDAIVPTQLWPTLETKKISGLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTELGYHIGLISQERFQAFQQKKEAIEAEKKRLYSVIIKPTAETQEFIRSLGGSELKDGIRASDLMKRPEMNYESVVRLAPAETPLPSDVCEQVEIQIKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEAKQKLKEVRPLSVAQASRISGVNPADISILLVYLEQGR 622
>gi|182683093|ref|YP_001834840.1| glucose-inhibited division protein A [Streptococcus pneumoniae CGSP14] >gi|182628427|gb|ACB89375.1| glucose-inhibited division protein A [Streptococcus pneumoniae CGSP14] (637 aa)
Score = 1357, Expect = 1.4e-147, Identities = 282/613 (46%), Positives = 390/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  + + L    ++ I   + K+ GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQDNLTLRQTMIDEILVEDGKIVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEAPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMDFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|15902168|ref|NP_357718.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae R6] >gi|116515312|ref|YP_815647.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pneumoniae D39] >gi|149005876|ref|ZP_01829605.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA(glucose-inhibited division protein A) [Streptococcus pneumoniae SP18-BS74] >gi|149017801|ref|ZP_01834260.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA(glucose-inhibited division protein A) [Streptococcus pneumoniae SP23-BS72] >gi|122279465|sp|Q04MU9|GIDA_STRP2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|73621004|sp|Q8DRH8|GIDA_STRR6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|15457663|gb|AAK98928.1| Glucose inhibited division protein A [Streptococcus pneumoniae R6] >gi|116075888|gb|ABJ53608.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA(glucose-inhibited division protein A) [Streptococcus pneumoniae D39] >gi|147762232|gb|EDK69193.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA(glucose-inhibited division protein A) [Streptococcus pneumoniae SP18-BS74] >gi|147931365|gb|EDK82343.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA(glucose-inhibited division protein A) [Streptococcus pneumoniae SP23-BS72] (637 aa)
Score = 1356, Expect = 1.5e-147, Identities = 283/613 (46%), Positives = 389/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +VIGAGHAG+EA+   ++   KV L  ++ +++  MPCNPSIGG AKGIV RE+DALGG  A   D T +QMK+LN+ KG    ALRAQ DK  YSK     +E  E + L    ++ I   + K  GV T  +Q + +  +IVTTGT L   I IG      GP+    S  LA  +KEL  +  R KTGTPPR+  +SI+Y   +I+PG      FS+  R   D+ K +V C+L +TN   HEII NNL ++ M++G + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G E+GL+    W  +      F+N +K L++  LK VK       E  +       T  E L+RP+ S+ D+  F+      LD+   + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 EEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLAFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKELYSKEMRKTVENQENLTLRQTMIDEILVEDGKAVGVRTATHQEYAAKAVIVTTGTALRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPGDEVPNHFSYTSRD-EDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTDAVTAKEFLRRPEVSYQDVVAFIGPAAEELDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|56422028|ref|YP_149346.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Geobacillus kaustophilus HTA426] >gi|81170543|sp|Q5KU58|GIDA_GEOKA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56381870|dbj|BAD77778.1| glucose-inhibited division protein [Geobacillus kaustophilus HTA426] (629 aa)
Score = 1355, Expect = 2.0e-147, Identities = 277/610 (45%), Positives = 390/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  +  L+  ++  MPCNPSIGGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     +E  E + L+  +V  +  V   VC GV T     + +  +++TTGTFL   I IG      GP++   S  L++ ++EL F+ +R KTGTPPR+   +IDYSK +I+PG  +  +FS+   K++    Q  C+L +T  + H II+ NL  S MYSG I GTGPRYCPSIEDKVVRF+DK RHQ+F+EPE +  + +Y+ GLS+SLPE +Q ++++ I G E A + +  YAIEYDAI P QL+PTLETK +K L+ AGQINGTSGYEEAA QG+MAGIN   +   RE ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY +GLIS+  + ++    E      K L+T  +K        ++E   +  K      ++L+RP+ ++  +         +     ++V+I IKY GYI+   + +   K ++N K+    DY  +  ++ EAR KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     8 YDVIVVGAGHAGCEAALASARIGAKTLVITLNLDMIAFMPCNPSIGGPAKGIVVREIDALGGEMAKNIDKTYIQMRMLNTGKGPAVRALRAQADKVLYQREMKKTLENQENLTLLQGKVERL-IVEDGVCKGVITHTGAHYYAKAVVITTGTFLRGEIIIGDIKYSSGPNNQQPSIKLSEHLEELGFELVRFKTGTPPRVNSRTIDYSKTEIQPGDKEPRAFSYETTKYI--TDQLPCWLTYTTEETHRIIDENLHLSPMYSGMIKGTGPRYCPSIEDKVVRFHDKPRHQIFLEPEGRETEEVYVQGLSTSLPEHIQRKLLETIPGLEKAQLMRAGYAIEYDAIVPTQLWPTLETKLVKNLYTAGQINGTSGYEEAAGQGIMAGINAAHRALGREEIILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTELGYRIGLISEERYQKFLAKKEAIEREKKRLQTVIIKPTPKVQEVIREAGGSELKDGIRAADLLRRPEMTYEHIRKLAPADEEIAPEVAEQVEIQIKYEGYIQKSLQEVERLKKMENKKIPEDIDYDAIQGLATEARQKLKQVRPLSIAQASRISGVNPADISILLVYLEQGR 622
>gi|71894526|ref|YP_278634.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma synoviae 53] >gi|123644047|sp|Q4A5P8|GIDA_MYCS5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|71851314|gb|AAZ43923.1| glucose inhibited division protein A [Mycoplasma synoviae 53] (609 aa)
Score = 1355, Expect = 2.0e-147, Identities = 308/611 (50%), Positives = 412/611 (67%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFN---NTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +VIGAGHAG+EAAF LAK   KVAL   D   +  MPCNPSIGGPAKGI+TREIDALGG+Q   +D   +Q+K+LN SKG    A+RAQIDK +YSK     +++N  I LI+  V  IK   +    V     +   +   ++TTGT+++S I  G  V   GPD    +  +++ +K+L F+  R KTGTP RI K+SID+SK++ E       +FS+   K L  N+Q  CYL +TN K HEII NNLDKS+MYSG I GTGPRYCPSIEDKVVRF+D+ RHQ+F EPE+     IYL GLS+S+PED+Q Q +K I G EN  I+KY YAIEYDA+N + L  +LETK IK  F AGQINGTSGYEEAA QGL+AGIN   +L+N++PLVLKR++AYIGVLI+DL+ K   +PYR+LTSRAEYRL LR+DN+D RL KYGY+LGLIS+  + +  K  +N N   N L +   ST  N+ + KYN ++  T+  ++L RP+   I+ +  LKN       +++++ I IK  GYIK Q++  +  KN++ IK+ +  +Y  V N++ EA+DKL  +KP T+ QA R+SGIN  D+  +  +L+  KK
  S:     5 FDAIVIGAGHAGVEAAFALAKSNNKVALITFDLSKITMMPCNPSIGGPAKGIITREIDALGGIQGYYSDLAMIQIKMLNDSKGPAVRAIRAQIDKEKYSKLIREDLQKNSNITLIEAGVYEIKADKKVFKSVVLSTGEEIFAKVCVLTTGTYMNSQILRGSSVTVSGPDGQKTTNKISESLKKLGFELQRFKTGTPARIYKSSIDFSKVEKEILDTNDLNFSNRSNKKL--NQQVSCYLTYTNEKTHEIILNNLDKSSMYSGLIKGTGPRYCPSIEDKVVRFSDRNRHQVFFEPETLDETIIYLNGLSTSMPEDIQMQFLKTIPGLENLKIQKYGYAIEYDALNSLDLKHSLETKVIKNFFAAGQINGTSGYEEAAAQGLIAGINAALKLKNKKPLVLKRSDAYIGVLIDDLVIKGTKEPYRMLTSRAEYRLLLRHDNSDYRLSKYGYKLGLISKDEYSQIQKKYKNINSKINYLSKKYLSTNSNIAK-KYNIKEA-TSYLKLLLRPE---INPKDILKNYK-----YQNELLIKIKLEGYIKKQKQDASRMKNLEKIKIPNNINYDKVLNLASEAKDKLKIIKPETIAQAYRISGINPSDIQMLIFHLKTYKK 606
>gi|57651105|ref|YP_187523.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus COL] >gi|151222823|ref|YP_001333645.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus str. Newman] >gi|161353516|ref|YP_501497.2| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161510920|ref|YP_001576579.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|162138569|ref|YP_495279.2| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus USA300] >gi|168727094|ref|ZP_02759371.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|172049080|sp|A6QKK1|GIDA_STAAE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|189039363|sp|A8YYS0|GIDA_STAAT tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|71152073|sp|Q5HCI4|GIDA_STAAC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|57285291|gb|AAW37385.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus COL] >gi|150375623|dbj|BAF68883.1| glucose-inhibited division protein A [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369729|gb|ABX30700.1| glucose inhibited division protein A [Staphylococcus aureus subsp. aureus USA300_TCH1516] (625 aa)
Score = 1355, Expect = 2.2e-147, Identities = 280/615 (45%), Positives = 401/615 (65%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++YD +VIGAGHAG+EA    A++  K  +  ++   +  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     IE+ E + ++   V+ +   + +V GV T     + S  +I+TTGTFL   I +G+     GP+    S  L+  ++EL F  +R KTGTPPR+   +IDYSK +I+PG +   +FS    +++    Q  C+L +TN + H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDAI P QL+PTLETK IK L+ AGQINGTSGYEEAA QGLMAGIN   ++ N    +L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYELG+IS+  +  +N+  +  +  +K L    +K        +++   +  K      ++L+RP+ ++  +   L+ ++ L+   +++V+I  KY GYI    + +   K ++  K+    DY  + +++ EAR+KL++VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:     2 VQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINLDNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQGMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSITLSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYI--LDQLPCWLTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDIRIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILELLEEEHQLNADVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQGKLQ 621
>gi|76786721|ref|YP_330690.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus agalactiae A909] >gi|77407093|ref|ZP_00784094.1| glucose inhibited division protein A [Streptococcus agalactiae H36B] >gi|123601023|sp|Q3JYG3|GIDA_STRA1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|76561778|gb|ABA44362.1| glucose-inhibited division protein A [Streptococcus agalactiae A909] >gi|77174300|gb|EAO77168.1| glucose inhibited division protein A [Streptococcus agalactiae H36B] (633 aa)
Score = 1352, Expect = 4.6e-147, Identities = 276/613 (45%), Positives = 388/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +V+GAGHAG+EA+   ++   K  L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++     +E+ E + L    ++ I   + KV GV T  NQ F +  +++TTGT L   I +G      GP++   S  LA  +++L  +  R KTGTPPR+  +SI+Y K +I+PG  +   FS   R       Q  C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +H + +Y+ GLS+SLPEDVQ  ++++I G ENA + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GL+ +  +  + K    F N L+ L+       + T K ++E  +       T  E ++RP  ++     F+   +  LD    + ++  IKY GYIK     +   K ++  ++    D+ D+ +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE ++K
  S:     7 ENYDIIVVGAGHAGVEASLAASRMGCKTLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQTMKQTVEKQENLTLRQAMIDEILVEDGKVVGVRTATNQKFSAKSVVITTGTALRGEIILGELKYSSGPNNSLASVTLADNLRDLGLEIGRFKTGTPPRVKASSINYEKTEIQPGDEQPNHFSFMSRDEDYITDQVPCWLTYTNTLSHDIINQNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRHTEEVYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGYEIGLVDEERYAIFKKRQMQFENELERLDSIKLKPVSETNKRIQELGFKPLTDALTAKEFMRRPQITYAVATDFVGCADEPLDSKVIELLETEIKYEGYIKKALDQVAKMKRMEEKRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGRQK 627
>gi|169830196|ref|YP_001700354.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (glucose-inhibited division protein A) [Lysinibacillus sphaericus C3-41] >gi|168994684|gb|ACA42224.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) [Lysinibacillus sphaericus C3-41] (630 aa)
Score = 1350, Expect = 8.0e-147, Identities = 281/610 (46%), Positives = 390/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFNNTLKEL----ETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +VIGAGHAG EAA   AK   K  +  ++  ++  MPCNPSIGGPAKGIV REIDALGG+     D T +QM++LN+ KG    ALRAQ DK+ Y +     +EE E + +    V  +   + +V GV T     + +  ++VTTGTFL   I IG      GP++   S  LA  +KEL F  +R KTGTPPR+   +IDY K +I+PG     +FS    +F+    Q  C+L +T+ + HEII  NL  S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPE VQ +++K+I G ENA + +  YAIEYD+I P QL+PTLETK+IKGL+ AGQINGTSGYEEAA QGLMAG+N    +  +E L+L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RLL+  Y++G++ Q  +D++N     +EN    L+E+      +T   ++    +  K      ++LKRP+  +  +   +       E  K++++I +KY GYI+     +     ++N K+    DY  +  ++ EAR KL +V PL++ QASR+SG+N  D+  + +Y+E  K
  S:    10 FDVIVIGAGHAGSEAAHAAAKMGAKTLMLTINLDMIAFMPCNPSIGGPAKGIVVREIDALGGVMGKVIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRILEETENLTIHQGMVEELIIEDGEVTGVITQIGAIYRAKTVVVTTGTFLRGEIIIGDIKYSSGPNNQQPSIRLADNLKELGFDLVRFKTGTPPRVNNRTIDYDKTEIQPGDEVPRAFSFETTEFI--MDQLPCWLTYTSPETHEIIEANLHLSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTREVYVQGLSTSLPEHVQTRLLKSIPGLENAEMMRAGYAIEYDSIVPTQLWPTLETKRIKGLYTAGQINGTSGYEEAAAQGLMAGMNAAANVLGKEELILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLLELAYKIGMVPQERYDKFNAKKALIENEIARLREIIIKPNEATQAVIRSAGGSELKDGIRGADLLKRPEMHYEMISSLIPADIEFTEEVKEQIEIQLKYEGYIEKALLQVEKLHKMENKKIPENIDYDAISGLATEARQKLKQVTPLSIAQASRISGVNPADISILLVYIEQGK 624
>gi|89100946|ref|ZP_01173793.1| glucose-inhibited division protein A [Bacillus sp. NRRL B-14911] >gi|89084355|gb|EAR63509.1| glucose-inhibited division protein A [Bacillus sp. NRRL B-14911] (629 aa)
Score = 1349, Expect = 1.1e-146, Identities = 280/610 (45%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK---NVKEFKYNS----RKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IE    I L+   V  +  V   VC GV T+    + +  +++TTGTFL   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  ++IDYSK +I+PG +   +FS+   K++    Q  C+L +TN   H +I++NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ++I++ I G EN  + +  YAIEYD+I P QL+PTLETKK+K L+ AGQINGTSGYEEAA QGLMAGIN       +E L+L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G+++GLIS   +  + +  +      + L +  +K    V+E   N      K      ++LKRP+ S+  ++        LD    ++V+I +KY GYI+   + +   K ++N K+    DY  +  ++ EAR KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     8 YDVIVIGAGHAGVEAGLAAGRLGAKTLMVTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGKNIDKTHIQMRMLNTGKGPAVRALRAQADKFTYQHEMKKTIENEPNITLLQGMVEKL-IVEDGVCKGVVTMTGAAYSAKTVVITTGTFLRGEIILGELKYSSGPNNQQPSIKLSEHLQELGFDMVRFKTGTPPRVNSHTIDYSKTEIQPGDDVPRAFSYETTKYI--TDQLPCWLTYTNETTHSLIDDNLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQQKILRTIPGLENVQMMRAGYAIEYDSIVPTQLWPTLETKKVKNLYTAGQINGTSGYEEAAGQGLMAGINAGLNALGKEELILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDAGHKIGLISDERYGRFTEKKQAIEAEKERLRSIIIKPSAEVQEMIKNQGGSELKDGIRASDLLKRPEMSYEHIKLAAPADADLDFDVTEQVEIQLKYEGYIEKSLQQVERLKKMENKKVPENIDYDAINGLASEARQKLKEVRPLSIAQASRISGVNPADISILLVYLEQGR 622
>gi|192809491|ref|ZP_03038166.1| glucose inhibited division protein A [Geobacillus sp. Y412MC10] >gi|192802162|gb|EDV78667.1| glucose inhibited division protein A [Geobacillus sp. Y412MC10] (628 aa)
Score = 1348, Expect = 1.2e-146, Identities = 274/613 (44%), Positives = 401/613 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR---------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           YD +V+GAGHAG EAA   A+   +  +  ++  +V  MPCNPSIGGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       +E+ E + L    V+ +  V   VC G+ T     + +  +++TTGT+L   + +G  + + GP++   S  LA  ++EL F  +R KTGTPPR+ K++ID+SK +I+PG  K   FS ++ K  D N+Q  C+L +T+   H+IIN+NL ++ M+SG I GTGPRYCPSIEDK+VRF DK +HQ+F+EPE K+    Y+ GLS+S+PEDVQ  ++++I G E   + +  YAIEYDA+ P QL+P+LETKK+ GLF AGQINGTSGYEEAA QG+MAGIN   +++ +EP++L R++ YIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+++GLIS+   + Y K +       +E+E      VK  + N+             + +  IL+RP+ +F  +E    +   LDE  K++V+I IKY GYI+ Q   +   + ++  ++     Y ++  +++EAR KLNK++P+++GQASR++G+   D+  + +YLE+  + T
  S:     8 YDVIVVGAGHAGCEAALASARMGAETLMVTINLDMVAFMPCNPSIGGPAKGHVVREIDALGGEMGRNIDKTFIQMRMLNTGKGPAVHALRAQADKFSYQHTMKETMEKEEKLTLRQGMVDQL-IVEDGVCVGIVTQTGTEYRAKAVVLTTGTYLRGKVIMGELMYESGPNNQQPSVKLAHNLRELGFDLVRFKTGTPPRVHKDTIDFSKTEIQPGDEKPKFFS-YETKSSD-NEQLPCWLTYTSVDTHKIINDNLHRAPMFSGVIEGTGPRYCPSIEDKIVRFADKPKHQIFLEPEGKNTKEYYVQGLSTSMPEDVQLAVLRSIPGMEKVEMMRNGYAIEYDAMVPTQLWPSLETKKLPGLFTAGQINGTSGYEEAAGQGIMAGINAARKVQGKEPVILDRSQGYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHDIGLISE---ERYAKFVLKKQLVEQEIERLRQTKVKPVEVNAMLEAAGSAPIVDGSNMLTILRRPEITFAMVESLSPSPYELDEEMKEQVEIQIKYAGYIEKQLGHVEKLQKMEKKRIPEDIVYDEINGLAMEARQKLNKIRPISIGQASRIAGVTPADISILLVYLEHYNRVT 624
>gi|16081153|ref|NP_391981.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus subtilis subsp. subtilis str. 168] >gi|121187|sp|P25812|GIDA_BACSU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|40026|emb|CAA44404.1| unnamed protein product [Bacillus subtilis] >gi|467385|dbj|BAA05231.1| unknown [Bacillus subtilis] >gi|2636648|emb|CAB16138.1| glucose-inhibited division protein [Bacillus subtilis subsp. subtilis str. 168] (628 aa)
Score = 1348, Expect = 1.4e-146, Identities = 273/611 (44%), Positives = 392/611 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +VIGAGHAG+EAA   A++  K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     N +E+   + L+   V  +   + +  GV T     + +  +++TTGT+L   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  ++IDYSK +I+PG +   +FS+   +++    Q  C+L +T+ + HEII++NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ++++  I G EN  + +  YAIEYDAI P QL+PTLETKKI  L+ AGQINGTSGYEEAA QG+MAGIN   +   +E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ +GLIS   +  + K         K L +  +K   E +   R       K      +++KRP+ ++  +      +  + +   ++V+I +KY GYI+   + +   K ++N K+    DY  +  I+ EAR KL  V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     7 QYDVIVIGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQHEMKNTLEKEPNLTLLQGIVERLIVEDGECRGVITQTGAHYRAKAVVMTTGTYLRGRIILGDLSYSSGPNNQQPSIKLSEHLEELGFDLVRFKTGTPPRVKSDTIDYSKTEIQPGDDVPRAFSYETVEYI--TDQLPCWLTYTSPETHEIIDSNLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQQRMLATIPGLENVQMMRAGYAIEYDAIVPTQLWPTLETKKITNLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHRIGLISDERYAAFEKKKAAIEAEKKRLHSVIIKPSPENQEYIRSLGGSELKDGVRGTDLMKRPEMNYETVTKLAPPEVPVPQDVAEQVEIQVKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEARQKLKNVRPLSVAQASRISGVNPADISILLVYLEQGR 622
>gi|138897066|ref|YP_001127519.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Geobacillus thermodenitrificans NG80-2] >gi|196249887|ref|ZP_03148583.1| glucose inhibited division protein A [Geobacillus sp. G11MC16] >gi|166222936|sp|A4ITX0|GIDA_GEOTN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|134268579|gb|ABO68774.1| Glucose inhibited division protein A [Geobacillus thermodenitrificans NG80-2] >gi|196210763|gb|EDY05526.1| glucose inhibited division protein A [Geobacillus sp. G11MC16] (629 aa)
Score = 1346, Expect = 2.1e-146, Identities = 276/610 (45%), Positives = 388/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +VIGAGHAG EAA   A+   K  +  L+  ++  MPCNPSIGGPAKGIV REIDALGG      D T +Q+++LN+ KG    ALRAQ DK+ Y +     +E  + + L+  +V  +  V   VC GV T     + +  +++TTGTFL   I IG      GP++   S  L++ ++EL F+ +R KTGTPPR+   +IDYSK +I+PG  +  +FS+   K++    Q  C+L +T  + H II+ NL  S MYSG I GTGPRYCPSIEDKVVRF+DK RHQ+F+EPE +  + +Y+ GLS+SLPE +Q ++++ I G E A + +  YAIEYDAI P QL+PTLETK +K L+ AGQINGTSGYEEAA QG+MAGIN   +   RE ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY +GLIS+  +  +    E      K L+T  +K   E +   R       K      ++L+RP+ ++  ++        +     ++V+I IKY GYI+   + +   K ++N K+    DY  +  ++ EAR KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     8 YDVIVIGAGHAGCEAALASARIGAKTLVITLNLDMIAFMPCNPSIGGPAKGIVVREIDALGGEMGKNIDKTYIQIRMLNTGKGPAVRALRAQADKVLYQREMKKTLENQKNLTLLQGKVERL-IVEDGVCKGVITQTGAHYYAKAVVITTGTFLRGEIIIGDIKYSSGPNNQQPSIKLSEHLEELGFELVRFKTGTPPRVNSRTIDYSKTEIQPGDEEPRAFSYETTKYI--TDQLPCWLTYTTEETHRIIDENLHLSPMYSGMIKGTGPRYCPSIEDKVVRFHDKPRHQIFLEPEGRETEEVYVQGLSTSLPEHIQRKLLETIPGLEKAQLMRAGYAIEYDAIVPTQLWPTLETKLVKNLYTAGQINGTSGYEEAAGQGIMAGINAAHRALGREEIILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTELGYRIGLISEERYQAFLAKKEAIEREKKRLQTVIIKPTPEVQEVIRQAGGSELKDGIRAADLLRRPEMTYEHIQKLAPADEDIAPEVAEQVEIQIKYEGYIQKSLQEVERLKKMENKKIPEDIDYDAIQGLATEARQKLKQVRPLSIAQASRISGVNPADISILLVYLEQGR 622
>gi|25012136|ref|NP_736531.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus agalactiae NEM316] >gi|77408891|ref|ZP_00785616.1| glucose inhibited division protein A [Streptococcus agalactiae COH1] >gi|77413195|ref|ZP_00789393.1| glucose inhibited division protein A [Streptococcus agalactiae 515] >gi|61224541|sp|P0A3F0|GIDA_STRA3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|61224542|sp|P0A3F1|GIDA_STRA5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|24413680|emb|CAD47760.1| Unknown [Streptococcus agalactiae NEM316] >gi|77160735|gb|EAO71848.1| glucose inhibited division protein A [Streptococcus agalactiae 515] >gi|77172482|gb|EAO75626.1| glucose inhibited division protein A [Streptococcus agalactiae COH1] (633 aa)
Score = 1343, Expect = 5.8e-146, Identities = 275/613 (44%), Positives = 388/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +V+GAGHAG+EA+   ++   K  L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++     +E+ E + L    ++ I   + KV GV T  NQ F +  +++TTGT L   I +G      GP++   S  LA  +++L  +  R KTGTPPR+  +SI+Y K +I+PG  +   FS   R       Q  C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  ++++I G ENA + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GL+ +  +  + K    F N L+ L+       + T K ++E  +       T  E ++RP  ++     F+   +  LD    + ++  IKY GYIK     +   K ++  ++    D+ D+ +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE ++K
  S:     7 ENYDIIVVGAGHAGVEASLAASRMGCKTLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQTMKQTVEKQENLTLRQAMIDEILVEDGKVVGVRTATNQKFSAKSVVITTGTALRGEIILGDLKYSSGPNNSLASVTLADNLRDLGLEIGRFKTGTPPRVKASSINYEKTEIQPGDEQPNHFSFMSRDEDYITDQVPCWLTYTNTLSHDIINQNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRYTEEVYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGYEIGLVDEERYAIFKKRQMQFENELERLDSIKLKPVSETNKRIQELGFKPLTDALTAKEFMRRPQITYAVATDFVGCADEPLDSKVIELLETEIKYEGYIKKALDQVAKMKRMEEKRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGRQK 627
>gi|160932435|ref|ZP_02079825.1| hypothetical protein CLOLEP_01270 [Clostridium leptum DSM 753] >gi|156868394|gb|EDO61766.1| hypothetical protein CLOLEP_01270 [Clostridium leptum DSM 753] (626 aa)
Score = 1342, Expect = 6.5e-146, Identities = 274/612 (44%), Positives = 394/612 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK--YNSRKTNTT-----LYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +YD +VIGAGHAG+EAA   A+   K A+F ++   VGN PCNPSIGG AKG + REIDALGG     AD   LQM++LN  KG    +LRAQID+ +YS+   +++E  E +DL   E+  I+ +        T  N  FE+  +IV TGT+L   I++G    + GPD    +  L K +KEL  +  R KTGTP R+LK+SID+S LQ +PG +    FS+   + L    + VC++++TN K  +II  N+ +S +Y G I G GPRYCPS+EDK+VRF DKERHQLF+EP  ++ + +YL G+SSSLPE+VQ Q   +I G E+ ++ + AYAIEYD ++P+Q+  TLE     GL+ AGQ NG+SGYEEAA QGL+AG+N   +++ RE +VL R  +YIG LI+DL+ K + DPYR++TSR+EYRL LR DNAD+RL   G E+GLIS S W+ + +  E     L  L+ ++L   KE      SR+T+       L E+LKRP   +  + P    +  LD    ++V++ IKY GYI+ Q+  I++ + ++  +L    DY+++  IS EA++KLN+V+P  +GQASR+SG++  D+  + ++L    K
  S:     7 QYDVVVIGAGHAGIEAALAAARLGCKTAVFTINMDAVGNCPCNPSIGGTAKGHLVREIDALGGEMGKTADQCLLQMRMLNRGKGPAVHSLRAQIDRRKYSEVMKHKLELQENLDLRQGEITEIRRLGDDRWQAVTRMNAVFEAKAVIVATGTYLGGRIYVGEVSYESGPDGTFPAAFLGKSLKELGLRLRRFKTGTPARVLKSSIDFSGLQEQPGEDPVIPFSYDTAEPL--KNKAVCHISWTNEKTKQIILENIHRSPLYGGKIEGVGPRYCPSLEDKIVRFADKERHQLFIEPCGENTEEMYLQGMSSSLPEEVQLQFYHSIKGLEHCLVMRCAYAIEYDCVDPLQMAATLEFMDYPGLYGAGQFNGSSGYEEAAAQGLVAGMNAALKIKGREQVVLDRASSYIGTLIDDLVTKGVEDPYRMMTSRSEYRLVLRQDNADERLTPLGREIGLISDSRWNRFVEKQELKRKELNRLKKTSLPPTKELNEILVSRETSPVETGIRLLELLKRPQVDYACLAPVDTTRPDLDPNIFEQVEVEIKYEGYIRRQKSQIDEMRRLEGKRLPKELDYQEIHGISSEAQEKLNRVRPGNIGQASRISGVSPADISVLLIWLSQNGK 623
>gi|154688206|ref|YP_001423367.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bacillus amyloliquefaciens FZB42] >gi|166222906|sp|A7ZAW0|GIDA_BACA2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|154354057|gb|ABS76136.1| GidA [Bacillus amyloliquefaciens FZB42] (628 aa)
Score = 1342, Expect = 6.5e-146, Identities = 272/611 (44%), Positives = 394/611 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +VIGAGHAG+EAA   A++  K  +  ++  +V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK +Y     + +E+   + L+      +   + +  GV T     +++  +++TTGT+L   I +G      GP++   S  L++ ++EL F  +R KTGTPPR+  +SIDYSK +I+PG     +FS+   +++    Q  C+L +T+ + HEII++NL +S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPEDVQ++++  I G E   + +  YAIEYDAI P QL+PTLETKKI  L+ AGQINGTSGYEEAA QG+MAGIN   +   +E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+++GLIS   ++ + K         K L +  +K   E +   R       K      +++KRP+ ++  +       + + +   ++V+I +KY GYI+   + +   K ++N K+    DY  +  I+ EAR KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     7 QYDVIVIGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQHEMKHTLEKTPNLTLLQGIAERLIIEDGECRGVITQTGAEYKAKTVVLTTGTYLRGRIILGDLSYSSGPNNQQPSIKLSEHLEELGFDLVRFKTGTPPRVSSDSIDYSKTEIQPGDPVPRAFSYETVEYI--TDQLPCWLTYTSPETHEIIDSNLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTQEVYVQGLSTSLPEDVQQRMLATIPGLEKVQMMRAGYAIEYDAIVPTQLWPTLETKKIPNLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHDIGLISDERYEAFEKKKAAIEAEKKRLWSVIIKPSPENQEYIRSLGGSELKDGVRGTDLMKRPEMNYETVTKLAPADSPVPQDVAEQVEIQVKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEARQKLKEVRPLSVAQASRISGVNPADISILLVYLEQGR 622
>gi|146319817|ref|YP_001199529.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus suis 05ZYH33] >gi|146322008|ref|YP_001201719.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus suis 98HAH33] >gi|166200624|sp|A4W4N0|GIDA_STRS2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166200626|sp|A4VYE0|GIDA_STRSY tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|145690623|gb|ABP91129.1| NAD/FAD-utilizing enzyme apparently involved in cell division [Streptococcus suis 05ZYH33] >gi|145692814|gb|ABP93319.1| NAD/FAD-utilizing enzyme apparently involved in cell division [Streptococcus suis 98HAH33] (638 aa)
Score = 1340, Expect = 1.0e-145, Identities = 279/613 (45%), Positives = 381/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA    ++   K  L  ++  +V  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN  KG    ALRAQ DK EY+      +E  E + L    ++ I   + KV GV T  NQ F +  ++VTTGT L   I IG      GP++   S  LA  +KEL  +  R KTGTPPR+   +I+Y   +I+PG  K   FS   +       Q  C+L +TN   HEIIN+NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ D IY+ GLS+SLPEDVQ+ ++ +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +  +   F+N +K LE+  LK +KE         +       T  E ++RPD ++ D   F+      LD    + ++  +KY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE + +
  S:     7 ENYDVIVIGAGHAGVEAGLAASRMGCKTLLATINLDMVAFMPCNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNMGKGPAVRALRAQADKAEYASEMKRTVERQENLTLRQTMIDEILVEDGKVIGVRTATNQKFSAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASITLADNLKELGLEIGRFKTGTPPRVNARTINYEDTEIQPGDEKPNHFSFLSKDEDYLLDQIPCWLTYTNATSHEIINSNLHRAPMFSGIVKGIGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTDEIYVQGLSTSLPEDVQQDLIHSIKGLENAQMMRTGYAIEYDMVMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKVQGKPELILKRSDGYIGVMIDDLVTKGTVEPYRLLTSRAEYRLILRHDNADMRLTEIGRQVGLVDDERWQVFQIHKNQFDNEMKRLESIKLKPIKETNEKVVAMGFKPLTDALTAKEFMRRPDVTYADAVAFIGPAAEDLDAKTIELIETEVKYEGYIAKALDQVEKMKRMEEKRIPADIDWDDIDSIATEARQKFKLISPETIGQASRISGVNPADISILMVYLEGRSR 627
>gi|76798866|ref|ZP_00781075.1| glucose-inhibited division protein A [Streptococcus agalactiae 18RS21] >gi|76585789|gb|EAO62338.1| glucose-inhibited division protein A [Streptococcus agalactiae 18RS21] (633 aa)
Score = 1339, Expect = 1.5e-145, Identities = 274/613 (44%), Positives = 388/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +V+GAGH+G+EA+   ++   K  L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++     +E+ E + L    ++ I   + KV GV T  NQ F +  +++TTGT L   I +G      GP++   S  LA  +++L  +  R KTGTPPR+  +SI+Y K +I+PG  +   FS   R       Q  C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  ++++I G ENA + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GL+ +  +  + K    F N L+ L+       + T K ++E  +       T  E ++RP  ++     F+   +  LD    + ++  IKY GYIK     +   K ++  ++    D+ D+ +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE ++K
  S:     7 ENYDIIVVGAGHSGVEASLAASRMGCKTLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQTMKQTVEKQENLTLRQAMIDEILVEDGKVVGVRTATNQKFSAKSVVITTGTALRGEIILGDLKYSSGPNNSLASVTLADNLRDLGLEIGRFKTGTPPRVKASSINYEKTEIQPGDEQPNHFSFMSRDEDYITDQVPCWLTYTNTLSHDIINQNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRYTEEVYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGYEIGLVDEERYAIFKKRQMQFENELERLDSIKLKPVSETNKRIQELGFKPLTDALTAKEFMRRPQITYAVATDFVGCADEPLDSKVIELLETEIKYEGYIKKALDQVAKMKRMEEKRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGRQK 627
>gi|148377441|ref|YP_001256317.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma agalactiae PG2] >gi|148291487|emb|CAL58872.1| Glucose inhibited division protein A [Mycoplasma agalactiae PG2] (613 aa)
Score = 1337, Expect = 2.3e-145, Identities = 283/614 (46%), Positives = 398/614 (64%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENF---NNTLKELETSTLKNVKEFKYNSRKTN-TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           KKYD +VIG GHAGLEAAF ++ K     L   + K +G MPCNPSIGGPAKGI+TREIDALGGMQ + AD   +Q+K+LN SKG    ALRAQIDK +YS+     + +   ++L++     +    N    GV   +    E+   ++TTGT+++S I  G  +   GPD+   +  L+  + +L F   RLKTGTPPRI  +SI++ +++ E  ++   SFS   R  L   KQ  CYL +T  + H II  N+ +S MYSG I G GPRYCPS+EDK+V+F DKERHQ+F EPE+      ++ GLS+S+P DVQE ++K+I G  NA ++K+AYAIEYDA++P+QL  +LETK +  LF AGQINGTSGYEEAA QGL+AGIN   +LE+++P+V+ RN  YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDNAD RL +Y Y  G+IS+   +EY K L+ +   ++ ++ L T+ L    +       TN +TL  ++ RPD   +D    + N   L+E     +   ++  GYI+ Q+   N    ++N+K+    +Y DV NI++EAR K  K++P T+GQASR+SGIN  D+  +  +LE++ K+
  S:     3 KKYDAIVIGGGHAGLEAAFAISHKGRNTLLLTFNSKKLGMMPCNPSIGGPAKGIITREIDALGGMQGLWADLATIQLKMLNLSKGPAVRALRAQIDKEKYSQLAYEYVLKQPNLELLEGVAEEVIVDENGYFKGVLVENIGLIEAKVCVITTGTYMNSRILRGQDITTSGPDNEKTTPKLSASLAKLGFTLQRLKTGTPPRIYSDSINFDEVEQEVLSDVNISFS--SRSNLKKPKQIACYLTYTTPETHRIIEENIHRSPMYSGVIEGIGPRYCPSVEDKIVKFPDKERHQIFFEPETADGAITHVNGLSTSMPIDVQELMIKSIPGLRNAKVQKWAYAIEYDALDPLQLKESLETKLVHNLFTAGQINGTSGYEEAAAQGLIAGINAALKLEDKDPIVILRNHGYIGVLIDDLVTKGTKEPYRMLTSRAEYRLLLRNDNADDRLSEYAYNSGMISK---EEYQKVLDKYKLIDDEIQRLNTTYLSGKSDVALKYNITNGSTLLNVISRPD---VDPSDIIPNFPYLEE-----ITTMVRLHGYIEKQKSDANKAVRLENLKIPEDLNYLDVKNIAIEARQKFEKIRPATIGQASRISGINPADIQMLMFHLESRNKK 608
>gi|81097430|ref|ZP_00875713.1| Glucose-inhibited division protein A subfamily [Streptococcus suis 89/1591] >gi|80976517|gb|EAP40117.1| Glucose-inhibited division protein A subfamily [Streptococcus suis 89/1591] (638 aa)
Score = 1336, Expect = 3.0e-145, Identities = 278/613 (45%), Positives = 381/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA    ++   K  L  ++  +V  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN  KG    ALRAQ DK EY+      +E  E + L    ++ I   + KV GV T  NQ F +  ++VTTGT L   I IG      GP++   S  LA  +KEL  +  R KTGTPPR+   +I+Y + +I+P   K   FS   +       Q  C+L +TN   HEIIN+NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ D IY+ GLS+SLPEDVQ+ ++ +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +  +   F+N +K LE+  LK +KE         +       T  E ++RPD ++ D   F+      LD    + ++  +KY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K   + P T+GQASR+SG+N  D+  + +YLE + +
  S:     7 ENYDVIVIGAGHAGVEAGLAASRMGCKTLLATINLDMVAFMPCNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNMGKGPAVRALRAQADKAEYAAEMKRTVERQENLTLRQTMIDEILVEDGKVIGVRTATNQKFSAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASITLADNLKELGLEIGRFKTGTPPRVNARTINYEETEIQPDDEKPNHFSFLSKDEDYLQDQIPCWLTYTNATSHEIINSNLHRAPMFSGIVKGIGPRYCPSIEDKIVRFADKERHQLFLEPEGRNTDEIYVQGLSTSLPEDVQQDLIHSIKGLENAQMMRTGYAIEYDMVMPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKVQGKPELILKRSDGYIGVMIDDLVTKGTVEPYRLLTSRAEYRLILRHDNADMRLTEIGRQVGLVDDERWQVFQIHKNQFDNEMKRLESIKLKPIKETNEKVVAMGFKPLTDALTAKEFMRRPDVTYADAVAFIGPAAEDLDAKTIELIETEVKYEGYIAKALDQVEKMKRMEEKRIPADIDWDDIDSIATEARQKFKLISPETIGQASRISGVNPADISILMVYLEGRSR 627
>gi|125624808|ref|YP_001033291.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactococcus lactis subsp. cremoris MG1363] >gi|146345425|sp|O32806|GIDA_LACLM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|124493616|emb|CAL98603.1| glucose inhibited division protein A [Lactococcus lactis subsp. cremoris MG1363] (625 aa)
Score = 1333, Expect = 6.9e-145, Identities = 276/611 (45%), Positives = 385/611 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVN--QKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           + YD +VIG GHAG+EA+   A+   K  L  ++  +V  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK EY+    N + + E + L    V  +   +  QKV GV T     + +  +I+TTGT L   I IG      GP++   S  LA  ++E+ F+  R KTGTPPR+L +SIDY K +I+PG      +SF   D  +L    Q  C+L +T    H I+ +NL ++ ++SG + G GPRYCPSIEDK+ RF DK RHQLF+EPE ++ + +Y+GGLS+S+PEDVQ  +VK+I G ENA + +  YAIEYD + P QL PTLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +   +LKR+EAYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD+RL + G ++GL+S + W+ Y   +  F+  +K L +  LK        + +  +   K   T  E LKRP+ ++ ++  F+ +    +D    + ++  I Y GYIK     ++    ++  ++    D+  + +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE K
  S:     5 ENYDVIVIGGGHAGVEASLAAARMGSKTLLMTINLNMVAFMPCNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNTGKGPAVRALRAQADKDEYAASMKNTVSDQENLTLRQGMVEELILDDEKQKVIGVRTSTGTQYGAKAVIITTGTALRGEIIIGELKYSSGPNNSLSSIGLADNLREIGFEIGRFKTGTPPRVLASSIDYDKTEIQPGDEAPNHFSFMSSDEDYL--KDQIPCWLTYTTENSHTILRDNLHRAPLFSGIVKGVGPRYCPSIEDKITRFADKPRHQLFLEPEGRNTEEVYIGGLSTSMPEDVQFDLVKSIPGLENAKMMRPGYAIEYDVVMPHQLRPTLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKIQGKPEFILKRSEAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADRRLTEIGRQVGLVSDAQWEHYQAKMAQFDREMKRLNSEKLKPLPDTQEKLGKLGFGPIKDALTGAEFLKRPEVNYDEVIDFIGQAPEVIDRTVIELIETEITYEGYIKKAMDQVDKMHRLEAKRIPKNMDWDKLDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGK 625
>gi|126651989|ref|ZP_01724181.1| glucose-inhibited division protein A [Bacillus sp. B14905] >gi|126591258|gb|EAZ85367.1| glucose-inhibited division protein A [Bacillus sp. B14905] (630 aa)
Score = 1333, Expect = 7.3e-145, Identities = 276/610 (45%), Positives = 386/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +VIGAGHAG EAA   AK      +  ++  ++  MPCNPSIGGPAKGIV REIDALGG+     D T +QM++LN+ KG    ALRAQ DK+ Y +     +EE E + +    V  +   + +V GV T     + +  ++VTTGTFL   I IG      GP++   S  LA  +KEL F  +R KTGTPPR+   +IDY K +I+PG     +FS    +F+    Q  C+L +T+ + HEII  NL  S MYSG I GTGPRYCPSIEDKVVRFNDK RHQ+F+EPE ++   +Y+ GLS+SLPE VQ +++K+I G ENA + +  YAIEYD+I P QL+PTLETK+IKGL+ AGQINGTSGYEEAA QGLMAG+N    +  +E L+L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RLL+  Y++G++ Q  ++++ +     +N +  L    +K        ++    +  K      ++LKRP+  +  +   +       E  K++++I +KY GYI+     +     ++N K+    DY  +  ++ EAR KL +V PL++ QASR+SG+N  D+  + +Y+E  K
  S:    10 FDVIVIGAGHAGSEAAHAAAKMGANTLMLTINLDMIAFMPCNPSIGGPAKGIVVREIDALGGVMGKVIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRILEETENLTIHQGMVEELIIEDGEVTGVITQIGAIYRAKTVVVTTGTFLRGEIIIGDIKYSSGPNNQQPSIRLADNLKELGFDLVRFKTGTPPRVNNRTIDYDKTEIQPGDEVPRAFSFETTEFI--MDQLPCWLTYTSPETHEIIEANLHLSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPEGRNTREVYVQGLSTSLPEHVQTRLLKSIPGLENAEMMRAGYAIEYDSIVPTQLWPTLETKRIKGLYTAGQINGTSGYEEAAAQGLMAGMNAAANVLGKEELILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLLELAYKIGMVPQERYEKFVEKKALIDNEIARLREIIIKPNEATQVVIRSAGGSELKDGIRGADLLKRPEMHYEMISSLIPADIEFTEEIKEQIEIQLKYEGYIEKALLQVEKLHKMENKKIPENIDYDAISGLATEARQKLKQVTPLSIAQASRISGVNPADISILLVYIEQGK 624
>gi|78043339|ref|YP_358879.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Carboxydothermus hydrogenoformans Z-2901] >gi|123577254|sp|Q3AG55|GIDA_CARHZ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|77995454|gb|ABB14353.1| glucose inhibited division protein A [Carboxydothermus hydrogenoformans Z-2901] (631 aa)
Score = 1332, Expect = 9.1e-145, Identities = 283/612 (46%), Positives = 390/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE----TSTLKNV---KEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +V+GAGHAG+EAA   A+   K  L  L    V  MPCNP++GGPAKG+V RE+DALGG   I  D T +Q+++LN+ KG     LRAQ DK  Y +     IE  E + L   E   I    +KV GV T     F S  ++VT+GT+L+S I IG      GP  F  + LL+K + +L F+  R KTGTP R+ K ++D+SK+  +PG ++   FS+        N    C+L +TN + H II  NL +S +YSG I G GPRYCPSIEDKVVRF+DK RHQ+F+EPE      +Y+ G+S+SLPED+Q ++++ + G E   I + AYAIEYD I+P QL  TLE K I+GLFFAGQINGTSGYEEAA QG++AGIN    ++ +EP +LKR+EAYIGV+I+DL+ K +TDPYRLLTSRAEYRL LR+DNAD RL + GY++GL+++  W ++N+ +E  N  ++ LE    T T +N+   +E+  +  K   +  E L+RP+ +   +E          +  K++V+I +KY GYI+ Q K I      +  KL    DY  V  +S EA  KLN +KP  +GQASRVSG+   D+  + +YLE++K +
  S:     8 YDVIVVGAGHAGVEAALASARMGLKTLLLTLSLDNVALMPCNPAVGGPAKGVVVREVDALGGEMGINTDKTYIQIRMLNTGKGPAVRTLRAQADKRRYQEEMKKTIERQENLYLKQAETIKILVEGEKVRGVLTRTGAVFTSRAVVVTSGTYLNSRIIIGDVHYPSGPAGFPYASLLSKSLADLGFKLGRFKTGTPARVDKRTVDFSKMIEQPGDDRPLYFSYMSEGIKRPNVS--CWLTYTNLETHTIILENLHRSPLYSGEIKGVGPRYCPSIEDKVVRFSDKPRHQVFLEPEGLDTYEMYVQGMSTSLPEDLQIKMLRTLPGLERVEIMRPAYAIEYDYIDPTQLKLTLEAKHIQGLFFAGQINGTSGYEEAAGQGIVAGINAALYVKEKEPFILKRSEAYIGVMIDDLVTKGVTDPYRLLTSRAEYRLLLRHDNADLRLTEKGYKIGLVTEERWRKFNERVEKINKLMEFLEENQVTPTKRNLEIMEEYGTSPPKHGISGKEFLRRPEINMEAIEKIFAIDGQFPDDVKEQVEILVKYEGYIEKQLKEIERFNKYEGKKLPPDFDYSKVKGLSAEAVQKLNAIKPENIGQASRVSGVTPADISVLLIYLESRKSE 624
>gi|89210808|ref|ZP_01189192.1| Glucose-inhibited division protein A subfamily [Halothermothrix orenii H 168] >gi|89159549|gb|EAR79213.1| Glucose-inhibited division protein A subfamily [Halothermothrix orenii H 168] (656 aa)
Score = 1332, Expect = 9.9e-145, Identities = 279/614 (45%), Positives = 397/614 (64%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNT-------TLYEILKRPDYSFIDMEPFLKNKNTLDEYWKD---KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           K+YD +VIGAGHAG EA+   A+  +KV    +D   V  MPCNPS+GGP K  + REIDALGG  A   D T +Q+++LN+SKG     LR Q DK +Y       +E    +DL  +    +   + ++ GV T     + +  +IVTTGTFL   I IG      GP+    +  L++ +K+  F+  R KTGTPPR+ KNS+D+SK++ + G +K  +FS     F    +Q  C+L +T ++ H II  N  ++ ++SG I G GPRYCPSIEDKVVRF  K+RHQ+F+EPE +  D  Y+ GLSSSLPEDVQ  +V++I G E A I + AYAIEYD I+P QL  TLE K IKGL+ AGQINGTSGYEEAA QGL+AGIN    L+ ++PL+LKR+EAYIGVLI++L+ K   +PYR++TSRAEYRL LR DNADQRL   GYE+GLIS+  + ++ K ++     L+ L ++ +    E +   ++ N+       TL ++L+RP   + D++ F+ +   L EY  D   +V I +KY GYI  Q   I   K +++  +    DY+++ N+ LEAR+KL+K+KP +LGQASR+SG++  D+  + +YLE ++++
  S:    34 KEYDVIVIGAGHAGSEASLAPARMGFKVLTMTVDLDHVAFMPCNPSLGGPGKSHIVREIDALGGEMARNMDETMIQIRMLNTSKGPAVRGLRGQADKKQYHLRMKRVLEREPNVDLKQEIAEKLVIEDGEIKGVITKTGILYRAKKVIVTTGTFLKGKIIIGEATFNAGPNQQYPANKLSESLKKAGFKLRRFKTGTPPRVNKNSLDFSKMKEQTG-DKGLTFSFVSPPFT--REQVSCWLTYTTDETHRIIQENKHRTPLFSGDIEGVGPRYCPSIEDKVVRFPHKDRHQIFLEPEGEFTDEYYVAGLSSSLPEDVQIDLVRSIPGMEKAEIMRPAYAIEYDCIDPTQLKLTLEAKHIKGLYMAGQINGTSGYEEAAGQGLIAGINASLSLQGKDPLILKRSEAYIGVLIDELVTKGTNEPYRIMTSRAEYRLILRQDNADQRLTPKGYEIGLISEERYKKFRKKVDKIEEALEFLRSNQISPTPEVRERLKELNSGDLSKPVTLEQLLRRPQLEYRDLKYFVDD---LPEYPDDIIEQVSIQVKYKGYIDRQMSQIEQFKKMEDKLIPDDIDYQELENLRLEAREKLDKIKPRSLGQASRISGVSPADISVLMVYLEQRQRR 651
>gi|116512725|ref|YP_811632.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactococcus lactis subsp. cremoris SK11] >gi|123125358|sp|Q02X03|GIDA_LACLS tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|116108379|gb|ABJ73519.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Lactococcus lactis subsp. cremoris SK11] (625 aa)
Score = 1331, Expect = 1.3e-144, Identities = 276/611 (45%), Positives = 383/611 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVN--QKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           + YD +VIG GHAG+EA+   A+   K  L  ++  +V  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK EY+    N + + E + L    V  +   +  QKV GV T     + +  +I+TTGT L   I IG      GP++   S  LA  + E+ F+  R KTGTPPR+L +SIDY K +I+PG      +SF   D  +L    Q  C+L +T    H I+ +NL ++ ++SG + G GPRYCPSIEDK+ RF DK RHQLF+EPE ++ + +Y+GGLS+S+PEDVQ  +VK+I G ENA + +  YAIEYD + P QL PTLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +   +LKR+EAYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD+RL + G ++GL+S + W+ Y   +  F+  +K L +  LK        + +  +   K   T  E LKRP+  + ++  F+ +    +D    + ++  I Y GYIK     ++    ++  ++    D+  + +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE K
  S:     5 ENYDVIVIGGGHAGVEASLAAARMGSKTLLMTINLNMVAFMPCNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNTGKGPAVRALRAQADKDEYAASMKNTVSDQENLTLRQGMVEELILDDEKQKVIGVRTSTGTQYGAKAVIITTGTALRGEIIIGELKYSSGPNNSLSSIGLADNLHEIGFEIGRFKTGTPPRVLASSIDYDKTEIQPGDEAPNHFSFMSSDEDYL--KDQIPCWLTYTTENSHTILRDNLHRAPLFSGIVKGVGPRYCPSIEDKITRFADKPRHQLFLEPEGRNTEEVYIGGLSTSMPEDVQFDLVKSIPGLENAKMMRPGYAIEYDVVMPHQLRPTLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKIQGKPEFILKRSEAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADRRLTEIGRQVGLVSDAQWEHYQAKMAQFDREMKRLNSEKLKPLPDTQEKLGKLGFGPIKDALTGAEFLKRPEVHYDEVIDFIGQAPEVIDRTVIELIETEITYEGYIKKAMDQVDKMHRLEAKRIPKNMDWDKLDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGK 625
>gi|40557589|gb|AAR88089.1| glucose inhibited division protein A [Sweet potato little leaf phytoplasma] (620 aa)
Score = 1331, Expect = 1.3e-144, Identities = 287/590 (48%), Positives = 393/590 (66%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC--GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKE------LETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQ 590
           MK Y  +V+G GHAG+EAA  LAK+ +K  L   + + + + PCNPSIGGPAKG+V REIDALGG+   AAD  Q+QMK+LN+SKG    +LRAQIDK++Y  + L  +++   + L++  V  +      +C  GV   + +   S+ +I+TTGT+L S I IG +VI  GP+    +Y ++KQ+ +   + IRLKTGTPPR+ K++IDY++   + G     +FS       +   Q++C+L  TN   H++I  NL KSAMYSG++  +GP YCPSIEDK+VRF DK RHQLF+EPES   D +YL GLS S+P +VQE+I+K I  F  A I KYAYAIEYDA NP QL+ TLE+KKIK LF AGQINGTSGYEEAACQGL+AGIN   +L+N+ P +LKRNEAYIGVLI+DLINK   +PYRLLTSRAE+RL LR+DNAD RL+ YG++ GLI    +D + KN +   N LKE      L+  +L    +F  NS     +LY++LKR D     +  F  ++ ++D    ++V I IKY  YI   +K +    +++   + +  DYK + N+S EA++KL K+KP  + Q
  S:    30 MKYYQSIVVGGGHAGVEAALALAKQSHKTLLITGNLQQIASYPCNPSIGGPAKGVVVREIDALGGIMGKAADICQIQMKMLNTSKGPAVRSLRAQIDKIKYPMFILETLKKTLNLTLMEALVEHLIIPENDLCVKGVKLTNGEVIYSDIVILTTGTYLTSKILIGSQVINSGPNKAPTTYNISKQLIKFGMEVIRLKTGTPPRVHKDTIDYTQTVEQSGDKVLQTFSS-PPVIDNLGVQKLCFLTHTNENTHQLIRQNLHKSAMYSGYVCSSGPPYCPSIEDKIVRFYDKNRHQLFIEPESLLSDEMYLQGLSMSMPSEVQEKILKTIPAFSKAKIIKYAYAIEYDAFNPNQLFHTLESKKIKNLFLAGQINGTSGYEEAACQGLIAGINAALKLQNKSPFILKRNEAYIGVLIDDLINKGTYEPYRLLTSRAEFRLLLRHDNADLRLMPYGFKFGLIDHKTFD-WLKNKQMQINYLKEKLHNFYLDADSL---YKFNINSDSRRISLYQLLKRSDLKEDILNNFFASQYSVDVL--EQVGIQIKYEDYILKSEKEVKKNSHLEEKVIPNNIDYKIIKNLSQEAKEKLXKIKPFNIAQ 620
>gi|153811976|ref|ZP_01964644.1| hypothetical protein RUMOBE_02369 [Ruminococcus obeum ATCC 29174] >gi|149831875|gb|EDM86961.1| hypothetical protein RUMOBE_02369 [Ruminococcus obeum ATCC 29174] (631 aa)
Score = 1328, Expect = 2.6e-144, Identities = 275/615 (44%), Positives = 389/615 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           K  D +V+GAGHAG EA+   A+      +F +    +  MPCNP++GG +KG + +E+DALGG      D T +Q K+LNSSKG    +LRAQ DK  YS      +E  E + +   EV  +     K+ GV       +    +++ TGT+L +    G      GP+    +  L   +KEL  +  R KTGTP RI  N+I+YSK++ + G  +   FS          +Q+ C+L +TN K HEII NNLD+S +YSG I GTGPRYCPSIEDKVVRF DK+RHQ+F+EPE  + + +Y+GG+SSSLPEDVQ+++  ++ G E+A I K AYAIEYD INP QLYPTLE KKIKGLF  GQ NG+SGYEEAA QGL+AGIN   +++ RE LVL R+EAYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNAD RL K GY++GLI +  +    +  E     ++  E +T+       K ++E      K+ TT+ E+++RP+ ++ D+ P  K +  L    K +V+I +KY GYIK Q K +   K ++  K+    DY+ V ++ +EAR KL + +P+++GQASR+SG++  D+  + +YLE  ++ +
  S:     8 KTCDIVVVGAGHAGCEASLACARLGLDTVMFTVSVDSIALMPCNPNVGGSSKGHLVKELDALGGEMGKNIDKTFIQSKMLNSSKGPAVHSLRAQADKQAYSTEMRKTLENQENLTIKQGEVTKLLVEEGKITGVQLYSGAVYHCQAVVLCTGTYLKARCIYGDVSNYTGPNGLQAANYLTDSLKELGIEMFRFKTGTPARIAGNTINYSKMEEQFGDERVVPFSFSTDPESVQIQQKSCWLTYTNEKTHEIIRNNLDRSPLYSGMIEGTGPRYCPSIEDKVVRFADKKRHQVFIEPEGLYTNEMYIGGMSSSLPEDVQDEMYHSVPGLEHAKIVKNAYAIEYDCINPRQLYPTLEFKKIKGLFSGGQFNGSSGYEEAAAQGLIAGINAAMEVKGREQLVLDRSEAYIGVLIDDLVTKENHEPYRMMTSRAEYRLLLRQDNADLRLRKKGYQVGLIDEETYQAVLRKEEAIQKEIERTEHATIGGTPEVQKLLEEKGSTLLKSGTTIAELIRRPELNYEDLAPIDKERPELPWDVKQQVEINLKYEGYIKRQLKQVEQFKKLEAKKIPEDLDYEKVGSLRIEARQKLEEYRPISIGQASRISGVSPADISVLLVYLEQYRRNS 629
>gi|171325317|ref|ZP_02913823.1| glucose inhibited division protein A [Geobacillus sp. WCH70] >gi|171088741|gb|EDT35086.1| glucose inhibited division protein A [Geobacillus sp. WCH70] (629 aa)
Score = 1327, Expect = 3.6e-144, Identities = 275/610 (45%), Positives = 392/610 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  +  L+  ++  MPCNPSIGGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     +E  E + L+  +V  +  V   VC GV T     + +  +++TTGTFL   I IG      GP++   S  L++ ++EL F+ +R KTGTPPR+   +IDYSK +I+PG +   +FS+   +++    Q  C+L +T  + H II+ NL  S MYSG I GTGPRYCPSIEDK+VRF+DK RHQ+F+EPE +  + +Y+ GLS+SLPE +Q Q++  I G E A + +  YAIEYDAI P QL+PTLETK +K L+ AGQINGTSGYEEAA QG++AGIN   +   +E ++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GY++GLIS+  + ++    E      K L++  +K  KE +   R       K      ++L+RP+ ++  ++     +  +     ++V+I IKY GYI+   + +   K ++N K+    DY  +  ++ EAR KL +V+PL++ QASR+SG+N  D+  + +YLE  +
  S:     8 YDVIVVGAGHAGCEAALAAARIGAKTLVITLNLDMIAFMPCNPSIGGPAKGIVVREIDALGGEMAKNIDKTYIQMRMLNTGKGPAVRALRAQADKVLYQREMKKTLENQENLTLLQGKVERL-IVEDGVCKGVVTQTGAHYYAKTVVITTGTFLRGEIIIGDIKYSSGPNNQQPSIKLSEHLEELGFELVRFKTGTPPRVNSRTIDYSKTEIQPGDDVPRAFSYETTEYI--TDQLPCWLTYTTPETHRIIDENLHLSPMYSGMIKGTGPRYCPSIEDKIVRFHDKPRHQIFLEPEGRETEEVYVQGLSTSLPEHIQRQLLTTIPGLEKAQLMRAGYAIEYDAIVPTQLWPTLETKLVKNLYTAGQINGTSGYEEAAGQGIIAGINAAHRAFGKEEIILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTELGYKIGLISEERYQKFLAKKEAIEREKKRLKSYIIKPTKEVQDVIRQAGGSELKDGIRAADLLRRPEMTYEHIKQLAPAEEEISPEVAEQVEIQIKYEGYIQKSLQQVERLKKMENKKIPEDIDYDAIHGLATEARQKLKQVRPLSIAQASRISGVNPADISILLVYLEQGR 622
>gi|171778577|ref|ZP_02919704.1| hypothetical protein STRINF_00556 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282800|gb|EDT48224.1| hypothetical protein STRINF_00556 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (632 aa)
Score = 1325, Expect = 6.5e-144, Identities = 273/614 (44%), Positives = 390/614 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +V+GAGHAG+EA+   A+   K  L  ++ +++  MPCNP+IGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  YS+   + +E+ E + L    +  +   + KV GV T  NQ F +  +++TTGT L   I +G      GP++   S  LA  +KEL  +  R KTGTPPR+  +SI+Y + +I+PG  K   FS F     D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+++V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  ++LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ +GL+ +  ++ Y      F+  L  L +  +K +KE         +       T  E ++RP+ ++     F+   +  LD    + ++  IKY GYI      +   K ++  ++ +  D+ D+ +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE K+  
  S:     7 ENYDVIVVGAGHAGVEASLAAARMGCKTMLATINLEMLSFMPCNPAIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYSRTMKHTVEQQENLTLRQSMIEEVLVEDGKVVGVRTATNQKFSAKAVVITTGTALRGEIILGELKYSSGPNNSLASIGLADNLKELGLEIGRFKTGTPPRVKASSINYDETEIQPGDEKPNHFS-FMSNDEDYLKDQIPCWLTYTNQTSHDIINKNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRETEEVYIQGLSTSLPEDVQKELVHSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKVQGKPEMILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGHRVGLVDEERYERYLNRKRQFDKELTRLSSLKIKPIKETNARIEALGFKPLTDALTAKEFMRRPEINYEIATSFVGPAEEKLDSKVVELLETEIKYEGYINKALDQVAKMKRMEEKRIPANIDWDDIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGKQNH 628
>gi|27262248|gb|AAN87405.1| glucose-inhibited division protein A [Heliobacillus mobilis] (643 aa)
Score = 1324, Expect = 9.3e-144, Identities = 267/613 (43%), Positives = 397/613 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETST--------LKNVKEFKYNSRKTN-TTLYEILKRPDYSFIDMEPFL---KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD +VIGAGHAG EAA   A+   K  +  +    V  MPCNP+IGGPAKG + REIDALGG   +  D T +Q+++LN+ KG    ALRAQ DK +Y ++ +  +E  E +D+    V +I+  + +V GV T    FF +  +++T+GT+L   I IG      GP+ +  S  LA  ++E+  Q  R KTGTP R+   ++D++K+  +PG +   +FS    +F    KQ  C+L +T  + H+II +NL +S +Y+G I GTGPRYCPSIEDKVVRF DK+ HQ+FVEPE      +Y+ G+S+SLPED+Q  ++++I+G EN  I +  YAIEYD + P QL  +LE + I+GLF AGQ+NGTSGYEEAA QG++AGIN  C+ + +EPL+LKR++AYIGVLI+DL+ K   +PYR+LTSRAEYRL LR DNADQRL + G  +GL+    ++ + + +E      KEL + T        L+ + E K ++  T   +L+++L+RP+ SF D+   L   + + T+D    ++V+I  K+ GY+  QQ  +     +++ ++    DY  +  +S EAR KL   +P +LGQASR+SG+N  D+  + +YLE ++++
  S:    15 QYDVIVIGAGHAGCEAALAAARMGCKTLILTISWDNVALMPCNPAIGGPAKGHLVREIDALGGQMGVTIDATAIQIRMLNTGKGPAVHALRAQADKKKYQQYMIQVLEHQENLDVRQAMVETIRVEDGQVQGVLTQTGAFFAAPNVVITSGTYLKGRIIIGDLHYPGGPNGYFPSTELAASLREVGVQLGRFKTGTPARVDGRTVDFTKMVEQPGDSDPLNFSFISSRFE--RKQISCWLTYTTEETHQIIRDNLHRSPLYAGVIEGTGPRYCPSIEDKVVRFADKKSHQVFVEPEGADTHEMYVQGMSTSLPEDIQLAMLRSIIGMENVKIIRPGYAIEYDYVVPTQLKLSLEHQTIQGLFTAGQVNGTSGYEEAAAQGIIAGINAACRAQGKEPLILKRSDAYIGVLIDDLVTKGTNEPYRMLTSRAEYRLLLRQDNADQRLTEIGCSIGLVDDVRYERFQRKMERVEQE-KELWSKTFVTPGNIRLQEILEQKRSAPLTKGLSLFDLLRRPELSFDDLHSLLEYDEARETVDPEVAEQVEISAKFEGYLVKQQAQVERFNKLESRRVPPDLDYALIGGLSTEARQKLIARRPESLGQASRISGVNPADISLLLVYLEQRRRR 636
>gi|193216990|ref|YP_002000232.1| glucose-inhibited division protein A [Mycoplasma arthritidis 158L3-1] >gi|193002313|gb|ACF07528.1| glucose-inhibited division protein A [Mycoplasma arthritidis 158L3-1] (607 aa)
Score = 1322, Expect = 1.2e-143, Identities = 290/613 (47%), Positives = 401/613 (65%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENF---NNTLKELETSTLKNVKEF--KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           K YD +VIG GHAG+EAA+ LAK+ + VAL  L+   +  +PCNPSIGG AKGI+TREIDALGGMQ   AD   +Q+K+LN+SKG   W+LRAQIDK +Y +  L+ I++   I LI+ EV  +  VN+  C GV T +N    +  +++TTG +++S I  G  +   GPD    S  L+K + +  F+ +RLKTGTP RI  +SID+SK++ E     + SFS      LD  +Q  C+L  T  K  EII NNLDKS++YSG I G GPRYCPS+EDK+VRF +KE H +F EPE+   D +Y+ GLS+S+PE VQ+Q++ +I G E A ++KY YAIEYDAINP+ LY +LE+K +   F AGQ NGTSGYEEAA QGL+AGIN   +L+    + +KR+ AYIGVLI+D++ K   +PYR+LTSRAEYRL LRNDN D+RL +Y +E  +IS      YNK L+ +   NN +++L+   + +  E   KYN     + L ++L  P    +D +  L N    D  + D++ I ++  GY+K Q+        ++ +KL    DY  V N++ EAR KLN++KP T+GQASR+SGIN  D+  +  YL N+KK
  S:     3 KTYDAIVIGGGHAGIEAAYALAKRAFNVALITLNINRLAMLPCNPSIGGSAKGIITREIDALGGMQGYFADLAMIQIKMLNTSKGPAVWSLRAQIDKEKYCQIILDDIKKQSNITLIEDEVVDL-IVNENQCHGVVTKENGNISAKVVVMTTGVYMNSRILRGTDIKYDGPDGEKTSSSLSKNLMKYGFEILRLKTGTPCRIYTDSIDFSKVEKEQLDKNELSFSSHSNVKLD--EQTCCFLTHTTAKTKEIILNNLDKSSLYSGIIIGIGPRYCPSVEDKIVRFQEKETHHIFFEPETAKGDIMYINGLSTSMPESVQDQMIASIPGLEKARVQKYGYAIEYDAINPLNLYKSLESKTLSNFFSAGQPNGTSGYEEAAAQGLIAGINAANKLDKMPMMEIKRSSAYIGVLIDDIVTKGTNEPYRMLTSRAEYRLLLRNDNVDERLSQYAFENKMISAQ---SYNKVLDKYKLINNEIQKLKDEYVSSNSELAKKYNVTSGVSKL-KLLANPA---VDPKDILGN----DFPYLDEITIQVRLFGYLKKQESAAEKMFRLEKLKLPIDLDYNLVENLATEARQKLNQIKPTTIGQASRISGINPADIQMLMYYLNNRKK 607
>gi|24380471|ref|NP_722426.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus mutans UA159] >gi|81170580|sp|Q8DRS6|GIDA_STRMU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|24378501|gb|AAN59732.1|AE015035_1 glucose inhibited division protein-like protein GidA [Streptococcus mutans UA159] (631 aa)
Score = 1320, Expect = 2.2e-143, Identities = 273/613 (44%), Positives = 391/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D + +QM++LN+ KG    ALRAQ DK  Y++   + +E+ E + L    ++ I   + KV GV T  NQ + +  +IVTTGT L   I +G      GP++   S  LA  +++L  +  R KTGTPPR+  NSI Y + +I+PG  K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DK+RHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ +V +I G ENA + +  YAIEYD + P QL  TLETKKI GLF AGQ NGTSGYEEAA QG++AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+++GL+++  +  +      F+N L  L +  L       K ++E  +       T  E ++RP+ ++     F+     +LDE   + ++  IKY GYI      +   K ++  ++    D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE K +
  S:     7 ENYDVIVIGAGHAGVEASLATSRMGCKTLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKSYIQMRMLNTGKGPAVRALRAQADKALYARNMKHTVEQQENLTLRQSMIDEILVEDGKVIGVRTATNQKYSAQAVIVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLRDLGLEIGRFKTGTPPRVKANSIHYDETEIQPGDKKANHFS-FMSKDEDYLKDQIPCWLTYTNQSSHDIINKNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKDRHQLFLEPEGRETEEVYIQGLSTSLPEDVQKDVVHSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIVAGINAALKIQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADLRLTEIGHQVGLVNEERYMRFQIRKNQFDNELTRLSSIKLKPVAEINKRIEELGFKPLTDALTAKEFMRRPEINYAIATSFVGPAAESLDEKVIELLETEIKYEGYINKALDQVAKMKRMEEKRIPKNIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGKNR 627
>gi|72080345|ref|YP_287403.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma hyopneumoniae 7448] (610 aa)
Score = 1319, Expect = 3.4e-143, Identities = 290/613 (47%), Positives = 400/613 (65%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIE--PGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+G GHAG+EA + L KKK KV L  LDKK + +MPCNP+IGGPAKGI+TREIDALGG+Q   +D   +Q+K LN SKG    A+RAQIDK +YSK  L  +++ E + +I+  V+ +     +V G+ T   Q F S  +I+TTGT++DS +  G   I  GPD    S LL+  +K L F+  RLKTGTPPRI  +SID+SK++ E  P  N  +SF    +      KQ  CYL +T  K H+IIN NL KS+MYSG I+G GPRYCPSIEDK+VRF++K RHQ+F EPE+K  D +Y+ GLS+S+PEDVQ ++VK I G ENA I K+ YAIEYDA+NP++L  +LETKK+KGLF AGQINGTSGYEEAA QGL+AGIN    +  ++P+ + RN+ YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDNAD R+ KY  + GLIS+  + +        +  + EL    +    E   KYN  K  + L +++  P+ +F D+ P        D  +  ++ +  +  GYI+ Q         ++ + +    +Y+ V N+S EA DK  KV+P T+G+ASR+SG+N  D+  +  +++  K Q
  S:     2 EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMPCNPAIGGPAKGIITREIDALGGVQGKFSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSKLILKDLKKQENLLIIEDLVSELLVEKNRVFGLKTAKKQVFFSKTVIITTGTYMDSKVLRGSLAIPSGPDGQQTSNLLSNNLKRLGFELQRLKTGTPPRIFTSSIDFSKVEKEVLPVYNINFSFQSKHK----LKKQISCYLTYTTAKTHDIINKNLGKSSMYSGLISGVGPRYCPSIEDKIVRFSEKPRHQIFFEPETKKQDIMYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIEYDALNPLELKKSLETKKVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKKPVEILRNDGYIGVLIDDLVTKGTKEPYRMLTSRAEYRLILRNDNADIRMAKYALKSGLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDELAKKYNLEKRISKL-KLISWPNVNFKDILP--------DFEFGYELTVMARLKGYIQKQNSEAQKMIRLEKLLIPGDLNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKVLKMQ 605
>gi|71893362|ref|YP_278808.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma hyopneumoniae J] (610 aa)
Score = 1318, Expect = 3.9e-143, Identities = 290/613 (47%), Positives = 400/613 (65%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIE--PGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+G GHAG+EA + L KKK KV L  LDKK + +MPCNP+IGGPAKGI+TREIDALGG+Q   +D   +Q+K LN SKG    A+RAQIDK +YSK  L  +++ E + +I+  V+ +     +V G+ T   Q F S  +I+TTGT++DS +  G   I  GPD    S LL+  +K L F+  RLKTGTPPRI  +SID+SK++ E  P  N  +SF    +      KQ  CYL +T  K H+IIN NL KS+MYSG I+G GPRYCPSIEDK+VRF++K RHQ+F EPE+K  D +Y+ GLS+S+PEDVQ ++VK I G ENA I K+ YAIEYDA+NP++L  +LETKK+KGLF AGQINGTSGYEEAA QGL+AGIN    +  ++P+ + RN+ YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDNAD R+ KY  + GLIS+  + +        +  + EL    +    E   KYN  K  + L +++  P+ +F D+ P        D  +  ++ +  +  GYI+ Q         ++ + +    +Y+ V N+S EA DK  KV+P T+G+ASR+SG+N  D+  +  +++  K Q
  S:     2 EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMPCNPAIGGPAKGIITREIDALGGVQGKFSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSKLILKDLKKQENLLIIEDLVSELLVEKNRVFGLKTAKKQVFFSKTVIITTGTYMDSKVLRGSLAIPSGPDGQQTSNLLSNNLKRLGFELQRLKTGTPPRIFTSSIDFSKVEKEVLPVYNINFSFQSKHK----IKKQISCYLTYTTAKTHDIINKNLGKSSMYSGLISGVGPRYCPSIEDKIVRFSEKPRHQIFFEPETKKQDIMYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIEYDALNPLELKKSLETKKVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKKPVEILRNDGYIGVLIDDLVTKGTKEPYRMLTSRAEYRLILRNDNADIRMAKYALKSGLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDELAKKYNLEKRISKL-KLISWPNVNFKDILP--------DFEFGYELTVMARLKGYIQKQNSEAQKMIRLEKLLIPGDLNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKVLKMQ 605
>gi|170077730|ref|YP_001734368.1| glucose-inhibited division protein A [Synechococcus sp. PCC 7002] >gi|169885399|gb|ACA99112.1| glucose-inhibited division protein A [Synechococcus sp. PCC 7002] (639 aa)
Score = 1317, Expect = 5.2e-143, Identities = 264/613 (43%), Positives = 386/613 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY-------NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +VIGAGH+G EAA   A+   +  +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+    N +E  +  +L+ +E  +   V   N ++CG+ T     F +  +++TTGTFL  +I IG+K +  G      +  + + + EL F+T RLKTGTP R+ + S+DYSK++I+P   +   FS FD +     +Q  CYL  T  K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DK+ HQ+F+EPE + +  +Y+ G S+ LPE +Q Q+++++ G E+ V+ + AYA+EYD +   Q YPTL TK+++GLF AGQINGT+GYEEAA QG++AGIN     + ++ +V  R ++Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  Y    EN     + L T  +K +               K++ TL ++L+RP + + D+  +      L +  +   +I IKY GYIK QQ  I+      N KL    DY  V  +S+EAR+KLNKV+PLT+GQA+R+ G+N  D+  + +YLE + +Q
  S:    11 EFDVIVIGAGHSGCEAALASARLGCRTLMLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAAVMKNIVENQD--NLVIREGMATDLVLGNNDEICGIQTYFGTCFGAKAVVLTTGTFLGGTIWIGNKSMPAGRAGEFAAVGMTETLNELGFETGRLKTGTPARVDRRSVDYSKMEIQPADEEVRWFS-FDPEAWVEREQMPCYLTRTTPKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKDSHQIFIEPEGRTIPELYIQGFSTGLPESLQLQMLQSLPGMEDCVMLRPAYAVEYDYLPATQCYPTLMTKRVEGLFSAGQINGTTGYEEAAAQGIVAGINAAKFAQGQDMVVFPREQSYLGTLIDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIGDRRWALYQTKQENIAAEKERLHTERVKELDPLGQKIAADTGQKIKSSVTLADLLRRPKFHYADLASYGLGNEALTQAEQAGAEIDIKYSGYIKRQQNQIDQISRHANRKLPEGLDYLTVETLSMEAREKLNKVRPLTIGQATRIGGVNPADINALLVYLEVQHRQ 630
>gi|168218050|ref|ZP_02643675.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens NCTC 8239] >gi|182379932|gb|EDT77411.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens NCTC 8239] (630 aa)
Score = 1316, Expect = 6.8e-143, Identities = 273/611 (44%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN---KNLENFNNTLKELE----TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +VIGAGHAG EA    A+   K  +  L    V  MPCNP+IGG AKG + REIDALGG   +  D+T +Q K+LN+SKG    +LRAQ DK +Y +     +E  E + L   EV S++  + KV GV T +  FFE   +I+T+GT+L S I IG     +GP+  + +  L+K + +L     R KTGTP RI K S+D+SK+  +PG  +   FS F    +D   Q  C+L +TN + H++I  N+ +S MY+G I G GPRYCPSIEDKV+RF DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ Q++K + G ENA I + AYAIEYD I+P QL  +LE K I G F AGQING+SGYEEA  QG++AGIN   +++ ++P++L R++ Y+GVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + GY +GL+++  W+++    +NLE     LKEL+    T   + + E      K    +YE++KRP+  +  +      +  L +   D+++I  +Y GYI++Q + +   K  +   L    DY DV ++ +EA  KLNK++PL +GQASR+SG++  D+  + ++LE+ +K
  S:     8 YDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLHLRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSNANELSKSLIDLGIDLRRFKTGTPARINKRSVDFSKMIEQPGDEEIIPFS-FISGNID-RDQVSCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPEGDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITKGTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGYNVGLVTEERWNKFQERKQNLERELERLKELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQINIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEHYRK 623
>gi|15673829|ref|NP_268004.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactococcus lactis subsp. lactis Il1403] >gi|13878503|sp|Q9CEJ4|GIDA_LACLA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|12724877|gb|AAK05945.1|AE006414_11 glucose inhibited division protein GidA [Lactococcus lactis subsp. lactis Il1403] (625 aa)
Score = 1316, Expect = 7.2e-143, Identities = 273/611 (44%), Positives = 381/611 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF--VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           + YD +VIG GHAG+EA+   A+   K  L  ++  +V  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK EY+    N + + E + L    V  +      +KV G+ T     + +  +I+TTGT L   I IG      GP++   S  LA  ++E+ F+  R KTGTPPR+L +SIDY K +I+PG      +SF   D  +L    Q  C+L +T    H I+  NL ++ ++SG + G GPRYCPSIEDK+ RF DK RHQLF+EPE ++ + +Y+GGLS+S+PEDVQ  +VK+I G ENA + +  YAIEYD + P QL PTLETK + GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +   +LKR+EAYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD+RL + G ++GL+S   W+ Y   +  F+  +K L +  LK        + +  +   K   T  E LKRP+  + ++  F+ +    +D    + ++  I Y GYIK     ++    ++  ++    D+  + +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE K
  S:     5 ENYDVVVIGGGHAGVEASLAAARMGSKTLLMTINLNMVAFMPCNPSIGGSAKGIVVREIDALGGEMGRNIDKTYIQMKMLNTGKGPAVRALRAQADKDEYADSMKNTVSDQENLTLRQGMVEELILDEEKKKVIGIKTSTGTKYGAKAVIITTGTALRGEIIIGELKYSSGPNNSLSSIGLADNLREIGFEIGRFKTGTPPRVLASSIDYDKTEIQPGDEAPNHFSFMSSDENYL--KDQIPCWLTYTTENSHTILRGNLHRAPLFSGIVKGVGPRYCPSIEDKITRFADKPRHQLFLEPEGRNTEEVYIGGLSTSMPEDVQFDLVKSIPGLENAQMMRPGYAIEYDVVMPHQLRPTLETKLVSGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKSEFILKRSEAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADRRLTEIGRQVGLVSDEQWEHYQAKMAQFDREMKRLNSEKLKPLPDTQEKLGKLGFGPIKDALTGAEFLKRPEVHYNEVIDFIGQAPEKIDRTVIELIETEITYEGYIKKAMDQVDKMHRLEAKRIPKNMDWDKLDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGK 625
>gi|113476427|ref|YP_722488.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Trichodesmium erythraeum IMS101] >gi|110167475|gb|ABG52015.1| glucose inhibited division protein A [Trichodesmium erythraeum IMS101] (637 aa)
Score = 1316, Expect = 7.2e-143, Identities = 266/613 (43%), Positives = 389/613 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV-NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYN-------SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD +V+GAGH+G EAA   A+      L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EY+    N +E  E + + +  V  +    N+++ GV T     F+   +I+TTGTFL   I +G+K +  G      +  L++ + +L F+T RLKTGTP R+ K S+DY+ L+ +PG  K   F+ FD +     +Q  CYL  T  + H++I +NL  S +Y G++   GPRYCPSIEDK+VRF DK  HQ+F+EPE + +  +Y+ G S+ LPE +Q Q+++++ G EN ++ + AYA+EYD +   Q YPTL TKKI+GLF AGQINGT+GYEEAA QGL+AGIN +  ++N E ++  R ++YIG LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W+ +     N N+    L ++ +K + E   N         K + TL ++L+RP + ++D+E +      L    K+  +I IKY GY++ QQ  I+      N +L +  DY  +  +SLEAR+KL+KV+PLT+GQASR+ G+N  D+  + +YLE + +Q
  S:    10 EYDIIVVGAGHSGCEAALATARLGCHTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALRAQTDKREYATIMRNIVENQENLRVRESMVTDLVLGDNEEIIGVETYFGVAFKCKAVILTTGTFLGGVIWVGNKSMPAGRAGEFSAIGLSETLNKLGFETGRLKTGTPARVDKRSVDYTDLEAQPGDEKVRWFT-FDPEVWVEREQMCCYLTRTTPETHKLIRDNLHLSPVYGGWVDAKGPRYCPSIEDKIVRFADKHSHQIFIEPEGRDIPELYIQGFSTGLPEKLQLQMLQSLPGLENCLMLRPAYAVEYDYLPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGLVAGINAVKFVKNEEMIIFPREQSYIGTLIDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWELFESKQANINSEKSRLNSTRIKELDEVAINIVADTHTKIKGSITLADLLRRPGFHYVDLEKYNLGNLDLKLVEKEGAEIDIKYSGYLQRQQNQIDQISRQKNRRLPTNLDYLSISTLSLEAREKLSKVQPLTIGQASRIGGVNPADINALLVYLEVQYRQ 629
>gi|55821969|ref|YP_140411.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus thermophilus LMG 18311] >gi|55823886|ref|YP_142327.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus thermophilus CNRZ1066] >gi|55737954|gb|AAV61596.1| glucose inhibited division protein A [Streptococcus thermophilus LMG 18311] >gi|55739871|gb|AAV63512.1| glucose inhibited division protein A [Streptococcus thermophilus CNRZ1066] (667 aa)
Score = 1315, Expect = 1.0e-142, Identities = 275/613 (44%), Positives = 377/613 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + +D +V+GAGHAG+EA+   A+   KV L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y+    + +E  E + L    V+ I   + KV GV T  NQ + +  ++VTTGT L   I IG      GP++   S  LA  +KEL  +  R KTGTPPR+  +SI+Y + +I+PG  K   FS   +       Q  C+L +TN + H+IINNNL ++ M+SG + G GPRYCPSIEDK+VRF DK RHQLF+EPE +  + +Y+ GLS+SLPEDVQ++++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G E+GL+    W+ +      F+  L  L    LK +KE         +       T  E ++RP+  +     F+      LD    + ++  IKY GYI      +   K ++  K+    D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:    41 ENFDVIVVGAGHAGVEASLAAARMGCKVLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAMTMKHTVERQENLTLRQSMVDEILVEDSKVVGVRTATNQKYGAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASVTLADNLKELGLEIGRFKTGTPPRVKASSINYEETEIQPGDEKPNHFSFLSKDEDYLQDQIPCWLTYTNQESHDIINNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKNRHQLFLEPEGRETEEVYVQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTPIGREVGLVDDERWNIFKIKKNQFDRELTRLSKEKLKPIKETNEKIQALGFKPLTDAMTAKEFMRRPEIDYATATQFVGPAAEDLDAKVIELLETEIKYEGYINKALDQVAKMKRMEEKKIPENIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGNNK 661
>gi|81170581|sp|Q5LXK0|GIDA_STRT1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|81170582|sp|Q5M250|GIDA_STRT2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) (633 aa)
Score = 1314, Expect = 1.1e-142, Identities = 275/613 (44%), Positives = 377/613 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + +D +V+GAGHAG+EA+   A+   KV L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y+    + +E  E + L    V+ I   + KV GV T  NQ + +  ++VTTGT L   I IG      GP++   S  LA  +KEL  +  R KTGTPPR+  +SI+Y + +I+PG  K   FS   +       Q  C+L +TN + H+IINNNL ++ M+SG + G GPRYCPSIEDK+VRF DK RHQLF+EPE +  + +Y+ GLS+SLPEDVQ++++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G E+GL+    W+ +      F+  L  L    LK +KE         +       T  E ++RP+  +     F+      LD    + ++  IKY GYI      +   K ++  K+    D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ENFDVIVVGAGHAGVEASLAAARMGCKVLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAMTMKHTVERQENLTLRQSMVDEILVEDSKVVGVRTATNQKYGAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASVTLADNLKELGLEIGRFKTGTPPRVKASSINYEETEIQPGDEKPNHFSFLSKDEDYLQDQIPCWLTYTNQESHDIINNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKNRHQLFLEPEGRETEEVYVQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTPIGREVGLVDDERWNIFKIKKNQFDRELTRLSKEKLKPIKETNEKIQALGFKPLTDAMTAKEFMRRPEIDYATATQFVGPAAEDLDAKVIELLETEIKYEGYINKALDQVAKMKRMEEKKIPENIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGNNK 627
>gi|166222942|sp|Q4A909|GIDA_MYCH7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|144575231|gb|AAZ53380.2| glucose inhibited division protein A [Mycoplasma hyopneumoniae 7448] (619 aa)
Score = 1314, Expect = 1.1e-142, Identities = 290/613 (47%), Positives = 400/613 (65%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIE--PGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+G GHAG+EA + L KKK KV L  LDKK + +MPCNP+IGGPAKGI+TREIDALGG+Q   +D   +Q+K LN SKG    A+RAQIDK +YSK  L  +++ E + +I+  V+ +     +V G+ T   Q F S  +I+TTGT++DS +  G   I  GPD    S LL+  +K L F+  RLKTGTPPRI  +SID+SK++ E  P  N  +SF    +      KQ  CYL +T  K H+IIN NL KS+MYSG I+G GPRYCPSIEDK+VRF++K RHQ+F EPE+K  D +Y+ GLS+S+PEDVQ ++VK I G ENA I K+ YAIEYDA+NP++L  +LETKK+KGLF AGQINGTSGYEEAA QGL+AGIN    +  ++P+ + RN+ YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDNAD R+ KY  + GLIS+  + +        +  + EL    +    E   KYN  K  + L +++  P+ +F D+ P        D  +  ++ +  +  GYI+ Q         ++ + +    +Y+ V N+S EA DK  KV+P T+G+ASR+SG+N  D+  +  +++  K Q
  S:    11 EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMPCNPAIGGPAKGIITREIDALGGVQGKFSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSKLILKDLKKQENLLIIEDLVSELLVEKNRVFGLKTAKKQVFFSKTVIITTGTYMDSKVLRGSLAIPSGPDGQQTSNLLSNNLKRLGFELQRLKTGTPPRIFTSSIDFSKVEKEVLPVYNINFSFQSKHK----LKKQISCYLTYTTAKTHDIINKNLGKSSMYSGLISGVGPRYCPSIEDKIVRFSEKPRHQIFFEPETKKQDIMYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIEYDALNPLELKKSLETKKVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKKPVEILRNDGYIGVLIDDLVTKGTKEPYRMLTSRAEYRLILRNDNADIRMAKYALKSGLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDELAKKYNLEKRISKL-KLISWPNVNFKDILP--------DFEFGYELTVMARLKGYIQKQNSEAQKMIRLEKLLIPGDLNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKVLKMQ 614
>gi|166222943|sp|Q4AAU6|GIDA_MYCHJ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|144227418|gb|AAZ44097.2| glucose inhibited division protein A [Mycoplasma hyopneumoniae J] (619 aa)
Score = 1314, Expect = 1.3e-142, Identities = 290/613 (47%), Positives = 400/613 (65%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIE--PGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+G GHAG+EA + L KKK KV L  LDKK + +MPCNP+IGGPAKGI+TREIDALGG+Q   +D   +Q+K LN SKG    A+RAQIDK +YSK  L  +++ E + +I+  V+ +     +V G+ T   Q F S  +I+TTGT++DS +  G   I  GPD    S LL+  +K L F+  RLKTGTPPRI  +SID+SK++ E  P  N  +SF    +      KQ  CYL +T  K H+IIN NL KS+MYSG I+G GPRYCPSIEDK+VRF++K RHQ+F EPE+K  D +Y+ GLS+S+PEDVQ ++VK I G ENA I K+ YAIEYDA+NP++L  +LETKK+KGLF AGQINGTSGYEEAA QGL+AGIN    +  ++P+ + RN+ YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDNAD R+ KY  + GLIS+  + +        +  + EL    +    E   KYN  K  + L +++  P+ +F D+ P        D  +  ++ +  +  GYI+ Q         ++ + +    +Y+ V N+S EA DK  KV+P T+G+ASR+SG+N  D+  +  +++  K Q
  S:    11 EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMPCNPAIGGPAKGIITREIDALGGVQGKFSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSKLILKDLKKQENLLIIEDLVSELLVEKNRVFGLKTAKKQVFFSKTVIITTGTYMDSKVLRGSLAIPSGPDGQQTSNLLSNNLKRLGFELQRLKTGTPPRIFTSSIDFSKVEKEVLPVYNINFSFQSKHK----IKKQISCYLTYTTAKTHDIINKNLGKSSMYSGLISGVGPRYCPSIEDKIVRFSEKPRHQIFFEPETKKQDIMYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIEYDALNPLELKKSLETKKVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKKPVEILRNDGYIGVLIDDLVTKGTKEPYRMLTSRAEYRLILRNDNADIRMAKYALKSGLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDELAKKYNLEKRISKL-KLISWPNVNFKDILP--------DFEFGYELTVMARLKGYIQKQNSEAQKMIRLEKLLIPGDLNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKVLKMQ 614
>gi|54019972|ref|YP_115518.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mycoplasma hyopneumoniae 232] >gi|81170558|sp|Q602E7|GIDA_MYCH2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|53987145|gb|AAV27346.1| glucose inhibited division protein A [Mycoplasma hyopneumoniae 232] (619 aa)
Score = 1313, Expect = 1.8e-142, Identities = 289/613 (47%), Positives = 400/613 (65%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIE--PGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+G GHAG+EA + L KKK KV L  LDKK + +MPCNP+IGGPAKGI+TREIDALGG+Q   +D   +Q+K LN SKG    A+RAQIDK +YSK  L  +++ E + +I+  V+ +     +V G+ T   Q F S  +I+TTGT++DS +  G   I  GPD    S LL+  +K L F+  RLKTGTPPRI  +SID+SK++ E  P  N  +SF    +      KQ  CYL +T  K H+IIN NL KS+MYSG I+G GPRYCPSIEDK+VRF++K RHQ+F EPE+K  D +Y+ GLS+S+PEDVQ ++VK I G ENA I K+ YAIEYDA+NP++L  +LETK++KGLF AGQINGTSGYEEAA QGL+AGIN    +  ++P+ + RN+ YIGVLI+DL+ K   +PYR+LTSRAEYRL LRNDNAD R+ KY  + GLIS+  + +        +  + EL    +    E   KYN  K  + L +++  P+ +F D+ P        D  +  ++ +  +  GYI+ Q         ++ + +    +Y+ V N+S EA DK  KV+P T+G+ASR+SG+N  D+  +  +++  K Q
  S:    11 EFDAIVVGGGHAGIEAVYALLKKKLKVVLITLDKKKLASMPCNPAIGGPAKGIITREIDALGGVQGKLSDLAMIQIKYLNESKGPAVLAIRAQIDKEKYSKLILKDLKKQENLLIIEDLVSELLVEKNRVFGLKTAKKQVFFSKTVIITTGTYMDSKVLRGSLAIPSGPDGQQTSNLLSNNLKTLGFELQRLKTGTPPRIFTSSIDFSKVEKEVLPVYNINFSFQSKHK----LKKQISCYLTYTTAKTHDIINKNLGKSSMYSGLISGVGPRYCPSIEDKIVRFSEKPRHQIFFEPETKKQDIMYINGLSTSMPEDVQLEMVKTIPGLENAKIAKFGYAIEYDALNPLELKKSLETKRVKGLFMAGQINGTSGYEEAAAQGLVAGINAGQFVLGKKPVEILRNDGYIGVLIDDLVTKGTKEPYRMLTSRAEYRLILRNDNADIRMAKYALKSGLISKKEYLKIKAKYAKIDRKILELSKEFVSPKDELAKKYNLEKRISKL-KLISWPNVNFKDILP--------DFEFGYELTVMARLKGYIQKQNSEAQKMIRLEKLLIPGELNYEKVANLSSEALDKFQKVRPKTIGEASRISGVNPADIQMLLFHIKVLKMQ 614
>gi|94989479|ref|YP_597580.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS9429] >gi|94993366|ref|YP_601465.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS2096] >gi|139474608|ref|YP_001129324.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes str. Manfredo] >gi|166200619|sp|Q1J990|GIDA_STRPB tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166200620|sp|Q1JJD7|GIDA_STRPC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166200623|sp|A2RH03|GIDA_STRPG tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|94542987|gb|ABF33036.1| putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit [Streptococcus pyogenes MGAS9429] >gi|94546874|gb|ABF36921.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Streptococcus pyogenes MGAS2096] >gi|134272855|emb|CAM31135.1| glucose inhibited division protein A [Streptococcus pyogenes str. Manfredo] (632 aa)
Score = 1312, Expect = 1.8e-142, Identities = 274/613 (44%), Positives = 384/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK VK       E  +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVKATNDRVQELGFKPLTDAMTAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|19747019|ref|NP_608155.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS8232] >gi|24636866|sp|Q8NZ02|GIDA_STRP8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|19749277|gb|AAL98654.1| glucose inhibited division protein [Streptococcus pyogenes MGAS8232] (632 aa)
Score = 1312, Expect = 1.9e-142, Identities = 274/613 (44%), Positives = 385/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG  +   D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK VK       E  +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMSKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVKATNDRVQELGFKPLTDAMTAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|168214842|ref|ZP_02640467.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens CPE str. F4969] >gi|182626428|ref|ZP_02954181.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens D str. JGS1721] >gi|170713742|gb|EDT25924.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens CPE str. F4969] >gi|177908302|gb|EDT70855.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens D str. JGS1721] (630 aa)
Score = 1312, Expect = 2.2e-142, Identities = 272/611 (44%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN---KNLENFNNTLKELE----TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +VIGAGHAG EA    A+   K  +  L    V  MPCNP+IGG AKG + REIDALGG   +  D+T +Q K+LN+SKG    +LRAQ DK +Y +     +E  E + L   EV S++  + KV GV T +  FFE   +I+T+GT+L S I IG     +GP+  + +  L+K + +L     R KTGTP RI K S+D+SK+  +PG  +   FS F    +D   Q  C+L +TN + H++I  N+ +S MY+G I G GPRYCPSIEDKV+RF DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ Q++K + G ENA I + AYAIEYD I+P QL  +LE K I G F AGQING+SGYEEA  QG++AGIN   +++ ++P++L R++ Y+GVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + G+ +GL+++  W+++    +NLE     LKEL+    T   + + E      K    +YE++KRP+  +  +      +  L +   D+++I  +Y GYI++Q + +   K  +   L    DY DV ++ +EA  KLNK++PL +GQASR+SG++  D+  + ++LE+ +K
  S:     8 YDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLHLRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSNANELSKSLIDLGIDLRRFKTGTPARINKRSVDFSKMIEQPGDEEIIPFS-FISGNID-RDQVSCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPEGDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITKGTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGHNVGLVTEERWNKFQERKQNLERELERLKELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQINIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEHYRK 623
>gi|168207743|ref|ZP_02633748.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens E str. JGS1987] >gi|170660925|gb|EDT13608.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens E str. JGS1987] (630 aa)
Score = 1312, Expect = 2.2e-142, Identities = 272/611 (44%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN---KNLENFNNTLKELE----TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +VIGAGHAG EA    A+   K  +  L    V  MPCNP+IGG AKG + REIDALGG   +  D+T +Q K+LN+SKG    +LRAQ DK +Y +     +E  E + L   EV S++  + KV GV T +  FFE   +I+T+GT+L S I IG     +GP+  + +  L+K + +L     R KTGTP RI K S+D+SK+  +PG  +   FS F    +D   Q  C+L +TN + H++I  N+ +S MY+G I G GPRYCPSIEDKV+RF DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ Q++K + G ENA I + AYAIEYD I+P QL  +LE K I G F AGQING+SGYEEA  QG++AGIN   +++ ++P++L R++ Y+GVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + G+ +GL+++  W+++    +NLE     LKEL+    T   + + E      K    +YE++KRP+  +  +      +  L +   D+++I  +Y GYI++Q + +   K  +   L    DY DV ++ +EA  KLNK++PL +GQASR+SG++  D+  + ++LE+ +K
  S:     8 YDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLHLRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSNANELSKSLIDLGIDLRRFKTGTPARINKRSVDFSKMIEQPGDEEIIPFS-FISGNID-RDQVSCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPEGDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITKGTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGHNVGLVTEERWNKFQERKQNLERELERLKELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQINIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEHYRK 623
>gi|110801428|ref|YP_697345.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens ATCC 13124] >gi|168211558|ref|ZP_02637183.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens B str. ATCC 3626] >gi|169343452|ref|ZP_02864452.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens C str. JGS1495] >gi|123148451|sp|Q0TLZ5|GIDA_CLOP1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|110676075|gb|ABG85062.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens ATCC 13124] >gi|169298404|gb|EDS80493.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens C str. JGS1495] >gi|170710449|gb|EDT22631.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens B str. ATCC 3626] (630 aa)
Score = 1312, Expect = 2.3e-142, Identities = 272/611 (44%), Positives = 391/611 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN---KNLENFNNTLKELE----TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +VIGAGHAG EA    A+   K  +  L    V  MPCNP+IGG AKG + REIDALGG   +  D+T +Q K+LN+SKG    +LRAQ DK +Y +     +E  E + L   EV S++  + KV GV T +  FFE   +I+T+GT+L S I IG     +GP+  + +  L+K + +L     R KTGTP RI K S+D+SK+  +PG  +   FS F    +D   Q  C+L +TN + H++I  N+ +S MY+G I G GPRYCPSIEDKV+RF DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ Q++K + G ENA I + AYAIEYD I+P QL  +LE K I G F AGQING+SGYEEA  QG++AGIN   +++ ++P++L R++ Y+GVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + G+ +GL+++  W ++    +NLE     LKEL+    T   + + E      K    +YE++KRP+  +  +      +  L +   D+++I  +Y GYI++Q + +   K  +   L    DY DV ++ +EA  KLNK++PL +GQASR+SG++  D+  + ++LE+ +K
  S:     8 YDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLHLRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSNANELSKSLIDLGIDLRRFKTGTPARINKRSVDFSKMIEQPGDEEIIPFS-FISGNID-RDQVSCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPEGDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITKGTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGHNVGLVTEERWSKFQERKQNLERELERLKELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQINIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEHYRK 623
>gi|94991466|ref|YP_599566.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS10270] >gi|166200621|sp|Q1JED6|GIDA_STRPD tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|94544974|gb|ABF35022.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Streptococcus pyogenes MGAS10270] (632 aa)
Score = 1311, Expect = 2.6e-142, Identities = 273/613 (44%), Positives = 385/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L++  LK +KE         +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGVVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLDSIKLKPIKETNDRVQDLGFKPLTDAMTAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|94995350|ref|YP_603448.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS10750] >gi|166200622|sp|Q1J457|GIDA_STRPF tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|94548858|gb|ABF38904.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Streptococcus pyogenes MGAS10750] (632 aa)
Score = 1311, Expect = 2.7e-142, Identities = 274/613 (44%), Positives = 384/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK VK       E  +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ENYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVKATNDRVQELGFKPLTDAMTAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|116628660|ref|YP_821279.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus thermophilus LMD-9] >gi|122266746|sp|Q03I89|GIDA_STRTD tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|116101937|gb|ABJ67083.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Streptococcus thermophilus LMD-9] (633 aa)
Score = 1311, Expect = 2.8e-142, Identities = 275/613 (44%), Positives = 377/613 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + +D +V+GAGHAG+EA+   A+   KV L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y+    + +E  E + L    V+ I   + KV GV T  NQ + +  ++VTTGT L   I IG      GP++   S  LA  +KEL  +  R KTGTPPR+  +SI+Y + +I+PG  K   FS   +       Q  C+L +TN + H+IINNNL ++ M+SG + G GPRYCPSIEDK+VRF DK RHQLF+EPE +  + +Y+ GLS+SLPEDVQ++++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G E+GL+    W+ +      F+  L  L    LK +KE         +       T  E ++RP+  +     F+      LD    + ++  IKY GYI      +   K ++  K+    D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ENFDVIVVGAGHAGVEASLAAARMGCKVLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAMTMKHTVECQENLTLRQSMVDEILVEDSKVVGVRTATNQKYGAKAVVVTTGTALRGEIIIGDLKYSSGPNNSLASVTLADNLKELGLEIGRFKTGTPPRVKASSINYEETEIQPGDEKPNHFSFLSKDEDYLQDQIPCWLTYTNQESHDIINNNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKNRHQLFLEPEGRETEEVYVQGLSTSLPEDVQKELIHSIKGLEKAEMIRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTPIGREVGLVDDERWNIFKIKKNQFDRELTRLSKEKLKPIKETNEKIQALGFKPLTDAMTAKEFMRRPEIDYATATQFVGPAAEDLDAKVIELLETEIKYEGYINKALDQVAKMKRMEEKKIPENIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMVYLEGNNK 627
>gi|18311636|ref|NP_563570.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens str. 13] >gi|21263661|sp|Q8XH31|GIDA_CLOPE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|18146320|dbj|BAB82360.1| glucose-inhibited division protein [Clostridium perfringens str. 13] (630 aa)
Score = 1311, Expect = 2.8e-142, Identities = 272/611 (44%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELE----TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +VIGAGHAG EA    A+   K  +  L    V  MPCNP+IGG AKG + REIDALGG   +  D+T +Q K+LN+SKG    +LRAQ DK +Y +     +E  E + L   EV S++  + KV GV T +  FFE   +I+T+GT+L S I IG     +GP+  + +  L+K + +L     R KTGTP RI K S+D+SK+  +PG  +   FS F    +D   Q  C+L +TN + H++I  N+ +S MY+G I G GPRYCPSIEDKV+RF DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ Q++K + G ENA I + AYAIEYD I+P QL  +LE K I G F AGQING+SGYEEA  QG++AGIN   +++ ++P++L R++ Y+GVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + G+ +GL+++  W+++    +NLE     LKEL+    T   + + E      K    +YE++KRP+  +  +      +  L +   D+++I  +Y GYI++Q + +   K  +   L    DY DV ++ +EA  KLNK++PL +GQASR+SG++  D+  + ++LE+ +K
  S:     8 YDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLHLRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSNANELSKSLIDLGIDLRRFKTGTPARINKRSVDFSKMIEQPGDEEIIPFS-FISGNID-RDQVSCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPEGDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITKGTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGHNVGLVTEERWNKFKERKQNLERELERLKELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQINIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEHYRK 623
>gi|110802913|ref|YP_699903.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium perfringens SM101] >gi|123145822|sp|Q0SPQ4|GIDA_CLOPS tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|110683414|gb|ABG86784.1| glucose-inhibited division protein A [Clostridium perfringens SM101] (630 aa)
Score = 1310, Expect = 3.1e-142, Identities = 271/611 (44%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN---KNLENFNNTLKELE----TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +VIGAGHAG EA    A+   K  +  L    V  MPCNP+IGG AKG + REIDALGG   +  D+T +Q K+LN+SKG    +LRAQ DK +Y +     +E  E + L   EV S++  + KV GV T +  FFE   +I+T+GT+L S I IG     +GP+  + +  L+K + +L     R KTGTP R+ K S+D+SK+  +PG  +   FS F    +D   Q  C+L +TN + H++I  N+ +S MY+G I G GPRYCPSIEDKV+RF DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ Q++K + G ENA I + AYAIEYD I+P QL  +LE K I G F AGQING+SGYEEA  QG++AGIN   +++ ++P++L R++ Y+GVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + G+ +GL+++  W+++    +NLE     LKEL+    T   + + E      K    +YE++KRP+  +  +      +  L +   D+++I  +Y GYI++Q + +   K  +   L    DY DV ++ +EA  KLNK++PL +GQASR+SG++  D+  + ++LE+ +K
  S:     8 YDIVVIGAGHAGCEAGLAAARMGCKTLVCTLTLDSVAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSKMLNTSKGPAVHSLRAQADKKKYQERMKKVLETQENLHLRQLEVVSVEVEDGKVKGVLTKNGAFFECKAVIMTSGTYLQSRIIIGDVSYSQGPNGLSNANELSKSLIDLGIDLRRFKTGTPARVNKRSVDFSKMIEQPGDEEIIPFS-FISGNID-RDQVSCWLTYTNEETHKVIQENIHRSPMYNGSIKGVGPRYCPSIEDKVMRFQDKDRHQIFIEPEGDDTEEMYVGGMSSSLPEDVQVQMIKTVPGLENAEIMRTAYAIEYDCIDPTQLKASLEFKNIDGFFSAGQINGSSGYEEAGAQGIVAGINAALKVQGKDPMILTRSDGYVGVLIDDLITKGTNEPYRMMTSRAEYRLLLRQDNADFRLTEIGHNVGLVTEERWNKFQERKQNLERELERLKELQITNKTENNEKIVELGSTELKKPIRMYELIKRPELDYFSLACLDPERPDLPKDIGDQINIIARYEGYIQTQLEQVAQFKKFEKKVLPEDLDYNDVNSLRIEAIQKLNKIRPLNIGQASRISGVSPADISVLLIFLEHYRK 623
>gi|21911374|ref|NP_665642.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS315] >gi|28896746|ref|NP_803096.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes SSI-1] >gi|25090459|sp|Q8K5H7|GIDA_STRP3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|21905590|gb|AAM80445.1| putative glucose inhibited division protein [Streptococcus pyogenes MGAS315] >gi|28812000|dbj|BAC64929.1| putative glucose inhibited division protein [Streptococcus pyogenes SSI-1] (632 aa)
Score = 1310, Expect = 3.4e-142, Identities = 274/613 (44%), Positives = 384/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK VK       E  +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKSELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVKATNDRVQELGFKPLTDAMTAKEFMRRPEIDYAIAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|15675920|ref|NP_270094.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes M1 GAS] >gi|71911651|ref|YP_283201.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS5005] >gi|21263681|sp|Q99XI8|GIDA_STRP1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|13623159|gb|AAK34815.1| glucose inhibited division protein [Streptococcus pyogenes M1 GAS] >gi|71854433|gb|AAZ52456.1| glucose inhibited division protein A [Streptococcus pyogenes MGAS5005] (632 aa)
Score = 1310, Expect = 3.5e-142, Identities = 273/613 (44%), Positives = 384/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-------FKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK +KE         +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPIKETNDRVQDLGFKPLTDAMTAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPTNIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|71904532|ref|YP_281335.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS6180] >gi|123639044|sp|Q48QN0|GIDA_STRPM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|71803627|gb|AAX72980.1| glucose inhibited division protein A [Streptococcus pyogenes MGAS6180] (632 aa)
Score = 1310, Expect = 3.7e-142, Identities = 271/613 (44%), Positives = 379/613 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS   +       Q  C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK VK       E  +       T  E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFSFMSKDAEYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVKATNDRVQELGFKPLTDAMTAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|161508217|ref|YP_001578188.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus helveticus DPC 4571] >gi|160349206|gb|ABX27880.1| Glucose inhibited division protein [Lactobacillus helveticus DPC 4571] (661 aa)
Score = 1309, Expect = 4.6e-142, Identities = 275/611 (45%), Positives = 384/611 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFNNTLKELETSTLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG EAA   A    K  L  +   +V  MPCNPS+GGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y +   + IE    + L    V+ +  V   VC GV T     + +  +++TTGT     I IG      GP++   S  L++ +++L F+  R KTGTPPR+  N+IDYSK + EPG      FS ++ K +D+ K ++ C++ +TNN  HEII  NL+++ M+SG I G GPRYCPSIEDKVVRF DK+RHQ+F+EPE +    +Y+G  S+S+PE++Q ++V ++ G E+A + +  YAIEYD + P QL  TLETK IK LF AGQ+NGTSGYEEAA QGL+AGIN     +++    L RN+AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL +YG+ELGLIS   ++++ +    + +    L E+      +V+EF         K        L+RP+    D+E     K   D Y K++V+I IKY GYIK ++  I   K  +  K+ +  DY+ +  ++ EAR K  K++P TL QA R+SG+N  DL  + +Y++N +
  S:     9 EYDVIVVGAGHAGCEAALASAHMGQKTLLVTIGLDMVAFMPCNPSVGGPAKGTVVREIDALGGQMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHEHMKDTIENTPNLTLRQAIVDQL-VVEDGVCKGVITNTGAKYHAKSVVLTTGTAARGKIIIGELTYSSGPNNTTPSIKLSENLEKLGFKLRRFKTGTPPRVNGNTIDYSKTEEEPGDKTPRHFS-YESKDVDYLKNQISCWMTYTNNGTHEIIRENLNRAPMFSGIIKGVGPRYCPSIEDKVVRFADKDRHQIFLEPEGRTTKEVYVGDFSTSMPEEIQLKMVHSVAGLEHAEMMRPGYAIEYDVVEPWQLKHTLETKNIKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQDKPGFTLGRNDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLILRHDNADLRLTEYGHELGLISDERYEKFEEKKQAIRDAKERLHEITVHLSDDVQEFLKSIGQEPMKAGVKADVFLRRPNVKIADIERLTGEKIPGDRYVKEQVEIGIKYAGYIKKEETRIARLKRQEAKKIPADIDYEMIEGLATEARQKFEKIRPETLAQAERISGVNPADLAILSVYIQNGR 626
>gi|50915202|ref|YP_061174.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus pyogenes MGAS10394] >gi|68052091|sp|Q5X9C2|GIDA_STRP6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|50904276|gb|AAT87991.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Streptococcus pyogenes MGAS10394] (632 aa)
Score = 1307, Expect = 8.4e-142, Identities = 273/613 (44%), Positives = 383/613 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK-------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           + YD +VIGAGHAG+EA+   ++   K  L  ++  ++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++   + +E+   + L    ++ I   + +V GV T   Q F +  ++VTTGT L   I +G      GP++   S  LA  +K+L  +  R KTGTPPR+  +SI+Y + +I+PG +K   FS F  K  D+ K ++ C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +  + +Y+ GLS+SLPEDVQ+ ++ +I G E A + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G ++GL+    W  +      F+N LK L +  LK VK       E  +          E ++RP+  +     F+      LD    + ++  IKY GYI+     +   K ++  ++ +  D+  + +I+ EAR K  K+ P T+GQASR+SG+N  D+  + +YLE   K
  S:     7 ESYDVIVIGAGHAGVEASLATSRMGCKTLLATINLDMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKSLYAREMKHTVEKQANLTLRQTMIDDILVEDGRVVGVLTATGQKFAAKAVVVTTGTALRGEIILGELKYSSGPNNSLASVTLADNLKKLGLEIGRFKTGTPPRVKASSINYDQTEIQPGDDKPNHFS-FMSKDADYLKDQIPCWLTYTNQTSHDIINQNLYRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRDTEEVYVQGLSTSLPEDVQKDLIHSIKGLEKAEMMRTGYAIEYDIVLPHQLRATLETKLISGLFTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKSELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGRDIGLVDDERWKAFEIKKNQFDNELKRLNSIKLKPVKATNDRVQELGFKPLTDAMIAKEFMRRPEIDYATAVSFVGPAAEDLDAKIIELLETEIKYEGYIRKALDQVAKMKRMEEKRIPANIDWDAIDSIATEARQKFKKINPETIGQASRISGVNPADISILMIYLEGNGK 627
>gi|42519902|ref|NP_965832.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus johnsonii NCC 533] >gi|81170550|sp|Q74H95|GIDA_LACJO tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|41584192|gb|AAS09798.1| glucose inhibited division protein A [Lactobacillus johnsonii NCC 533] (632 aa)
Score = 1306, Expect = 1.0e-141, Identities = 269/611 (44%), Positives = 383/611 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL---KNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG+EAA   A+   K  L  ++  +V  MPCNPS+GGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y +   + IE    + L     + +  V   VC G+ T     + +  +++TTGT     I IG      GP++   S  L + +++L F+  R KTGTPPR+  N+IDYSK Q EPG  +   FS+  +       Q  CY+ +TN   H+II  NLD++ M+SG I G GPRYCPSIEDKVVRF DK+RHQ+F+EPE +H   IY+G  S+S+PE+VQ +++ ++ G E A + +  YAIEYD I P QL  TLETK IK LF AGQ+NGTSGYEEAA QGL+AGIN     +N+    L+R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ELGLIS+  + E+    +  +  ++ ++  T+     V+E+    K +      +  + LKRP  +F  +E         D Y K++V+I +KY GYIK ++ +++    +++ K+    DY  +P+++ EAR K  K++P ++ QA R+SG+N  DL  +  Y++  +
  S:     8 EYDVIVVGAGHAGVEAALASARMGEKTLLLTINLDMVAFMPCNPSVGGPAKGTVVREIDALGGEMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHERMKDTIENEPNLTLRQAVADEL-IVEDGVCKGLITNTGAKYYAKSVVLTTGTAARGKIIIGELAYSSGPNNSLPSIKLPENLEKLGFKLRRFKTGTPPRVDGNTIDYSKTQEEPGDKEPRHFSYTSKDSDYLEDQMSCYMTYTNTVTHDIIRANLDRAPMFSGVIKGVGPRYCPSIEDKVVRFADKDRHQIFLEPEGRHTKEIYVGDFSTSMPEEVQLKMLHSVAGLEKAELMRPGYAIEYDVIEPWQLKHTLETKNIKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQNKPGFTLQRDEAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEKGHELGLISEDRYKEFQDKKQAISQAMEAIKKVTIHPTDEVQEYLASVKQDRLNAGVSGADFLKRPRVTFDAVERLSGETLATDRYVKEQVEIALKYEGYIKKEKTLVDRLHRLESKKIPVDIDYNAIPSLATEARQKFEKIRPESIAQAERISGVNPADLAILTAYIQQGR 625
>gi|188587518|ref|YP_001919063.1| glucose inhibited division protein A [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352205|gb|ACB86475.1| glucose inhibited division protein A [Natranaerobius thermophilus JW/NM-WN-LF] (644 aa)
Score = 1304, Expect = 1.6e-141, Identities = 269/612 (43%), Positives = 400/612 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNT---LKELETSTLKNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +V+GAGHAG EAA   A+   K  L  L+   +  MPCNP+IGGPAK  + RE+DALGG      D+T +Q ++LN+ KG    ALRAQ DK++Y +     +E  E + L  + VN +   + ++ GV T D  ++    L++T+GT+L   I +G      GP+    +Y L++  K+     +R KTGTP R+ + S+++ +++I+ G +   ++SF H   +     KQ  CYL FTN + H+IIN++L +S +YSG I GTGPRYCPSIEDK+VRF DK RHQLF+EPE  +    Y+ G+S+SLP DVQE++++ I G E   I +  YAIEYD I+P QL  TLE K+I GLFFAGQINGTSGYEEAA QG++AGIN   +++ +EP+++KR++ YIGVLI+DL+ K   +PYR+LTSRAEYRL LR DNAD RL + GY++GLI + ++ ++ + LE   +    LK ++ +  KNV+ F  ++N+   K  TTL+ ILKRP+ S+  +E F + +  L     ++++I IKY GYI  Q + +   + ++   +    DY  +  +S+EAR+KL   +P ++GQA+R+SGI+  D+  + +YLE  K++
  S:     8 YDLIVVGAGHAGCEAALAGARIGAKTLLLTLNLDQIALMPCNPAIGGPAKSHIVREVDALGGEMGKNIDDTAIQFRMLNTRKGPAVQALRAQADKIKYQERMKYILENEENLLLKQETVNQLMIEDNQIKGVVTKDGTYYYCEQLVITSGTYLKGRIIVGDVDYSGGPNGQQAAYGLSEDFKQHGISLMRFKTGTPARVYRKSLNFDEMEIQHGDDYPWRFSFYHSSERL----KQLPCYLTFTNYETHKIINDSLSRSPLYSGRIEGTGPRYCPSIEDKIVRFPDKSRHQLFLEPEGLNTQEYYVQGMSTSLPLDVQERMLRTIPGLEEVEIMRPGYAIEYDCIDPTQLELTLEHKQISGLFFAGQINGTSGYEEAAGQGILAGINAAQKIQGKEPVIIKRSQGYIGVLIDDLVTKGTQEPYRMLTSRAEYRLILRQDNADLRLTELGYQVGLIKEGNYQKFKEKLEKIESEKERLKSIKLTPNKNVQNFMEEHNTSGLKKPTTLFHILKRPEISYEALEYFDETRPDLPLEVTEQIEIQIKYEGYIDKQVEQVQRFEKLEARLIPDDIDYSQISGLSIEAREKLQTYRPRSVGQANRISGIDPSDISVLMVYLEQLKQR 624
>gi|160882058|ref|YP_001561026.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium phytofermentans ISDg] >gi|189039336|sp|A9KLX8|GIDA_CLOPH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|160430724|gb|ABX44287.1| glucose inhibited division protein A [Clostridium phytofermentans ISDg] (627 aa)
Score = 1303, Expect = 2.1e-141, Identities = 273/614 (44%), Positives = 390/614 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +V+GAGHAG EAA   A+  +   +  +    +  MPCNP+IGG +KG + REIDALGG      D T +Q K+LN SKG    +LRAQ DK++Y +     +E  + + L   EV  I   N +V GV       +    +I+ TG +L++    G      GP+    +  L + +K+L  +  R KTGTP RI K SID+SK++ + G  K   FS F     D  K+++ C+L +TN   H+II +N+ +S +YSG I GTGPRYCPSIEDKVV+F DK+RHQ+F+EPE  + + +Y+ G+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD INP+QL  +LE   I GLF  GQ NG+SGYEEAA QGLMAGIN   +L  +EP+VL R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNADQRL + G+E+GLIS+  ++            +  LE S +   KE +         + KT TTL E+++RP+ ++  + P  KN+  L E    +V+I  KY GYIK Q+  +   K ++  K+    DY DVP++ +EA+ KLN++KP ++GQASR+SG++  D+  + +YLE  +++
  S:     6 EAYDVVVVGAGHAGCEAALACARLGFNTIMLTVSMDNIALMPCNPNIGGTSKGHLVREIDALGGEMGKNIDKTYIQSKMLNQSKGPAVHSLRAQADKMDYCREMRKVVENTDNLTLRQDEVIDILTENNEVTGVKVYSGGVYPCKVVILCTGVYLNARCIYGETSHYTGPNGLPSANHLTESLKKLGIEMYRFKTGTPARIDKRSIDFSKMEEQFGDEKVVPFS-FINNPEDIEKEQISCWLTYTNENTHDIIRDNIHRSPLYSGNIKGTGPRYCPSIEDKVVKFPDKDRHQVFIEPEGNYTNEMYISGMSSSLPEDVQFKMYRSVSGLENAKIVRNAYAIEYDCINPMQLKSSLEFMSINGLFSGGQFNGSSGYEEAAAQGLMAGINAARKLSGKEPIVLDRSQAYIGVLIDDLVTKETHEPYRMMTSRAEYRLILRQDNADQRLTRIGHEIGLISEDRYEHLIDKERMIKEEMMRLENSLIGASKEVQEILEGLGTTTLKTGTTLAELVRRPELTYAALAPLDKNREPLPEEVITQVEINFKYDGYIKRQEHQVEQFKKLEGKKIPEDLDYSDVPSLRIEAKQKLNQIKPSSVGQASRISGVSPADISVLLVYLEQIRRK 626
>gi|196258435|ref|ZP_03156969.1| glucose inhibited division protein A [Cyanothece sp. PCC 7822] >gi|196200349|gb|EDX95170.1| glucose inhibited division protein A [Cyanothece sp. PCC 7822] (634 aa)
Score = 1302, Expect = 2.9e-141, Identities = 273/609 (44%), Positives = 376/609 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-KYNSRKT------NTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           +D +V+GAGH+G EAA   A+   +  +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+      +E  E  +L  +E  +   V   N +V GV T     F +  +I+TTGTFL   I IG K +  G      +  L   + +L F+T RLKTGTP R+ K S+DYSKL+ +P  +K   FS FD +     +Q  CYL  T  K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q  ++  + G EN V+ + AYA+EYD I   Q YPTL TKKI+GLF AGQINGT+GYEEAA QG++AGIN    ++    +V  R E+YIG L++DL  K++ +PYR+LTSR+EYRL LR+DNADQR+   G E+GLI    WD + +   N     + L  S +K   E  K  + KT      + TL ++L+RP + + D+E +      L    K+  +I IKY GYIK QQ  I       N  L +  DY  +  +S+EAR+KL KVKPLT+GQASR+ G+N  D+  + +YLE +
  S:    13 FDVIVVGAGHSGCEAALATARLGCRTLMLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNASRGPAVWALRAQTDKREYAAVMKQIVENQE--NLFIREAMATDLVLGKNDEVIGVQTYFGTCFAAKAVILTTGTFLGGRIWIGGKSMAAGRAGEFAAVGLTDTLNQLGFETGRLKTGTPARVDKRSVDYSKLEPQPPDDKVCWFS-FDPQAWVEREQMNCYLTRTTAKTHQLIRDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGREIPELYIQGFSTGLPENIQLAMLHTLPGLENCVMLRPAYAVEYDYIPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGIVAGINAAQLVKGLPFVVFPREESYIGTLVDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRMTPLGREIGLIDDRRWDLFQRKQANIIAEKERLYESRIKENDELGKAIAAKTEQKIKGSVTLADLLRRPGFHYADLETYGLGNLDLTTAEKEGAEIDIKYSGYIKRQQNQIEQVSRHSNRSLPAELDYMKIDTLSMEAREKLTKVKPLTIGQASRIGGVNPADINALLVYLETR 628
>gi|167629164|ref|YP_001679663.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Heliobacterium modesticaldum Ice1] >gi|167591904|gb|ABZ83652.1| glucose-inhibited division protein a [Heliobacterium modesticaldum Ice1] (637 aa)
Score = 1301, Expect = 3.8e-141, Identities = 265/612 (43%), Positives = 387/612 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS--TLKNVK------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT---LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           KYD +VIGAGHAG EAA   A+   K  +  +    V  MPCNP+IGGPAKG + REIDALGG   +  D T +Q++LLN+ KG    ALRAQ DK  Y +  +  +E  E +D+    V S+     +V G+ T    FF +  L++TTGT+L   I IG      GP+ +  S  LA  ++++  +  R KTGTP R+   ++D+S++  +PG  +  +FS    +     KQ  C+L +T  + H+II +NL +S +Y+G I GTGPRYCPSIEDKVVRF DK+ HQ+F+EPE +    +Y+ G+S+SLPEDVQ  ++++I+G ++  I +  YAIEYD ++P QL  +LE ++I GLF AGQINGTSGYEEAA QGLMAGIN    ++  EPLVLKR++AYIGVLI+DL+ K   +PYR+LTSRAEYRL LR DNADQRL + G  +GL+    +  + + ++     +   ++S  T  N K      E K        +LY++L+RP+ ++ D+ P   +      +D    ++V+I  K+ GY+  QQ  ++    ++N +L +  DYK V  +S E R KL   KP+++GQASR+SG++  D+  + +YLE +++
  S:     8 KYDVIVIGAGHAGCEAALASARLGAKTLILTISWDNVALMPCNPAIGGPAKGHLVREIDALGGQMGLTIDKTCIQIRLLNTGKGPAVHALRAQADKKRYQREMIRVLEHQENLDVRQAMVESVVVEQGRVRGIRTNTGAFFAAPALVITTGTYLRGRIIIGDLHYPGGPNGYFPSVALAASLRDIGVRLGRFKTGTPARVDGRTVDFSQMVEQPGDREPLNFSFLSPRIE--RKQISCWLTYTTEETHQIIRDNLHRSPLYAGVIEGTGPRYCPSIEDKVVRFADKKSHQVFIEPEGEGTHEMYVQGMSTSLPEDVQVTMLRSIIGMKDVKIIRPGYAIEYDYVDPTQLRLSLEHQEIGGLFTAGQINGTSGYEEAAAQGLMAGINAARFVKGEEPLVLKRSDAYIGVLIDDLVTKGTNEPYRMLTSRAEYRLLLRQDNADQRLTEIGRSIGLVDDRRYRRFREKMQLLEQEVVRWKSSFVTPGNKKIQAILDEKKSAPLTKGVSLYDLLRRPELTYDDLIPLCNDGEKDLPIDPEVAEQVEISAKFEGYLVKQQAQVDRFNKLENKRLPADLDYKRVHGLSNEGRQKLIARKPVSIGQASRISGVSPADISILLVYLEQQRR 628
>gi|125974849|ref|YP_001038759.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium thermocellum ATCC 27405] >gi|196251651|ref|ZP_03150319.1| glucose inhibited division protein A [Clostridium thermocellum DSM 4150] >gi|166222929|sp|A3DHY7|GIDA_CLOTH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|125715074|gb|ABN53566.1| glucose inhibited division protein A [Clostridium thermocellum ATCC 27405] >gi|196199028|gb|EDX93857.1| glucose inhibited division protein A [Clostridium thermocellum DSM 4150] (630 aa)
Score = 1300, Expect = 4.7e-141, Identities = 278/613 (45%), Positives = 402/613 (65%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV----NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHW---DEYNKNLENFNNTLKELETSTLKNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD  V+GAGHAG EAA   A+   K  +F ++   + NMPCNP+IGG AKG + REIDALGG     AD T +Q K+LNS+KG   ++LRAQ+D+  Y     N +E+ E +D+   E+  I +      + V GV T     ++S  +I+ TGT+L   I IG      GPD    +  L+  ++E+  + +R KTGTP R+ + SID+SK++ +PG  +   FS F+ +  +  K++V CYL +TN++ H II  NL +S ++ G I G GPRYCPSIEDKVVRF+DKE HQ+FVEP   +   +YL G+S+SLPEDVQ ++++ I G EN  I + AYAIEYD INP QL  +LE + ++GLF AGQINGTSGYEEAA QG++AGIN   +++  EPL+L R++AYIGVLI+D++ K   +PYR++TSRAEYRL LR DNAD RL   GYE+GLIS+  +   +E  + +E     +K+   +  + V EF  K+NS   K+   L ++L+RP+  +  +    +N+  L    +++V I IKY GYIK Q + +   K ++  KL    +Y ++  + LEAR KLNK+KP ++GQASR+SG++  D+  + +YLE +K+Q
  S:     7 EYDVAVVGAGHAGCEAALAAARLGVKTVVFAINLDSIANMPCNPNIGGTAKGHLVREIDALGGEMGKNADKTFIQSKILNSAKGPAVYSLRAQVDRRSYQIEMKNTLEKQENLDVKQAEIVEILYDEVEGKKTVRGVKTHTGAIYKSKVVILATGTYLKGKIIIGDVSYSGGPDGLFPANKLSDSLREMGIELMRFKTGTPARVNRRSIDFSKMEEQPGDERIVPFS-FENE--EIKKEQVSCYLTYTNSETHRIIRENLHRSGLFGGLIEGIGPRYCPSIEDKVVRFSDKESHQVFVEPMGLNTQEMYLQGMSTSLPEDVQIEMLRTIPGLENVSIMRNAYAIEYDCINPTQLKLSLELRDVEGLFTAGQINGTSGYEEAAAQGIIAGINAARKIKGLEPLILDRSQAYIGVLIDDIVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTPIGYEVGLISEERYRKFEEKRRLIEQEIERVKKTNIAPTEKVNEFLKKHNSTPIKSGVKLADLLRRPELDYDTLAEIDENRPDLSFAVREQVSISIKYEGYIKRQMQQVEQFKKLEERKLDKDINYDEIKGLRLEARQKLNKIKPESVGQASRISGVSPADISVLLVYLEQRKRQ 628
>gi|116874161|ref|YP_850942.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123464237|sp|A0AMD1|GIDA_LISW6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|116743039|emb|CAK22163.1| gidA [Listeria welshimeri serovar 6b str. SLCC5334] (629 aa)
Score = 1299, Expect = 5.8e-141, Identities = 263/610 (43%), Positives = 390/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD   +  + Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++ ++EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I +KY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDHL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVDMMLD-QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFDKEPIILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFITDEIAEQVEIQVKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGK 623
>gi|186686455|ref|YP_001869651.1| glucose inhibited division protein A [Nostoc punctiforme PCC 73102] >gi|186468907|gb|ACC84708.1| glucose inhibited division protein A [Nostoc punctiforme PCC 73102] (670 aa)
Score = 1299, Expect = 5.9e-141, Identities = 264/610 (43%), Positives = 377/610 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-------KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EY+    N +E  E + + +  V  +    N +V GV T     F    +I+TTGTFL   I +G+K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYSK+ I+PG      FS FD +     +Q  CY+  T  + H +I +NL  S +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q Q+++ + G E  V+ + AYA+EYD +   Q YPTL TKK+ GLF AGQINGT+GYEEAA QGL+AGIN    + ++E +V  R ++YIG L++DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    WD + +   N     + L+ + +K   E           + K + TL ++L+RP + ++D++ F      L+   K+  +I IKY GY+  QQ  I+      + +L +  DY  +  +S EAR+KL  VKPLTLGQA+R+ G+N  D+  + LYLE +K
  S:    43 FDVIVVGAGHSGCEAALASARLGCRTLLLTLNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKVADRTYLQKRILNSSRGPAVWALRAQTDKREYAAVMKNIVENQENLTIRESMVTDLVLGANDEVIGVETYFGVGFRCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTQTLNRLGFETGRLKTGTPARVDKRSVDYSKMLIQPGDEDVRWFS-FDPEAWVEREQMPCYITRTTTETHRLIQDNLHLSPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPENLQLQMLRTLPGLEKCVMLRPAYAVEYDYLPATQCYPTLMTKKVAGLFCAGQINGTTGYEEAAAQGLVAGINAARFVHSQEMIVFAREQSYIGTLVDDLCTKDLREPYRMLTSRSEYRLLLRSDNADQRLTTLGREIGLIDDRRWDLFTQKQANIITEKQRLQATRVKEHDEMGIAIASDTQQAIKGSITLNDLLRRPGFHYVDLDRFGLGNPNLNRAEKEGAEIDIKYYGYLARQQNQIDQIARQAHRQLPADLDYTTIDTLSKEAREKLTHVKPLTLGQAARIGGVNPADVNALLLYLELRK 659
>gi|126655030|ref|ZP_01726469.1| glucose-inhibited division protein A [Cyanothece sp. CCY0110] >gi|126622509|gb|EAZ93214.1| glucose-inhibited division protein A [Cyanothece sp. CCY0110] (634 aa)
Score = 1299, Expect = 6.9e-141, Identities = 266/611 (43%), Positives = 382/611 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLEN--------FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +V+GAGH+G EAA   A+   +  +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EYS      +E  E + + +  V  +    N +V G+ T     F++  +I+TTGTFL   I IG+K ++ G      +  L   + +L F+T RLKTGTP R+ K S+DYSKL+ +P   +   FS FD +     +Q  CYL  T  K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q  +++ + G EN V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQ+NGT+GYEEAA QG++AGIN +  ++N E ++  R E+Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DNADQR+   G E+GLI    W  +     N        +   +KE +   +K V + +    K + TL ++L+RP + +  +E +      L    K+  +I IKY GY+K QQ  I+      N KL S  DY  +  +S+EAR+KL KV+PLTLGQASR+ G+N  D+  + +YLE + +
  S:    13 FDIIVVGAGHSGCEAALAAARLGCRTLMLTLNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNSSRGPAVWALRAQTDKREYSAVMKEIVENQENLSIREGMVTDLVLGKNDEVIGIQTYFGTCFQAKAVILTTGTFLGGRIWIGNKSMEAGRAGEFAAVGLTDTLNDLGFETGRLKTGTPARVDKRSVDYSKLEPQPPDEEVRWFS-FDPEVWVEKEQMNCYLTRTTTKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGREIPELYIQGFSTGLPENIQLAMLRTLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKIQGLFCAGQVNGTTGYEEAAAQGIVAGINAVKFVKNEEMIIFPREESYLGTLVDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRMTPLGREIGLIDDRRWALFEHKQANIVAEKERLYETRIKERDEVAIKIVNDTQ-QKIKGSATLADLLRRPKFHYQHLEKYGLGNQNLTIVEKEGAEIDIKYSGYLKRQQIQIDQITRHSNKKLPSDLDYMAIDTLSMEAREKLTKVRPLTLGQASRIGGVNPADINALLVYLELRSR 630
>gi|167748064|ref|ZP_02420191.1| hypothetical protein ANACAC_02808 [Anaerostipes caccae DSM 14662] >gi|167652056|gb|EDR96185.1| hypothetical protein ANACAC_02808 [Anaerostipes caccae DSM 14662] (627 aa)
Score = 1299, Expect = 7.1e-141, Identities = 268/607 (44%), Positives = 388/607 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWD---EYNKNLENFNNTLKELETSTLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+GAGHAG EAA   A+  +K   F +    +  MPCNP+IGG +KG + +EIDALGG   +  D T +Q K+LN SKG    +LRAQ DK  YS      +   + + +   EV  I   N KV GV T     + +  +I+TTGT+L +    G    + GP+    +  L + +K+L  +  R KTGTP RI KNSID++K++ + G +K   FS F     D  + ++ C+L +TN + HEII  N+ +S ++SG I GTGPRYCPSIEDK+V+F DK RHQ+F+EPE ++ + +Y+GG+SSSLPEDVQ  + +++ G EN  I + AYAIEYD IN  QL P+LE +KI GLF AGQ NG+SGYEEAA QGL+AGIN    ++ +E LVL R++AYIGVLI+DL+ KE ++PYR++TSRAEYRL LR DNAD RL K GYE+GLIS+  +    E    +E   N L  +       V++     +    K++ T+ E+++RP+ ++  + P   ++    E  +++V+I IKY GYIK Q   +   K ++  K+     Y+D+ N+ +EA  KL+K++P ++GQASR+SG++  D+  + +YLE
  S:     8 YDIVVVGAGHAGCEAALASARLGFKTICFTVSMDSIALMPCNPNIGGSSKGHLVKEIDALGGEMGVNIDKTYIQSKMLNRSKGPAVHSLRAQADKKMYSMAMTQTMGNTKNLTVRQGEVTQILTQNGKVTGVKTYSGAVYHAKAVILTTGTYLKARCIYGDVSNETGPNGLQAANYLTQSLKDLGIEMRRFKTGTPARIDKNSIDFNKMEEQFGDDKIVPFS-FTNTREDIQRDQISCWLTYTNEETHEIIRENIGRSPLFSGAIEGTGPRYCPSIEDKIVKFPDKNRHQVFIEPEGEYTNEMYVGGMSSSLPEDVQYAMYRSVTGLENVKIIRNAYAIEYDCINATQLKPSLEFRKIGGLFSAGQFNGSSGYEEAAAQGLIAGINAARMIQGKESLVLDRSQAYIGVLIDDLVTKETSEPYRMMTSRAEYRLLLRQDNADLRLSKIGYEMGLISEERYQNLLEKEARIEKEINRLSRVNVGASGKVQDLLSKCQSTELKSSATMAELIRRPELTYDMLSPIDPDRPEYPEDVREQVNINIKYEGYIKRQLSQVRQFKRLEKKKIPEGIKYEDIGNLRIEAIQKLSKIRPASIGQASRISGVSPADISVLLIYLE 621
>gi|169333909|ref|ZP_02861102.1| hypothetical protein ANASTE_00295 [Anaerofustis stercorihominis DSM 17244] >gi|169259474|gb|EDS73440.1| hypothetical protein ANASTE_00295 [Anaerofustis stercorihominis DSM 17244] (625 aa)
Score = 1299, Expect = 7.2e-141, Identities = 291/613 (47%), Positives = 397/613 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDE---YNKNLENFNNTLKELET--STLKNVK--EFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD +VIGAGHAG EAA   A+K     L  L+   +  MPCNPSIGG  KG + REIDALGG      D T +Q K LN++KG    +LRAQ DK +Y +     IE  + +DL  +E   I   + KV GV T     +++  +++ +GT+L   I IG      GP+    +  L+  +K+L F+ +RLKTGTP R+ K SID+SK++I+ G  +   +SF + D+  L++++Q  CYLA+TN K HE+IN+NL +S +YSG ITG GPRYCPSIEDK+VRF DKERHQLFVEPE  + + +YL G+SSSLPEDVQ + ++ I G EN  I + AYAIEYDA+ P Q+  +LE+K +KGLF AGQINGTSGYEEAA QGL+AGIN    ++NREPL+L R+ +YIGVLI+D+  K   +PYR+ TSR EYRL LR DNAD RL  YG+E GLIS+  ++    Y + +      LKE++   S   N+K         K   T+Y+++KRP  S+ D + F +N+  L    K +V+I IKY  YI  QQ  I+  K+++   L    +Y ++ N+ LEAR KL  ++P  LGQASR+SG++  D IN+ L    K KQ
  S:     7 EYDVIVIGAGHAGCEAALASARKGSSTLLLTLNLDALAMMPCNPSIGGTGKGHLVREIDALGGEMGKNIDKTFIQTKTLNTAKGVAVQSLRAQADKKKYQEEMKFVIENTDNLDLKQQEAVEILTEDGKVSGVITHTGAMYKTKAIVICSGTYLKGRIIIGDVSYSGGPNGIFPANKLSDSLKKLGFKLLRLKTGTPARVNKRSIDFSKMEIQFGDKEITPFSFENEDKD-LEYDEQP-CYLAYTNEKTHEVINDNLHRSPLYSGNITGIGPRYCPSIEDKIVRFADKERHQLFVEPEGLNTNEMYLQGMSSSLPEDVQVKFLRTIKGLENVEIMRVAYAIEYDAVEPTQIELSLESKIVKGLFTAGQINGTSGYEEAAAQGLIAGINAANYVQNREPLILDRSSSYIGVLIDDITTKGTKEPYRMFTSRVEYRLLLRQDNADLRLTPYGFEQGLISKERYERLLGYEETVNKEKARLKEIKITPSNENNIKLESIGTTPLKNTITVYDLIKRPKISYDDTKIFDENRPELSRRVKQQVEIQIKYHDYIIKQQASIDKFKSMEKKVLPEDINYNEIKNLRLEARQKLEDIRPKNLGQASRISGVSPSD-INVLLIELAKNKQ 625
>gi|47095617|ref|ZP_00233225.1| glucose-inhibited division protein A [Listeria monocytogenes str. 1/2a F6854] >gi|153180989|ref|ZP_01933956.1| glucose-inhibited division protein A [Listeria monocytogenes F6900] >gi|153184306|ref|ZP_01935065.1| glucose-inhibited division protein A [Listeria monocytogenes J0161] >gi|153192597|ref|ZP_01939557.1| glucose-inhibited division protein A [Listeria monocytogenes J2818] >gi|153197354|ref|ZP_01941604.1| glucose-inhibited division protein A [Listeria monocytogenes 10403S] >gi|47016047|gb|EAL06972.1| glucose-inhibited division protein A [Listeria monocytogenes str. 1/2a F6854] >gi|126942809|gb|EBA20543.1| glucose-inhibited division protein A [Listeria monocytogenes J0161] >gi|127633073|gb|EBA22491.1| glucose-inhibited division protein A [Listeria monocytogenes 10403S] >gi|127763634|gb|EBA24468.1| glucose-inhibited division protein A [Listeria monocytogenes J2818] >gi|133731507|gb|EBA33205.1| glucose-inhibited division protein A [Listeria monocytogenes F6900] (629 aa)
Score = 1299, Expect = 7.2e-141, Identities = 266/610 (43%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAETVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGK 623
>gi|16804847|ref|NP_466332.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria monocytogenes EGD-e] >gi|47093269|ref|ZP_00231040.1| glucose-inhibited division protein A [Listeria monocytogenes str. 4b H7858] >gi|153176116|ref|ZP_01931375.1| glucose-inhibited division protein A [Listeria monocytogenes FSL N3-165] >gi|153204446|ref|ZP_01945243.1| glucose-inhibited division protein A [Listeria monocytogenes HPB2262] >gi|168267006|ref|ZP_02688971.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria monocytogenes FSL J2-071] >gi|21263664|sp|Q8Y3M5|GIDA_LISMO tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|16412310|emb|CAD01023.1| gidA [Listeria monocytogenes] >gi|47018343|gb|EAL09105.1| glucose-inhibited division protein A [Listeria monocytogenes str. 4b H7858] >gi|133728829|gb|EBA30527.1| glucose-inhibited division protein A [Listeria monocytogenes FSL N3-165] >gi|133734226|gb|EBA35924.1| glucose-inhibited division protein A [Listeria monocytogenes HPB2262] (629 aa)
Score = 1298, Expect = 7.7e-141, Identities = 266/610 (43%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGK 623
>gi|153815416|ref|ZP_01968084.1| hypothetical protein RUMTOR_01651 [Ruminococcus torques ATCC 27756] >gi|145847275|gb|EDK24193.1| hypothetical protein RUMTOR_01651 [Ruminococcus torques ATCC 27756] (636 aa)
Score = 1298, Expect = 7.9e-141, Identities = 272/610 (44%), Positives = 394/610 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVN------QKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWD---EYNKNLENFNNTLKELETSTLKNV----KEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           +YD  V+GAGHAG EAA   A+  +K  +F +    +  MPCNP+IGG +KG + +EIDALGG      D T +Q K+LN SKG    +LRAQ DK +YSK     +EE + +D+   EV  I   +      +K+ GV T     +    +I+ TGT+L +    G    + GP+    +  L   +K L  +  R KTGTP RI KNSID++K++ + G  +   FS F     D    +V C+L +TN   HEII  NLD+S ++SG I GTGPRYCPSIEDKVV+F DK RHQ+F+EPE  H + +Y+GG+SSSLPEDVQ  + +++ G E+A I + AYAIEYD I+  QL  TLE K I+GLF  GQ NG+SGYEEAA QG++AGIN   +L+ +E +V+ R++ YIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNADQRL K GY++GLIS+  ++   E  + +E   + ++ +   T + V    K ++     + TTL E+++RP+ S+  + P  KN+  L E    +VDI IKY GYIK Q + +   K ++N K+    +Y ++ ++ +EA+ KLN+++P ++GQASR+SG++  D+  + +YL ++
  S:    14 QYDIAVVGAGHAGCEAALACARLGFKTVMFTVSVDSIALMPCNPNIGGSSKGHLVKEIDALGGEMGKVIDKTFIQSKMLNQSKGPAVHSLRAQADKSDYSKEMRRVLEEQDNLDIRQMEVTDIIADDPNESGIRKIKGVQTYSGAIYPCKAVILCTGTYLKARCIYGEISTQTGPNGLQSANYLTDSLKSLGIKMYRFKTGTPARIDKNSIDFTKMEEQKGDERVVPFS-FTTDPEDVQIDQVSCWLTYTNETTHEIIRENLDRSPLFSGAIEGTGPRYCPSIEDKVVKFPDKNRHQVFIEPEGIHTNEMYVGGMSSSLPEDVQYAMYRSVPGLEHAKIVRNAYAIEYDCIDARQLKSTLEFKNIEGLFSGGQFNGSSGYEEAAAQGIVAGINAARKLQGKEGIVIDRSQGYIGVLIDDLVTKESREPYRMMTSRAEYRLLLRQDNADQRLTKIGYKIGLISEERYEKLLEKERLIEEEIHRVERVNIGTSEEVQNLLKTYESTPLTSGTTLAELIRRPELSYEKLAPIDKNRKNLPEDVAQQVDINIKYDGYIKRQMRQVEQFKKLENKKIPEDINYDEIKSLRIEAKQKLNQIRPASIGQASRISGVSPADVSVLLVYLGSR 636
>gi|16802001|ref|NP_472269.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria innocua Clip11262] >gi|21263670|sp|Q926U8|GIDA_LISIN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|16415483|emb|CAC98167.1| gidA [Listeria innocua] (629 aa)
Score = 1298, Expect = 8.6e-141, Identities = 264/610 (43%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD   +   +Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMML-EQLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQRAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGK 623
>gi|149178844|ref|ZP_01857424.1| glucose-inhibited division protein A [Planctomyces maris DSM 8797] >gi|148842319|gb|EDL56702.1| glucose-inhibited division protein A [Planctomyces maris DSM 8797] (610 aa)
Score = 1298, Expect = 8.7e-141, Identities = 260/611 (42%), Positives = 374/611 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYS---KWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT--LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG EAA   A+   K AL  ++   VG M CNP+IGG AKG + REIDALGG      D T +Q ++LN SKG    + RAQ DK  Y    KW   ++E+ + + L  + V S+   N ++CGV    +  + +  +I+TTGTFL + +H G    K G      +  L+  + +L F+  R KTGTP R+   +ID+S L+ +PG  +   FS+   K     +Q  CYL  TN  +H +IN NL ++ MYSG I  TGPRYCPSIEDKVVRF+++  HQ+F+EPE ++ +  Y  G+S+SLP DVQ++++ +I G E   I +Y YA+EYD   P QL PTLETK++ GL+FAGQ+NGT+GYEEAA QGL+AG+N   ++  +E L+L RNEAY+GVLI+DL+ K + +PYR+ TSRAE+RL LR DNAD+R+   G  +G +SQ  W+++            +   + +  + EF   +R    TL E L+R D  + D+  F        L E   ++  I ++Y GYIK Q   I   KN++ + +    DY+ VPN+  EA++KL++VKP  +GQA R+SG+   DL  + LYL +  +
  S:     9 YDIVVVGAGHAGCEAALASARLGAKTALLTMNCDTVGQMSCNPAIGGVAKGQIVREIDALGGEMGRVIDETGIQFRMLNLSKGPAMHSPRAQADKKAYQFCMKW---KVEQQDNLALRQEIVKSLIVENDQICGVEVHGDATYRARAVILTTGTFLQAIMHTGEAKTKGGRAGEGTTGTLSDSLAQLGFELQRFKTGTPARLNGRTIDFSVLEEQPGDERPQPFSYMTEKLT--QEQMPCYLTETNEHVHRVINENLHRAPMYSGQINSTGPRYCPSIEDKVVRFSERNSHQIFLEPEGRYTNEYYCNGISTSLPRDVQDEMIHSIRGLEKTEIMRYGYAVEYDFATPTQLKPTLETKRVAGLYFAGQLNGTTGYEEAAGQGLLAGLNAALKIAGKEDLILDRNEAYLGVLIDDLVTKGVDEPYRMFTSRAEFRLLLRQDNADRRMTPIGQRIGSVSQERWEQF------------QAYEAEISQIMEFIRGNRYQGQTLEEWLRRQDTGWEDICGFAPELKAFPLSERAIEQTLIEVQYAGYIKRQTAEIEKQKNVETLHIPDHIDYQLVPNLRNEAKEKLSRVKPRNIGQAGRISGVTPADLTVLVLYLNSSSR 607
>gi|58338214|ref|YP_194799.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus acidophilus NCFM] >gi|81170549|sp|Q5FHQ6|GIDA_LACAC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|58255531|gb|AAV43768.1| glucose inhibited division protein A [Lactobacillus acidophilus NCFM] (632 aa)
Score = 1297, Expect = 1.0e-140, Identities = 272/611 (44%), Positives = 379/611 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNT---LKELETSTLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG EAA   A    K  L  +   +V  MPCNPS+GGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y ++  + IE    + L    V+ +  V   VC GV T     + +  +++TTGT     I IG  +   GP++   S  L++ +++L F+  R KTGTPPR+  N+IDYSK + EPG    + +S+   D  +L    Q  C++ +TN   HE+I +NLD++ M++G I G GPRYCPSIEDKVVRF DK+RHQ+F+EPE K    +Y+G  S+S+PE+VQ ++V ++ G E+A + +  YAIEYD + P QL  TLETK +K LF AGQ+NGTSGYEEAA QGL+AGIN     + +    L RN+AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL +YG++LGLIS   +  + +  +   +T   L E+       V++F         K        L+RP  +  D+E     K   D Y K++V+I IKY GYIK ++  I   K  +  K+ +  DY  +  ++ EAR K  K++P TL QA R+SG+N  DL  + +Y++N +
  S:     9 EYDVIVVGAGHAGCEAALASAHMGQKTLLVTIGLDMVAFMPCNPSVGGPAKGTVVREIDALGGQMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHEYMKDTIENTPNLTLRQAIVDEL-VVEDGVCKGVITNTGAKYHAKSVVLTTGTAARGKIIIGELMYSSGPNNTTPSIKLSENLEKLGFKLRRFKTGTPPRVNGNTIDYSKTEEEPGDKVPRHFSYESKDENYL--QNQISCWMTYTNPVTHEVIRDNLDRAPMFTGVIKGVGPRYCPSIEDKVVRFADKDRHQIFLEPEGKTTKEVYVGDFSTSMPEEVQLKMVHSVAGLEHAEMMRPGYAIEYDVVEPWQLKHTLETKNVKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQGKSGFTLGRNDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLILRHDNADLRLTEYGHKLGLISDDRYQAFEEKKQAIKDTQARLHEITVHVTDEVQDFLKSIGQEPMKAGVKADVFLRRPHVTINDIERLTGQKIDGDRYVKEQVEIGIKYAGYIKKEETRIARLKRQEAKKIPADIDYNMIEGLATEARQKFEKIRPETLAQAERISGVNPADLAILSVYIQNGR 626
>gi|172037374|ref|YP_001803875.1| glucose inhibited division protein A [Cyanothece sp. ATCC 51142] >gi|171698828|gb|ACB51809.1| glucose inhibited division protein A [Cyanothece sp. ATCC 51142] (634 aa)
Score = 1296, Expect = 1.3e-140, Identities = 267/611 (43%), Positives = 382/611 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQ-KVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLEN--------FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +V+GAGH+G EAA   A+   +  +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EYS      +E  E + + +  V  +   N  +V G+ T     FE+  +I+TTGTFL   I IG+K ++ G      +  L   + +L F+T RLKTGTP R+ K S+DYS+L+ +P   +   FS FD       KQ  CYL  T +K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q  +++ + G EN V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQ+NGT+GYEEAA QG++AGIN +  + N E ++  R E+Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQR+   G ++GLI    W  + +   N        +   +KE +   +K V + +    K + TL ++L+RP + +  +E +      L    K+  +I IKY GY+K QQ  I+      N KL S  DY  +  +S+EAR+KL KV+PLTLGQASR+ G+N  D+  + +YLE + +
  S:    13 FDIIVVGAGHSGCEAALAAARLGCRTLMLTLNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNSSRGPAVWALRAQTDKREYSAVMKEIVENQENLSIREGMVTDLVLGNNDEVIGIQTYFGTCFEAKAVILTTGTFLGGRIWIGNKSMEAGRAGEFAAVGLTDTLNDLGFETGRLKTGTPARVDKRSVDYSQLEPQPPDEEVRWFS-FDPYVWVEKKQMNCYLTRTTSKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGREIPELYIQGFSTGLPENIQLAMLRTLPGLENCVMLRPAYAVEYDFLPATQCYPTLMTKKIQGLFCAGQVNGTTGYEEAAAQGIVAGINAVKFVNNEEMIIFPREESYLGTLIDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRMTPLGRKIGLIDDRRWALFEQKQANIVAEKERLYETRIKERDEVAIKIVNDTQ-QKIKGSATLADLLRRPKFHYQHLEQYGLGNKDLTIVEKEGAEIDIKYSGYLKRQQIQIDQITRHSNKKLPSDLDYMTIDTLSMEAREKLTKVRPLTLGQASRIGGVNPADINALLVYLELRSR 630
>gi|46908999|ref|YP_015388.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria monocytogenes str. 4b F2365] >gi|67460831|sp|Q71VV1|GIDA_LISMF tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|46882272|gb|AAT05565.1| glucose-inhibited division protein A [Listeria monocytogenes str. 4b F2365] (632 aa)
Score = 1296, Expect = 1.3e-140, Identities = 266/610 (43%), Positives = 389/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFAKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGK 623
>gi|20807573|ref|NP_622744.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermoanaerobacter tengcongensis MB4] >gi|22095718|sp|Q8RAT8|GIDA1_THETN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA 1 (Glucose-inhibited division protein A 1) >gi|20516110|gb|AAM24348.1| NAD/FAD-utilizing enzyme apparently involved in cell division [Thermoanaerobacter tengcongensis MB4] (633 aa)
Score = 1296, Expect = 1.3e-140, Identities = 271/613 (44%), Positives = 395/613 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTT-------LYEILKRP--DY---SFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD  V+G GHAG EAA   A+       F  +   +  M CNPSIGGPAK  + REIDALGG  AI  D + LQM+ LN+SKG    +LRAQ+DK  Y     + +E  E +D+   E+  I   + KV GV T     ++    I+TTGTFL   + IG    + GP     +  L++ +K L F+ +R KTGTPPR+ K SID+SK++I+PG      +SF H D+  ++   Q  C+L +TN K H+II +N+ ++ +++G ITG G RYCPSIEDKVV+F  +ERHQ+F+EPE +    +Y+ G+SSSLPEDVQ + ++ + G EN  + + AYAIEYD I+P QL  TLE+K I+GL+FAGQ+NGTSGYEEAA QGLMAGIN   ++ N+ P+VL R++AYIG+LI+DL+ K   +PYR+LTSRAEYRL LR DNAD RL + G E+GL+++  ++++ +        ++ L T  ++  +E         +T       LY +LKRP  DY    F+D +   +  + LD    +++DI IKY GYI  Q + +   K ++N K+    DY  +  +S EA++KL+K++P ++GQASR+SG++  D+  + +YL+  +K+
  S:     7 EYDVCVVGLGHAGSEAALASARLGLSTVGFATNLDAIALMACNPSIGGPAKAQLVREIDALGGQMAINTDKSLLQMRTLNTSKGPAVRSLRAQVDKKLYQMNMKHTLERQENLDIKQAEIVDILVEDNKVTGVVTKLGAIYKCKACIITTGTFLKGRVIIGEVDFESGPSGLFPASELSEALKRLGFKLMRFKTGTPPRVDKRSIDFSKMEIQPGDEVITPFSFMH-DKIEIE---QMPCWLTYTNEKTHKIIRDNIHRAPLFTGAITGVGVRYCPSIEDKVVKFPHRERHQIFIEPEGRDTYEMYVQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIEYDCIDPTQLKATLESKWIEGLYFAGQVNGTSGYEEAAAQGLMAGINAAMKILNKPPVVLDRSQAYIGILIDDLVTKGTNEPYRMLTSRAEYRLLLRQDNADFRLTEIGKEIGLVTEERYEKFLRKKIQLEKEMRRLSTVMVRPTEEVNNFLISRGSTPLVSGVDLYTLLKRPEVDYKSTKFLDPD---RPDDILDSV-AEQIDINIKYEGYILKQLRQVEQFKAMENKKIPEDIDYYQISGLSNEAKEKLSKIRPTSVGQASRISGVSPADISVLLIYLQQMRKK 625
>gi|153956502|ref|YP_001397267.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium kluyveri DSM 555] >gi|189039335|sp|A5N450|GIDA_CLOK5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|146349360|gb|EDK35896.1| GidA [Clostridium kluyveri DSM 555] (628 aa)
Score = 1296, Expect = 1.6e-140, Identities = 263/614 (42%), Positives = 401/614 (65%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQ-KVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++YD +VIGAGHAG EA    A+   +  +  ++   +G MPCNP+IGG AKG + REIDALGG   +  D T +Q ++LN+SKG    +LRAQ DK  YS    + +E    +DL   EV  I+  N+ KVCGV T +  +FE+  ++++TGT+L   + IG      GP+ F  +  L++ + +L  +  R KTGTP R+ + S+D+SK+  +PG  +   FS F  + LD  KQ  CYL +T     ++I  N+++S +++G I   GPRYCPSIEDK+VRF +KE HQ+F+EPE +  + +Y+ G S+S+PEDVQ  + + I+G EN    +  YAIEYD INP+QL PTLE KK++GLF AGQ+NG+SGYEEAA QG++AGIN   +++ +EP +LKR++AYIGVLI+DL+ K   +PYR++TSR+EYRL LR DNAD RL + GY++GL+++  +D+Y     ++E     +K L  +  K V EF      +  K + +LYE++KRP+  +  ++    ++  L+E  +++V+I  KY GYIK Q + +   K  +N  +    DY ++  + +EA  KL K++P+++GQASR+SG++  D+  + +YLE K ++
  S:     6 ERYDVIVIGAGHAGCEAGLAAARMGCRTLMCTMNLDSIGFMPCNPNIGGTAKGHLVREIDALGGEMGVNIDATFIQSRMLNTSKGPAVHSLRAQADKRNYSGRMKSVLERQHNLDLKQLEVVGIRIDNEGKVCGVITKNGAYFETKTIVLSTGTYLKGKVIIGDVSYSSGPNGFMPANDLSQSLLDLGIEIRRFKTGTPARVNRRSVDFSKMIEQPGDKRIVPFS-FMSENLD-RKQVSCYLTYTTENTTKVIRENINRSPLFNGSIKSVGPRYCPSIEDKIVRFPNKENHQIFIEPEGEDTNELYVDGASTSMPEDVQIAMYRTIIGLENVEFLRTGYAIEYDCINPLQLRPTLEFKKVEGLFGAGQLNGSSGYEEAASQGIIAGINAALKVKGKEPFILKRSDAYIGVLIDDLVTKGTEEPYRMMTSRSEYRLILRQDNADLRLTEMGYKIGLVTKERYDKYLERKNSIETEIKRIKNLYITPKKEVIEFLNSLGSSELKKSISLYELIKRPELDYFKLQLLDMDRPELNEDVQEEVNIISKYEGYIKKQLEQVQQFKKFENKFIPENIDYDEIKGLRIEANQKLKKIRPISIGQASRISGVSPADISVLLVYLEKKHRE 625
>gi|147679251|ref|YP_001213466.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Pelotomaculum thermopropionicum SI] >gi|146275348|dbj|BAF61097.1| NAD/FAD-utilizing enzyme apparently [Pelotomaculum thermopropionicum SI] (631 aa)
Score = 1295, Expect = 1.8e-140, Identities = 264/612 (43%), Positives = 376/612 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNT--------TLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +V+GAGHAG EA    A+   +  +  L+   V  MPCNP++GGPAKG + RE+DALGG   +  D   +QM+LLN+ KG    ALRAQ DK  Y       +E    +DL    V  I     KV GV T     FE+  +++TTGT+L   I IG      GP+    S  L+  + +L  +  R KTGTP R+ +NSID+SK+ I+PG  K ++FS      +   +Q  C+L +T  + H II  NL ++ +Y+G I   GPRYCPSIE KVVRF+DK  HQ+F+EPE ++   +Y+ G+S+SLPEDVQ  +++ + G E   + +  YAIEYD +   QL P+LETK I GLF AGQINGTSGYEEAA QG+MAGIN    ++NREP +L R+EAYIGVLI+DL+ KEI +PYR+LTSRAEYRL LR DNAD RL + GY++GL+S   + +Y +  +      + LE + +    E K      N+        +L  +L+RP+  +  +     N   L +  +++V+I IKY GYIK QQ  +   + ++  K+    DY  V  +S+EAR+KL  ++P ++GQASR++G+   D+  + +YLE  +++
  S:     9 YDVVVVGAGHAGCEAGLAAARMGCRTLVLTLNMDNVALMPCNPAVGGPAKGHLVREVDALGGEIGLNTDRASIQMRLLNTGKGPAVHALRAQADKRYYQLCMKKVLECQPGLDLKQALVEKIMVEKGKVRGVLTSTGARFEAGAVVLTTGTYLKGRIIIGDLSFPGGPNGQFPSVTLSDCLADLGIKLGRFKTGTPARVDRNSIDFSKMSIQPGDKKTHNFSFISE--IKEREQLPCWLTYTTEETHRIIRENLHRAPLYTGVIKSQGPRYCPSIETKVVRFSDKPAHQVFIEPEGRNTTEMYVQGMSTSLPEDVQLAMLRTLPGLERVEMMRPGYAIEYDYVVATQLKPSLETKAIPGLFTAGQINGTSGYEEAAAQGIMAGINAALYVKNREPFILNRSEAYIGVLIDDLVTKEIDEPYRMLTSRAEYRLLLRQDNADLRLTEKGYKIGLVSPERYAKYERKKKLVEEERQRLEKTMVAVGDEVKRVLEAANSPGLPQQGISLAGLLRRPEIGYEHLLQIPGNHPDLPDEVREQVEIQIKYEGYIKKQQAQVEKFRRLEEKKIPQDIDYGRVRGLSVEAREKLEMIRPASIGQASRIAGVTPADVSVLLIYLERARRE 626
>gi|153168989|ref|ZP_01928728.1| glucose-inhibited division protein A [Listeria monocytogenes FSL N1-017] >gi|133725937|gb|EBA27635.1| glucose-inhibited division protein A [Listeria monocytogenes FSL N1-017] (629 aa)
Score = 1295, Expect = 1.9e-140, Identities = 266/610 (43%), Positives = 388/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F   R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFGLRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGK 623
>gi|167751435|ref|ZP_02423562.1| hypothetical protein EUBSIR_02431 [Eubacterium siraeum DSM 15702] >gi|167655681|gb|EDR99810.1| hypothetical protein EUBSIR_02431 [Eubacterium siraeum DSM 15702] (625 aa)
Score = 1294, Expect = 2.6e-140, Identities = 267/610 (43%), Positives = 380/610 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTT-------LYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K A+F L    + NMPCNP IGG AKG + RE+D+LGG    AAD T +Q ++LN  KG    +LR Q D+++Y  +  + +E  E +D+   EV  +   N K+ G+ T    F+ +  +I+TTGT+L   IHIG    + GPD+ + +  L + ++ L     R KTGTP R+ K SID+S ++ + G      F  FD  F   NK + CY+ +TN + H II +NLD+S +Y+G I G GPRYCPSIEDK+VRF+DK RHQLFVEP     D  YL G+SSSLPEDVQ + ++ I G E+  I + AYAIEYD  +P++LYPTLE KKI GLF AGQ N TSGYEEAA QG++AG+N   +++ RE  +  R  ++IG LI+DL+ K   +PYR++TSR+EYRL LR DNA+ RL+  G++ GLIS   +  + +     +N    ++ +T+   +E         T+         E+LKRP   + D+  F  N   L+    DK++I IKY GYIK+Q + I   K ++  +L +  DYK +  + LEA++KLNK +PL +GQA R+SG+N  D+  + ++L  +K
  S:     7 YDVIVVGAGHAGCEAALAAARLGCKTAVFTLSLDAIANMPCNPCIGGSAKGQLVRELDSLGGEMGRAADATFIQSRMLNKGKGPAVHSLRVQSDRVKYHTFMKSVLEHTENLDIKQAEVTEVCAENGKITGIKTRLGAFYPAGCVIITTGTYLGGKIHIGELNYQSGPDNVSAALQLTESLRNLGLSMRRFKTGTPARVHKRSIDFSVMEEQDGDEYITPFC-FDNTFKLENKVK-CYVTYTNAETHRIILDNLDRSPLYAGRIQGVGPRYCPSIEDKIVRFSDKPRHQLFVEPMGLDTDEYYLQGMSSSLPEDVQIKFLRTIKGLEHVEIMRPAYAIEYDCCDPLELYPTLEFKKISGLFGAGQFNCTSGYEEAAAQGVIAGMNAAMKIKGREQYIPDRTTSFIGTLIDDLVTKGCVEPYRMMTSRSEYRLLLRQDNANDRLVPIGHKFGLISDERYQRFLERKNILDNETSRIKKATIYPCEELNKMLESKGTSPITQGVKFIELLKRPQIDYRDLAQFDDNAPELEHDIIDKLEINIKYEGYIKTQTEKIEQMKRLEEKQLPTDIDYKTISGLRLEAQEKLNKYRPLNIGQAGRISGVNPADVSVLLIWLSGRK 621
>gi|51894469|ref|YP_077160.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Symbiobacterium thermophilum IAM 14863] >gi|81170583|sp|Q67J34|GIDA_SYMTH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|51858158|dbj|BAD42316.1| Glucose inhibited division protein A [Symbiobacterium thermophilum IAM 14863] (630 aa)
Score = 1293, Expect = 2.9e-140, Identities = 264/609 (43%), Positives = 379/609 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRI-EENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHW-------DEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           K+YD +V+GAGHAG+EAA   A+K  + A F    + +G M CNPSIGGPAKG + REIDALGG  A+ AD T LQM+LLNS KG    ALRAQIDK  Y+ W +  + E    +DL    V  I   + +V G+ T    F+ +  ++++TGT+L     IG      GP     +  L + +K L F+  R KTGTPPR+   ++D+S++  + G  + + FS      LD  +Q  C+L  T    HE+I  NL ++ M++G I G GPRYCPS+EDKVVRF DKE HQ+F+EPES+    +Y+ GLS+SLPE+VQ ++V+ + G E A + +  YAIEYD I   QL P+LETK ++GLF  GQINGTSGYEEAA QGL+AGIN  C +E REPLV+ R+E YIGVLI+DL+ K   +PYR+LTSRAE+R+ LR DNA  RL + G E GL+  + W       D      E    T+        + ++       K   TL ++L+RP+  +  +      +  LDE    +V+  +KY GYI  +Q+ ++  + ++  ++    DY+ +  +S+EAR+KL++++P TLGQASR+SG++  D+  + ++L+
  S:     5 KEYDVIVVGAGHAGIEAALAAARKGMRTACFTTTLENIGAMNCNPSIGGPAKGHLVREIDALGGQMALTADATFLQMRLLNSGKGPAVQALRAQIDKRAYA-WAMRLVLERTPNLDLKQAMVQEIVVEDGRVRGIVTATGIFYGAKAVVLSTGTYLHGRTIIGEVQRSSGPGGLAPAVGLTESLKRLGFEVGRFKTGTPPRVDGRTVDFSRMVRQDGDPEPHRFSFMSP--LDHREQLPCWLTHTTPASHELIRRNLHRAPMFTGVIEGRGPRYCPSVEDKVVRFADKESHQVFLEPESRESHEMYVLGLSTSLPEEVQIELVRTVPGMEEAELMRPGYAIEYDYIVSTQLKPSLETKLVRGLFCGGQINGTSGYEEAAAQGLIAGINAACYVEGREPLVISRSEGYIGVLIDDLVTKGSPEPYRMLTSRAEFRMMLRQDNAHLRLTEKGREYGLVDDARWEVFVALRDGIEAERERLARTVVGPAPEVQRVLERLGSAPLKAGVTLEQLLRRPEVRYEHLVEMGLGRPDLDEAIWREVETQVKYAGYIAKEQQQVDRMRRMEARRIPPTLDYQALTGLSMEAREKLSRIRPETLGQASRISGVSPADVAVLMVHLD 618
>gi|167218570|ref|ZP_02288206.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria monocytogenes FSL J1-175] (629 aa)
Score = 1293, Expect = 3.0e-140, Identities = 265/610 (43%), Positives = 388/610 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL K++PL++ QA R+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKKIEPLSIAQARRISGVNPADISILLVYIEQGK 623
>gi|191639863|ref|YP_001989029.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) [Lactobacillus casei] >gi|190714165|emb|CAQ68171.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) [Lactobacillus casei BL23] (633 aa)
Score = 1293, Expect = 3.0e-140, Identities = 264/610 (43%), Positives = 375/610 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG--TNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  +  +++  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +   + IE    +DL       +   N +  G+       + +  +++T GT     I IG  +   GP++   S  L++ +++L F+  R KTGTPPR+  N+ID+ K + +PG  T   +SF+  D  +L    Q  C++ +TN   H+II +NLD++ M+SG I G GPRYCPSIEDK+VRF DK RHQLF+EPE +     Y+G  S+S+PE++Q +++ ++ G E+A + +  YAIEYD I P QL  TLETK +  LF AGQ+NGTSGYEEAA QG+MAGIN   + + + P  LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G+ELGLIS   + E+    +     L  L T+ LK       ++   Y   K      + LKRP+  +  M  FL +  TLD    ++V+I IKY GYI  ++  +   K ++  K+    +Y  +  ++ EAR KL K++P T+ QASR+SG+N  D+  + +Y+E  +
  S:    12 YDVIVVGAGHAGCEAALAAARMGQKTLLLTISLEMLAFMPCNPSLGGPAKGIVVREIDALGGEMGKNIDRTYIQMRMLNTGKGPAVRALRAQADKAAYHRSMKHVIENTPNLDLRQGLATEVLVENGQAVGIVAATGAMYRAKSVVLTAGTSSRGKIIIGELMYSSGPNNSLPSIKLSENLEQLGFKLRRFKTGTPPRVNGNTIDFDKTEEQPGDKTPNHFSFTTPDSVYL--KDQLSCWMTYTNATTHQIIRDNLDRAPMFSGVIKGVGPRYCPSIEDKIVRFADKPRHQLFLEPEGRDTSEYYVGDFSTSMPEEIQLKMLHSVAGLEHAELMRAGYAIEYDVIEPWQLKATLETKVVDNLFTAGQMNGTSGYEEAAGQGIMAGINAALRAQGKGPFTLKRSDAYIGVMIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTPMGHELGLISDERYAEFLAKRQAIETELNRLNTTRLKPKDVNPWLEAHHYAPLKDGVLASDFLKRPEIDYQTMAQFLPDNPTLDHRVIEQVEIQIKYAGYIAKEEASVAKLKRLEGKKIPLRINYAAINGLATEARQKLVKIQPETIAQASRISGVNPADVAILSVYIEQGR 627
>gi|90961108|ref|YP_535024.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus salivarius UCC118] >gi|122449445|sp|Q1WVH6|GIDA_LACS1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|90820302|gb|ABD98941.1| Putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit [Lactobacillus salivarius UCC118] (637 aa)
Score = 1293, Expect = 3.4e-140, Identities = 272/612 (44%), Positives = 387/612 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG--TNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHW---DEYNKNLENFNNTLKELETSTLKNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKN-KNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           K YD +V+GAGHAG EAA   A+   +  L  ++ ++V  MPCNPSIGGPAKGIV REIDA+GG      D T +QM++LN+ KG    ALRAQ DK +YS    + IE+  ++ L    V+ +   + +V GV T     + +  +++TTGT     I IG  +   GP++   +  L+K + +L F+  R KTGTPPR+  N+IDY K + +PG      +S+   D  +L    Q  C+L +TN   H+II +NLD++ M++G I G GPRYCPSIEDK+VRF+DK RHQLF+EPE ++ D  Y+ GLS+SLPE+VQ+++V++I G E+A + +  YAIEYD ++P QL PTLETK IKGL+ AGQ NGTSGYEEAA QG +AG+N   + +  E + LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   +   +E    +E     L ++       V  F   +  R  K      E L+RP  ++ D+  F+      LD    ++++I  KY GYIK +   +   K ++  K+ +  DY  +  I+ EA+ KL K++P TL QA R+SG+N  DL  + +Y+E  K
  S:    10 KDYDVIVVGAGHAGCEAALASARMGNETLLITINLEMVAFMPCNPSIGGPAKGIVVREIDAMGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKRQYSIEMKHTIEQTPHLTLRQGIVDDLIIEDGEVKGVVTNTGACYGAKSVVLTTGTAARGKIIIGELMYSSGPNNTQPALELSKNLAKLGFELKRFKTGTPPRVDGNTIDYDKTEEQPGDVEPNHFSYESKDEDYLKVKDQLSCWLTYTNEYTHKIIQDNLDRAPMFTGVIEGVGPRYCPSIEDKIVRFSDKPRHQLFLEPEGRNTDEYYVQGLSTSLPEEVQQEMVRSIDGLEHAEMMRPGYAIEYDVVSPYQLRPTLETKLIKGLYTAGQTNGTSGYEEAAGQGFIAGVNAGRRAKGLEEITLKRSDAYIGVMIDDLVTKGTNEPYRLLTSRAEYRLILRHDNADLRLTELGHEIGLISDERYAAFEEKKAQIEAEKQRLSKIRIKPNAEVNAFVEAHGDRELKDGVLATEFLRRPYVTYQDLLKFIPAPAEPLDRRVIEQIEIQFKYEGYIKKEYAKVEKLKRMEAKKIPARIDYSRIEGIATEAQQKLAKIQPETLAQAGRISGVNPADLSILAVYIEQGK 631
>gi|167730716|emb|CAO81628.1| glucose-inhibited division protein A [Candidatus Cloacamonas acidaminovorans] (615 aa)
Score = 1292, Expect = 4.6e-140, Identities = 266/613 (43%), Positives = 386/613 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPF-LKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL-ENKKKQ 615
           K+D +V+GAGH+G+EA+   AK+  KVALF +  + +G M CNPSIGGPAKG + REIDALGG  A +AD + +  ++LN SKG   WA R+Q D+ +Y       +E+ E I LI+  +  I   N  V GV +     + +  +I+ TGTFL   IHIG      G         L++ +     +  R KTGTPPR+   S++Y+KL+ + G      FS +  + ++      CY+  T  + H+II  NL +SA+YSG I G GPRYCPSIEDK+V+F  +E H +F+EPE  +    Y+ G+S+SLP ++QE+IV +I G E A I +YAYAIEYD I+P ++  +L+ KKIKGL+ AGQINGTSGYEEAA QGL+AGIN    LEN+EPL+LKR+EAYIGVLI+DL+ +   +PYR+ TSRAEYRL LR DNAD+RL+  GY+LGL+ +S W  + +  E     LK L+        E K   R       ++LKRP+ SF D++ +  K    ++   ++++++ IKY GY+   ++ I   +N + I +    DY  +P+++ EAR+KL+K++P  +GQA R+ GIN  D + + ++L +N KK+
  S:     6 KFDLIVVGAGHSGIEASLAAAKRGLKVALFTIKIEAIGRMSCNPSIGGPAKGHLAREIDALGGELAKSADLSGIHFRMLNRSKGPAVWAPRSQNDRQKYHLLMREAVEKQENIHLIEATIEEIIVENGCVKGVISQIGHCYYAPKIILATGTFLQGKIHIGKISYAGGRSGEPSVEYLSRSLSAWGLKVRRFKTGTPPRVDLRSVNYNKLEEQKGDENPQGFSFY--RDIEIKNLVSCYITHTTEETHQIIRANLTESALYSGIIKGIGPRYCPSIEDKIVKFPQRESHHIFIEPEGLNTFEGYVNGISTSLPAEIQEKIVHSIPGLEEARILRYAYAIEYDFIDPEEIDSSLQCKKIKGLYLAGQINGTSGYEEAAAQGLLAGINASLALENKEPLILKRSEAYIGVLIDDLVTRGTNEPYRMFTSRAEYRLLLRQDNADERLMPVGYKLGLVEESRWQRFLQMQEILRRELKYLKQHNCLPNGEIKEPIR-----FAQLLKRPEISFNDLQNYGYKIPADVNSDIQNRLELEIKYSGYLNRMEEEIQKFQNAETIAIPEEMDYFSIPSLAYEAREKLSKIRPKNIGQAMRIPGINYSDSVALMIWLRKNAKKE 613
>gi|177666595|ref|ZP_02942387.1| glucose inhibited division protein A [Cyanothece sp. PCC 8801] >gi|196246614|ref|ZP_03145332.1| glucose inhibited division protein A [Cyanothece sp. PCC 8802] >gi|172074314|gb|EDT59733.1| glucose inhibited division protein A [Cyanothece sp. PCC 8801] >gi|196205525|gb|EDY00326.1| glucose inhibited division protein A [Cyanothece sp. PCC 8802] (631 aa)
Score = 1292, Expect = 4.6e-140, Identities = 267/614 (43%), Positives = 389/614 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY------NSR-KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           ++D +V+GAGHAG EAA   A+   +  +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+   +  I EN+  +L  +E  +   +   N++V GV T     F +  +I+TTGTFL   I IG+K ++ G      S  L++ +  L F+  RLKTGTP R+ K S+DYS L+ +P  ++   FS FD       +Q  CY+  T ++ H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DK+ HQ+F+EPE + +  +Y+ G S+ LPE++Q  +++ + G EN V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQINGT+GYEEAA QG++AGIN +  ++ +E ++  R E+Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  +     N     + L  + +K   E         N + K + TL ++L+RP + +ID+E +      L+   K+  +I IKY GY+K QQ  I+      N +L    +Y  +  +S+EAR+KLNK+KPLTLGQASR+ G+N  D+  + +YLE + +Q+
  S:     8 QFDVIVVGAGHAGCEAALASARLGCRTLMLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAA-IMKEIVENQD-NLSIREAMATDLILGKNEEVIGVQTYFGTCFGAKAVILTTGTFLGGRIWIGNKSMEAGRAGEFASVGLSETLNRLGFEVGRLKTGTPARVDKRSVDYSNLETQPPDDEIRWFS-FDPDAWIEREQMNCYITRTTSQTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKDSHQIFIEPEGREIPELYIQGFSTGLPENIQLAMLRTLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGIVAGINAVRFVKKQEMIIFAREESYLGTLIDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWQLFQDKQANIIAEKERLHETRIKEKDEVAITIVNDTNQKIKGSITLADLLRRPQFHYIDLERYGLGNAQLNSVEKEGAEIDIKYSGYLKRQQNQIDQISRQSNRQLPEDLNYMKIETLSMEAREKLNKIKPLTLGQASRIGGVNPADINALLVYLELRSRQS 628
>gi|116496319|ref|YP_808053.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus casei ATCC 334] >gi|116106469|gb|ABJ71611.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Lactobacillus casei ATCC 334] (633 aa)
Score = 1291, Expect = 5.3e-140, Identities = 264/610 (43%), Positives = 375/610 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG--TNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  +  +++  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +   + IE    +DL       +   N +  G+       + +  +++T GT     I IG  +   GP++   S  L++ +++L F+  R KTGTPPR+  N+ID+ K + +PG  T   +SF+  D  +L    Q  C++ +TN   H+II +NLD++ M+SG I G GPRYCPSIEDK+VRF DK RHQLF+EPE +     Y+G  S+S+PE++Q +++ ++ G E+A + +  YAIEYD I P QL  TLETK +  LF AGQ+NGTSGYEEAA QG+MAGIN   + + + P  LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G+ELGLIS   + E+    +     L  L T+ LK       ++   Y   K      + LKRP+  +  M  FL +  TLD    ++V+I IKY GYI  ++  +   K ++  K+    +Y  +  ++ EAR KL K++P T+ QASR+SG+N  D+  + +Y+E  +
  S:    12 YDVIVVGAGHAGCEAALAAARMGQKTLLLTISLEMLAFMPCNPSLGGPAKGIVVREIDALGGEMGKNIDRTYIQMRMLNTGKGPAVRALRAQADKAAYHRSMKHVIENTPNLDLRQGLATEVLVENGQAVGIVAATGAMYRAKSVVLTAGTSSRGKIIIGELMYSSGPNNSLPSIKLSENLEQLGFKLRRFKTGTPPRVNGNTIDFDKTEEQPGDKTPNHFSFTTPDSVYL--KDQLSCWMTYTNATTHQIIRDNLDRAPMFSGVIKGVGPRYCPSIEDKIVRFADKPRHQLFLEPEGRDTSEYYVGDFSTSMPEEIQLKMLHSVAGLEHAELMRAGYAIEYDVIEPWQLKATLETKVVDNLFTAGQMNGTSGYEEAAGQGIMAGINAALRAQGKGPFTLKRSDAYIGVMIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLKPMGHELGLISDERYAEFLAKRQAIETELNRLNTTRLKPKDVNPWLEAHHYAPLKDGVLASDFLKRPEIDYQTMAQFLPDNPTLDHRVIEQVEIQIKYAGYIAKEEASVAKLKRLEGKKIPLRINYAAINGLATEARQKLVKIQPETIAQASRISGVNPADVAILSVYIEQGR 627
>gi|134301152|ref|YP_001114648.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Desulfotomaculum reducens MI-1] >gi|172044353|sp|A4J9S0|GIDA_DESRM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|134053852|gb|ABO51823.1| glucose inhibited division protein A [Desulfotomaculum reducens MI-1] (630 aa)
Score = 1291, Expect = 6.3e-140, Identities = 265/612 (43%), Positives = 386/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET-------STLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +++GAGHAG EA    A+   K  +  L+   +  MPCNP++GGPAK  + +EIDALGG   +  D   +QM++LN+ KG   +ALRAQ DK++Y +     +E  E +D+    V  I   N +V GV T     F +  ++VTTGT+L   I IG+     GP+    S  L++ ++ L  +  R KTGTP R+ + +ID++K+ I+PG  + ++FS+     +   +Q  C+L +T  K HEII  NL +S +YSG I G GPRYCPSIEDK+VRF DK +HQ+FVEPE  H   +Y+ G+S+SLP DVQ ++ + I G EN  I + AYAIEYD I P QL  TLETK+I GL+ AGQINGTSGYEEAA QG+MAGIN   Q++ ++P  L R+EAYIGVLI+DL+ K   +PYRL+T+RAEYRL LR DNAD RL + GY +GL+SQ  +D Y    ++ +  ++ L+T        T K +K  + +    NT    +L+RP+  +  +     +   L +   ++V+I +KY GYIK Q   +   + ++   L+   DY+ +  +SLEAR KL K KP ++GQASR+SG++  D+  + ++LE ++++
  S:     8 YDVIIVGAGHAGCEAGLAAARMGCKTLVLTLNLDNIALMPCNPAVGGPAKSHLVKEIDALGGQMGLTTDLAAIQMRMLNTGKGPAVYALRAQADKVKYQQLMKKNLETQENLDVKQLLVEEILVKNGRVTGVATQIGAEFSARAVVVTTGTYLKGRIIIGNVHFPGGPNSQFPSVNLSENLRSLGLELGRFKTGTPARVDRRTIDFTKMTIQPGDEEVHNFSYISP--VTQREQVPCWLTYTTEKTHEIIRENLHRSPLYSGIIEGVGPRYCPSIEDKIVRFADKPQHQIFVEPEGLHTYEMYVQGMSTSLPPDVQLKMYRTIPGMENVSIMRPAYAIEYDYIVPTQLRTTLETKEIIGLYAAGQINGTSGYEEAAAQGIMAGINAALQVQEKDPFYLSRSEAYIGVLIDDLVVKGTNEPYRLMTARAEYRLLLRQDNADHRLTQKGYNIGLVSQVRYDHYMNKWQSISKEMERLKTIVIPANEETNKVLKSLESSEITQNTPFINLLRRPEIKYNTLAGLSDHFLDLPQEVIEEVEIEVKYEGYIKKQLAQVERFEKLEGRILNIDIDYEMIKGLSLEARQKLKKFKPTSIGQASRISGVSPADISVLLIWLEQERRK 624
>gi|167462791|ref|ZP_02327880.1| glucose inhibited division protein A [Paenibacillus larvae subsp. larvae BRL-230010] (631 aa)
Score = 1290, Expect = 6.6e-140, Identities = 264/614 (42%), Positives = 385/614 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           +YD +VIGAGHAG E+A   A+      L  ++  +V  MPCNPSIGGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IE+   + +    V  +  V   VC GV T     +    +++TTGT+L   + +G  + + GP++   S  L++ ++ L F+ +R KTGTPPR+ K SID+SK +I+PG  +   FS+  R+ +   +Q  C+L +T+ +  E+I  NL ++ M+SG I GTGPRYCPSIEDK+VRF DK +HQ+F+EPE ++    Y+ GLS+S+PEDVQ  +++ I G E   + +  YAIEYDA+ P QL PTLETK ++GLF AGQINGTSGYEEAA QG+MAGIN   +++ +EP++L R+E YIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYE+GLI++  +  +          ++ L T+ ++        + E           L  +L+RP   +  +E    +   LD   K++V+I IKY GY + Q   +   K ++   +     Y+++  I+ EA+ KL K++P+++GQASR+SG++  D+  + +YLE+  + T
  S:     7 EYDVIVIGAGHAGCESALAAARMGCSTLLLTINLDMVAFMPCNPSIGGPAKGHVVREIDALGGEMGRNIDKTYIQMRMLNTGKGPAVHALRAQADKFLYQQTMKETIEKQPNLTMRQGMVEEL-IVEAGVCKGVITKSGAEYYGKAIVLTTGTYLRGKVIMGELMYESGPNNQQPSIKLSESLRNLGFELVRFKTGTPPRVHKESIDFSKTEIQPGDAEPEFFSYETREPVK-EEQLPCWLTYTSAETQELITENLHRAPMFSGVIEGTGPRYCPSIEDKIVRFADKPKHQIFLEPEGRYTSEYYVQGLSTSMPEDVQLSMLRTIPGLECVEMMRTGYAIEYDAVIPTQLKPTLETKLVEGLFTAGQINGTSGYEEAAGQGIMAGINAARKVQGKEPIILDRSEGYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTPIGYEIGLITEERYQAFLNKKGKVEQEIERLRTTKVRPEAFIQDLLAEAGTVQLNNAVDLLSLLRRPQIMYSHIEQMSPSPLELDGEMKEQVEIQIKYSGYSEKQLAQVERLKKMEKKLIPDDIVYEEIHGIATEAKQKLAKIRPISIGQASRISGVSPADISILLVYLEHYNQVT 626
>gi|163814996|ref|ZP_02206383.1| hypothetical protein COPEUT_01149 [Coprococcus eutactus ATCC 27759] >gi|158449679|gb|EDP26674.1| hypothetical protein COPEUT_01149 [Coprococcus eutactus ATCC 27759] (630 aa)
Score = 1290, Expect = 6.8e-140, Identities = 265/613 (43%), Positives = 392/613 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-------NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +++GAGHAG EAA   A+      +F +    V  MPCNP++GG +KG + REIDALGG      D T +Q K+LNSSKG    +LRAQ DK  YS+     +E  + + L   EV+ I   +  V GV T     +++  +++ TGT+L +    G  V   GP+    +  L+  +K       R KTGTP R+ K +ID+S+++ + G  K   FS F     D  ++++ C+L +TN K HEII NN+++S ++SG I GTGPRYCPSIEDKV +F DK RHQ+F+EPE +  + +Y+GG+SSSLPEDVQ  ++ ++ G ENA I + AYAIEYD IN I L P+LE K I GLF AGQING+SGYEEAA QGLMAGIN   +++ + P+VL R++AYIGVLI+DL+ KE ++PYR++TSRAEYRL LR DNAD RL   G+++GLI    + ++        K +    NT+     +  K +++      KT  +L E+++RP+ S+ D+E   + +  L +   ++++I IKY GYI  Q + ++  K +++ +L    DY+ + N+ LEAR KL+K++P  +GQASR+SG++  D+  + +Y++ K K
  S:     6 EEYDVVIVGAGHAGCEAALASARLGLNTIIFTVSMDSVAMMPCNPNVGGSSKGHLVREIDALGGEMGKNIDKTYIQSKMLNSSKGPAVHSLRAQADKANYSRTMKYTLENTDNLTLRQAEVSEILVDDGIVKGVKTYSGATYKAKAVVLCTGTYLKARCIYGDVVYHTGPNGLMAANHLSDSMKNAGISIRRFKTGTPARLDKRTIDFSQMEEQKGDEKIVPFS-FTNTESDIKREQISCWLCYTNEKTHEIIRNNIERSPLFSGVIEGTGPRYCPSIEDKVTKFPDKSRHQIFIEPEGEFTNEMYMGGMSSSLPEDVQYDMIHSMKGLENAKIIRNAYAIEYDCINAINLKPSLEFKTISGLFGAGQINGSSGYEEAAAQGLMAGINAARKVQGKTPVVLDRSQAYIGVLIDDLVTKETSEPYRMMTSRAEYRLLLRQDNADIRLTDIGHDIGLIDDERYSKFILKKKQIEKEIYRLENTMVGANATIQKFLEKKNSTGLKTAASLAELIRRPELSYEDIEEIDEGREKLPDDVIEQINITIKYKGYIDRQNQQVHQFKKLESRRLPDDIDYEQIKNLRLEARQKLSKIRPENIGQASRISGVSPADISVLLVYMKMKGK 625
>gi|17231053|ref|NP_487601.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Nostoc sp. PCC 7120] >gi|21263666|sp|Q8YR87|GIDA_ANASP tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|17132694|dbj|BAB75260.1| glucose inhibited division protein A [Nostoc sp. PCC 7120] (640 aa)
Score = 1290, Expect = 7.3e-140, Identities = 261/612 (42%), Positives = 377/612 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNV----KEFKYNSR---KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EY+    N +E  E + + +  V  +    N +V GV T     F+   +I+TTGTFL   I +G+K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYSK+Q++PG  +   FS FD       +Q  C++  T  + H +I  NL  S +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q Q+++++ G EN V+ + AYA+EYD +   Q YPTL TKKI GLF AGQ+NGT+GYEEAA QG++AGIN    + + E +V  R  +Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  + +  E      + L  + +K      K    N++   K + TL ++L+RP + ++D++ +      L    K+  +I IKY GY+  QQ  I         +L    DY  V  +S EAR+KLNKVKPLT+GQA+R+ G+N  D+  + +YLE ++ +
  S:    13 FDVIVVGAGHSGCEAALATARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALRAQTDKREYAAIMKNIVENQENLSIRESMVTDLVLGANDEVIGVETYFGVAFQCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTETLNRLGFETGRLKTGTPARVDKRSVDYSKMQLQPGDAEVRWFS-FDPDVWVEREQLPCHMTRTTPETHRLIRENLHLSPVYGGWVEAKGPRYCPSIEDKIVRFVDKESHQIFIEPEGRDIPELYIQGFSTGLPENLQLQMLRSLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKIAGLFCAGQVNGTTGYEEAAAQGIVAGINAARFVRDEEMIVFPREHSYLGTLVDDLCTKDLREPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWQMFTRKQEQITGEKERLYATRVKENDDVGKAIASNTQQAIKGSITLADLLRRPGFHYVDLDRYGLGNPELTPAEKEGAEIDIKYSGYLARQQSQIEQIARQAQRQLPGDLDYTTVDTLSKEAREKLNKVKPLTIGQAARIGGVNPADINALLIYLELRQSK 631
>gi|160941471|ref|ZP_02088806.1| hypothetical protein CLOBOL_06362 [Clostridium bolteae ATCC BAA-613] >gi|158435617|gb|EDP13384.1| hypothetical protein CLOBOL_06362 [Clostridium bolteae ATCC BAA-613] (631 aa)
Score = 1290, Expect = 7.8e-140, Identities = 267/612 (43%), Positives = 388/612 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL---KNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           + YD +++GAGHAG EAA   A+   +  +F +    +  MPCNP+IGG +KG + RE+DALGG      D T +Q K+LN SKG    +LRAQ DK +YS+     +E  E++ +   EV+ I   + K+ GV T     + +  +I+ TGT+L +    G      GP+    +  L   ++E   +  R KTGTP R+ K SID+SK++ + G  +   FS F     +  K +V C+L +TN   H II +NLD+S ++SG I GTGPRYCPSIEDKVV+F DK RHQ+FVEPE  + + +YLGG+SSSLPEDVQ  + + + G E   I + AYAIEYD IN +QL PTLE KKI GLF  GQ NG+SGYEEAA QG MAG+N + ++  +E +VL R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNAD RL K G+E+GL+    ++   + +++  + +K LE + +     V+ F   Y S   K+  TL E++KRP+  ++ +    + +  L +  +++V+I IKY GYIK Q + +   K +++ KL    DY +V ++  EA  KLNKV+P T+GQASR+SG++  D+  + ++   K+
  S:    13 ETYDVVIVGAGHAGCEAALASARLGMETIMFTVSVDSIALMPCNPNIGGSSKGHLVRELDALGGEMGKNIDKTFIQSKMLNESKGPAVHSLRAQADKQDYSRHMRRTLENTEHLTIRQAEVSEIMAEDGKIRGVKTFSGAVYYAKAVILCTGTYLKARCIYGDVSNPTGPNGLQAANHLTDSLREHGIEMFRFKTGTPARVDKKSIDFSKMEEQFGDLRIVPFS-FSTNPDEIQKDQVSCWLTYTNENTHRIIKDNLDRSPLFSGAIEGTGPRYCPSIEDKVVKFPDKNRHQVFVEPEGLYTNEMYLGGMSSSLPEDVQYAMYRTVPGLEKVKIVRNAYAIEYDCINALQLKPTLEFKKISGLFAGGQFNGSSGYEEAAVQGFMAGVNAVMKIRGQEAVVLDRSQAYIGVLIDDLVTKENHEPYRMMTSRAEYRLLLRQDNADIRLRKIGHEIGLVCDEEYEHLLRKMDDIQSEIKRLEKTVIGVSDRVQMFLENYGSTLLKSGITLAELVKRPELDYVKLAELDEGRPELPDDVREQVNIEIKYEGYIKRQMQQVAQFKKLEDKKLPEDFDYSEVNSLRREAVQKLNKVQPATIGQASRISGVSPADISVLLVHFTRKQ 631
>gi|104774815|ref|YP_619795.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|123378327|sp|Q1G7Z5|GIDA_LACDA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|103423896|emb|CAI98938.1| GidA (Glucose inhibited division protein A) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (631 aa)
Score = 1289, Expect = 8.8e-140, Identities = 272/611 (44%), Positives = 376/611 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL-ETSTLKNVKEFKYNSRKTNTTLYE------ILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG EAA   A+   K  L  +   +V  MPCNPS+GGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y +     IE    + L    V+ +   + +  GV T     + +  +++TTGT     I IG      GP++   +  L++ ++ L F+  R KTGTPPR+ +++IDYSK + EPG    + +SF+  D  +L    Q  C++ +TN K HEIIN NLD+S M+SG I G GPRYCPSIE KVVRF DK+RHQ+F+EPE +  + IY+G  S+S+PE+VQ +++  + G E   + +  YAIEYD ++P QL  TLETK+IK L+ AGQ+NGTSGYEEAA QGL+AGIN     E +    L R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G++LGLI    + E+    E     L  L E +    +   +Y +    T L         L+RP  +  D+E     K   D Y K++V+I IKY GYIK Q+  +   +  +  K+    DY  +  ++ EAR+KL K++P TL QA R+SG+N  DL  + +Y++N K
  S:     8 EYDVIVVGAGHAGCEAALASARMGEKTLLLTISLDMVAFMPCNPSVGGPAKGTVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKWDYHEEMKRTIENTPNLTLRQAVVDDLIVEDGECRGVVTNTGARYRAKSVVLTTGTAARGRIFIGELNYSSGPNNTIPAIKLSESLERLGFKLRRFKTGTPPRVNRHTIDYSKTEEEPGDKEPRHFSFTSRDEDYL--TDQTSCWMTYTNPKTHEIINENLDRSPMFSGDIVGVGPRYCPSIETKVVRFADKDRHQIFLEPEGRKTEEIYVGDFSTSMPEEVQLEMLHTVAGLEKVEMMRPGYAIEYDVVDPWQLTHTLETKRIKHLYMAGQMNGTSGYEEAAGQGLIAGINAALSAEGKPAFTLGRDEAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEKGHDLGLIDDDRYAEFLAKKELIQEDLDRLGEITVHPTIAVNEYLAGLGQTDLNGGVKADVFLRRPRVTVEDVERLTGQKLAGDRYVKEQVEIDIKYAGYIKKQEIQVARLRRQEAKKIPKDIDYDQIEGLATEAREKLAKIRPETLAQAERISGVNPADLAILSVYVQNGK 625
>gi|22538276|ref|NP_689127.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Streptococcus agalactiae 2603V/R] >gi|22535190|gb|AAN01000.1|AE014288_18 glucose-inhibited division protein A [Streptococcus agalactiae 2603V/R] (613 aa)
Score = 1289, Expect = 9.6e-140, Identities = 266/599 (44%), Positives = 376/599 (62%)
  Q:    16 LEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +EA+   ++   K  L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++     +E+ E + L    ++ I   + KV GV T  NQ F +  +++TTGT L   I +G      GP++   S  LA  +++L  +  R KTGTPPR+  +SI+Y K +I+PG  +   FS   R       Q  C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE ++ + +Y+ GLS+SLPEDVQ  ++++I G ENA + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GL+ +  +  + K    F N L+ L+       + T K ++E  +       T  E ++RP  ++     F+   +  LD    + ++  IKY GYIK     +   K ++  ++    D+ D+ +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE ++K
  S:     1 MEASLAASRMGCKTLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQTMKQTVEKQENLTLRQAMIDEILVEDGKVVGVRTATNQKFSAKSVVITTGTALRGEIILGDLKYSSGPNNSLASVTLADNLRDLGLEIGRFKTGTPPRVKASSINYEKTEIQPGDEQPNHFSFMSRDEDYITDQVPCWLTYTNTLSHDIINQNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRYTEEVYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGYEIGLVDEERYAIFKKRQMQFENELERLDSIKLKPVSETNKRIQELGFKPLTDALTAKEFMRRPQITYAVATDFVGCADEPLDSKVIELLETEIKYEGYIKKALDQVAKMKRMEEKRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGRQK 607
>gi|116514944|ref|YP_813850.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274324|sp|Q047G0|GIDA_LACDB tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|116094259|gb|ABJ59412.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (631 aa)
Score = 1287, Expect = 1.6e-139, Identities = 272/611 (44%), Positives = 376/611 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL-ETSTLKNVKEFKYNSRKTNTTLYE------ILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG EAA   A+   K  L  +   +V  MPCNPS+GGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y +     IE    + L    V+ +   + +  GV T     + +  +++TTGT     I IG      GP++   +  L++ ++ L F+  R KTGTPPR+ +++IDYSK + EPG    + +SF+  D  +L    Q  C++ +TN K HEIIN NLD+S M+SG I G GPRYCPSIE KVVRF DK+RHQ+F+EPE +  + IY+G  S+S+PE+VQ +++  + G E   + +  YAIEYD ++P QL  TLETK+IK L+ AGQ+NGTSGYEEAA QGL+AGIN     E +    L R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G++LGLI    + E+    E     L  L E +    +   +Y +    T L         L+RP  +  D+E     K   D Y K++V+I IKY GYIK Q+  +   +  +  K+    DY  +  ++ EAR+KL K++P TL QA R+SG+N  DL  + +Y++N K
  S:     8 EYDVIVVGAGHAGCEAALASARMGEKTLLLTISLDMVAFMPCNPSVGGPAKGTVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKWDYHEEMKRTIENTPNLTLRQAVVDDLIVEDGECRGVVTNTGARYRAKSVVLTTGTAARGRIFIGELNYSSGPNNTIPAIKLSESLERLGFKLRRFKTGTPPRVNRHTIDYSKTEEEPGDKEPRHFSFTSRDEDYL--TDQTSCWMTYTNPKTHEIINENLDRSPMFSGDIVGVGPRYCPSIETKVVRFADKDRHQIFLEPEGRKTEEIYVGDFSTSMPEEVQLEMLHTVAGLEKVEMMRPGYAIEYDVVDPWQLTHTLETKRIKHLYTAGQMNGTSGYEEAAGQGLIAGINAALSAEGKPAFTLGRDEAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEKGHDLGLIDDDRYAEFLAKKELIQEDLDRLGEITVHPTIAVNEYLAGLGQTDLNGGVKADVFLRRPRVTVEDVERLTGQKLAGDRYVKEQVEIDIKYAGYIKKQEIQVARLRRQEAKKIPKDIDYDQIEGLATEAREKLAKIRPETLAQAERISGVNPADLAILSVYVQNGK 625
>gi|116326853|ref|YP_796573.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116329800|ref|YP_799518.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116119597|gb|ABJ77640.1| Glucose-inhibited division protein A [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116123489|gb|ABJ74760.1| Glucose inhibited division protein A [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (635 aa)
Score = 1286, Expect = 2.0e-139, Identities = 277/613 (45%), Positives = 388/613 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++DC+V+GAGHAG EAA+I +K   K  L  ++   +G M CNP+IGG AKG + RE+DALGG+     DNT +Q K+LN+SKG   WA RAQ +K EY     + +E  + + +    V  +   N +V GV T       +N++I+TTGTFL S +HIG    + G         L+K + + + +  RLKTGTPPRI KNS+D S L I+ G      FS    K     +Q  CY+ +TN + H++I+ NL  S MYSG I  TGPRYCPSIEDKVVRF D+ERHQ+F+EPE      IYL G+S+SLPE+VQ ++V+++ G ENA I +  YAIEYD ++P +L PTLETKKIKGL+ AGQINGT+GYEEAA QGL+A  +VL  L+N +PL+ KR+E+YIGVLI+DL+ K + DPYR+ TSRAE+RL LR DNADQRL+KYGYELGL+ Q  +D      E  N+  +++    LK   EF+         + K    L   LKRP+    D+E  L   ++  E  K+ +++ IKY GYIK + + I       ++ +    +Y+ +  +  EA  KL   KP+TL +A ++SG++  D+  +  +++ K+KQ
  S:    13 RFDCVVVGAGHAGSEAAYIASKGGAKTLLITMNLDTIGQMSCNPAIGGIAKGHMVREVDALGGIMGKVIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQLKVKHTLEAEKNLSMRQDTVEELLIENDQVIGVKTGRGFEIYTNHVILTTGTFLSSLVHIGTYQNENGRMCEPTVKGLSKSLAKYNLKLGRLKTGTPPRIHKNSVDLSVLAIQDGDANPSPFSFSTEKIT--RRQIPCYITYTNVETHKLIHENLSLSPMYSGQIQSTGPRYCPSIEDKVVRFADRERHQVFLEPEGYETTEIYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIEYDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLKNLDPLLFKRSESYIGVLIDDLVYKGVEDPYRMFTSRAEHRLLLRQDNADQRLMKYGYELGLVDQESYDRMKDKYERVNSVREKIYQIPLKPSDEFQNLLDQKGITNYKFGMKLDSFLKRPEIKIEDVEFMLPEVSSWSESEKNILEMEIKYEGYIKRELETIQWKNKYLDLAIPEDINYESIAGLKKEAIQKLKTHKPMTLEKAGQISGVDPSDVDLLLYHIKGKRKQ 630
>gi|77410825|ref|ZP_00787182.1| glucose inhibited division protein A [Streptococcus agalactiae CJB111] >gi|77163043|gb|EAO73997.1| glucose inhibited division protein A [Streptococcus agalactiae CJB111] (604 aa)
Score = 1285, Expect = 2.5e-139, Identities = 264/587 (44%), Positives = 369/587 (62%)
  Q:    28 KVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           K  L  ++ +++  MPCNPSIGG AKGIV REIDALGG      D T +QMK+LN+ KG    ALRAQ DK  Y++     +E+ E + L    ++ I   + KV GV T  NQ F +  +++TTGT L   I +G      GP++   S  LA  +++L  +  R KTGTPPR+  +SI+Y + +I+PG  +   FS   R       Q  C+L +TN   H+IIN NL ++ M+SG + G GPRYCPSIEDK+VRF DKERHQLF+EPE +H + +Y+ GLS+SLPEDVQ  ++++I G ENA + +  YAIEYD + P QL  TLETK I GLF AGQ NGTSGYEEAA QGL+AGIN   +++ +  L+LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GL+ +  +  + K    F N L+ L+       + T K ++E  +       T  E ++RP  ++     F+      LD    + ++  IKY GYIK     +   K ++  ++    D+ D+ +I+ EAR K  K+ P TLGQASR+SG+N  D+  + +YLE ++K
  S:     4 KTLLATINLEMLAFMPCNPSIGGSAKGIVVREIDALGGEMGKNIDKTYIQMKMLNTGKGPAVRALRAQADKALYAQTMKQTVEKQENLTLRQAMIDEILVEDGKVVGVRTATNQKFSAKSVVITTGTALRGEIILGELKYSSGPNNSLASVTLADNLRDLGLEIGRFKTGTPPRVKASSINYEETEIQPGDEQPNHFSFMSRDEDYITDQVPCWLTYTNTLSHDIINQNLHRAPMFSGIVKGVGPRYCPSIEDKIVRFADKERHQLFLEPEGRHTEEVYVQGLSTSLPEDVQVDLLRSIKGLENAEMMRTGYAIEYDIVLPHQLRATLETKVIAGLFTAGQTNGTSGYEEAAGQGLVAGINAALKVQGKPELILKRSDAYIGVMIDDLVTKGTLEPYRLLTSRAEYRLILRHDNADMRLTEIGYEIGLVDEERYAIFKKRQMQFENELERLDSIKLKPVSETNKRIQELGFKPLTDALTAKEFMRRPQITYAVATDFVGCTDEPLDSKVIELLETEIKYEGYIKKALDQVAKMKRMEEKRIPPHIDWDDIDSIATEARQKFKKINPETLGQASRISGVNPADISILMVYLEGRQK 598
>gi|75909745|ref|YP_324041.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Anabaena variabilis ATCC 29413] >gi|123608727|sp|Q3M790|GIDA_ANAVT tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|75703470|gb|ABA23146.1| Glucose-inhibited division protein A subfamily [Anabaena variabilis ATCC 29413] (640 aa)
Score = 1285, Expect = 2.6e-139, Identities = 260/613 (42%), Positives = 379/613 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE----FKYNSR---KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE--NKKKQT 616
           +D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EY+    N +E  E + + +  V  +    N +V GV T     F+   +I+TTGTFL   I +G+K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYSK+Q++PG  +   FS FD       +Q  C++  T  + H +I  NL  S +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q Q+++++ G EN V+ + AYA+EYD +   Q YPTL TKK+ GLF AGQ+NGT+GYEEAA QG++AGIN    + ++E +V  R ++Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DN+DQRL   G E+GLI    W  + +  E      + L  + +K   E       N++   K + TL ++L+RP + ++D++ +      L    ++  +I IKY GY+  QQ  I         +L    DY  V  +S EAR+KLNKVKP+T+GQA+R+ G+N  D+  + +YLE    K QT
  S:    13 FDVIVVGAGHSGCEAALATARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNSSRGPAVWALRAQTDKREYAAIMKNIVENQENLSIRESMVTDLVLGANDEVIGVETYFGVAFQCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTETLNRLGFETGRLKTGTPARVDKRSVDYSKMQLQPGDEEVRWFS-FDPDVWVEREQLPCHMTRTTPETHRLIRENLHLSPVYGGWVEAKGPRYCPSIEDKIVRFVDKESHQIFIEPEGRDIPELYIQGFSTGLPENLQLQMLRSLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKVAGLFCAGQVNGTTGYEEAAAQGIVAGINAARFVRDQEMIVFPREQSYLGTLVDDLCTKDLREPYRMLTSRSEYRLLLRSDNSDQRLTPLGREIGLIDDRRWQLFTRKQEQITGEKERLYATRVKENDEVGKAIASNTQQAIKGSITLADLLRRPGFHYVDLDRYGLGNPELTPAEREGAEIDIKYSGYLARQQSQIEQIARQAQRQLPRDLDYTTVETLSKEAREKLNKVKPMTIGQAARIGGVNPADINALLIYLELRQTKHQT 634
>gi|24753758|gb|AAN64006.1|AF434658_3 glucose inhibited division protein A [Leptospira interrogans] (635 aa)
Score = 1285, Expect = 2.8e-139, Identities = 277/613 (45%), Positives = 391/613 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++DC+V+GAGHAG EAA+I +K   +  L  ++   +G M CNP+IGG AKG + RE+DALGG+     DNT +Q K+LN+SKG   WA RAQ +K EY     + +E  + + +    V  +   N +V GV T       +N++I+TTGTFL S +HIG    + G         L+K + + + +  RLKTGTPPRI KNS+D S L I+ G +    FS    K     KQ  C++ +TN + H++I+ NL+ S MYSG I  TGPRYCPSIEDKVVRF D+ERHQ+F+EPE      IYL G+S+SLPE+VQ ++V+++ G ENA I +  YAIEYD ++P +L PTLETKKIKGL+ AGQINGT+GYEEAA QGL+A  +VL  L N  PL+ KR+E+YIGVLI+DL++K + DPYR+LTSRAE+RL LR DNADQRL+KYGY+LGL+ Q  +D   +  E  N+  +++    LK   EF+         + K    L   LKRP+    D+E  +   ++  +  K  +++ IKY GYIK + + I       ++ +    +Y+ +  +  EA  KL   KP+TL +AS++SG++  D+  I  +++ KKKQ
  S:    13 RFDCVVVGAGHAGSEAAYISSKGGARTLLITMNLDTIGQMSCNPAIGGIAKGHMVREVDALGGIMGKMIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQLKVKHTLEAEKNLSIRQDTVEELIIENDQVIGVRTGRGFEIFTNHVILTTGTFLSSLVHIGTYQNENGRMCEPTVKGLSKSLAKYNLKLGRLKTGTPPRIHKNSVDLSVLTIQEGDSNPSPFSFSTDKIT--RKQIPCFITYTNAETHKLIHENLNLSPMYSGQIQSTGPRYCPSIEDKVVRFADRERHQVFLEPEGYETSEIYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIEYDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLRNLTPLLFKRSESYIGVLIDDLVHKGVEDPYRMLTSRAEHRLLLRQDNADQRLMKYGYDLGLVDQKSYDCMKEKYERVNSVREKIYQIPLKPSDEFQNLLDQKGITNYKFGMKLDSFLKRPEIKIKDIEFMISEVSSWSDLEKSVLEMEIKYEGYIKRELETIQWKNKYLDLAIPEDINYEMIAGLKKEAIQKLKSHKPMTLEKASQISGVDPSDVDLILYHIKGKKKQ 630
>gi|186903177|ref|ZP_02976114.1| glucose inhibited division protein A [Cyanothece sp. PCC 7424] >gi|186689735|gb|EDU14374.1| glucose inhibited division protein A [Cyanothece sp. PCC 7424] (634 aa)
Score = 1284, Expect = 3.2e-139, Identities = 265/611 (43%), Positives = 376/611 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY-------NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +V+GAGH+G EAA   A+   +  +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+      +E  E  +L+ +E  +   V   N +V GV T     F +  +I+TTGTFL   I IG K +  G      +  L + + +L F+T RLKTGTP R+ K S+DYSKL+ +P   +   FS FD +     +Q  CYL  T  K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q  ++  + G EN V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQ+NGT+GYEEAA QG++AGIN +  ++ +  +V  R E+YIG L++DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  + +   N     + L  + +K   E             K +  L ++L+RP + ++++E +      L    K+  +I IKY GYIK QQ  I       +  LS   DY  +  +S+EAR+KL KVKPLT+GQASR+ G+N  D+  + +YLE + +
  S:    13 FDLIVVGAGHSGCEAALATARLGCRTLMLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRILNASRGPAVWALRAQTDKREYAAVMKQIVENQE--NLVIREGMATDLVLGKNDEVIGVQTYFGTCFAAKAVILTTGTFLGGRIWIGGKSMAAGRAGEFAAVGLTETLNQLGFETGRLKTGTPARVDKRSVDYSKLEPQPPDEQVGWFS-FDPEVWVEREQMNCYLTRTTAKTHQLIRDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPENIQLAMLHTLPGLENCVMLRPAYAVEYDYLPATQCYPTLMTKKIEGLFCAGQVNGTTGYEEAAAQGIVAGINAVRFIKGQSMIVFPREESYIGTLVDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWQLFQQKQANIIAEKERLHETRIKENDELGKAIVADTGQKIKGSICLADLLRRPGFHYVNLEHYGLGNLNLTPAEKEGAEIDIKYSGYIKRQQNQIEQISRHSHRPLSENLDYMKIDTLSMEAREKLTKVKPLTIGQASRIGGVNPADINALLVYLETRSR 630
>gi|169187378|ref|ZP_02847537.1| glucose inhibited division protein A [Paenibacillus sp. JDR-2] >gi|169005387|gb|EDS52239.1| glucose inhibited division protein A [Paenibacillus sp. JDR-2] (629 aa)
Score = 1283, Expect = 4.5e-139, Identities = 271/614 (44%), Positives = 396/614 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-NVKEFKYNSRKTNTTLY-----EILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           +Y+ +VIGAGHAG EAA   A+   +  L  ++  +V  MPCNPSIGGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IEE +++ L       +   + K+ G+ T     + +  +++TTGT+L   I +G  + + GP++   S  L+  +KEL F+  R KTGTPPR+ K++ID+SK +I+PG +    FS ++ K  D N+Q  C+L +T+   H+IIN+NL ++ M+SG I GTGPRYCPSIEDK+VRF DK +HQ+F+EPE KH    Y+ GLS+S+PEDVQ  I+++I G E   + +  YAIEYDA+ P QL+P+LETK + GLF AGQINGTSGYEEAA QG++AGIN   +++ +EP+V+ R++ YIGV+I+DL+ K  +DPYRLLTSRAEYRL LR+DNAD RL   GYE+GLIS+  +  +    E     ++ L T  +K  V +   ++  +    +      +L+RP+ S+  +E    ++  L E  K++V+I IKY GYI+ Q   +     ++  K+     Y +V  ++ EA+ KL  ++PL++GQASR++G+   D+  + +YLE+  + T
  S:     7 QYEVIVIGAGHAGAEAALASARMGCETLLLTINLDMVAFMPCNPSIGGPAKGHVVREIDALGGEMGRNIDKTFIQMRMLNTGKGPAVHALRAQADKFSYQHTMKKTIEETDHLTLRQGMAEDLIVEDGKIAGIVTKTGAIYRAKAVVITTGTYLRGKIIMGELMYESGPNNQQPSVKLSASLKELGFKLARFKTGTPPRVHKDTIDFSKTEIQPGDDNPKFFS-YETKSSD-NEQLPCWLTYTSEATHKIINDNLHRAPMFSGAIEGTGPRYCPSIEDKIVRFADKPKHQIFLEPEGKHTSEYYVQGLSTSMPEDVQLGILRSIPGLEKVEMMRNGYAIEYDAVVPTQLWPSLETKLVDGLFTAGQINGTSGYEEAAGQGIIAGINAARKVQGKEPVVIDRSQGYIGVMIDDLVTKGTSDPYRLLTSRAEYRLLLRHDNADLRLTPTGYEIGLISEERYQAFLNKKELVAQEIERLGTVKIKPEVAQPVLDAANSAPIAFTMDALSLLRRPELSYALLEQLSPSELPLTEEMKEQVEIQIKYAGYIEKQLHQVERLSKMEKKKIPDDIVYSEVHGLASEAKQKLADIRPLSIGQASRIAGVTPADISILLVYLEHYNRVT 624
>gi|196177846|gb|EDX72849.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Microcoleus chthonoplastes PCC 7420] (648 aa)
Score = 1283, Expect = 4.6e-139, Identities = 257/611 (42%), Positives = 388/611 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-------KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++G PAK  +  E+DALGG     AD T LQ ++LN S+G   WALRAQ DK EY+   + RI EN+  +L+ +E      V   N +V GV T     F++  +I+TTGTFL   I +G+K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYSK++ +PG ++  S+  FD +     +Q  CY+  T  + H++I +NL  S +Y G++   GPRYCPSIEDK+VRF DK+ HQ+F+EPE + +  +Y+ G S+ LPE++Q Q+++++ G E+  + + AYA+EYD +   Q +PTL TKKI+GLF AGQINGT+GYEEAA QG++AGIN +  + ++E LV  R E+YIG LI+DL  K++ +PYR+LTSR+EYRL LR+DNAD+RL   G E+GLI    W  Y +   N     + L+T  +K  +E             K + TL E+L+RP + + +++ +    ++L++  +D  +I IKY GY++ QQ  I+        +L +  DY  +  +S E+R+KL++V+PLT+GQASR+ G+N  D+  + +YLE + +
  S:    13 FDVIVVGAGHSGCEAALAAARLGCRTLLLTLNLDKIAWQPCNPAVGAPAKSQLAHEVDALGGEIGKMADRTYLQKRVLNQSRGPAVWALRAQTDKREYAA-VMKRIVENQE-NLVIREGMVTDLVLGANDQVIGVQTYFGVAFQAPAVILTTGTFLGGCIWVGNKSMSAGRAGEFAAVGLTETLNRLGFETGRLKTGTPARVDKRSVDYSKMEPQPG-DEVVSWFSFDPEVWVEREQMNCYITRTTAQTHQLIRDNLHLSPVYGGWVDAKGPRYCPSIEDKIVRFADKQSHQIFIEPEGRDIPELYIQGFSTGLPENLQLQMLRSLPGLEHCTMLRPAYAVEYDYLPATQCFPTLMTKKIEGLFCAGQINGTTGYEEAAAQGIVAGINAVRYVRHQEMLVFPREESYIGTLIDDLCTKDLREPYRMLTSRSEYRLLLRSDNADRRLTPLGREIGLIDDRRWQLYTEKQANIAAEKERLQTVRIKEHEELGVAIASDTQQRIKGSITLAELLRRPKFHYTNLDHYGLGNSSLNQAERDGAEIDIKYAGYLQRQQNQIDQVSRQSQRRLPTDLDYDAIETLSKESREKLSQVQPLTIGQASRIGGVNPADINALLVYLEVRSR 630
>gi|16331425|ref|NP_442153.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechocystis sp. PCC 6803] >gi|2494736|sp|Q55694|GIDA_SYNY3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|1001595|dbj|BAA10223.1| glucose inhibited division protein A [Synechocystis sp. PCC 6803] (635 aa)
Score = 1282, Expect = 5.8e-139, Identities = 258/614 (42%), Positives = 374/614 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV-NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           ++D +V+GAGHAG EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN S+G   WALRAQ DK EY+    N +E    + + +  V  +    N ++ GV T     F +  +++TTGTFL   I IG+K +  G      +  L + + EL F+T RLKTGTP R+ + S+DY KL+ +P  +++ S+  FD +     +Q  CYL  T  K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE+VQ  +++ + G EN V+ + AYA+EYD +   Q YP+L TKK+ GLF AGQINGT+GYEEAA QGL+AGIN     + +  ++  R  +Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    WD +     N     + L ++ +       K + ++     K +  L E+L+RP + + D+E F      L    K  V+I IKY GYIK QQ  I         +L    +Y  +  +S+EAR+KL + +PLT+GQA R+ G+N  D+  + +YLE + +++
  S:    12 QFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNISRGPAVWALRAQTDKREYAAVMKNIVENQPNLSIREGMVTDLVLGDNDEIQGVQTYFGACFGAQSVVITTGTFLGGKIWIGNKSMPAGRAGEFAAVGLTETLNELGFETGRLKTGTPARVDRRSVDYDKLEPQP-PDEQVSWFSFDPEVWVEREQMNCYLTRTTAKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVEYDFLPATQCYPSLMTKKVAGLFCAGQINGTTGYEEAAAQGLVAGINAARHCQGKSLIIFSREGSYLGTLIDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWDLFQTKQANITAEKERLYSTRIKEQDAVGKEIVDYTQQKIKGSIVLAELLRRPGFHYPDLEKFQLGNEELKPEEKTSVEIEIKYSGYIKRQQTQIEQVSRHSQKRLPPGLNYMAIETLSMEAREKLTQFQPLTIGQAGRIGGVNPADINALLVYLETQLRRS 632
>gi|67922566|ref|ZP_00516073.1| Glucose-inhibited division protein A subfamily [Crocosphaera watsonii WH 8501] >gi|67855575|gb|EAM50827.1| Glucose-inhibited division protein A subfamily [Crocosphaera watsonii WH 8501] (634 aa)
Score = 1282, Expect = 6.8e-139, Identities = 264/611 (43%), Positives = 380/611 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLEN--------FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +V+GAGH+G EAA   A+      +  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EYS      +E  + + + +  V  +    N +V G+ T     F++  +I+TTGTFL   I IG+K ++ G      +  L + +  L F+T RLKTGTP R+ K S+DYS+L+ +P   +   FS FD       +Q  CYL  T  K H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE +Q  +++ + G E+ V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQ+NGT+GYEEAA QG++AGIN +  ++N E ++  R E+Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQR+   G E+GLI    W+ + +   N        +   +KE +   +K V + +    K + TL ++L+RP + +  +E +      L    K+  +I IKY GY+K QQ  I       N KL S  DY  +  +S+EAR+KL KV+PLTLGQASR+ G+N  D+  + +YLE + +
  S:    13 FDIIVVGAGHSGCEAALAAARLGCCTMMLTLNLDRIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNSSRGPAVWALRAQTDKREYSAVMKEIVENQKNLSIREGMVTDLVLGKNDEVIGIQTYFGTCFQAKAVILTTGTFLGGRIWIGNKSMEAGRSGEFAAVGLTETLNNLGFETGRLKTGTPARVDKRSVDYSRLEPQPPDEEVRWFS-FDPAVWVQKEQMNCYLTRTTIKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGREIPELYIQGFSTGLPEKIQLAMLRTLPGLEDCVMLRPAYAVEYDFLPATQCYPTLMTKKIEGLFSAGQVNGTTGYEEAAAQGIVAGINAVKFVKNEEMIIFPREESYLGTLIDDLCTKDLREPYRMLTSRSEYRLILRSDNADQRMTPLGREIGLIDDRRWNLFEEKQANIVAEKERLYETRIKERDEVGIKIVNDTQ-QKIKGSVTLADLLRRPKFHYEHLEQYGLGNTELKTVEKEGAEIDIKYSGYLKRQQIQIEQISRHSNKKLPSDIDYMSIDTLSMEAREKLTKVRPLTLGQASRIGGVNPADINALLVYLELRSR 630
>gi|167770826|ref|ZP_02442879.1| hypothetical protein ANACOL_02179 [Anaerotruncus colihominis DSM 17241] >gi|167666866|gb|EDS10996.1| hypothetical protein ANACOL_02179 [Anaerotruncus colihominis DSM 17241] (642 aa)
Score = 1280, Expect = 1.0e-138, Identities = 263/613 (42%), Positives = 370/613 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYN----SRKTNTT-----LYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           YD  VIG GHAG+EAA   A+      LF +    +GNMPCNPSIGG AKG + REIDALGG    AAD T LQ ++LN  KG    +LRAQ D+ +Y ++    +E  + +D+I  E+  I+  +  V  V T     + +  +I+ TGT+L   I +G    + GPD  + +  L   ++ L     R KTGTP R  + SID+  L+++ G +    FS F+        + VC++A+TN + H +I  NL +S +YSG I G GPRYCPSIEDKVVRF+DK RHQ+F+EP     + +YL G+SSSLPE+VQ ++ + + GFE   I + AYAIEYD ++P  L  TLE K ++GL+ AGQ NGTSGYEEAA QGL+AGIN    ++ + PLVL R  +YIG LI+DL+ K   DPYR++TSR+EYRL LR DNAD RL   GYE+GLI    W  + K  E     ++ L    +      K N    SR+T+       L E+LKRP  S+  + PF   +  L     ++V+I IKY GYIK Q + +   + ++  +L    DY+ +  + LEA +KL +++PL +GQASR+SG++  D+  + ++L      T
  S:    15 YDIAVIGGGHAGIEAALAAARLGAHTVLFTMSLDAIGNMPCNPSIGGTAKGHLVREIDALGGEMGRAADATMLQSRMLNRGKGPAVHSLRAQTDRKDYHRYMKYAVENQDRLDVIQAEIVDIRASDGAVESVVTALGALYHARAVILCTGTYLRGRIFVGEYTAQSGPDGLHAADQLTAALERLGLPLRRFKTGTPARADRRSIDFQLLEVQEGDDPITPFS-FETDGGMLKNRAVCHIAYTNEQTHRVILENLHRSPLYSGQIEGIGPRYCPSIEDKVVRFSDKPRHQIFIEPMGLDTNEVYLQGMSSSLPEEVQVKLYRTVKGFEQIRIMRNAYAIEYDCLDPTCLQATLECKAVRGLYGAGQFNGTSGYEEAAAQGLIAGINAARAVQGKTPLVLDRASSYIGTLIDDLVVKGCNDPYRMMTSRSEYRLILRQDNADMRLTPIGYEIGLIGAERWAAFLKKRELVEGEIRRLR--AVHTAPSEKLNALLVSRETSPIATGIRLCELLKRPQLSYASLAPFDPERPELPAQVCEQVEITIKYEGYIKKQLEQVEQMRRLEGKQLPGDLDYQSIGGLRLEAVEKLTRLRPLNIGQASRISGVSPADVSVLLIWLSQHHAST 633
>gi|170288483|ref|YP_001738721.1| glucose inhibited division protein A [Thermotoga sp. RQ2] >gi|170175986|gb|ACB09038.1| glucose inhibited division protein A [Thermotoga sp. RQ2] (626 aa)
Score = 1279, Expect = 1.3e-138, Identities = 281/611 (45%), Positives = 393/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYL----IVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYS--GFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG+EAA   A+  ++V +  ++   VG  PCNP+IGGPAKG+V REIDALGG  A   D T + +++LN SKG    ALRAQIDK+ YS+    ++E N  I L    V  I     +V GV  VDN  +  +YL    IVTTGTFL   I IG      G      +  L + + EL F+  R KTGTP R+LK SI++S ++ +  +++  +FS FD   +   K   C+L  TN + H II   L+ S +Y     I G GPRYCPSIEDKVV+F DKE HQ+FVEPE +  +  YL GLS+SLP + Q ++++++ G ENA++ + AYAIEYD I+P QLYPTLE+K ++ L+FAGQ+NGTSGYEEAA QG++AGIN   +L    PL+LKR+EAYIGVLI+DL+ K + +PYRLLTSRAEYRL LR+DNA  RL KYGY +GLI +  +++        N  ++ L+   +K        +     +  K + +LY++LKRP  S+  ++ FL      D    ++V+I +KY GYI+   + +   +  +N ++    DY  VPN+S EARDKL K++P ++GQA R+ GIN  D+ N+ +YL+ KK+
  S:     9 YDVIVVGAGHAGIEAALAAARMGFRVLVLTVNPDTVGWAPCNPAIGGPAKGVVVREIDALGGEMAKTTDETMINVRMLNVSKGPAVRALRAQIDKISYSRTMKRKLETNPNIVLRHGIVERILTEKGRVKGV--VDN--YGIDYLGKAVIVTTGTFLRGKIFIGRSTFPAGRMGEFPATKLTESLIELGFEVGRFKTGTPARVLKRSINFSVMERQDTSDEPLAFSFFDEPRV-LPKDYPCWLTRTNPETHSIIKQYLEFSPLYGTVKLIEGIGPRYCPSIEDKVVKFKDKESHQVFVEPEGRDTEEYYLNGLSTSLPYEAQIKMIRSVKGLENAIVTRPAYAIEYDYIDPRQLYPTLESKLVENLYFAGQVNGTSGYEEAAGQGIIAGINAALKLRGEPPLILKRSEAYIGVLIDDLVTKGVDEPYRLLTSRAEYRLLLRHDNAHLRLAKYGYRVGLIPKWFYEKVLSLERRINEEIERLKKVIVKPSDRVNDLLTSLGTSPLKESVSLYQLLKRPQLSYSALK-FLDPNPIDDPEVVEQVEINVKYEGYIQKMFEEVAVFEKYENYEIPHDLDYDAVPNLSTEARDKLKKIRPRSIGQAMRIPGINPSDISNLIIYLDRKKQ 626
>gi|167038668|ref|YP_001666246.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167041018|ref|YP_001664003.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermoanaerobacter sp. X514] >gi|166855258|gb|ABY93667.1| glucose inhibited division protein A [Thermoanaerobacter sp. X514] >gi|166857502|gb|ABY95910.1| glucose inhibited division protein A [Thermoanaerobacter pseudethanolicus ATCC 33223] (633 aa)
Score = 1279, Expect = 1.3e-138, Identities = 270/612 (44%), Positives = 385/612 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNK--NTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +YD  V+G GHAG EAA   A+   K   F ++   +  M CNPSIGGPAK  + REIDALGG  AI  D + LQ++ LN+SKG    +LRAQ+DK  Y       +E  E +D+   E+  I   + KV GV T     ++    I+TTGTFL   + IG      GP     +  L++ +K L F+ +R KTGTP R+ K SID+SK++I+PG      FS+   K     +Q  C+L +TN + HEII  N+ +S ++SG ITG G RYCPSIEDKVV+F  KERHQ+F+EPE  +   +Y+ G+SSSLPEDVQ + ++ + G EN  + + AYAIEYD I+P QL  TLE+KKI+GL+FAGQ+NGTSGYEEAA QGLMAGIN   +L N+  ++L R++AYIGVLI+DL+ K   +PYR+LTSRAEYRL LR DNAD RL + GY++GL+++  + ++ K        ++ L    +K  +E              T   LY +LKRP+  +   +   KN+  + LD    +++DI IKY GYI  Q + +   K ++N K+    DY  +  +S EA++KL K++P ++GQASR+SG++  D+  + +Y++  ++
  S:     7 EYDVAVVGLGHAGSEAALACARLGLKTVGFAVNLDSIALMACNPSIGGPAKAQLVREIDALGGEMAINTDKSLLQIRTLNTSKGPAVRSLRAQVDKKLYQMNMKYTLERQENLDIKQAEIVDILVEDNKVTGVVTKLGAIYKCKACIITTGTFLKGRVIIGDVSFDSGPSGLFPANQLSETLKRLGFKLMRFKTGTPARVDKRSIDFSKMEIQPGDEVITPFSYMHDKIEI--EQLPCWLTYTNKRTHEIIMANIHRSPLFSGEITGVGVRYCPSIEDKVVKFPHKERHQIFIEPEGLNTYEMYVQGMSSSLPEDVQLEFLRTVPGLENVRVMRPAYAIEYDCIDPTQLKATLESKKIEGLYFAGQVNGTSGYEEAAAQGLMAGINAAMKLLNKPSVILDRSQAYIGVLIDDLVTKGTNEPYRMLTSRAEYRLLLRQDNADFRLTELGYKIGLVTEERYQKFLKKKIQLEKEMRRLLGVMIKPSEEVNNFLISKGSTPLVTGVDLYTLLKRPEIDYKSTKFLDKNRPDDILDSV-AEQIDINIKYEGYIMKQLRQVEHFKALENKKIPEDIDYYQIHGLSNEAKEKLTKIRPTSIGQASRISGVSPADISVLLIYMQQLRR 624
>gi|15643033|ref|NP_228076.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermotoga maritima MSB8] >gi|7674053|sp|Q9WYA1|GIDA_THEMA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|4980759|gb|AAD35351.1|AE001708_19 glucose-inhibited division protein A [Thermotoga maritima MSB8] (629 aa)
Score = 1278, Expect = 1.7e-138, Identities = 280/611 (45%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYL----IVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYS--GFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG+EAA   A+  ++V +  ++   VG  PCNP+IGGPAKG+V REIDALGG  A   D T + +++LN SKG    ALRAQIDK+ YS+    ++E N  I L    V  I     +V GV  VDN  +  +YL    IVTTGTFL   I IG      G      +  L + + EL F+  R KTGTP R+LK SI++S ++ +  +++  +FS FD   +   K   C+L  TN + H II   L+ S +Y     I G GPRYCPSIEDKVV+F DKE HQ+FVEPE +  +  YL GLS+SLP + Q ++++++ G ENA++ + AYAIEYD I+P QLYPTLE+K ++ L+FAGQ+NGTSGYEEAA QG++AGIN   +L    PL+LKR+EAYIGVLI+DL+ K + +PYRLLTSRAEYRL LR+DNA  RL KYGY +GLI +  +++        N  ++ L+   +K        +   + +  K   + Y++LKRP  S+  ++ FL      D    ++V+I +KY GYI+   + +   +  +N ++    DY  VPN+S EARDKL K++P ++GQA R+ GIN  D+ N+ +YL+ KK+
  S:    12 YDVIVVGAGHAGIEAALAAARMGFRVLVLTVNPDTVGWAPCNPAIGGPAKGVVVREIDALGGEMAKTTDETMINVRMLNVSKGPAVRALRAQIDKISYSRTMKRKLETNPNIVLRHGIVERILTEKGRVKGV--VDN--YGIDYLGKAVIVTTGTFLRGKIFIGRSTFPAGRMGEFPATKLTESLIELGFEVGRFKTGTPARVLKRSINFSVMERQDTSDEPLAFSFFDEPRV-LPKDYPCWLTRTNPETHSIIKQYLEFSPLYGTVKLIEGIGPRYCPSIEDKVVKFKDKESHQVFVEPEGRDTEEYYLNGLSTSLPYEAQIKMIRSVKGLENAIVTRPAYAIEYDYIDPRQLYPTLESKLVENLYFAGQVNGTSGYEEAAGQGIIAGINAALKLRGEPPLILKRSEAYIGVLIDDLVTKGVDEPYRLLTSRAEYRLLLRHDNAHLRLAKYGYRVGLIPKWFYEKVLSLERRINEEIERLKKVIVKPSDRVNDLLTSLRTSPLKEPVSFYQLLKRPQLSYSALK-FLDPNPIDDPEVVEQVEINVKYEGYIQKMFEEVAVFEKYENYEIPHDLDYDAVPNLSTEARDKLKKIRPRSIGQAMRIPGINPSDISNLIIYLDRKKQ 629
>gi|153854262|ref|ZP_01995561.1| hypothetical protein DORLON_01555 [Dorea longicatena DSM 13814] >gi|149753037|gb|EDM62968.1| hypothetical protein DORLON_01555 [Dorea longicatena DSM 13814] (636 aa)
Score = 1278, Expect = 1.9e-138, Identities = 275/612 (44%), Positives = 387/612 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFN-KQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWD---EYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTN--TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKD-------KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           KYD +VIGAGHAG EAA   A+  ++  +F +    +  MPCNP+IGG +KG + RE+DALGG      D T +Q K+LN SKG    +LRAQ DK  YS+     +E  E +++   EV ++   + K+ GV T     +    +I+ +GT+L +    G      GP+    +  L   +KEL  +  R KTGTP R+ + ++D+SK++ + G  +   FS F     D    Q  C+L +TN   HEII  NLD+S +YSG I GTGPRYCPSIEDKVV+F DK+RHQ+F+EPE    D +Y+GG+SSSLPEDVQ  + +++ G E+  I + AYAIEYD I+  QL P+LE + I GLF AGQ NG+SGYEEAA QGL+AGIN   +L+ +E LVL R+EAYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNADQRL + GYE+GLISQ  +D   E  + +E+    LK     T + V+E    Y S   N  ++L E+++RP+ S+   E       T  E  KD       +VDI +KY GYI+ Q++ +   K ++N K+    DY  V ++ +EA  KL + +P+++GQASR+SG++  D+  + +YL    +
  S:    14 KYDVVVIGAGHAGCEAALATARLGFQTLVFTVSVDSIAMMPCNPNIGGSSKGHLVRELDALGGEMGKVIDRTFIQSKMLNKSKGPAVHSLRAQADKAVYSRTMRRVLEAQENLEIKQGEVANLLVEDGKITGVQTFSGATYHCKAVIICSGTYLKARCIYGDVSQYTGPNGLQAANHLTDCLKELGIKMYRFKTGTPARVDRKTVDFSKMEEQFGDERVVPFS-FTTNPDDVQIDQASCWLTYTNETTHEIIRANLDRSPLYSGMIEGTGPRYCPSIEDKVVKFADKKRHQVFLEPEGLETDEMYIGGMSSSLPEDVQYAMYRSVPGLEHVKIVRNAYAIEYDCIDARQLKPSLEFRNISGLFSAGQFNGSSGYEEAAAQGLIAGINAARKLQGKESLVLDRSEAYIGVLIDDLVTKESHEPYRMMTSRAEYRLLLRQDNADQRLTEKGYEVGLISQERYDRLKEKERLIESEIERLKNAYVGTSEKVQELLESYESTPLNSGSSLAELIRRPELSY---EAVTAIDVTRPELPKDLAAEVIEQVDISLKYDGYIQRQKRQVEQFKKMENKKIPEDMDYDAVNSLRIEAVQKLKEYRPVSIGQASRISGVSPADISVLLVYLSGNHR 636
>gi|118727507|ref|ZP_01576105.1| glucose inhibited division protein A [Clostridium cellulolyticum H10] >gi|118663084|gb|EAV69747.1| glucose inhibited division protein A [Clostridium cellulolyticum H10] (627 aa)
Score = 1278, Expect = 1.9e-138, Identities = 272/612 (44%), Positives = 393/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSI--KFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL---KNVKEFKYNSR----KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +V+G GHAG EAA   A+      +F ++   + NMPCNPSIGG AKG + REIDALGG    A D T +Q K+LNSSKG   ++LRAQ+D+ +Y     N +E+ E +D+   EV  I       KV GV T     F    +++TTGT+L   I IG      GPD    +  L++ ++ L    IR KTGTP R+ + S+++SK+  +PG +    FS F+ + +D  +Q  C+L +TN + HE+I  N+ KS +YSG ITG GPRYCPSIEDKVVRF+DKE HQ+FVEP     + +YL G+SSSLPEDVQ + ++ I G EN  + + AYAIEYD I+  QL  +LE K + GLF AGQING+SGYEEAA QG++AGIN + +++NREPLV  R++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL   G E+GLIS+  +  + +  E     ++ L+ + L   + V+ +  N      K+   + E+L+RP+ S+  +    +  + L    +++V++ +KY GYIK Q + +   K ++  KL    DY ++  + LEAR KL+++KP ++GQASR++G++  D+  + +YLE  K++
  S:     8 YDIVVVGGGHAGCEAALAAARLGCSTIIFSINLDSIANMPCNPSIGGTAKGHLVREIDALGGQMGKATDKTFIQSKILNSSKGPAVYSLRAQVDRRQYQMEMKNILEKQENLDIRQSEVVEILTDENKTKVTGVKTHTGAIFHCKAVVLTTGTYLKGRIFIGDVNYSGGPDGLFPANKLSESLQNLGLNLIRFKTGTPARLNRQSLNFSKMSEQPGDDVIVPFS-FETEKID-KEQVSCWLTYTNQETHEVIKRNIHKSPLYSGNITGVGPRYCPSIEDKVVRFSDKEHHQVFVEPMGLETEEMYLQGMSSSLPEDVQIEFMRTIPGLENVKVMRSAYAIEYDGIDATQLKLSLEYKDVAGLFSAGQINGSSGYEEAAAQGIVAGINAVMKIKNREPLVFDRSQAYIGVLIDDLVTKGTKEPYRMMTSRAEYRLLLRQDNADLRLTPIGREIGLISEERYKRFLEKKEMIEKEIERLKKTYLPPSEKVQSYLENRNSTAIKSGIQVTELLRRPEISYESLSEICELPD-LPRAVREQVEVAVKYEGYIKRQMQQVEQYKKLEGRKLPHDIDYNEIQGLRLEARQKLSQIKPDSIGQASRITGVSPADISVLLIYLEQVKRK 625
>gi|169825320|ref|YP_001692931.1| glucose inhibited division protein A [Finegoldia magna ATCC 29328] >gi|167832125|dbj|BAG09041.1| glucose inhibited division protein A [Finegoldia magna ATCC 29328] (627 aa)
Score = 1278, Expect = 2.0e-138, Identities = 259/611 (42%), Positives = 380/611 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-------NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG EAA   A+   K A+  +    V ++PCNP+IGG  KG + +E+DALGG   +  D T +Q ++LN+SKG    +LR Q DK +Y     + +E  E +DLI+ EV  I+  + K+  + T     F +  +I+ TGT+L   + +G    + GP     S  L+  +K L  +  R KTGTP R+ ++S++Y  + ++PG +    FS  +       KQE CYL +T  K  +II +NL++S MY+G + G GPRYCPSIEDK+VRF D++ HQ+FVEPE      +Y+ G+SS+LPE+VQ+++ K I+GFEN    + AY IEYD I+P  L  TLE  +I  LFFAGQING+SGYEEAA QG++AGIN    L  +EP VL R++AYIGVLI+DL+ K   +PYR++TSR EYRL LR DNAD RL +  +E+GL +   +++        ++ +E   + +      T + ++    +  KT  TL +++KRP+ ++   E F   +  L  Y + +V+ +IKY GYI  Q   I   K ++N KL  I DYK+V  +S EA  KLN +KP +LGQASR+SG++  D+  + +Y+E +KK
  S:    10 YDVVVVGAGHAGCEAALATARLGLKTAIMSISLDSVADLPCNPNIGGTGKGHLVKEVDALGGEMGLVIDKTYIQSRMLNTSKGPAVHSLRVQADKRKYHDEMKSVLENTENLDLIEAEVVDIEVEDNKIKSITTAQGAIFPTRAVILATGTYLKGLVMMGEYTYESGPHGMKSSKKLSYSLKNLGIELRRFKTGTPARVHRDSLNYEVMTVQPGDDDVIPFSFLNDGKDISKKQEHCYLTYTTLKTKQIIEDNLERSPMYAGIVKGVGPRYCPSIEDKIVRFPDRDEHQVFVEPEGLSTKEMYIQGVSSTLPEEVQKEMYKTIIGFENVRFMRSAYGIEYDCIDPTILKRTLEHLEINNLFFAGQINGSSGYEEAAGQGIIAGINAAMNLLGKEPFVLDRSDAYIGVLIDDLVTKGTNEPYRMMTSRCEYRLTLRQDNADLRLTERAHEIGLATDERYEKMLHKKKTIDEEIERLKSIMVTPTEETNEKLRNLGSSELKTGITLLDLIKRPELTYDKTEEFDAERTELPRYLRLQVETHIKYEGYIAKQMSQIKQFKKLENRKLDMIEDYKEVMGLSNEAVQKLNDIKPESLGQASRISGVSPSDINVLLIYMETRKK 627
>gi|5672641|dbj|BAA82679.1| 77%-identity [Bacillus halodurans] (579 aa)
Score = 1277, Expect = 2.6e-138, Identities = 263/558 (47%), Positives = 355/558 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEY---------------WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKL 560
           ++D +V+GAGHAG+EA    A+      +  L+   V  MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK  Y       IEE E + L    V  +   + +  GV T     + +  ++VTTGT+L   I IG    + GP++   S  L+  ++EL F+ +R KTGTPPR+   +IDY K +I+PG     +FS+   K++    Q  C+L +T +K H+IIN+NL +S MYSG I GTGPRYCPSIEDK+VRFNDK RHQ+F+EPE +H   +Y+ GLS+SLPEDVQ  ++K+I G E A + +  YAIEYDAI P QL+PTLETKK+ GLF AGQINGTSGYEEAA QG+MAGIN   +++ ++ L+L R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + GYE+GLI++  ++ + +         K LE+ T+K  KE        N  L E+   P    +    FLK      E+                 ++V+I IKY GYI    + +   K +++ K+
  S:     7 EFDVIVVGAGHAGVEAGLAAARMGANTLMLTLNLDAVAFMPCNPSVGGPAKGIVVREIDALGGEMARNIDKTHIQMRMLNTGKGPAVRALRAQADKFLYQHEMKKTIEEEENLLLRQGMVERLIIEDGECRGVITNTGAEYRAKAVVVTTGTYLRGKIIIGDLAYESGPNNMQPSINLSYHLQELGFEMVRFKTGTPPRVNGETIDYDKTEIQPGDEVPRAFSYETTKYI--TDQLPCWLTYTGDKTHQIINDNLGRSPMYSGMIEGTGPRYCPSIEDKIVRFNDKPRHQIFLEPEGRHTSEVYVQGLSTSLPEDVQLDVLKSIPGLEKARMMRPGYAIEYDAIVPTQLWPTLETKKVPGLFTAGQINGTSGYEEAAGQGIMAGINAALRVQGKDGLILDRSEAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEKGYEIGLIARERYERFCEKKAQIAAEKKRLESITVKPSKE-------VNALLEEVGSAPLKEAVQANVFLKRPEVTYEHVAKVIPAPEQELSADVAEQVEIQIKYEGYISKMLQQVERAKKMNDKKI 570
>gi|116630434|ref|YP_819587.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus gasseri ATCC 33323] >gi|116096016|gb|ABJ61168.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Lactobacillus gasseri ATCC 33323] (637 aa)
Score = 1276, Expect = 2.8e-138, Identities = 263/611 (43%), Positives = 380/611 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL---KNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +YD +V+GAGHAG+EAA   A+   K  L  ++  +V  MPCNPS+GGPAKG V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y +   + IE    + L     + +   +    G+ T     + +  +++TTGT     I IG      GP++   S  L + +++L F+  R KTGTPPR+  N++DYSK Q EPG  +   FS+  +       Q  CY+ +TN   H+II  NLD++ M+SG I G GPRYCPSIEDKVVRF DK+RHQ+F+EPE ++   IY+G  S+S+PE+VQ +++ ++ G E A + +  YAIEYD I P QL  TLETK IK LF AGQ+NGTSGYEEAA QGL+AGIN     +N+    L+R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ELGLIS+  + ++    +  +  +  ++  T+     V+E+    K +      +  + LKRP  +F  +E         D Y K++V+I +KY GYIK ++ +++    +++ K+    DY  +P+++ EAR K  K++P ++ QA R+SG+N  DL  +  Y++  +
  S:    14 EYDVIVVGAGHAGVEAALAAARMGEKTLLLTINLDMVAFMPCNPSVGGPAKGTVVREIDALGGEMGKNIDATYIQMRMLNTGKGPAVRALRAQADKWQYHEHMKDTIENEPNLTLRQAVADELIVEDGACKGLITNTGAKYHAKSVVLTTGTAARGKIIIGELTYSSGPNNSLPSIKLPENLEKLGFKLRRFKTGTPPRVDGNTVDYSKTQEEPGDKEPRHFSYTSKDSDYLKDQMSCYMTYTNTVTHDIIRANLDRAPMFSGVIKGVGPRYCPSIEDKVVRFADKDRHQIFLEPEGRNTKEIYVGDFSTSMPEEVQLKMLHSVAGLEKAELMRPGYAIEYDVIEPWQLKHTLETKNIKHLFTAGQMNGTSGYEEAAGQGLIAGINAALSAQNKPGFTLQRDEAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEKGHELGLISEERYAKFEAKKQAISRAMAAIKKVTIHPTDEVQEYLASVKQDRLNAGVSGADFLKRPRVTFDAVEKLSGQTLATDRYVKEQVEIALKYEGYIKKEKTLVDRLHRLESKKIPVDIDYNAIPSLATEARQKFEKIRPESIAQAERISGVNPADLAILTAYIQQGR 631
>gi|87126017|gb|ABD20531.1| glucose-inhibited division protein A [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87204224|gb|ABD32034.1| glucose inhibited division protein A, putative [Staphylococcus aureus subsp. aureus NCTC 8325] (594 aa)
Score = 1276, Expect = 3.2e-138, Identities = 266/574 (46%), Positives = 376/574 (65%)
  Q:    42 MPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           MPCNPS+GGPAKGIV REIDALGG  A   D T +QM++LN+ KG    ALRAQ DK+ Y +     IE+ E + ++   V+ +   + +V GV T     + S  +I+TTGTFL   I +G+     GP+    S  L+  ++EL F  +R KTGTPPR+   +IDYSK +I+PG +   +FS    +++    Q  C+L +TN + H++I++NL  SAMYSG I GTGPRYCPSIEDK VRFNDK RHQLF+EPE ++ + +Y+ GLS+SLPE VQ Q+++ I G E A + +  YAIEYDAI P QL+PTLETK IK L+ AGQINGTSGYEEAA QGLMAGIN   ++ N    +L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   GYELG+IS+  +  +N+  +  +  +K L    +K        +++   +  K      ++L+RP+ ++  +   L+ ++ L+   +++V+I  KY GYI    + +   K ++  K+    DY  + +++ EAR+KL++VKPL + QASR+SG+N  D+  + +YLE  K Q
  S:    12 MPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQADKVLYQQEMKRVIEDEENLHIMQGMVDELIIEDNEVKGVRTNIGTEYLSKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSITLSDNLRELGFDIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFETTEYI--LDQLPCWLTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDKPRHQLFLEPEGRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMAGINAAGKVLNTGEKILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARFNEKRQQIDAEIKRLSDIRIKPNEHTQAIIEQHGGSRLKDGILAIDLLRRPEMTYDIILELLEEEHQLNADVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSKIDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYLEQGKLQ 590
>gi|45659306|ref|YP_003392.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|59797795|sp|Q72LR0|GIDA_LEPIC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|45602552|gb|AAS72029.1| glucose inhibited division protein A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (635 aa)
Score = 1276, Expect = 3.2e-138, Identities = 275/613 (44%), Positives = 390/613 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++DC+V+GAGHAG EAA+I +K   +  L  ++   +G M CNP+IGG AKG + RE+DALGG+     DNT +Q K+LN+SKG   WA RAQ +K EY     + +E  + + +    V  +   N +V GV T       +N++I+TTGTFL S +HIG    + G         L+K + + + +  RLKTGTPPRI KNS+D S L I+ G +    FS    K     KQ  C++ +TN + H++I+ NL+ S MYSG I  TGPRYCPSIEDKVVRF D+ERHQ+F+EPE      IYL G+S+SLPE+VQ ++V+++ G ENA I +  YAIEYD ++P +L PTLETKKIKGL+ AGQINGT+GYEEAA QGL+A  +VL  L N  PL+ KR+E+YIGVLI+DL++K + DPYR+ TSRAE+RL LR DNADQRL+KYGY+LGL+ Q  +D   +  E  N+  +++    LK   +F+         + K    L   LKRP+    D+E  +   ++  +  K  +++ IKY GYIK + + I       ++ +    +Y+ +  +  EA  KL   KP+TL +AS++SG++  D+  I  +++ KKKQ
  S:    13 RFDCVVVGAGHAGSEAAYISSKGGARTLLITMNLDTIGQMSCNPAIGGIAKGHMVREVDALGGIMGKMIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQLKVKHTLEAEKNLSIRQDTVEELIIENDQVIGVRTGRGFEIFTNHVILTTGTFLSSLVHIGTYQNENGRMCEPTVKGLSKSLAKYNLKLGRLKTGTPPRIHKNSVDLSVLTIQEGDSNPSPFSFSTDKIT--RKQIPCFITYTNAETHKLIHENLNLSPMYSGQIQSTGPRYCPSIEDKVVRFADRERHQVFLEPEGYETSEIYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIEYDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLRNLTPLLFKRSESYIGVLIDDLVHKGVEDPYRMFTSRAEHRLLLRQDNADQRLMKYGYDLGLVDQKSYDCMKEKYERVNSVREKIYQIPLKPSDKFQNLLDQKGITNYKFGMKLDSFLKRPEIKIKDIEFMIPEVSSWSDLEKSILEMEIKYEGYIKRELETIQWKNKYLDLAIPEDINYEMIAGLKKEAIQKLKSHKPMTLEKASQISGVDPSDVDLILYHIKGKKKQ 630
>gi|159030162|emb|CAO91054.1| gidA [Microcystis aeruginosa PCC 7806] (635 aa)
Score = 1276, Expect = 3.5e-138, Identities = 260/611 (42%), Positives = 380/611 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENF--------NNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           ++D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+      +E     +L+ +E  +   +   N++V GV T     F +  +I+TTGTFL   I IG K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYS+++ +P  ++   FS FD +     +Q  C+L  T    H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE+VQ  +++ + G EN V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQINGT+GYEEAA QGL+AGIN       +E +V  R E+Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  + +   N            +KE +   +  VK+ +    K + +L ++L+RP   ++D++ +      ++   ++ V+I IKY GY+K QQ  I+      N  LS   DY  +  +S+E+R+KL K+KP T+GQASR+ G+N  D+  + +YLE ++
  S:    12 EFDVIVVGAGHSGCEAALACARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAAVMKGIVETQA--NLVIREAMATDLILGANEQVLGVETYFGTCFAAKAVILTTGTFLGGKIWIGGKSMAAGRAGEFAAVGLTETLNRLGFETGRLKTGTPARVDKRSVDYSRMEPQPPDDEVRWFS-FDPEVWIEREQMNCHLTRTTAATHQLIRDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPENVQLAMLRTLPGLENCVMLRAAYAVEYDYLPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGLVAGINAARFALGKELIVFPREESYLGTLVDDLCTKDLREPYRMLTSRSEYRLVLRSDNADQRLTPLGREIGLIDDRRWQLFQRKQTNIIAEKERLHETRIKERDQVAIAIVKDTE-QKIKGSLSLADLLRRPSLHYLDLDRYGLGNPDINLAEREGVEIEIKYSGYLKRQQNQIDQISRHSNRHLSPDIDYMKIETLSMESREKLTKIKPATIGQASRIGGVNPADINALLVYLEMRQ 629
>gi|24217058|ref|NP_714539.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Leptospira interrogans serovar Lai str. 56601] >gi|59797872|sp|Q8EY59|GIDA_LEPIN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|24198471|gb|AAN51557.1|AE011588_6 glucose inhibited division protein A [Leptospira interrogans serovar Lai str. 56601] (635 aa)
Score = 1274, Expect = 5.8e-138, Identities = 274/613 (44%), Positives = 390/613 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++DC+V+GAGHAG EAA+I +K   +  L  ++   +G M CNP+IGG AKG + RE+DALGG+     DNT +Q K+LN+SKG   WA RAQ +K EY     + +E  + + +    V  +   N +V GV T       ++++I+TTGTFL S +HIG    + G         L+K + + + +  RLKTGTPPRI KNS+D S L I+ G +    FS    K     KQ  C++ +TN + H++I+ NL+ S MYSG I  TGPRYCPSIEDKVVRF D+ERHQ+F+EPE      IYL G+S+SLPE+VQ ++V+++ G ENA I +  YAIEYD ++P +L PTLETKKIKGL+ AGQINGT+GYEEAA QGL+A  +VL  L N  PL+ KR+E+YIGVLI+DL++K + DPYR+ TSRAE+RL LR DNADQRL+KYGY+LGL+ Q  +D   +  E  N+  +++    LK   +F+         + K    L   LKRP+    D+E  +   ++  +  K  +++ IKY GYIK + + I       ++ +    +Y+ +  +  EA  KL   KP+TL +AS++SG++  D+  I  +++ KKKQ
  S:    13 RFDCVVVGAGHAGSEAAYISSKGGARTLLITMNLDTIGQMSCNPAIGGIAKGHMVREVDALGGIMGKMIDNTGIQFKMLNTSKGPSVWAPRAQAEKKEYQLKVKHTLEAEKNLSIRQDTVEELIIENDQVIGVRTGRGFEIFTDHVILTTGTFLSSLVHIGTYQNENGRMCEPTVKGLSKSLAKYNLKLGRLKTGTPPRIHKNSVDLSVLTIQEGDSNPSPFSFSTDKIT--RKQIPCFITYTNAETHKLIHENLNLSPMYSGQIQSTGPRYCPSIEDKVVRFADRERHQVFLEPEGYETSEIYLNGVSTSLPEEVQWKLVRSLKGLENAEIVRPGYAIEYDYVDPTELKPTLETKKIKGLYHAGQINGTTGYEEAAAQGLVAAYSVLHSLRNLTPLLFKRSESYIGVLIDDLVHKGVEDPYRMFTSRAEHRLLLRQDNADQRLMKYGYDLGLVDQKSYDCMKEKYERVNSVREKIYQIPLKPSDKFQNLLDQKGITNYKFGMKLDSFLKRPEIKIKDIEFMIPEVSSWSDLEKSILEMEIKYEGYIKRELETIQWKNKYLDLAIPEDINYEMIAGLKKEAIQKLKSHKPMTLEKASQISGVDPSDVDLILYHIKGKKKQ 630
>gi|166368239|ref|YP_001660512.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Microcystis aeruginosa NIES-843] >gi|189039347|sp|B0JGQ4|GIDA_MICAN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166090612|dbj|BAG05320.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme [Microcystis aeruginosa NIES-843] (635 aa)
Score = 1273, Expect = 6.1e-138, Identities = 260/611 (42%), Positives = 379/611 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENF--------NNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           ++D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+      +E     +L+ +E  +   +   N++V GV T     F +  +I+TTGTFL   I IG K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYS+++ +P  ++   FS FD +     +Q  C+L  T    H++I +NL  S +Y GFI   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE+VQ  +++ + G EN V+ + AYA+EYD +   Q YPTL TKKI+GLF AGQINGT+GYEEAA QGL+AGIN       +E +V  R E+Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  +     N            +KE +   +  VK+ +    K + +L ++L+RP   ++D++ +      ++   ++ V+I IKY GY+K QQ  I+      N  LS   DY  +  +S+E+R+KL K+KP T+GQASR+ G+N  D+  + +YLE ++
  S:    12 EFDVIVVGAGHSGCEAALACARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAAVMKGIVETQA--NLVIREAMATDLILGANEQVLGVETYFGTCFAAKAVILTTGTFLGGKIWIGGKSMAAGRAGEFAAVGLTETLNRLGFETGRLKTGTPARVDKRSVDYSRMEPQPPDDEVRWFS-FDPEVWIEREQMNCHLTRTTAATHQLIRDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPENVQLAMLRTLPGLENCVMLRAAYAVEYDYLPATQCYPTLMTKKIEGLFCAGQINGTTGYEEAAAQGLVAGINAARFALGKELIVFPREESYLGTLVDDLCTKDLREPYRMLTSRSEYRLVLRSDNADQRLTPLGREIGLIDNRRWQLFQSKQANIIAEKERLHETRIKERDQVAIAIVKDTE-QKIKGSLSLADLLRRPSLHYLDLDRYGLGNPDINLAEREGVEIEIKYSGYLKRQQNQIDQISRHSNRHLSPDIDYMKIETLSMESREKLTKIKPATIGQASRIGGVNPADINALLVYLEMRQ 629
>gi|119510372|ref|ZP_01629507.1| glucose-inhibited division protein A [Nodularia spumigena CCY9414] >gi|119465009|gb|EAW45911.1| glucose-inhibited division protein A [Nodularia spumigena CCY9414] (638 aa)
Score = 1273, Expect = 7.6e-138, Identities = 259/613 (42%), Positives = 369/613 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-------KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           +D +V+GAGH+G EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EY+      +E  E + + +     +    N +V GV T     F    +I+TTGTFL   I +G+K +  G      +  L + +  L F+T RLKTGTP R+ K S+DYSK+ I+PG  +   FS FD       +Q  CY+  T  + H +I +NL  S +Y G++   GPRYCPSIEDK+VRF DK+ HQ+F+EPE + +  +Y+ G S+ LPE +Q Q+++++ G EN  + + AYA+EYD +   Q YPTL TKKI GLF AGQINGT+GYEEAA QG++AGIN    +   E +V  R  +Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W+ +             L  + +K   E           + K + TL E+L+RP + ++D++ +      L +  K+  +I IKY GY+  QQ  I       + +L +  DY  +  +S EAR+KL+KVKPLTLGQASR  G+N  D+  + +YLE +K  +
  S:    11 FDVIVVGAGHSGCEAALAAARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKVADRTYLQKRILNSSRGPAVWALRAQSDKREYAAVMKTIVENQENLSIREAMATDLVLGANDEVIGVETYFGVAFGCKAVILTTGTFLGGKIWVGNKSMPAGRAGEFAAEGLTQTLNRLGFETGRLKTGTPARVDKRSVDYSKMTIQPGDEEVRWFS-FDPDVWIKKEQIPCYITRTTAETHRLIRDNLHLSPVYGGWVEAKGPRYCPSIEDKIVRFADKQSHQIFIEPEGRDIPELYIQGFSTGLPETLQLQMLRSLPGLENCTMLRPAYAVEYDYLPATQCYPTLMTKKISGLFCAGQINGTTGYEEAAAQGIVAGINAARLVRGEEMIVFPREHSYLGTLVDDLCTKDLREPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWNLFTDKQTQITTEKARLYATRIKEHDEIGQAIASVSQQTIKGSITLAELLRRPGFHYVDLDSYGLGNPNLKQAEKEGAEIDIKYSGYLARQQNQIEQIARQAHRQLPADLDYTTIDTLSKEAREKLSKVKPLTLGQASRTGGVNPADINALLIYLELRKTNS 630
>gi|160946572|ref|ZP_02093775.1| hypothetical protein PEPMIC_00530 [Peptostreptococcus micros ATCC 33270] >gi|158446956|gb|EDP23951.1| hypothetical protein PEPMIC_00530 [Peptostreptococcus micros ATCC 33270] (628 aa)
Score = 1272, Expect = 8.1e-138, Identities = 271/614 (44%), Positives = 385/614 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNS--------RKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +KYD +VIGAGHAG EA    A+   K A+  +    V +MPCNP+IGG  KG + REIDALGG  AI  D T +Q ++LN+SKG    +LR Q DK  Y       +E  + IDLI  EV  I   N ++ GV T  N+ F +  +I+ TGT+L S I IG    + GP+++  S  L+  ++ L     R KTGTP R+ ++SIDYSK+ I+ G +    FS  +      N +E C+L +T  +  +II  NL +S MY+G + G GPRYCPSIEDK+VRFN+K+ HQ+F+EPE      +Y+ G+SS+LP +VQ+Q+ K+I+G EN  I + AY IEYD I+P  L  TLE K IK LFFAGQING+SGYEEAA QG++AGIN    +  +EP VL R++AYIGVLI+DLI K   +PYR++TSR EYRL LR DNAD RL +  Y +GL ++  +++         N ++ L++S L   KE   N+         KT  +LY+++KRP+  +  ++     +  LD   K +V   IKY GYI+ Q + I   K ++N KL +I DY  +  + +EA  KL K +P T+GQASR+SG++  D+  + ++LE ++++
  S:     7 EKYDVVVIGAGHAGCEAGLASARLGLKTAILTISMDSVADMPCNPNIGGTGKGHLVREIDALGGEMAINIDKTFIQSRMLNTSKGPAVHSLRVQADKKMYHTEMKKVLENEKNIDLIQAEVKEILTENNEITGVLTTSNEIFPAKAVIICTGTYLKSMILIGENCYESGPNNWKCSTYLSDSLRNLGIPLRRFKTGTPARVHRDSIDYSKMDIQKGDDNIIPFSFMNEGKDIGNHKEDCFLTYTTLETKKIIEQNLHRSPMYAGIVKGVGPRYCPSIEDKIVRFNEKDEHQVFIEPEGLDTSEMYVQGVSSTLPLEVQKQMYKSILGLENVKIMRPAYGIEYDCIDPTILRATLEHKDIKNLFFAGQINGSSGYEEAASQGIIAGINSAMNILGKEPFVLTRSDAYIGVLIDDLITKGTDEPYRMMTSRTEYRLSLRQDNADLRLTEMSYNIGLATKERYEKCLNKKTLIENEIERLKSSIL-TPKENTNNALEALGSMKLKTAVSLYDLIKRPELDYEIIKDLDTTREPLDREIKMQVQTMIKYEGYIEKQSQQIEAFKKLENKKLENI-DYNSLSGLRIEAVQKLAKFRPETVGQASRISGVSPADINVLLIHLETQRRK 626
>gi|148269797|ref|YP_001244257.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermotoga petrophila RKU-1] >gi|147735341|gb|ABQ46681.1| glucose inhibited division protein A [Thermotoga petrophila RKU-1] (626 aa)
Score = 1272, Expect = 8.7e-138, Identities = 281/611 (45%), Positives = 392/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYL----IVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYS--GFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG+EAA   A+  ++V +  ++   VG  PCNP+IGGPAKG+V REIDALGG  A   D T + +++LN SKG    ALRAQIDK+ YS+    ++E N  I L    V  I     KV GV  VDN  +  +YL    IVTTGTFL   I IG      G      +  L + + EL F+  R KTGTP R+LK SI++S ++ +  +++  +FS FD   +   K   C+L  TN + H II   L+ S +Y     I G GPRYCPSIEDKVV+F DKE HQ+FVEPE +  +  YL GLS+SLP + Q ++++++ G ENA+I + AYAIEYD I+P QLYPTLE+K ++ L+FAGQ+NGTSGYEEAA QG++AGIN   +L    PL+LKR+EAYIGVLI+DL+ + + +PYRLLTSRAEYRL LR+DNA  RL KYGY +GLI +  +++        N  ++ L+   +K        +     +  K + +LY +LKRP  S+  ++ FL      D    ++V+I +KY GYI+   + +   +  +N ++    DY  VPN+S EA+DKL K++P ++GQA R+ GIN  D+ N+ +YL+ KK+
  S:     9 YDVIVVGAGHAGIEAALAAARMGFRVLVLAVNPDTVGWAPCNPAIGGPAKGVVVREIDALGGEMAKTTDETMINIRMLNVSKGPAVRALRAQIDKILYSRTMKRKLETNPNIVLRHGIVEKILTEKGKVKGV--VDN--YGIDYLGKAVIVTTGTFLRGKIFIGRSTFPAGRMGEFPATKLTESLIELGFEVGRFKTGTPARVLKRSINFSVMERQDTSDEPLAFSFFDEPRV-LPKDYPCWLTRTNPETHSIIRQYLEFSPLYGTVKLIEGVGPRYCPSIEDKVVKFKDKESHQVFVEPEGRDTEEYYLNGLSTSLPYEAQIKMIRSVKGLENAIITRPAYAIEYDYIDPRQLYPTLESKLVENLYFAGQVNGTSGYEEAAGQGIIAGINAALKLRGESPLILKRSEAYIGVLIDDLVTRGVDEPYRLLTSRAEYRLLLRHDNAHLRLAKYGYRVGLIPKWFYEKVLSLERRINEEIERLKKVAVKPSDRINDLLTSLGTSPLKESVSLYHLLKRPQLSYSTLK-FLDPNPMDDPEVVEQVEINVKYEGYIQKMFEEVAVFEKYENYEVPYDLDYDAVPNLSTEAKDKLKKIRPRSIGQAMRIPGINPSDISNLIIYLDKKKQ 626
>gi|81429489|ref|YP_396490.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus sakei subsp. sakei 23K] >gi|123563598|sp|Q38UF0|GIDA_LACSS tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|78611132|emb|CAI56185.1| Cell division protein GidA [Lactobacillus sakei subsp. sakei 23K] (630 aa)
Score = 1272, Expect = 9.9e-138, Identities = 266/610 (43%), Positives = 378/610 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-YNSRKTNTTL------YEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   +  L  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IE  E++ L      S+  V   VC G+ T     + ++ +I+T GT     I IG      GP++   S  L++ +++  F   R KTGTPPR+   +ID+SK + +PG  +   +SF   D  +L    Q  C++ +TN+  H++I +NLD++ M++G I G GPRYCPSIEDK+VRF DK RHQ+F+EPE +  +  Y+G  S+S+PE++Q +++ +I G ENA + +  YAIEYD + P QL PTLETK ++ L+ AGQ+NGTSGYEEAA QGLMAGIN   +   R+P +L R+EAYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ELGLI+   +D Y          L  LE   LK   E + + + K    L       + LKRP+  + D+  F+     +D    ++V+I +KY GYI  ++  I   K ++  K+ +  DY  +  ++ E R KL K++P TL QASR+ G+N  D+  + +Y++  K
  S:     9 YDVIVVGAGHAGSEAALAAARMGRETLLLTINLDMVAFMPCNPSLGGPAKGIVVREIDALGGQMGRNIDKTYIQMRMLNTGKGPAVRALRAQADKHAYHRTMKRTIETTEHLTLRQGIAESL-IVEDGVCKGIVTNTGARYSADSVILTAGTASRGKIIIGELTYSSGPNNSIPSIKLSESLEDNGFVLTRFKTGTPPRVDGTTIDFSKTEEQPGDKEPNHFSFETPDSAYL--KDQLSCWMTYTNDTTHQVIRDNLDRAPMFTGVIEGVGPRYCPSIEDKIVRFADKPRHQIFLEPEGRETEEYYVGDFSTSMPEEIQHKMIHSIEGLENAQMMRPGYAIEYDVVEPWQLKPTLETKVVENLYTAGQMNGTSGYEEAAGQGLMAGINAALKQTGRDPFILDRSEAYIGVLIDDLVTKGTKEPYRLLTSRAEYRLMLRHDNADLRLTEKGHELGLINDDRFDSYEVKKAAVEAELARLEKIRLKPTPEIQAFLAAKGEAPLKDGVLASDFLKRPEVKYADLIQFIPAVEGIDNRVVEQVEIQVKYAGYIDKEKAKIAKLKRMEAKKIPANIDYDAIEGLATEGRQKLQKIQPETLAQASRIGGVNPADIGILSVYIQQGK 625
>gi|29377752|ref|NP_816906.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Enterococcus faecalis V583] >gi|81170540|sp|Q82YX0|GIDA_ENTFA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|29345220|gb|AAO82976.1| glucose-inhibited division protein A [Enterococcus faecalis V583] (632 aa)
Score = 1271, Expect = 1.2e-137, Identities = 270/612 (44%), Positives = 376/612 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKN-KNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           + YD +V+GAGHAG EAA   A+   K  L  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y+    + IE+ E + L    V  +  V   VC GV T     + S  +++T GT L   I IG      GP++   S  LA  +KEL  +  R KTGTPPR+  ++IDYS  + +PG  +   FS+          QE C+L +TN   HEII  NL ++ M++G + G G RYCPSIEDK+VRF DK RHQLF+EPE  + + +Y+ GLS+SLPEDVQ +++ +I G E   + +  YAIEYD + P QL PTLETK I+ L+ AGQ NGTSGYEEAA QGLMAGIN   +++ +EPLVLKR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GL+ +  +  Y          +  L    +K  KE +           K      + LKRP+ S+ ++  F+   +  LD    ++V+I IKY GYIK   + +   K ++  ++    DY+ +  ++ EA+ KL K++P T+ QASR+SG+N  D+  + +Y+E  K
  S:     7 ESYDVIVVGAGHAGSEAALAAARMGVKTLLLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKHAYATEMKHTIEKEENLTLRQGIVEEL-IVEDGVCRGVVTSTGAAYRSQAVVITAGTALRGEIIIGELKYSSGPNNSQPSVGLANHLKELGLEIDRFKTGTPPRVKSSTIDYSVTEEQPGDKEPNHFSYSTPDSAYNQNQEPCWLTYTNETTHEIIQKNLHRAPMFTGIVEGVGARYCPSIEDKIVRFADKPRHQLFLEPEGLNTEEVYVQGLSTSLPEDVQTEMLHSIEGLEKVEMMRTGYAIEYDVVVPHQLRPTLETKVIENLYTAGQTNGTSGYEEAAGQGLMAGINAALKIQGKEPLVLKRSDGYIGVMIDDLVTKGTNEPYRLLTSRAEYRLILRHDNADLRLTEMGHEIGLVKEEQYAAYLVKKAAVEAEIARLGKHRIKPTKEVQAFLETKGAAGLKDGILARDFLKRPEISYQEVAQFIPAPEEALDPKVIEQVEIQIKYEGYIKKAMEKVEKLKRMEAKRIPENIDYQAINGLATEAKQKLQKIQPETIAQASRISGVNPADISILMVYIEQGK 626
>gi|170760523|ref|YP_001788984.1| glucose-inhibited division protein A [Clostridium botulinum A3 str. Loch Maree] >gi|169407512|gb|ACA55923.1| glucose-inhibited division protein A [Clostridium botulinum A3 str. Loch Maree] (625 aa)
Score = 1270, Expect = 1.3e-137, Identities = 270/612 (44%), Positives = 398/612 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ E + L   EV  I   + +V GV T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ + +L     R KTGTP RI K S+D+SK+  +PG  K   FS    K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++ ++PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY +GL+ +  +++Y    KN+EN    +K+++ +  K + EF      T      +LYE++KRP+  +  +EP    +  L +  K++++I  KY GYI  Q + +   K  +N  +    +Y D+  + +EA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEENVVLRQLEVIEIDVEDNEVKGVLTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLDLGINLRRFKTGTPARINKRSVDFSKMVEQPGDEKIVPFSFIHDK-LD-KDQISCYLTYTSEETHKIIHENIHRSPLYNGSIEGIGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLVAGINAVLKIKGKDPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTEMGYRIGLVKEDRYNKYLNRKKNVENEIERIKKVQITGKKEINEFLLEKGSTELKKPISLYELIKRPELDYFKVEPLDDKRPNLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYENRLIPKSINYSDIKGLRIEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMERKNRE 624
>gi|163791743|ref|ZP_02186130.1| glucose-inhibited division protein A [Carnobacterium sp. AT7] >gi|159872985|gb|EDP67102.1| glucose-inhibited division protein A [Carnobacterium sp. AT7] (631 aa)
Score = 1270, Expect = 1.7e-137, Identities = 263/610 (43%), Positives = 381/610 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTT-------LYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +D +V+GAGHAG EAA   A+   +  L  ++  +V  MPCNPSIGGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y+      IEE E + L     + +  +   +C G+ T     + S  +I+T GT     I IG      GP++   S  L++ + E  F+  R KTGTPPR+  ++IDYS  + +PG  K   FS+          Q  C+L +TN   H+ I +NL ++ M++G + G G RYCPSIEDKVVRF+DK RHQLF+EPE ++ + +Y+ GLS+SLPEDVQ+ I+ +I G ENA + +  YAIEYD + P QL P+LETK ++ LF AGQ+NGTSGYEEAA QG+MAGIN   +++ +EP V+KR+E YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GL+++  +D +      F   ++ L +  LK   E +    + N           + L+RP+ S+ D+  F+     L    +++V+I +KY GYI    + ++  K ++N ++    DY  +  I+ EA++KL K++P T+ QASR+SG+N  D+  + +Y+E  K
  S:     9 FDVIVVGAGHAGSEAALAAARMGSQTLLITINLDMVAFMPCNPSIGGPAKGVVVREIDALGGEMGRNIDKTYIQMRMLNTGKGPAVRALRAQADKFMYANEMKKTIEETENLVLRQGIADEL-IIEDGICKGIITNTGAIYRSKAVILTAGTSSRGQIIIGELKYSSGPNNSQPSIKLSESLLENGFELNRFKTGTPPRVKSSTIDYSVTEEQPGDEKPNHFSYETPNSAYLKDQLSCWLTYTNEATHQKIQDNLHRAPMFTGIVEGVGARYCPSIEDKVVRFSDKPRHQLFLEPEGRNTEEVYVQGLSTSLPEDVQQDIIHSIEGLENAEMMRTGYAIEYDVVTPHQLRPSLETKIVENLFTAGQMNGTSGYEEAAGQGIMAGINAALKVQGKEPFVMKRSEGYIGVMIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADFRLTEIGHEIGLVTKERYDTFVAKKAQFEGEIERLGSIRLKPTTEIQSYLIENNQAPLKDGILAKDFLRRPEVSYQDLLAFVPRDYELPLAVEEQVEIQVKYEGYIAKAAQKVDKLKRMENKRIPENIDYASINGIATEAKEKLIKIQPETIAQASRISGVNPADISILMVYVEQGK 625
>gi|168181109|ref|ZP_02615773.1| glucose-inhibited division protein A [Clostridium botulinum NCTC 2916] >gi|182668094|gb|EDT80073.1| glucose-inhibited division protein A [Clostridium botulinum NCTC 2916] (625 aa)
Score = 1269, Expect = 2.1e-137, Identities = 269/612 (43%), Positives = 399/612 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ E + L   EV  I   + +V GV T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ + +L     R KTGTP RI K S+D+SK+  +PG  K   FS  D K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++ + PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +  ++++    KN+EN    L+ ++ +  + + EF      T      +LYE++KRP+  +  +EP    + +L +  K++++I  KY GYI  Q + +   K  ++  +    +Y D+  + LEA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEENVVLRQLEVIEIDVEDNEVKGVLTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLDLGINLRRFKTGTPARINKRSVDFSKMIEQPGDKKIVPFSFIDNK-LD-KDQISCYLTYTSEETHKIIHENIHRSPLYNGSIEGVGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKNPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGYKVGLVKEDRYNKFLNRKKNVENEIERLRNMQITGKREINEFLLEKGSTELKKPISLYELIKRPELDYFKVEPLDDKRPSLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYEDRLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMERKNRE 624
>gi|195962119|ref|ZP_03098324.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia spielmanii A14S] (621 aa)
Score = 1268, Expect = 2.3e-137, Identities = 275/612 (44%), Positives = 392/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPED+Q++ + +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  + +Y    K +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ IKL    +Y+ +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLSFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRANMGRLSEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPEDIQQKFINSIKGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSKYLFKEKRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKKLHNLELIKLPLDFNYEIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSNPKNK 614
>gi|167766871|ref|ZP_02438924.1| hypothetical protein CLOSS21_01388 [Clostridium sp. SS2/1] >gi|167711419|gb|EDS21998.1| hypothetical protein CLOSS21_01388 [Clostridium sp. SS2/1] (627 aa)
Score = 1267, Expect = 3.3e-137, Identities = 267/609 (43%), Positives = 388/609 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVK----EFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +KYD +V+GAGHAG EAA   A+  ++   F +    V  MPCNP+IGG +KG + +EIDALGG      D T LQ K+LN SKG    +LRAQ DK  YS      +     + L   EV  I   + K+ GV T     + +  +++TTGT+L +    G      GP+    +  L   +K       R KTGTP RI KN+ID+SK+  + G  +   FS F  K  D  + ++ C+L +T  + HEII  N+ +S ++SG I GTGPRYCPSIEDK+V+F DK RHQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++  ++ G ENA I + AYAIEYD I+  QL  +LE K+I GLF  GQ NG+SGYEEAA QGLMAGIN   +L+ ++P++L R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNAD RL K GYE GLISQ  +D+     + +E+    L+++     KNV+    E    + K++  + E+++RP+ +++D+ P    +   D   +++V+I IKY GYIK Q   +   K ++  ++    DY+DV ++ +EA+ KL+K++P ++GQASR+SG++  D+  + +YLE
  S:     6 EKYDIIVVGAGHAGCEAALAAARMGFETICFTVSMDSVALMPCNPNIGGSSKGHLVKEIDALGGEMGKNIDKTYLQSKMLNKSKGPAVHSLRAQADKKMYSISMTQVMGNTPNLTLRQGEVTEILVEDGKIKGVKTYSGAVYYAKAVVLTTGTYLKARCIYGEVSNHTGPNGLQAANYLTDSLKSHGISMRRFKTGTPARIDKNTIDFSKMAEQFGDERIVPFS-FTNKEEDIKRDQISCWLTYTTEETHEIIKENIHRSPLFSGAIEGTGPRYCPSIEDKIVKFPDKNRHQVFIEPEGEYTNEMYVGGMSSSLPEDVQYKMYHSVPGLENAKIVRNAYAIEYDCIDATQLKASLEFKEIDGLFSGGQFNGSSGYEEAAAQGLMAGINAARKLQEKDPIILDRSQAYIGVLIDDLVTKETQEPYRMMTSRAEYRLLLRQDNADLRLTKIGYEAGLISQERYDKLLVKEQQIEDEMKRLEDINVGASKNVQSLLEELGSTTLKSSAKMTELIRRPELTYMDLAPIDPERPEYDLDVQEQVNINIKYEGYIKRQLSQVKQFKKMEKKRIPEDIDYEDVGSLRIEAKQKLSKIRPSSIGQASRISGVSPADISVLLIYLE 621
>gi|194467397|ref|ZP_03073384.1| glucose inhibited division protein A [Lactobacillus reuteri 100-23] >gi|194454433|gb|EDX43330.1| glucose inhibited division protein A [Lactobacillus reuteri 100-23] (647 aa)
Score = 1267, Expect = 3.6e-137, Identities = 273/610 (44%), Positives = 383/610 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK----NVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  ++ ++V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IEE   + L    V+ +  V   VC GV T     + +  +++T GT     I IG    + GP++   +  L++ ++EL F   R KTGTPPR+   +IDYS  + +PG  +   +SF   D  ++  ++Q  C+L +TN   H II  NL ++ M+SG I G GPRYCPSIEDKVVRF DK RHQ+F+EPE +  D  YL G+S+S+PE++Q++IV +I G ENA + +  YAIEYD + P QL+PTLETK IK L+ AGQ NG+SGYEEAA QGL+AGIN   + + +EP VLKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL++ G+ +GL+S     +  +        +K LE   LK     V EF      N  K      ++LKRP + +  +  F+   +  LD +  ++V+I +KY GYIK ++  +   K ++  ++    DY D+  ++ E R KL K++P TL QASR+SG+N  D+  + +Y+   K
  S:    20 YDVIVVGAGHAGSEAALAAARMGNKTLLVTINLEMVAFMPCNPSVGGPAKGIVVREIDALGGEMGHNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHRAMKQTIEEEPNLTLRQATVDQL-IVEDGVCKGVITNTGARYHAKTVVLTVGTAARGKIIIGELQYESGPNNSKSAVKLSENLEELGFDLERFKTGTPPRVNGKTIDYSVTEEQPGDEEPHHFSFDTPDSAYIPISEQLSCWLTYTNEGTHAIIRENLSRAPMFSGVIKGVGPRYCPSIEDKVVRFADKPRHQVFLEPEGRDTDEYYLDGISTSMPEEIQQKIVHSIKGLENAEMMRPGYAIEYDVVAPYQLHPTLETKIIKNLYTAGQTNGSSGYEEAAGQGLIAGINAGLRAQGKEPFVLKRSDAYIGVMIDDLVTKGTKEPYRLLTSRAEYRLILRHDNADFRLMEMGHNVGLVSDERLAKMEEKKRQVAAEIKRLEEIKLKPSDDKVNEFIEAHGDNRLKDGIAAADLLKRPYFDYQTLAEFIPVPEQELDRHVIEQVEIQLKYAGYIKKEEVKVERMKRMEAKRIPDDIDYGDIDGLATEGRQKLEKIRPETLAQASRISGVNPADIAILSVYVRQGK 640
>gi|154503057|ref|ZP_02040117.1| hypothetical protein RUMGNA_00879 [Ruminococcus gnavus ATCC 29149] >gi|153796298|gb|EDN78718.1| hypothetical protein RUMGNA_00879 [Ruminococcus gnavus ATCC 29149] (635 aa)
Score = 1266, Expect = 4.8e-137, Identities = 264/610 (43%), Positives = 391/610 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVN-----QKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET---STLKNVKEFKYNSRKT----NTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           +YD +++GAGHAG EAA   A+  ++  +F +    +  MPCNP+IGG +KG + +E+DALGG      D T +Q K+LNSSKG    +LRAQ DK  YSK     +E+ E +++   EV  I   +     + + GV T     +    +++ TGT+L +    G   ++ GP+    +  L   +KEL  +  R KTGTP RI K SID+SK++ + G  +   FS F     D    +V C+L +TN K HEII  NLD+S ++SG I GTGPRYCPSIEDKVV+F DK RHQ+F+EPE    + +Y+GG+SSSLPEDVQ  + +++ G E+A I + AYAIEYD I+  QL  TLE K ++GLF  GQ NG+SGYEEAA QGL+AGIN   +L+ +E +++ R+E YIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNAD RL K GYE+GLI +  +    K  E     ++ +E+    T K V+E   +   T      +L ++++RP+ S+  +    K +  L     ++V+I IKY GYIK Q+K +   K ++  ++ +  +Y++V ++ LEA+ KL++++P ++GQASR+SG++  D+  + +YLE++
  S:    14 EYDVVIVGAGHAGCEAALACARMGFQTLMFTVSVDSIALMPCNPNIGGSSKGHLVKEVDALGGEMGKVIDRTFIQSKMLNSSKGPAVHSLRAQADKANYSKTMRKVLEDQENLEIKQMEVTEILAEDGADGKKIITGVRTYSGATYRCRAVVLCTGTYLKARCIYGDVSMQTGPNGLQPANYLTDSLKELGIEMYRFKTGTPARIDKRSIDFSKMEEQKGDERIVPFS-FTTDPEDIQIDQVSCWLTYTNEKTHEIIRENLDRSPLFSGMIEGTGPRYCPSIEDKVVKFADKNRHQVFIEPEGLDTNEMYVGGMSSSLPEDVQYAMYRSVPGLEHAKIVRNAYAIEYDCIDARQLKSTLEFKNVEGLFSGGQFNGSSGYEEAAAQGLVAGINAARKLQGKEGIIIDRSEGYIGVLIDDLVTKESHEPYRMMTSRAEYRLLLRQDNADLRLTKIGYEVGLIEEERYQNLLKKEEQIQKEIERVESVHVGTTKEVQELLESCGSTPLVSGASLADLIRRPELSYEILASVDKMRPELKYDVAEQVNINIKYEGYIKRQKKQVEQFKKLEKKRIPADINYEEVQSLRLEAKQKLSQIRPASIGQASRISGVSPADISVLLVYLESR 635
>gi|167759570|ref|ZP_02431697.1| hypothetical protein CLOSCI_01927 [Clostridium scindens ATCC 35704] >gi|167662797|gb|EDS06927.1| hypothetical protein CLOSCI_01927 [Clostridium scindens ATCC 35704] (634 aa)
Score = 1265, Expect = 5.6e-137, Identities = 272/607 (44%), Positives = 385/607 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHF-DRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSF-----IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +VIGAGHAG EAA   A+  Y+  +F +  + +  MPCNP+IGG +KG + REIDALGG      D T +Q K+LN SKG    +LRAQ DK  YS+     +E  + +D+   EV  I     KV GV T     +    +I+ TGT+L S    G      GP+    +  L   +++L  +  R KTGTP RI KNS+D+SK++ + G  K   FS   D K +  + Q  C+L +TN + HEII  NLD+S ++SG I GTGPRYCPSIEDKVV+F DK+RHQ+F+EPE    + +Y+GG+SSSLPEDVQ ++ + + G EN  I + AYAIEYD I+  QL P+LE K I GL+  GQ NG+SGYEEAA QGL+AGIN   +L+ +E ++L R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNADQRL + GYE+GLIS+  +    +  E     +K L  +++         +K ++     + +T+ E+++RP+ S+     ID E        L+E   ++++I IKY GYI  Q+K +   K ++N K+    DY  V ++ LEA  KL + +P ++GQASR+SG++  D+  + +YLE
  S:    15 YDVVVIGAGHAGCEAALATARLGYQTMVFTVSVESIALMPCNPNIGGSSKGHLVREIDALGGEMGKVIDQTFIQSKMLNKSKGPAVHSLRAQADKAWYSRTMRQVLENQDNLDIKQDEVVKILVDEGKVTGVQTFSGTIYPCRAVILCTGTYLRSRCIYGDVSNYTGPNGLQAANYLTDCLEDLGIKMYRFKTGTPARIDKNSVDFSKMEEQFGDEKVIPFSFTTDPKDVQID-QSSCWLTYTNPRTHEIIRKNLDRSPLFSGMIEGTGPRYCPSIEDKVVKFADKDRHQVFIEPEGLETNEMYIGGMSSSLPEDVQYEMYRTVPGLENVKIVRNAYAIEYDCIDARQLRPSLEFKNISGLYSGGQFNGSSGYEEAAAQGLIAGINAARKLQGKESIILDRSQAYIGVLIDDLVTKESHEPYRMMTSRAEYRLLLRQDNADQRLTRIGYEVGLISEKRYHRLLEKEELIQKEVKRLTHASVGANEKVQNLLKSYESTPLSSGSTVAELIRRPELSYEMLADID-ECRPVLPEELEEEVVEQINISIKYDGYISRQKKQVEQFKKLENKKIPEDIDYNLVKSLRLEALQKLKEYRPASIGQASRISGVSPADISVLLVYLE 632
>gi|158321889|ref|YP_001514396.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Alkaliphilus oremlandii OhILAs] >gi|158142088|gb|ABW20400.1| glucose inhibited division protein A [Alkaliphilus oremlandii OhILAs] (630 aa)
Score = 1265, Expect = 6.3e-137, Identities = 260/612 (42%), Positives = 385/612 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS----TLKN--VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKD---KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +V+GAGHAG EAA   A+  Y   +  +    +  +PCNPSIGG  KG + REIDALGG   +  D T +Q ++LN++KG    +LRAQ DK  Y       +E    + L+  EV  I   +  V GV T     +    +I+ TG +L S I +G    + GP+    +  L++++K L     R KTGTP RI K+SID+SK+ ++    +   FS  +       K+++ C+L  T  + H II  NL +SAMY G I  TGPRYCPSIEDK+VRF++K  HQ+F+EPE      +Y+ G S+SLPE+VQ Q+V++++G ENA+I + AYAIEYD I+P QL  +LE K I  LF AGQ NG+SGYEEAA QGLMAGIN + ++   +P +L R+EAYIGVLI+DL+ K   +PYR++TSR+EYRL LR DNAD RL + GY LGL+ +  ++ Y    E+  N ++ L+T+    T+ N  ++  +    K   +LY++LKRP+ ++ +++    +     +  KD   + ++ IKY GYI+ Q + I+  K ++N KL    DY ++  + +EAR KLN ++PL++GQASR+SG++  D+  + +YLE K+++
  S:     9 YDVVVVGAGHAGCEAALATARMGYSTMMLTMSLDAIAMLPCNPSIGGTGKGHLVREIDALGGEMGLNIDKTFIQSRMLNTAKGPAVHSLRAQADKTRYHIEMKKMLENEPNLHLLQGEVVDIIVEDNTVKGVVTKTGAIYYGKAVILATGVYLKSKIFMGEVNYESGPNGLFPALYLSEKLKALGCNMRRFKTGTPARIHKDSIDFSKVSVQIEDEEIVPFSFMNEAL---EKEQIPCWLTRTTEETHRIIKENLGRSAMYRGDIESTGPRYCPSIEDKIVRFSEKPSHQIFIEPEGAETKEMYIQGFSTSLPEEVQVQMVRSVIGLENAIIMRPAYAIEYDCIDPTQLKASLEVKHINNLFSAGQFNGSSGYEEAAAQGLMAGINAVLKIRGEDPFILDRSEAYIGVLIDDLVTKGTNEPYRMMTSRSEYRLVLRQDNADLRLTEKGYALGLVKEDRYERYLLKKEHIKNEMERLKTTNVSPTIANPVLERAESTPIKVGMSLYDLLKRPELTYENIKEI--DGTRPQDLMKDAQFQCEVMIKYEGYIEKQLRQIDQFKKLENKKLREDIDYNEIDGLRIEARQKLNAIRPLSVGQASRISGVSPADISVLLIYLEQKRRK 625
>gi|195951582|ref|ZP_03092679.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 29805] (621 aa)
Score = 1263, Expect = 9.2e-137, Identities = 272/612 (44%), Positives = 392/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK++++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ V  +S EAR+K +K++P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKMEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSRYLFKESRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIVEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 614
>gi|111115000|ref|YP_709618.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia afzelii PKo] >gi|123145773|sp|Q0SNY6|GIDA_BORAP tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|110890274|gb|ABH01442.1| glucose inhibited division protein A [Borrelia afzelii PKo] (621 aa)
Score = 1263, Expect = 9.3e-137, Identities = 271/612 (44%), Positives = 393/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  +++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI + S+D+SK +++ G +    FS F    LD   Q  CY+ +TN + HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE+VQ++++ +I G E+AVI +  YA+EYD INPI+LYP+LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  + +Y    + +E     LK+   S LK++ + +   +  N   Y ILK P  S    I ++P L +   + E    +V++ IKY GYI  Q+ +I    N++ +KL    +Y  +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALAISRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRANMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHRKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKRTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENVQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPSLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSKYLFKKRRVEEIKELLKQRRLS-LKDIADEQLK-KHVNKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDIKYEGYINRQKDLIKKLHNLELVKLPFDFNYGIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSNPKNK 614
>gi|187777373|ref|ZP_02993846.1| hypothetical protein CLOSPO_00929 [Clostridium sporogenes ATCC 15579] >gi|187774301|gb|EDU38103.1| hypothetical protein CLOSPO_00929 [Clostridium sporogenes ATCC 15579] (625 aa)
Score = 1262, Expect = 1.2e-136, Identities = 269/612 (43%), Positives = 397/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ + + L   EV  I   + KV G+ T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ + +L     R KTGTP RI K S+D+SK+  +PG  K   FS    K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++  +PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +  +D++    KN+E+    LK ++ +  + + EF      T      +LYE++KRP+  +  +EP    +  L +  K++++I  KY GYI  Q + +   K  ++  +    +Y DV  + LEA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEKNVILRQLEVIQIDVEDHKVKGILTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLDLGINLRRFKTGTPARINKRSVDFSKMIEQPGDEKIVPFSFIHDK-LD-KDQISCYLTYTSEQTHKIIHENIHRSPLYNGSIEGVGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLVAGINSVLKIKGEDPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGYKIGLVKEDRYDKFLNRKKNVESEVERLKNVQITGKREINEFLLEKGSTELKKPISLYELIKRPELDYFKVEPLDDKRPDLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYEDRLIPKSINYPDVKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMERKNRE 624
>gi|184154470|ref|YP_001842811.1| cell division protein [Lactobacillus reuteri F275] >gi|183225814|dbj|BAG26331.1| cell division protein [Lactobacillus reuteri F275] (641 aa)
Score = 1262, Expect = 1.2e-136, Identities = 271/610 (44%), Positives = 383/610 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK----NVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKN-KNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  ++ ++V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IEE   + L    V+ +  V   VC GV T     + +  +++T GT     I IG    + GP++   +  L++ ++EL F   R KTGTPPR+   +IDYS  + +PG  +   +SF   D  ++  ++Q  C+L +TN   H II  NL ++ M+SG I G GPRYCPSIEDK+VRF DK RHQ+F+EPE +  D  YL G+S+S+PE++Q++IV +I G ENA + +  YAIEYD + P QL+PTLETK IK L+ AGQ NG+SGYEEAA QGL+AGIN   + + ++P VLKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL++ G+ +GL+S     +  +        +K LE   LK     V EF      N  K      ++LKRP + +  +  F+   +  LD +  ++V+I +KY GYIK ++  +   K ++  ++    DY D+  ++ E R KL K++P TL QASR+SG+N  D+  + +Y+   K
  S:    14 YDVIVVGAGHAGSEAALAAARMGNKTLLVTINLEMVAFMPCNPSVGGPAKGIVVREIDALGGEMGHNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHRAMKQTIEEEPNLTLRQATVDQL-IVEDGVCKGVITNTGARYHAKTVVLTVGTAARGKIIIGELQYESGPNNSKSAVKLSENLEELGFDLERFKTGTPPRVNGKTIDYSVTEEQPGDKEPHHFSFDTPDSAYIPISEQLSCWLTYTNEGTHAIIRENLSRAPMFSGVIKGVGPRYCPSIEDKIVRFADKPRHQVFLEPEGRDTDEYYLDGISTSMPEEIQQKIVHSIKGLENAEMMRPGYAIEYDVVAPYQLHPTLETKIIKNLYTAGQTNGSSGYEEAAGQGLIAGINAGLRAQGKKPFVLKRSDAYIGVMIDDLVTKGTKEPYRLLTSRAEYRLILRHDNADFRLMEMGHHVGLVSDERLAKMEEKKRQVAAEIKRLEEIKLKPSDDKVNEFIEAHGDNRLKDGIAAADLLKRPYFDYQTLAEFIPAPEQDLDRHVIEQVEIQLKYAGYIKKEEVKVERMKRMEAKRIPDDIDYGDIDGLATEGRQKLEKIRPETLAQASRISGVNPADIAILSVYVRQGK 634
>gi|160893419|ref|ZP_02074204.1| hypothetical protein CLOL250_00968 [Clostridium sp. L2-50] >gi|156864814|gb|EDO58245.1| hypothetical protein CLOL250_00968 [Clostridium sp. L2-50] (632 aa)
Score = 1262, Expect = 1.3e-136, Identities = 261/612 (42%), Positives = 387/612 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFNNTLKELETSTLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           + YD +V+GAGHAG EAA   A+   +  LF +    V  MPCNP++GG +KG + RE+DALGG      D T +Q K+LN+SKG    +LRAQ DK  YS+   + +E  +++ L   EV+ +  ++  V GV T     + +  +++ TGT+L +    G  V   GP+    +  L+  +KE      R KTGTP R+ K +ID+S+++ + G      FS F     D  + +V C+L +TN + HEII  N+++S ++SG I GTGPRYCPSIEDKV++F DK RHQ+F+EPE +  + +Y+GG+SSSLPEDVQ ++++++ G EN  I + AYAIEYD I+ I L  +LE K ++GLF AGQ+NG+SGYEEAA QGLMAGIN   ++  +EP+VL R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNAD RL   G+E+GLI    ++++ +    +E     L E        ++EF    +    KT  +L E+ +RP+ S+  + P    +  L     +++DI IKY GYIK Q + ++  K ++   + +  +Y DV N+  EAR KL  +KP  +GQASR+SG++  D+  + +YL+ K+
  S:     6 ENYDVVVVGAGHAGCEAALASARLGLETILFTVSMDSVAMMPCNPNVGGSSKGHLVRELDALGGEMGKNIDKTYIQSKMLNASKGPAVHSLRAQADKSNYSRTMKHTLENTDHLVLRQAEVSELMVIDGVVKGVKTFSGATYYAKAVVLCTGTYLKARCIYGDVVNHTGPNGLMAANHLSDSMKEAGIGIRRFKTGTPARLDKRTIDFSQMEEQKGDEHIVPFS-FTNTEEDIKRDQVSCWLCYTNEETHEIIRENINRSPLFSGVIEGTGPRYCPSIEDKVMKFPDKTRHQIFIEPEGEFTNEMYMGGMSSSLPEDVQYKMIRSMKGLENVRIVRNAYAIEYDCISAINLKHSLEFKDVEGLFGAGQLNGSSGYEEAAAQGLMAGINAARKVLGKEPVVLDRSQAYIGVLIDDLVTKETKEPYRMMTSRAEYRLLLRQDNADLRLTDIGHEIGLIDDERYEKFCQKRTMIEEETKRLTETMVGGNSKIQEFLRSMETTELKTAVSLAELTRRPELSYEKIAPIDPERQPLPADVIEQIDISIKYEGYIKRQTEQVHQFKKLEKRMIPADLNYDDVSNLRKEARQKLKDIKPENIGQASRISGVSPADISVLLVYLKMKQ 624
>gi|170756087|ref|YP_001783277.1| glucose-inhibited division protein A [Clostridium botulinum B1 str. Okra] >gi|169121299|gb|ACA45135.1| glucose-inhibited division protein A [Clostridium botulinum B1 str. Okra] (625 aa)
Score = 1262, Expect = 1.4e-136, Identities = 268/612 (43%), Positives = 397/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ E + L   EV  I   + +V GV T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ +  L     R KTGTP RI K S+D+SK+  +PG  K   FS    K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++ + PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +  ++++    KN+EN    L+ ++ +  + + EF      T      +LYE++KRP+  +  +EP    + +L +  K++++I  KY GYI  Q + +   K  ++  +    +Y D+  + LEA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEENVVLRQLEVIEIDVEDNEVKGVLTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLNLGINLRRFKTGTPARINKRSVDFSKMIEQPGDEKIVPFSFIHNK-LD-KDQISCYLTYTSEETHKIIHENIHRSPLYNGSIEGVGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKNPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGYKVGLVKEDRYNKFLNRKKNVENEIERLRNMQITGKREINEFLLEKGSTELKKPISLYELIKRPELDYFKVEPLDDKRPSLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYEDRLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMERKDRE 624
>gi|148545138|ref|YP_001272508.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus reuteri F275] >gi|148532172|gb|ABQ84171.1| glucose inhibited division protein A [Lactobacillus reuteri F275] (647 aa)
Score = 1261, Expect = 1.5e-136, Identities = 271/610 (44%), Positives = 383/610 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK----NVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKN-KNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  ++ ++V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IEE   + L    V+ +  V   VC GV T     + +  +++T GT     I IG    + GP++   +  L++ ++EL F   R KTGTPPR+   +IDYS  + +PG  +   +SF   D  ++  ++Q  C+L +TN   H II  NL ++ M+SG I G GPRYCPSIEDK+VRF DK RHQ+F+EPE +  D  YL G+S+S+PE++Q++IV +I G ENA + +  YAIEYD + P QL+PTLETK IK L+ AGQ NG+SGYEEAA QGL+AGIN   + + ++P VLKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL++ G+ +GL+S     +  +        +K LE   LK     V EF      N  K      ++LKRP + +  +  F+   +  LD +  ++V+I +KY GYIK ++  +   K ++  ++    DY D+  ++ E R KL K++P TL QASR+SG+N  D+  + +Y+   K
  S:    20 YDVIVVGAGHAGSEAALAAARMGNKTLLVTINLEMVAFMPCNPSVGGPAKGIVVREIDALGGEMGHNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHRAMKQTIEEEPNLTLRQATVDQL-IVEDGVCKGVITNTGARYHAKTVVLTVGTAARGKIIIGELQYESGPNNSKSAVKLSENLEELGFDLERFKTGTPPRVNGKTIDYSVTEEQPGDKEPHHFSFDTPDSAYIPISEQLSCWLTYTNEGTHAIIRENLSRAPMFSGVIKGVGPRYCPSIEDKIVRFADKPRHQVFLEPEGRDTDEYYLDGISTSMPEEIQQKIVHSIKGLENAEMMRPGYAIEYDVVAPYQLHPTLETKIIKNLYTAGQTNGSSGYEEAAGQGLIAGINAGLRAQGKKPFVLKRSDAYIGVMIDDLVTKGTKEPYRLLTSRAEYRLILRHDNADFRLMEMGHHVGLVSDERLAKMEEKKRQVAAEIKRLEEIKLKPSDDKVNEFIEAHGDNRLKDGIAAADLLKRPYFDYQTLAEFIPAPEQDLDRHVIEQVEIQLKYAGYIKKEEVKVERMKRMEAKRIPDDIDYGDIDGLATEGRQKLEKIRPETLAQASRISGVNPADIAILSVYVRQGK 640
>gi|126645956|ref|ZP_01718473.1| glucose-inhibited division protein A [Algoriphagus sp. PR1] >gi|126577588|gb|EAZ81808.1| glucose-inhibited division protein A [Algoriphagus sp. PR1] (621 aa)
Score = 1261, Expect = 1.6e-136, Identities = 262/607 (43%), Positives = 388/607 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL------KNVKEFKYNSRKTNTTLYEILKRPDYSF---IDMEPFLKNKNTLDEYWKD---KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           KYD +V+GAGHAG EAA   AK   KV L  ++   +  M CNP++GG AKG + REIDALGGM  I +D + +Q ++LN SKG   W+ R+Q D++ +++ +   +E    +D   + +  I   + +V GV T      E+  +++T GTFL+  IHIG K    G    + +  + +Q+  L F++ R+KTGTPPR+   S+DYSK++++ G      FS+ D       +Q  C++ +TN ++H  +    D+S M++G I G GPRYCPSIEDK+ RF ++ERHQ+FVEPE  +   IY+ G S+SLPEDVQ + ++ I GFENA + +  YAIEYD   P QL  TLET+ ++GL+FAGQINGT+GYEEAA QGL+AGIN   +++ ++P +LKR++AYIGVLI+DLINK   +PYR+ TSRAE+RL LR DNAD RL + GY L L SQ  +D+     +N    + +L+   L      K ++       K   +L ++LKRP       +D++P +     L+ + KD   + ++ IKY  YI+ +Q+++N   N++N K+    DY  +P +S E + KL+K+KP TLGQASR+SG++  DL  + +YL
  S:     4 KYDVIVVGAGHAGCEAAHAAAKMGSKVLLCTMNMNTIAQMSCNPAMGGVAKGQIVREIDALGGMSGIISDKSMIQFRMLNRSKGPAMWSPRSQNDRMRFAEEWRLALERTPNVDFWQEMITGIIEKDGRVKGVKTGIGIEIEAKSVVLTNGTFLNGLIHIGEKQFGGGRTGESAAKGITEQLVSLGFESGRMKTGTPPRVDGRSLDYSKMEVQYGDENPEKFSYSDETS-PIKEQRTCWITYTNKEVHSTLEEGFDRSPMFNGRIKGLGPRYCPSIEDKINRFAERERHQIFVEPEGWNTVEIYVNGFSTSLPEDVQYKAIQKITGFENAKMFRPGYAIEYDFFPPTQLKLTLETQLVEGLYFAGQINGTTGYEEAASQGLIAGINASLKVQEKDPFLLKRSDAYIGVLIDDLINKGTEEPYRMFTSRAEFRLLLRQDNADLRLTELGYNLNLASQERFDKMQSKKQNTAKLINDLKQKKLAPEQINKGLEALGTAEIKEKISLEKLLKRPQLGLDQMMDLDPDI--SKFLEGFPKDVREQAEVQIKYDSYIEKEQQMVNKLSNMENFKIPLKFDYLTIPALSNEGKQKLHKIKPETLGQASRISGVSPADLSILTVYL 619
>gi|168334918|ref|ZP_02693038.1| glucose inhibited division protein A [Epulopiscium sp. 'N.t. morphotype B'] (635 aa)
Score = 1261, Expect = 1.6e-136, Identities = 264/610 (43%), Positives = 389/610 (63%)
  Q:     5 DCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE---------TSTLKNVKEFKYNSRKTN-TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           D +VIG GHAG EAA  LA+   K  +F L+ + +  MPCNP+IGG +KG + +EIDALGG      D T +Q K+LN+SKG    +LRAQ DK+EY K  L  ++    + +  +EV+ I   N +V GV T+    + +  ++V TGT+L S I IG      GPD    S +L+  + +      R KTGTP R+ K +ID++ ++ + G +K   FS F        K ++ C+L +TN + H+II +NLD+S +Y G I G GPRYCPSIEDKVVRF DK RHQ+F+EPE    + +Y+ G+SSSLPE+VQ Q+++++ G EN  + +  YAIEYD INP  L  +LE K I GLFFAGQING+SGYEEAA QGL+AGIN   +++ +EPL++ R E YIGVLI+DL+ K   +PYR+LTSRAEYRL LR DNAD RL+  G+++GL+     D Y K L+       E+E         T+T++++   K ++  T+  +L+E+LKRP+  + D      +   L +   ++++I +KY GYIK Q   ++  K ++   +     Y+D+ ++ +EAR KL ++KP ++G ASR+SG++  D+  + +Y+E  K+
  S:     9 DAIVIGGGHAGCEAALSLARLGKKTVIFCLNIEAIAKMPCNPNIGGTSKGHLVKEIDALGGEMGKNIDKTYIQSKMLNTSKGPAVHSLRAQADKVEYHKAMLKVLDAETNLTIKQQEVSDILIENARVMGVRTITGAIYYAKAVVVCTGTYLKSKIFIGEFAENAGPDGLKSSQVLSNSLLDNGITLRRFKTGTPARVDKRTIDFTAMEAQLGDSKVVPFS-FSNSAASIKKNQIQCFLTYTNEQTHQIIRDNLDRSPLYGGKIEGVGPRYCPSIEDKVVRFADKSRHQIFIEPEGVETNEMYVQGMSSSLPEEVQIQMLRSVRGLENVEVIRGGYAIEYDCINPTSLLHSLENKVISGLFFAGQINGSSGYEEAAAQGLVAGINAALKIDAKEPLIIDRAEGYIGVLIDDLVIKGTNEPYRMLTSRAEYRLLLRQDNADIRLMTKGHDIGLVPD---DIYAKFLDKQEVIEAEIERIKKVFVGTTATVQSILMAKGSTPLTSGMSLHELLKRPELDYKDFAAVNLDGPELSDEIIEQIEITLKYEGYIKRQLIQVDQFKKLEKKLIPENLKYEDIKSLRIEARQKLLEIKPKSIGAASRISGVSPADISVMLVYMEQLKR 625
>gi|183222816|ref|YP_001840812.1| glucose-inhibited division protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189909571|ref|YP_001961126.1| Glucose inhibited division protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167774247|gb|ABZ92548.1| Glucose inhibited division protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167781238|gb|ABZ99536.1| Glucose-inhibited division protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (624 aa)
Score = 1261, Expect = 1.7e-136, Identities = 263/606 (43%), Positives = 381/606 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLY 608
           ++DC+V+GAGHAG EAA+I AK   K  L  ++   +G M CNP+IGG AKG + RE+DALGG+     D T +Q K+LN+SKG   WA RAQ +K +Y     +++E+ + + +    V  +     +V GV T     F +N++I+TTGTFL S IHIG    + G      +  L+  +   + +  RLKTGTP R+ KNSI++  L+I+ G      FS F  K +D  KQ  C++ +TN+  HE+I  NL+ S MYSG I   GPRYCPSIEDKVVRF +++RHQ+F+EPE    + +YL G+S+SLPE+VQ + +++I G E   + +  YAIEYD ++P +L+PTLETKK+KGL+ AGQINGT+GYEEAA QGL+A  NV+  +   EP++ KR+E+YIGVL++DL+ K + DPYR+ TSRAEYRL LR DNADQRL++YGYE+GL+ +S + +         +    L  S +K        ++E +  + K   +L   LKR D    D+EP +   + L+E  K  +++ +KY GY+K + + I   K   N ++    DY  V  +  EA  KL K +PL L  A  +SG++  D +++ LY
  S:     9 QFDCIVVGAGHAGTEAAYISAKAGLKTLLITMNLDTIGQMSCNPAIGGIAKGHMVREVDALGGLMGRVIDQTGIQFKMLNTSKGPSVWAPRAQAEKKQYQLMIKHQLEKLQQLSIRQDTVEDLIVEGNQVTGVITGRGFTFYTNHVILTTGTFLSSVIHIGTYQKESGRIGEPTTKGLSHTLARFELRLGRLKTGTPARVHKNSINFDGLEIQDGDENPRPFS-FSTKKID-RKQIPCFITYTNDTTHELIKQNLEYSPMYSGQIKSVGPRYCPSIEDKVVRFAERDRHQIFIEPEGYETNEMYLNGVSTSLPEEVQWKFLRSIKGLEQVELMRPGYAIEYDYVDPTELHPTLETKKVKGLYHAGQINGTTGYEEAAAQGLVAAYNVIRSVRKEEPILFKRSESYIGVLVDDLVYKGVEDPYRMFTSRAEYRLLLRQDNADQRLMQYGYEMGLVEESLYKDMKDRYARIESIKSHLFVSAMKPSPELTKVLEEKQITNYKFGHSLSSFLKRSDIKIKDLEPIVSELSILNEDEKAVLEMEVKYEGYLKRELETIEYRKKFLNFQIPIDFDYASVKGLKTEAIVKLEKHRPLNLENALHISGVDPSD-VDLLLY 618
>gi|153939143|ref|YP_001392998.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum F str. Langeland] >gi|166222927|sp|A7GJN8|GIDA_CLOBL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|152935039|gb|ABS40537.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum F str. Langeland] (625 aa)
Score = 1261, Expect = 1.8e-136, Identities = 267/612 (43%), Positives = 398/612 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ + + L   EV  I   + +V GV T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ + +L     R KTGTP RI K S+D+SK+  +PG  K   FS    K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++ + PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +  ++++    KN+EN    L+ ++ +  + + EF      T      +LYE++KRP+  +  +EP    + +L +  K++++I  KY GYI  Q + +   K  ++  +    +Y D+  + LEA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEDNVVLRQLEVIEIDVEDNEVKGVLTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLDLGINLRRFKTGTPARINKRSVDFSKMIEQPGDEKIVPFSFIHNK-LD-KDQISCYLTYTSEETHKIIHQNIHRSPLYNGSIEGVGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKNPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGYKVGLVKEDRYNKFLNRKKNVENEIERLRNMQITGKREINEFLLEKGSTELKKPISLYELIKRPELDYFKVEPLDDKRPSLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYEDRLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMERKNRE 624
>gi|166032900|ref|ZP_02235729.1| hypothetical protein DORFOR_02621 [Dorea formicigenerans ATCC 27755] >gi|166027257|gb|EDR46014.1| hypothetical protein DORFOR_02621 [Dorea formicigenerans ATCC 27755] (640 aa)
Score = 1261, Expect = 1.8e-136, Identities = 276/607 (45%), Positives = 394/607 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSI------KFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYN---KNLENFNNTLKELETSTLKNVKEF--KYNSRKTNT--TLYEILKRPDYSF-----IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           +YD  VIGAGHAG EAA   A+  +K  +F +  + +  MPCNP+IGG +KG + +E+DALGG      D T +Q K+LN SKG    +LRAQ DK +YS+     +E  E +D+   EV +I      +   +KV GV  +    +    +++ TGT+L +    G      GP+    +  L + +K L     R KTGTP RI K SID++K++ + G  +   FS F     D    +V C+L +TN K HEII NNLD+S +YSG I GTGPRYCPSIEDKVVRF DK RHQ+F+EPE    + +Y+GG+SSSLPEDVQ  + +++ G E+A I + AYAIEYD I+  QL P+LE ++I+GLF  GQ NG+SGYEEAACQGL+AGIN   +L+ +E +VL R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNADQRL + GYE+GLISQ  ++      K +E   + ++ +   T + V+    +Y S   N+  +L E+++RP+ ++     ID E   +    L E   ++V+I IKY GYIK Q+K +   K ++N K+    DY  V ++ +EA  KL + +P+++GQASR+SG++  D+  + +YL
  S:    14 EYDIAVIGAGHAGCEAALAAARMGFKTVVFTVSVESIAMMPCNPNIGGSSKGHLVKEVDALGGEMGKVIDKTFIQSKMLNQSKGPAVHSLRAQADKEQYSRTMRRVLENQENLDVRQTEVVNILTEEVCESGKKKVIGVQILSGGIYRVKAVVLCTGTYLRARCVYGEVSNATGPNGLQAANHLTECLKNLGINMYRFKTGTPARIDKRSIDFNKMEAQYGDERITPFS-FTTNPDDIQIDQVPCWLTYTNEKTHEIIRNNLDRSPLYSGMIEGTGPRYCPSIEDKVVRFADKNRHQVFIEPEGIDTNEMYIGGMSSSLPEDVQYDMYRSVAGLEHAKIVRNAYAIEYDCIDARQLKPSLEFREIEGLFSGGQFNGSSGYEEAACQGLIAGINAARKLQKKEAVVLDRSQAYIGVLIDDLVTKESHEPYRMMTSRAEYRLLLRQDNADQRLTEIGYEIGLISQDRYERLKLKEKLIEEEVSRVEHVHVGTSEKVQNLLAQYQSTPLNSGISLAELIRRPELTYQVLTTID-EARPEFPKDLSEEVSEQVNISIKYDGYIKRQKKQVEQFKKLENKKIPENIDYDQVKSLRIEAVQKLKEFRPVSIGQASRISGVSPADISVLLVYL 637
>gi|15896964|ref|NP_350313.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium acetobutylicum ATCC 824] >gi|21263674|sp|Q97CW3|GIDA_CLOAB tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|15026840|gb|AAK81653.1|AE007868_9 Glucose-inhibited division protein, GIDA (NAD/FAD-utilizing enzyme) [Clostridium acetobutylicum ATCC 824] (626 aa)
Score = 1260, Expect = 1.9e-136, Identities = 263/607 (43%), Positives = 395/607 (65%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY--NKN-LENFNNTLKELETSTLKNVKEFKYN----SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +VIG GHAG EAA   ++   +  +  ++   +  MPCNP+IGG AKG + +EIDALGG   +  D T +Q ++LN SKG    +LRAQ DK+ YS+   N +E  E + L   EV S+   + KV G+ T +   F +N +++ TGT+L S I IG      GP     +  L++ + ++  +  R KTGTP RI K S+D+SK+  +PG  +   FS  + K     +Q  CYL +TN K HE+I  N+D+S +Y+G I   GPRYCPSIEDKV+RF DK++HQ+F+EPE ++ + +Y+GG+SSSLPE+VQ +++K + G E+  I K AYAIEYD I+P QL  +LE K +KGLF AGQ NG+SGYEEAA QG++AGIN    ++N+EPL+L R++ YIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + G+++GL+ ++ ++++   KN +E   N LK+++ +  K V +F       S K   +LYE+++RP+  +  ++    ++  L +   D+V+I IKY GYI+ Q + ++  K  +   +    DY  + N+  EA  KL+K++P+ LGQASR+SG++  D+  + +YL+
  S:     9 YDVIVIGGGHAGCEAALAASRMGCRTLMCTMNLDSIAMMPCNPNIGGTAKGHLVKEIDALGGEMGVNIDKTFIQSRMLNISKGPAVHSLRAQADKVRYSEVMRNVLENQEDLYLRQIEVISLDIEDGKVKGIVTKNGACFTANTIVLATGTYLRSRIIIGEVNYSGGPSGLFPANELSQSLIDVGIKLRRFKTGTPARINKRSVDFSKMVEQPGDERIIPFSFLNDKLE--KEQISCYLTYTNEKTHEVIKENIDRSPLYNGTIKSVGPRYCPSIEDKVMRFPDKQQHQIFIEPEGENTNDLYVGGMSSSLPEEVQIKMLKTVPGLEDVEILKTAYAIEYDCIDPTQLKLSLEFKDVKGLFGAGQFNGSSGYEEAASQGIIAGINAALMVKNKEPLILGRSDGYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGHKIGLVDENRYEKFIGRKNAIEEELNRLKKVQITNKKEVNDFLEGLGSVSLKKPISLYELIRRPELDYDKLQTLDIDRKDLAQDIIDEVNIMIKYEGYIEKQLEQVDQFKKFEKRVIPEDIDYNSIKNLRTEAIQKLSKLRPVNLGQASRISGVSPSDISVLMIYLD 620
>gi|154496172|ref|ZP_02034868.1| hypothetical protein BACCAP_00456 [Bacteroides capillosus ATCC 29799] >gi|150274727|gb|EDN01791.1| hypothetical protein BACCAP_00456 [Bacteroides capillosus ATCC 29799] (621 aa)
Score = 1260, Expect = 1.9e-136, Identities = 261/607 (42%), Positives = 367/607 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKTN-TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +D  VIGAGHAG+EAA   A+   +   F ++   VGNMPCNP+IGG  KG + REIDALGG    AAD   +Q ++LN  KG   W+LRAQ D+ EY K   + +E  E + +   EV  I+     V  V T     +     +V TGTFL     +G  V   GPD  + +  L   +K L     R KTGTPPR+ + S+D+SK++++PG      FS F+      NK  VC+L +TN   H +I  NLD+S +Y G I G GPRYCPSIE K+VRF +KERHQLF+EP     + +Y+ GLSSSLPE+VQ +++  I G E A + + AYAIEYD ++P +L PTLE KK+ GL+ AGQ NG+SGYEEAA QGL+AGIN   +L  R P+VL R++ YIGVLI+DL+ K   +PYR++TSR EYRL  R DNAD+RL   G+E+GL+S+  +          +     LE      +  L  +   K      N   L ++L+RP  ++ D+ P    +  L     + V+I +KY GYI+ QQ+ + + + +++  L    DY+ +  + LEAR KL++++PL LGQASR+SG++  D+  + + LE
  S:     8 FDIAVIGAGHAGIEAALAAARLGLQTVCFTVNLDAVGNMPCNPAIGGTGKGHLVREIDALGGEMGRAADAACIQYRILNKGKGPAVWSLRAQADRREYQKVMKHTLERQENLWVKQAEVVEIRTEQGAVSAVVTATGAVYAVKAAVVCTGTFLGGRTIVGDVVRDSGPDGLSAALPLTDCLKSLGLSIRRFKTGTPPRVHRRSVDFSKMELQPGDPDAQPFS-FETATAPENKA-VCHLTYTNAATHAVIRANLDRSPLYDGTIEGVGPRYCPSIETKIVRFPEKERHQLFIEPMGLDTEELYIQGLSSSLPEEVQVEMLHTIPGLERAEMTRAAYAIEYDCVDPTELLPTLECKKVPGLYGAGQFNGSSGYEEAAAQGLVAGINAALKLLGRPPMVLSRDQGYIGVLIDDLVTKGTNEPYRMMTSRTEYRLLCRQDNADRRLTGVGHEVGLVSEERYRAMLDKYAAVDRECARLERTGVSPSPVLDALLSDKGEPPAPNGARLADLLRRPRMTYGDLTPLDPARPDLPAAVTEAVEIDLKYRGYIERQQRQVEEMRRLESRPLPPDLDYQSLQGLRLEARQKLSEIRPLNLGQASRISGVSPADIAALMIALE 619
>gi|167931731|ref|ZP_02518818.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 156a] >gi|195949093|ref|ZP_03090193.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi WI91-23] >gi|195955443|ref|ZP_03094136.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi CA-11.2a] (621 aa)
Score = 1260, Expect = 2.2e-136, Identities = 272/612 (44%), Positives = 391/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ V  +S EAR+K +K++P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSRYLFKESRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIVEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 614
>gi|119489483|ref|ZP_01622244.1| glucose-inhibited division protein A [Lyngbya sp. PCC 8106] >gi|119454562|gb|EAW35709.1| glucose-inhibited division protein A [Lyngbya sp. PCC 8106] (638 aa)
Score = 1260, Expect = 2.2e-136, Identities = 255/613 (41%), Positives = 377/613 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-------KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+G GH+G EAA   A+   +  +  L+   +   PCNP++G PAK  +T E+DALGG     AD T LQ +LLN+S+G   WALRAQ DK EY+    N IE  E + + +  V  +    N ++ GV T  +  F+   +I+TTGTFL   I +G+K +  G      +  L   + +L F+T RLKTGTP R+ K S++YS+L+ +PG  +   FS FD +     +Q  CYL  T  + H II  NL  S +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE +++  +Y+ G S+ LPE +Q Q+++++ G E   + + AYA+EYD +   Q YPTL TK+I+GLF AGQINGT+GYEEAA QG++AGIN      N+E ++  R  +Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  +     N     + L ++ +K   E             K + TL ++L+RP + ++++E +      +D   K+  +I +KY GY++ QQ  I+      N KL    +Y  +  +S+E+R+KL KV+PLT+GQASR+ G+N  D+  + +YLE + +Q
  S:    12 EFDIVVVGGGHSGCEAALASARLGCRTLMLTLNLDKIAWQPCNPAVGAPAKSQLTHEVDALGGEIGKMADRTYLQKRLLNNSRGPAVWALRAQTDKREYAAVMQNIIENQENLAIREGMVTDVVLGENDEIIGVKTYFDVAFKCKAVILTTGTFLGGVIWVGNKSMSAGRAGEFAAVGLTDTLNKLGFETGRLKTGTPARVDKRSVNYSQLEPQPGDEEVRWFS-FDPEVWVEREQMCCYLTRTTAETHRIIRENLHLSPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRNIPELYIQGFSTGLPERLQLQMLRSLPGLEKCTMLRPAYAVEYDYLPATQCYPTLMTKRIEGLFCAGQINGTTGYEEAAAQGIVAGINAARFSRNQEMIIFPREGSYLGTLIDDLCTKDLREPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWQLFEHKQANIIAEKERLHSTRIKERDEVGMAIVSDTQQKIKGSITLADLLRRPGFHYVNLERYNLGNPDIDSVEKEGAEIEVKYSGYLQRQQNQIDQISRHANRKLPENINYMMIETLSMESREKLTKVRPLTIGQASRIGGVNPADVNALLIYLEIQNRQ 631
>gi|168183720|ref|ZP_02618384.1| glucose-inhibited division protein A [Clostridium botulinum Bf] >gi|182673272|gb|EDT85233.1| glucose-inhibited division protein A [Clostridium botulinum Bf] (625 aa)
Score = 1260, Expect = 2.2e-136, Identities = 268/612 (43%), Positives = 397/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ E + L   EV  I   + +V GV T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ + +L     R KTGTP RI K S+D+SK+  +PG  K   FS    K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++   PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +  ++++    KN+EN    L+ ++ +  + + EF      T      +LYE++KRP+  +  +EP    + +L +  K++++I  KY GYI  Q + +   K  ++  +    +Y D+  + LEA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEENVVLRQLEVIEIDVEDNEVKGVLTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLDLGINLRRFKTGTPARINKRSVDFSKMIEQPGDEKIVPFSFIHDK-LD-KDQISCYLTYTSEETHKIIHENIHRSPLYNGSIEGVGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAQILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEENPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGYKVGLVKEDRYNKFLNRKKNVENEIERLRNMQITGKREINEFLLEKGSTELKKPISLYELIKRPELDYFKVEPLDDKRPSLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYEDRLIPKNINYLDIKGLRLEAIQKLKKIKPINIGQASRISGVSPADISVLLIYMERKNRE 624
>gi|167942513|ref|ZP_02529587.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia afzelii ACA-1] (621 aa)
Score = 1260, Expect = 2.3e-136, Identities = 270/612 (44%), Positives = 393/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDY---SFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  +++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI + S+D+SK +++ G +    FS F    LD   Q  CY+ +TN + HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE+VQ++++ +I G E+AVI +  YA+EYD INPI+LYP+LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  + +Y    + +E     LK+   S LK++ + +   +  N   Y ILK P     + I ++P L +   + E    +V++ IKY GYI  Q+ +I    N++ +KL    +Y  +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALAISRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRANMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHRKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKRTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENVQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPSLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSKYLFKKRRVEEIKELLKQRRLS-LKDIADEQLK-KHVNKDFYHILKDPSINLDNLIKIDPSLSDSKVILE----QVELDIKYEGYINRQKDLIKKLHNLELVKLPFDFNYGIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSNPKNK 614
>gi|195941909|ref|ZP_03087291.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 80a] (621 aa)
Score = 1260, Expect = 2.3e-136, Identities = 272/612 (44%), Positives = 391/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIKGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSRYLFKESRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLNDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIIEGLSREAREKFSKVQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 614
>gi|69247495|ref|ZP_00604365.1| Glucose-inhibited division protein A subfamily [Enterococcus faecium DO] >gi|68194820|gb|EAN09295.1| Glucose-inhibited division protein A subfamily [Enterococcus faecium DO] (633 aa)
Score = 1260, Expect = 2.3e-136, Identities = 268/610 (43%), Positives = 377/610 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKF-LDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  YS    + IE+   + L    V  +  V   VC GV T     + +  +++T GT L   I IG      GP++   S  LA  +KEL F   R KTGTPPR+  ++IDYS  + +PG  +   +SFS  D  + LD   QE C+L +T    H+II +NL ++ M++G + G G RYCPSIEDK+VRF DK RHQLF+EPE  + + +Y+ GLS+SLPEDVQ  ++ +I G E   + +  YAIEYD + P QL PTLETK ++ L+ AGQ NGTSGYEEAA QGL+AGIN   +++ +EPLV+KR++ YIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ +GL+ +  +  Y K  E     +K L    +K  +E +           K      + L+RP+ ++ ++  F+     L     ++V++ IKY GYIK   + +   K ++  K+    DY  +  ++ EA+ KL K++P T+ QASR+SG+N  DL  + +Y+E  K
  S:     9 YDVIVVGAGHAGSEAALAAARMGSKTLLLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGKNIDKTYIQMRMLNTGKGPAVRALRAQADKHAYSTEMKHTIEKEPNLTLRQGIVEEL-IVEDGVCHGVVTSTGASYRAKAVVITAGTALRGEIIIGELKYSSGPNNSQPSIGLANHLKELGFAIERFKTGTPPRVKSSTIDYSVTEEQPGDKEPNHFSFSTPDSAYKLD---QESCWLTYTGETTHQIIRDNLHRAPMFTGIVEGVGARYCPSIEDKIVRFADKPRHQLFLEPEGLNTEEVYVQGLSTSLPEDVQVNMLHSIAGLEKVEMMRTGYAIEYDVVEPHQLRPTLETKVVENLYTAGQTNGTSGYEEAAGQGLIAGINAALKVQGKEPLVIKRSDGYIGVMIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTEMGHRVGLVKEDQYKNYLKKKEAVEQEIKRLMNVRIKPTEEVQDFLATINAAPLKDGVLASDFLRRPEITYAELLRFIPENEELTRKEIEQVEVQIKYEGYIKKAMEKVEKLKRMEAKKIPENIDYAAINGLATEAKQKLQKIQPETIAQASRISGVNPADLSILMVYIEQGK 625
>gi|51598439|ref|YP_072627.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia garinii PBi] >gi|81170527|sp|Q662I6|GIDA_BORGA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|51573010|gb|AAU07035.1| glucose inhibited division protein A [Borrelia garinii PBi] (621 aa)
Score = 1259, Expect = 2.6e-136, Identities = 271/612 (44%), Positives = 392/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F SN +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN + HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++ + +I G E+A+I +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  + +Y    + +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLDFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIKGVVTERGNKFRSNVVVLTTGTFLRGKIFIGEYRANMGRLAEFSAYGLDKTLLSLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGNLD-KSQLSCYVTYTNKRTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKFINSIEGLEHAIITRPGYAVEYDYINPIELYPNLESKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSKYLFKKRRVEEIKELLKQRRLS-LKDVADEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKKLNNLELVKLPFDFNYEIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSNPKNK 614
>gi|15594523|ref|NP_212312.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi B31] >gi|2688059|gb|AAC66557.1| glucose inhibited division protein A (gidA) [Borrelia burgdorferi B31] (627 aa)
Score = 1259, Expect = 3.1e-136, Identities = 271/612 (44%), Positives = 391/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +K++P TL QASR+ GI   D+  + +Y  N K +
  S:     9 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEKRYSRYLFKESRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIIEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 620
>gi|167933989|ref|ZP_02521064.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi ZS7] >gi|167944058|ref|ZP_02531132.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi Bol26] >gi|195960786|ref|ZP_03096991.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 64b] >gi|1707903|sp|P53362|GIDA_BORBU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|1200212|emb|CAA78149.1| gidA [Borrelia burgdorferi] >gi|2689170|emb|CAA06005.1| glucose inhibited division protein A [Borrelia burgdorferi] (621 aa)
Score = 1259, Expect = 3.1e-136, Identities = 271/612 (44%), Positives = 391/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +K++P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEKRYSRYLFKESRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIIEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 614
>gi|114568075|ref|YP_755229.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317084|sp|Q0ATU6|GIDA_SYNWW tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|114339010|gb|ABI69858.1| glucose inhibited division protein A [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (624 aa)
Score = 1259, Expect = 3.1e-136, Identities = 265/612 (43%), Positives = 384/612 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYN--------SRKTNTTLYEILKRPDYSFIDM--EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           Y+ +VIGAGHAG EAA   A+   +  L  +    +  MPCNPSIGGPAK  V REIDALGG  A+  D   +Q++ +N+ KG    ALRAQ DK +Y    L  +   + +D++  EV  I+    +V  + T     FE   L++TTGT+L   I +G      GP +   +  L++ +K +  +  R KTGTPPRI   S+D+SK+  +PG  +   FS F    ++   Q  C+L  +N K H+I+ NNLD++ MY+G I G G RYCPS EDKVVRF+ K+ HQLF+EPE +  D +Y+ GL++SLPEDVQ +++K+I G EN  I +  YAIEYD I P QL  +LE K ++GLF AGQINGTSGYEEAA QGL+AGIN   Q++ +EP +LKR+EAYI V+I+DLINKEI +PYRLLTSRAEYRL LR DNAD RL + G ++GL+  + W  Y +  E       EL+ S+     E   +        + +   +L+E+L+RP+ S  D   + +L++    D    ++++I  KY GYI+ Q++ +   + ++N  +    +Y +V  +S EA  KL  + P ++GQASR++G+N  D+  + ++LE K+++
  S:     8 YEVIVIGAGHAGCEAALASARMGCQTLLVTMSIDHIALMPCNPSIGGPAKAQVVREIDALGGEMALNIDKANVQIRTINTGKGPAVQALRAQADKRQYHLEMLKTLFNQKKLDILMAEVEDIELSAGRVKAIVTRTGARFECQALVLTTGTYLKGRIIVGDISFDGGPGNQFPAARLSESLKRMGLRLGRFKTGTPPRIDSKSVDFSKMIEQPGDKRPLRFS-FISPLIN-RPQLPCWLTHSNKKTHQIVMNNLDRAPMYTGIIKGIGTRYCPSFEDKVVRFSHKDSHQLFIEPEGRDTDEMYVQGLNTSLPEDVQIEVLKSIPGLENVRIMRTGYAIEYDIIYPSQLKLSLECKTVEGLFTAGQINGTSGYEEAAAQGLIAGINAALQVKEKEPFILKRSEAYIAVMIDDLINKEIVEPYRLLTSRAEYRLLLRQDNADLRLTEKGRQIGLVDDNRWMAYQQKEEILEVESNELKFSSFTPADEEMADFLSGKNTAAIRDRVSLWELLRRPELSIYDYVEKGWLRDN---DPDILEQLEIQAKYEGYIEKQKEQVKRFEKLENKMIPPDINYDEVYGLSQEAVQKLKIILPASVGQASRIAGVNPADINVLLIFLEKKRRK 624
>gi|126701302|ref|YP_001090199.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile 630] >gi|168714861|ref|ZP_02747138.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile QCD-63q42] >gi|196124299|ref|ZP_03116048.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile ATCC 43255] >gi|115252739|emb|CAJ70584.1| glucose inhibited division protein A [Clostridium difficile 630] (631 aa)
Score = 1259, Expect = 3.2e-136, Identities = 270/612 (44%), Positives = 379/612 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR---------KTNTTLYEILKRPDYSFIDMEPFLKNK-NTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           KYD +V+GAGHAG EAA   A+  YK  +  +    +  MPCNPSIGG  KG + +EIDALGG   +  D T +Q ++LN++KG    +LRAQ DK +Y +     +E+   +D+   EV  I      V GV T     F+S  +I+ TG +L+S I++G     +GP+    +  L   + EL  +  R KTGTP R+ ++SID+S + ++ G  K   FS  +       KQE CYL  T  +  ++I +NL +SAMYSG I  TGPRYCPSIEDKVVRF+DK  HQLF+EPE  +   +Y+ G+S+SLP +VQ  + K I G EN  I + AYAIEYD ++P QL  +LE K ++ LF AGQ NGTSGYEEAA QGLMAGIN + ++E +EP VL R+EAYIGVL++DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +   D Y + L       KE E    + V   + NS          K   +LYE LKRP+ ++  +E   K   + +    K++  I  KY GYI+ Q K I+  K ++N KL    +Y  +  + LEAR KL+ +KP+++GQASR+SG++  D+  + +YLE  ++
  S:     8 KYDVIVVGAGHAGCEAALATARMGYKTLIITMSLDSIALMPCNPSIGGTGKGQLVKEIDALGGQMGLNIDKTYIQSRMLNTAKGPAVHSLRAQADKFKYHEEMKKTLEDEPNLDIAMDEVVEILHEGNVVIGVGTKLGCSFKSKAVILATGVYLNSKIYMGEVAFYEGPNALGYAKYLTDSLVELGLRMRRFKTGTPARVHRDSIDFSVMSLQEGDEKVTPFSFMNENIE--KKQEPCYLTRTTEETQKVILDNLKRSAMYSGVIESTGPRYCPSIEDKVVRFSDKTSHQLFIEPEGLNTKEMYIQGISTSLPFEVQLDMYKTIKGLENCKIMRPAYAIEYDCVDPTQLKISLEIKGVENLFSAGQFNGTSGYEEAAAQGLMAGINAVRKIEGKEPFVLDRSEAYIGVLLDDLVTKGTNEPYRMMTSRAEYRLYLRQDNADMRLTQKGYDIGLVKK---DRYERFLNKKAAVEKEFERLKNERVTPKEVNSLLEEKGATPIKVGISLYEFLKRPEVTYELLEELGKGAGDDVSREVKEQCVIITKYEGYIEKQLKQIDQFKKLENKKLDEKINYSSIEGLRLEARQKLDDIKPISIGQASRISGVSPADISVLLIYLEQIRR 624
>gi|195958865|ref|ZP_03095074.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia sp. SV1] (621 aa)
Score = 1258, Expect = 3.3e-136, Identities = 272/612 (44%), Positives = 391/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ V  +S EAR+K +K++P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEKRYSRYLFKESRVEEIKELLKQRRLS-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLGDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIVEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 614
>gi|145952512|ref|ZP_01801522.1| hypothetical protein CdifQ_04004263 [Clostridium difficile QCD-32g58] >gi|168695991|ref|ZP_02728268.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile QCD-37x79] >gi|168724968|ref|ZP_02757245.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile QCD-76w55] >gi|168732205|ref|ZP_02764482.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile QCD-97b34] >gi|196160215|ref|ZP_03120776.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile CIP 107932] (631 aa)
Score = 1257, Expect = 4.4e-136, Identities = 270/612 (44%), Positives = 378/612 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR---------KTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           KYD +V+GAGHAG EAA   A+  YK  +  +    +  MPCNPSIGG  KG + +EIDALGG   +  D T +Q ++LN++KG    +LRAQ DK +Y +     +E+   +D+   EV  I      V GV T     F+S  +I+ TG +L+S I++G     +GP+    +  L   + EL  +  R KTGTP R+ ++SID+S + ++ G  K   FS  +       KQE CYL  T  +  ++I +NL +SAMYSG I  TGPRYCPSIEDKVVRF+DK  HQLF+EPE  +   +Y+ G+S+SLP +VQ  + K I G EN  I + AYAIEYD ++P QL  +LE K ++ LF AGQ NGTSGYEEAA QGLMAGIN + ++E +EP VL R+EAYIGVL++DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +   D Y + L       KE E    + V   + NS          K   +LYE LKRP+ ++  +E   K     +    K++  I  KY GYI+ Q K I+  K ++N KL    +Y  +  + LEAR KL+ +KP+++GQASR+SG++  D+  + +YLE  ++
  S:     8 KYDVIVVGAGHAGCEAALATARMGYKTLIITMSLDSIALMPCNPSIGGTGKGQLVKEIDALGGQMGLNIDKTYIQSRMLNTAKGPAVHSLRAQADKFKYHEEMKKTLEDEPNLDIAMDEVVEILHEGNVVIGVGTKLGCSFKSKAVILATGVYLNSKIYMGEVAFYEGPNALGYAKYLTDSLVELGLRMRRFKTGTPARVHRDSIDFSVMSLQEGDEKVTPFSFMNENIE--KKQEPCYLTRTTEETQKVILDNLKRSAMYSGVIESTGPRYCPSIEDKVVRFSDKTSHQLFIEPEGLNTKEMYIQGISTSLPFEVQLDMYKTIKGLENCKIMRPAYAIEYDCVDPTQLKISLEIKGVENLFSAGQFNGTSGYEEAAAQGLMAGINAVRKIEGKEPFVLDRSEAYIGVLLDDLVTKGTNEPYRMMTSRAEYRLYLRQDNADMRLTQKGYDIGLVKK---DRYERFLNKKAAVDKEFERLKNERVTPKEVNSLLEEKGATPIKVGISLYEFLKRPEVTYELLEELGKGAGEDVSREVKEQCVIITKYEGYIEKQLKQIDQFKKLENKKLDEKINYSSIEGLRLEARQKLDDIKPISIGQASRISGVSPADISVLLIYLEQVRR 624
>gi|195947818|ref|ZP_03089004.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia garinii PBr] (621 aa)
Score = 1257, Expect = 4.7e-136, Identities = 272/612 (44%), Positives = 392/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K SID+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++ + +I G E+A+I +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  + +Y    + +E     LK+   S LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFILNSMR---NEIKGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRANMGRLAEFSAYGLDKTLLSLGFEMGRLKTGTPARIHKKSIDFSKTEVQFGDSDIIPFS-FSNGNLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKFINSIEGLEHAIITRPGYAVEYDYINPIELYPNLESKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSKYLFKKRRVEEIKELLKQRRLS-LKDVADEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKKLNNLELVKLPFDFNYEIIEGLSREAREKFSKVQPATLAQASRIPGIRNTDITVLFIYFSNPKNK 614
>gi|164686453|ref|ZP_02210481.1| hypothetical protein CLOBAR_00018 [Clostridium bartlettii DSM 16795] >gi|164604464|gb|EDQ97929.1| hypothetical protein CLOBAR_00018 [Clostridium bartlettii DSM 16795] (631 aa)
Score = 1257, Expect = 4.7e-136, Identities = 273/611 (44%), Positives = 381/611 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS--TLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEY-WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG EAA   A+   K  +  L    +G MPCNPSIGG  KG + +EIDALGG   +  D T +Q ++LN++KG    +LRAQ DK +Y       +E    ++++  EV  +    + + GV T     + S  +++ TG +L+S I+IG   + +GP+    +  L  ++ +L     R KTGTP RI ++SID+S++ I+ G  K   +SF   D K      Q  CYLA TN   H++I +N+++SAMY G I  TGPRYCPSIEDKVVRFNDKE HQ F+EPE      +Y+ G+S+SLP +VQ Q+ +++ G EN  I + AYAIEYD +NP QL  +LE K  + LF AGQ NGTSGYEEAA QGLMAGIN   +++ +EP +L R+EAYIGVLI+DLI K   +PYR++TSRAEYRL LR DNAD RL + GYE+GL SQ  +D +          L+ L+T   T K V E       +  K   +LY+ LKRP+ ++  +E   K  +    Y  K++  I  KY GYI  Q K I+  K ++N KLS   DY  +  + +EAR KLN +KP+++GQASR+SG++  D+  + +YLE  ++
  S:     9 YDVIVVGAGHAGCEAALASARMGCKTLMVTLTLDSIGMMPCNPSIGGTGKGQLVKEIDALGGEMGVNTDKTFIQSRMLNTAKGPAVHSLRAQADKFKYHTEMKKTLENEPNLEIVMDEVVDLINDGKVIKGVITRMGCKYHSKAVVLATGVYLNSLIYIGEVTLNEGPNGLGYAEKLTDKLVDLGLDMRRFKTGTPARIHRDSIDFSQMVIQEGDEKITPFSFMSDDLKI----DQVPCYLARTNLDTHKVIMDNINRSAMYGGKIHSTGPRYCPSIEDKVVRFNDKESHQTFIEPEGLDTKEMYIQGISTSLPYEVQIQMYRSMKGLENCKIMRPAYAIEYDCLNPTQLKASLEIKVTENLFSAGQFNGTSGYEEAAAQGLMAGINAARKIQGKEPFILDRSEAYIGVLIDDLITKGTNEPYRMMTSRAEYRLYLRQDNADMRLTEKGYEIGLASQERYDRFLTKKALVEAELERLKTERVTPKEVNELLVEKGASEIKVGLSLYDFLKRPEVTYELLEQIGKAASEEVPYDVKEQCVIMSKYEGYIDKQLKQIDQFKKLENKKLSEDIDYSTIEGLRIEARQKLNDIKPISIGQASRISGVSPADISVLLIYLEQMRR 624
>gi|88860625|ref|ZP_01135262.1| tRNA modification, oxidoreductase-like with FAD/NAD(P)-binding domain [Pseudoalteromonas tunicata D2] >gi|88817220|gb|EAR27038.1| tRNA modification, oxidoreductase-like with FAD/NAD(P)-binding domain [Pseudoalteromonas tunicata D2] (629 aa)
Score = 1257, Expect = 4.9e-136, Identities = 270/611 (44%), Positives = 371/611 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNT---LKEL----ETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPF--LKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           + +D +V+G GHAG EAA   A+      L   +   +G M CNP+IGG  KG + +EIDALGG  A A D   +Q + LNSSKG    A RAQ D+  Y +     ++  E + +  +  + +   N  V GV T     F S  +++T GTFL   IHIG +    G      S  LAK+++EL F+  RLKTGTPPRI   ++D+SK+QI+PG      FS F  K  D   Q  CY+ +TN K H++I NNLD+S MY+G I G GPRYCPSIEDK++RF DK+RHQ+FVEPE      +Y  G+S+SLP DVQ QIV++I GFENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N   Q++ ++    +R+EAY GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL++   W  +N  +E        LKE+    +   L+ V            +L E+++RP+ ++ ++     L +++T +E   ++V+I IKY GYI  QQ+ I+     +   L +  DY  V  +S E   KL+ V+P T+GQASR+SGI    +  + +YL+ +
  S:     5 EHFDVIVVGGGHAGTEAALASARMGMNTLLLTHNMDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAQAIDKGGIQFRTLNSSKGPAVRATRAQADRKLYKEAIQQTLQNQENLKIFQQSCDDLIVENDHVVGVVTQMGLRFSSRSVVLTVGTFLGGQIHIGMESFSGGRAGDQPSIALAKRLRELPFRVSRLKTGTPPRIDARTVDFSKMQIQPGDTPTPVFS-FMGKQSDHPTQIPCYITYTNEKTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKIMRFADKDRHQIFVEPEGLTTHELYPNGISTSLPFDVQLQIVQSITGFENAHICRPGYAIEYDFFDPRDLKQSLETKFISGLFFAGQINGTTGYEEAAAQGLIAGMNAALQVQGKDAWTPRRDEAYAGVLIDDLATLGTKEPYRMFTSRAEYRLLLREDNADLRLTAKGRELGLVNDERWAAFNIKIEEIEKEAQRLKEVWIHKDHPQLEAVNNLLKAPLSREASLEELIRRPEVTYNELVKIEGLGSEST-NEQALEQVEIQIKYAGYIARQQEEIDKQLRHEMTLLPADYDYAAVSGLSNEVVAKLSDVRPQTIGQASRISGITPAAISLLLVYLKKQ 622
>gi|196163213|ref|ZP_03123744.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium difficile QCD-23m63] (631 aa)
Score = 1255, Expect = 9.3e-136, Identities = 269/612 (43%), Positives = 378/612 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR---------KTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           KYD +V+GAGHAG EAA   A+  YK  +  +    +  MPCNPSIGG  KG + +EIDALGG   +  D T +Q ++LN++KG    +LRAQ DK +Y +     +E+   +D+   EV  I      V GV T     F+S  +I+ TG +L+S I++G     +GP+    +  L   + EL  +  R KTGTP R+ ++SID+S + ++ G  K   FS  +       +QE CYL  T  +  ++I +NL +SAMYSG I  TGPRYCPSIEDKVVRF+DK  HQLF+EPE  +   +Y+ G+S+SLP +VQ  + K I G EN  I + AYAIEYD ++P QL  +LE K ++ LF AGQ NGTSGYEEAA QGLMAGIN + ++E +EP VL R+EAYIGVL++DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +   D Y + L       KE E    + V   + NS          K   +LYE LKRP+ ++  +E   K     +    K++  I  KY GYI+ Q K I+  K ++N KL    +Y  +  + LEAR KL+ +KP+++GQASR+SG++  D+  + +YLE  ++
  S:     8 KYDVIVVGAGHAGCEAALATARMGYKTLIITMSLDSIALMPCNPSIGGTGKGQLVKEIDALGGQMGLNIDKTYIQSRMLNTAKGPAVHSLRAQADKFKYHEEMKKTLEDEPNLDIAMDEVVEILHEGNVVIGVGTKLGCSFKSKAVILATGVYLNSKIYMGEVAFYEGPNALGYAKYLTDSLVELGLRMRRFKTGTPARVHRDSIDFSVMSLQEGDEKVTPFSFMNENIE--KEQEPCYLTRTTEETQKVILDNLKRSAMYSGVIESTGPRYCPSIEDKVVRFSDKTSHQLFIEPEGLNTKEMYIQGISTSLPFEVQLDMYKTIKGLENCKIMRPAYAIEYDCVDPTQLKISLEIKGVENLFSAGQFNGTSGYEEAAAQGLMAGINAVRKIEGKEPFVLDRSEAYIGVLLDDLVTKGTNEPYRMMTSRAEYRLYLRQDNADMRLTQKGYDIGLVKK---DRYERFLNKKAAVEKEFERLKNERVTPKEVNSLLEEKGATPIKVGISLYEFLKRPEVTYELLEELGKGAGEDVSREVKEQCVIITKYEGYIEKQLKQIDQFKKLENKKLDEKINYSSIEGLRLEARQKLDDIKPISIGQASRISGVSPADISVLLIYLEQVRR 624
>gi|168526496|ref|ZP_02720135.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 118a] >gi|168580092|ref|ZP_02724064.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 72a] >gi|168692652|ref|ZP_02725444.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia burgdorferi 94a] (621 aa)
Score = 1254, Expect = 1.0e-135, Identities = 270/612 (44%), Positives = 390/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F S+ +++TTGTFL   I IG      G      +Y L K +  L F+  RLKTGTP RI K S+D+SK +++ G +    FS F    LD   Q  CY+ +TN K HEII+ N+  S +YSG I G GPRYCPSIEDK+V+F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G E+AVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+     LK+V + +   +  +   Y ILK P  S    I ++P L +   + E    +V++ +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +K++P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FDAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRSSVVVLTTGTFLRGKIFIGEYRADMGRLAEFSAYGLDKTLLGLGFEMGRLKTGTPARIHKKSVDFSKTEVQFGDSDIIPFS-FSNGKLD-KSQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLEHAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEERYSRYLFKESRVEEIKELLKQRRLG-LKDVVDEQLK-KHVSKDFYHILKDPSISLDNLIKIDPSLSDSKVILE----QVELDVKYEGYINRQKDLIKRLDNLELVKLPFDFNYEIIEGLSREAREKFSKIQPATLAQASRIPGIRSTDITVLLIYFSNPKNK 614
>gi|160902994|ref|YP_001568575.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Petrotoga mobilis SJ95] >gi|189039348|sp|A9BGL2|GIDA_PETMO tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|160360638|gb|ABX32252.1| glucose inhibited division protein A [Petrotoga mobilis SJ95] (625 aa)
Score = 1252, Expect = 2.0e-135, Identities = 279/611 (45%), Positives = 396/611 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGP-DDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSG--FITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENF-NNTLKELET-----STLKNVKEFKYNSRKTNTT-LYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +D +V+GAGHAG+EAA   AK      +  ++   +G  PCNP+IGGPAKG+V REIDALGG+QA   D T + +++LN+SKG    ALRAQIDK +YS+     +E  + + L      +I   N K+ G+ T     + +  +I+TTGTFL   I +G    + G   +   + L    IKE   +  R KTGTP R+ K+SID+SK  I+   ++  +FS++ +  +   K   CYL  TN+K HE+I   +  S +Y     I   GPRYCPSIEDKV++FN K+ HQ F+EPESKH   IYL GLS+SLP + Q +I+K I G ENA+I++ AYA+EYD +NPIQL   LETKKI+GLF AGQINGTSGYEEAA QGL+AGIN   ++   EP VL R+EAY+GVLI+DLI K + +PYRLLTSRAEYRL LR+DNA  RL KYGY+ GL+S+  +++ ++ LEN  N+ ++ L+      + + ++   K +S+ T    + E+LKR + S+ D++  L  +   ++   +++DI+ KY GY +  Q  I   K ++  K+ S  +Y  + NI+ EA++KL K+KP T GQ  R+ GIN  D IN+++YL+ K K
  S:     8 FDVIVVGAGHAGIEAALASAKMGMNTLILNINLDTLGWAPCNPAIGGPAKGVVAREIDALGGVQAKVTDETMINIRMLNTSKGIAVRALRAQIDKYDYSQRMKEILETTDNLILRHGIAKNILVENGKIIGLETELGMKYFAKVVILTTGTFLRGKIFVGRNTFEAGRMGELPANSLTYSLIKE-GLEVSRFKTGTPARVRKDSIDFSKFDIQETADEPLAFSYWSQPRV-LTKDYPCYLGRTNSKTHEVIRKYIAFSPLYGDVKLIQSIGPRYCPSIEDKVMKFN-KDTHQFFLEPESKHSKEIYLNGLSTSLPFEAQIEILKTIPGLENAIIERPAYAVEYDFVNPIQLKHNLETKKIEGLFLAGQINGTSGYEEAAGQGLLAGINAALKIRGEEPFVLDRSEAYLGVLIDDLITKGVDEPYRLLTSRAEYRLLLRHDNAHLRLYKYGYKYGLLSKEQYEQLHR-LENLINHQIERLDQIKVSPNQVNDILASKGSSKITQPVHMSELLKRSEISYTDLK-HLDEEAVEEKEVIEQIDIHFKYNGYFQRMQDEIAKMKELEKEKIPSDIEYDKINNIAYEAKEKLKKIKPETFGQLLRIPGINPADAINLRIYLKQKDK 623
>gi|148381579|ref|YP_001256120.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum A str. ATCC 3502] >gi|153930874|ref|YP_001385956.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum A str. ATCC 19397] >gi|153936277|ref|YP_001389363.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum A str. Hall] >gi|166222925|sp|A7FPL9|GIDA_CLOB1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166222926|sp|A5I815|GIDA_CLOBH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|148291063|emb|CAL85200.1| glucose inhibited division protein A [Clostridium botulinum A str. ATCC 3502] >gi|152926918|gb|ABS32418.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum A str. ATCC 19397] >gi|152932191|gb|ABS37690.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum A str. Hall] (625 aa)
Score = 1251, Expect = 2.1e-135, Identities = 266/612 (43%), Positives = 397/612 (64%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTN----TTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIGAGHAG EAA   A+   K  +  ++   +  M CNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK  YS+   + +E+ + + L   EV  I   + +V GV T +  +F +  +I+ TGT+L   I IG  +   GP     +  L++ + +L     R KTGTP RI K S+D+SK+  +PG  K   FS    K LD   Q  CYL +T+ + H+II+ N+ +S +Y+G I G GPRYCPSIEDK+VRF DK++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++ +++ G ENA I + AYAIEYD I+P QL  TLE K I GL+ AGQ NG+SGYEEAA QGL+AGIN + +++ + PL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY++GL+ +  ++++    KN+EN    L+ ++ +  + + EF      T      +LYE++KRP+  +  +E     + +L +  K++++I  KY GYI  Q + +   K  ++  +    +Y D+  + LEA  KL K+KP+ +GQASR+SG++  D+  + +Y+E K ++
  S:     8 FDVVVIGAGHAGCEAALASARMGCKTLICTMNLDSIALMACNPNIGGTAKGHLVREIDALGGEMGINIDHTFIQSRMLNTSKGPAVHSLRAQADKKRYSERMKHLLEKEDNVVLRQLEVIEIDVEDNEVKGVLTKNGAYFTTKAIILCTGTYLKGKIIIGDIIYSSGPSGLYPANDLSQSLLDLGINLRRFKTGTPARINKRSVDFSKMIEQPGDEKIVPFSFIHNK-LD-KDQISCYLTYTSEETHKIIHENIHRSPLYNGSIEGVGPRYCPSIEDKIVRFPDKDKHQIFIEPEGENTEELYVGGMSSSLPEDVQIKMYRSVPGLENAEILRTAYAIEYDCIDPQQLDLTLEFKNINGLYGAGQFNGSSGYEEAAAQGLIAGINAVLKIKEKNPLILKRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTELGYKVGLVKEDRYNKFLNRKKNVENEIERLRNMQITGKREINEFLLEKGSTELKKPISLYELIKRPELDYFKVESLDDKRPSLSDDEKEEINIIAKYEGYINKQLEQVEQFKKYEDRLIPKSINYLDIKGLRLEAIQKLEKIKPINIGQASRISGVSPADISVLLIYMERKNRE 624
>gi|28379976|ref|NP_786868.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus plantarum WCFS1] >gi|38257498|sp|Q88RX6|GIDA_LACPL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|28272817|emb|CAD65746.1| cell division protein GidA [Lactobacillus plantarum WCFS1] (636 aa)
Score = 1251, Expect = 2.5e-135, Identities = 266/612 (43%), Positives = 376/612 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNT-------TLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           + YD +V+GAGHAG EAA   A+   +  L  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y     + IE    + L    V+ +  V   VC GV T     + +  +++TTGT     I IG  +   GP++   +  L+  ++ L F   R KTGTPPR+  N+IDYS  + +PG  +   +SF   D  ++D   Q  C+L +TN   H+II  NLD++ M++G I G GPRYCPSIEDK+VRF DK+RHQLF+EPE ++ D  Y+ GLS+S+PE+VQ++I+ +I G E+A + +  YAIEYD + P QL  TLETK +K L+ AGQ NGTSGYEEAA QGL+AGIN   +  +R    LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G ELGLI    +  +    +   N L  L    +K   E     R  N+          + LKRP+  + D+  F+      L+ +  ++V+I IKY GYI+  ++ ++  K ++  K+    DY  +  ++ EA  KL K++P T+ QASR+SG+N  D+  + +Y++  +
  S:    10 RDYDVIVVGAGHAGSEAALAAARMGNRTLLMTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHAEMKHTIEREPNLTLRQGIVDGL-IVEDGVCKGVITNTGARYSAKSVVLTTGTAARGKIIIGELMYSSGPNNSQPAMKLSGDLERLGFNLERFKTGTPPRVDGNTIDYSVTEEQPGDPEPHHFSFETKDADYIDLKHQLSCWLTYTNETTHKIIRENLDRAPMFTGVIEGVGPRYCPSIEDKIVRFADKKRHQLFLEPEGRNTDEWYVQGLSTSMPEEVQQRILHSIKGLEDAEMMRPGYAIEYDVVAPYQLKATLETKLVKNLYTAGQTNGTSGYEEAAGQGLIAGINAGLRALDRGQFTLKRSDAYIGVMIDDLVTKGTNEPYRLLTSRAEYRLILRHDNADLRLTDKGRELGLIDDERYAAFEAKRQAIKNELDRLGKIRIKPNDEVNAFLRAHNSGELKDGVLAADFLKRPEVQYADLMKFIPAAPEPLERHVIEQVEIQIKYAGYIQKAEERVDRLKKMEAKKIPDRIDYDAIDGLATEAHQKLKKIQPTTIAQASRISGVNPADIAILSVYIQQGR 631
>gi|184156314|ref|YP_001844654.1| glucose inhibited division protein [Lactobacillus fermentum IFO 3956] >gi|183227658|dbj|BAG28174.1| glucose inhibited division protein [Lactobacillus fermentum IFO 3956] (634 aa)
Score = 1251, Expect = 2.5e-135, Identities = 264/610 (43%), Positives = 378/610 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG--TNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSH---WDEYNKNLENFNNTLKELETSTLKNVKEFKY----NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT----LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+GAGHAG EAA   A+   K  L  +  ++V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y +     IE+ + + L    V+ +   +  V GV T     + +  +++T GT     I IG    + GP++   +  L++ ++ L F   R KTGTPPR+  N+IDYSK + +PG  T   +SF   D  ++    Q   +L +TN   HEI+ NNLD++ M+SG I G GPRYCPSIEDK+VRF DK+RHQ+F+EPE +  D  YL GLS+S+PE++Q Q++ ++ G E+A + +  YAIEYD + P QL  TLETK +  L+ AGQ NGTSGYEEAA QGL+AGIN   + + +EP VLKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL++ G+ +GL+S       +E  + +E+    LK+      + +  F         K        L+RP   ++D    LK  +     LD    ++V+I +KY GYI+ ++  I   K ++  ++ +  DY+ +  ++ E R KL +++P TL QASR+SG+N  DL  + +YL   K
  S:    13 YDVIVVGAGHAGSEAALAAARMGNKTLLITISLEMVAFMPCNPSLGGPAKGVVVREIDALGGEMGHNIDKTYIQMRMLNTGKGPAVRALRAQADKHAYHRQMKWTIEKEKNLTLRQGVVDDLIVEDGTVKGVITNTGAAYHAKAVVLTVGTAARGKIIIGELQYQSGPNNSKAAVKLSEALERLGFDLQRFKTGTPPRVDGNTIDYSKTEEQPGDQTPNHFSFDTPDTSYIPVKDQISSWLTYTNPTTHEILRNNLDRAPMFSGVIEGVGPRYCPSIEDKIVRFADKDRHQVFLEPEGRDTDEFYLDGLSTSMPEEIQHQMIHSVAGLEHAELMRPGYAIEYDVVAPYQLKATLETKLVNNLYTAGQTNGTSGYEEAAGQGLIAGINAGLRAQGKEPFVLKRSDAYIGVMIDDLVTKGTKEPYRLLTSRAEYRLILRHDNADLRLMEKGHAIGLVSDERLAAMEEKKQRVEDEIARLKDFRIKPGEEIDAFVVAHGDKPLKDAIAADAFLRRP---YVDYPTLLKFVDAPAVELDRQEVEQVEIQLKYAGYIEKEEAKIERLKRMEAKRIPADIDYQAIEGLATEGRQKLEQIRPTTLAQASRISGVNPADLAILSVYLRQGK 632
>gi|20809124|ref|NP_624295.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermoanaerobacter tengcongensis MB4] >gi|22095715|sp|Q8R6K9|GIDA2_THETN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA 2 (Glucose-inhibited division protein A 2) >gi|20517804|gb|AAM25899.1| NAD/FAD-utilizing enzyme apparently involved in cell division [Thermoanaerobacter tengcongensis MB4] (633 aa)
Score = 1251, Expect = 2.6e-135, Identities = 263/613 (42%), Positives = 384/613 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTT-------LYEILKRP--DYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD  V+G GHAG EAA   A+       F  +   +  M CNPSIGGPAK  + REIDALGG  A+  D + LQM+ LN+SKG    +LRAQ+DK  Y     + +E  + +D+   E+  I   N KV GV T     ++    I+TTGTFL   + IG    + GP     +  L++ IK L F+ +R  T TPPR+ K ++D+SK+ ++PG      +SF H D+  ++   Q  C+L +TN K H+II +N+ ++ +Y+G + G G RYCPSIEDKV++F  ++RHQ+FVEPE +    +Y+ GL SS PED+Q +I+  I G ENA I + AYAIEYD I+P QL  TLETK ++GL+FAGQ+NGTSGYEEAA QGLMAGIN   ++  + PL+L R++AYIG+LI+DL+ K   +PYR+LTSRAEYRL LR DNAD RL + G E+GL+++  ++++ +        +  L T  ++  +E         +T       LY +LKRP  DY         +  + LD    +++DI IKY GYI  Q + +   K ++N K+    DY  V  +S EA++KL+K++P ++GQASR+SG++  D+  + +YL+  +++
  S:     7 EYDVCVVGLGHAGSEAALASARLGLATVGFATNLDAIALMACNPSIGGPAKAQLVREIDALGGEMAVNTDKSLLQMRTLNTSKGPAVRSLRAQVDKKLYQANMKHTLERQKNLDIKQAEIVDILVENNKVVGVVTKLGAIYKCKACIITTGTFLRGRVIIGEVGFESGPSGLFPAKELSEAIKRLGFKMMRFNTSTPPRVDKRTVDFSKMIMQPGDEVITPFSFMH-DKIEIE---QIPCWLTYTNEKTHKIIRDNIHRAPLYTGEVEGVGVRYCPSIEDKVMKFPHRDRHQIFVEPEGRDTYEMYIQGLFSSFPEDLQMEILSTIPGLENAKIMRPAYAIEYDCIDPTQLKATLETKLVEGLYFAGQVNGTSGYEEAAAQGLMAGINAALKILGKPPLILDRSQAYIGILIDDLVTKGTNEPYRMLTSRAEYRLILRQDNADFRLTEIGKEIGLVTEERYEKFLRKKIQLEKEMMRLPTVMVRPTEEVNNFLISRGSTPLVSGVDLYTLLKRPEIDYKSTKFLDPTRPDDILDSV-AEQIDINIKYEGYILKQLRQVEQFKAMENKKIPEDIDYYQVHGLSNEAKEKLSKIRPTSVGQASRISGVSPADISVLLIYLQQMRRK 625
>gi|15606146|ref|NP_213523.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Aquifex aeolicus VF5] >gi|3913739|sp|O66962|GIDA_AQUAE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|2983328|gb|AAC06917.1| glucose inhibited division protein A [Aquifex aeolicus VF5] (617 aa)
Score = 1251, Expect = 2.6e-135, Identities = 273/607 (44%), Positives = 383/607 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRK-----FLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-----NTTLYEI--LKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           ++D +VIG GHAG+EAA   A+   K A+FVL+   +G M CNP+IGG AKGIV REIDALGG    A D T +Q K+LN+ KG    + RAQ DK  Y ++     E  E + +  +EV  I   N +V GV T     +++  ++VTTGTFL+  I+IG K+I  G      S  L+   +  DF  IR KTGTP R+ K +ID+S L++ PG +    FS +        F    +Q  C++ +T  K HEII  NL ++A+Y G I G GPRYCPSIEDK+V+F DKERHQ+F+EPE      IY  GLS+SLPE+VQ ++ ++I G EN V+ + AYAIEYD + P +LYPTLETKKI+GLF AG  NGT+GYEEAA QG++AGIN   +   +EP+ L+R+E+YIGV+I+DL  K +T+PYRL TSR+EYRL +R DNA  RL K G ELGL+S+  +             +KELE   ++  KEF  + R +     +T  Y +  L   +Y+  D++     +     Y K++V+I +KY  YI+ ++K+    K +++ K+    DY  +P ++ EAR+KL K KP+T+GQASR+ GI    +  + +YL
  S:     7 EFDVVVIGGGHAGIEAALAAARMGAKTAMFVLNADTIGQMSCNPAIGGIAKGIVVREIDALGGEMGKAIDQTGIQFKMLNTRKGKAVQSPRAQADKKRYREYMKKVCENQENLYIKQEEVVDIIVKNNQVVGVRTNLGVEYKTKAVVVTTGTFLNGVIYIGDKMIPGGRLGEPRSEGLSDFYRRFDFPLIRFKTGTPARLDKRTIDFSALEVAPGDDPPPKFSFWTEPVGSYWFPKGKEQVNCWITYTTPKTHEIIRKNLHRTALYGGLIKGIGPRYCPSIEDKIVKFPDKERHQIFLEPEGLDTIEIYPNGLSTSLPEEVQWEMYRSIPGLENVVLIRPAYAIEYDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAALRAFGKEPIYLRRDESYIGVMIDDLTTKGVTEPYRLFTSRSEYRLYIRQDNAILRLAKLGRELGLLSEEQY-----------KLVKELERE-IEKWKEFYKSERVSVAVGGDTRSYSVATLMTMNYTLDDVKEKFGYEVPQHPYVKEEVEIQLKYEPYIERERKLNEKLKKLEDTKIPPDIDYDKIPGLTKEAREKLKKFKPITVGQASRIDGITPAAITALLVYL 613
>gi|116493569|ref|YP_805304.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Pediococcus pentosaceus ATCC 25745] >gi|122264967|sp|Q03D60|GIDA_PEDPA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|116103719|gb|ABJ68862.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Pediococcus pentosaceus ATCC 25745] (637 aa)
Score = 1248, Expect = 4.9e-135, Identities = 270/612 (44%), Positives = 378/612 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKE-LDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTN--KKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY------NSRKTNTTLYEILKRPDYSFIDMEPFLKN-KNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           ++YD +V+GAGHAG EAA   A+   K  L  ++  +V  MPCNPSIGGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y       IE    + L    V+ +  V   VC GV T     +++  +++T GT     I IG      GP++   +  L K + E   F   R KTGTPPR+   +I+Y + + +PG      +SF   D K+++   Q  C+L +TN K HEII  NLD++ M+SG I G GPRYCPSIEDK+VRF DK RHQLF+EPE +  D  Y+ GLS+S+PE+VQ+QI+ +I G E A + +  YAIEYD + P QL  TLETK +K L+ AGQ NGTSGYEEAA QGL+AGIN   +   +EPL LKR++AYIGV+I+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+ LGL+S   ++ + +  ++  + L+ L    +K  +  K+      N  K      E L+RP+ ++ D+  F+   +  LD    ++V+I  KY GYIK  Q  ++  K ++   +    DY+ +  ++ E R KL K++P T+ QASR+SG+   D+  + +Y++  K
  S:    10 REYDVIVVGAGHAGSEAALAAARMGNKTLLMTINLDMVAFMPCNPSIGGPAKGIVVREIDALGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHAEMKKTIEAEPNLTLRQGIVDDL-IVEDGVCKGVITNTGARYQAKSVVLTLGTAARGKIIIGELQYSSGPNNSQAALELTKNLTEKYHFDLERFKTGTPPRVDGGTINYDETEEQPGDEVPNHFSFQTPDSKYIELKNQLSCWLTYTNEKTHEIIRENLDRAPMFSGMIEGVGPRYCPSIEDKIVRFADKSRHQLFLEPEGRKTDEWYVQGLSTSMPEEVQQQILHSIKGLEEAEMMRPGYAIEYDVVAPYQLKNTLETKLVKNLYTAGQTNGTSGYEEAAGQGLIAGINAGRRALGKEPLTLKRSDAYIGVMIDDLVTKGTKEPYRLLTSRAEYRLILRHDNADLRLTEVGHNLGLVSDEEYNAFLEKKQDIKDELQRLSEIRIKPSQVQKFLESKGSNGLKDGVLASEFLRRPEVNYSDLLKFIDAPEKDLDRRVIEQVEIETKYAGYIKKAQDRVDRLKRMEEKAIPDRIDYEAINGLATEGRQKLEKIRPTTIAQASRISGVTPADIAILSVYIQQGK 631
>gi|182416733|ref|ZP_02948132.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium butyricum 5521] >gi|182379390|gb|EDT76885.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium butyricum 5521] (628 aa)
Score = 1247, Expect = 7.1e-135, Identities = 256/610 (41%), Positives = 385/610 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKT----NTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           ++D +V+GAGHAG EAA   A+      +  ++   +  MPCNP+IGG AKG + REIDALGG   +  D+T +Q ++LN+SKG    +LRAQ DK +Y       +EE + + +   EV  +   + KV GV T +   F+   +++ TGT+L   I IG      GP+    +  L++ + +L     R KTGTP RI   S+D+SK+  + G +K   FS    K     +Q  CYL +TN + H II  N+++S +Y+G I G GPRYCPSIEDKV+RF DK +HQ+FVEPE      +Y+GG SSSLPE+VQ ++++ + G EN  + + AYAIEYD+I+P QL PTLE K I GL+ AGQ+NG+SGYEEA  QGL+AG+N   +++N+EPL+L R++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + G+ +GL+++  ++ +    KN+E+    LK L+ +  K V EF  +   T      + YE+++RP+  +  +      +  L +   +++++  KY GYI+SQ + ++  K  +   L    DY DV  +  EA  KL+ +KP+++GQASR+SG++  D+  + +YLE++
  S:     9 QFDVIVVGAGHAGCEAALASARMGLNTLVCTINLDSIALMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSRMLNTSKGPAVHSLRAQADKKDYQFRMKKVLEEQDNLKIRQIEVTELIVEDGKVSGVVTKNGAVFKCKAVVLATGTYLKGKIIIGEVSYSGGPNGLFPANDLSQSLLDLGISLRRFKTGTPARINSKSVDFSKMIEQNGDDKIVPFSFMSGKLQ--KEQVACYLTYTNEETHNIIRENINRSPIYNGSIKGVGPRYCPSIEDKVMRFPDKTQHQIFVEPEGMDTLEMYVGGFSSSLPEEVQIKMLRTLPGLENVEMMRTAYAIEYDSIDPTQLKPTLEFKNIDGLYGAGQLNGSSGYEEAGAQGLVAGVNAALKIKNQEPLILTRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADLRLTEMGHRVGLVTEERYNTFLTRKKNIEDELERLKTLKVTNKKEVNEFLVSINSTPLRKAISFYELMQRPELEYFQLAQLDPERPDLSDDIGEQINVLTKYEGYIQSQMEQVSQFKKFEKKLLPKDIDYNDVSGLRTEAVQKLSNIKPISIGQASRISGVSPADISVLLIYLEHQ 623
>gi|15603350|ref|NP_246424.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431542|sp|P57945|GIDA_PASMU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|12721869|gb|AAK03569.1| GidA [Pasteurella multocida subsp. multocida str. Pm70] (629 aa)
Score = 1246, Expect = 8.9e-135, Identities = 268/614 (43%), Positives = 372/614 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSF---IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + REIDA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E  E +D+  +EV  I     +VCGV T     F +  +I+T GTFL   IHIG +    G      S +LA +++EL+ +  RLKTGTPPRI   +ID+S L  + G  K   FS F        +Q  C++  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF+++  HQ+++EPE    + IY  G+S+SLP DVQ +IV ++ G E A I K  YAIEYD  +P  L PTLETK I+GLFFAGQINGT+GYEEAA QGL+AGIN    ++ +E    +R++AYIGVL++DL      +PYR+ TSRAEYRL LR DNAD RL    ++LGLI +  W  +N+ +EN     + L    L    E+   + K          +  ++L+RP+ ++     + PF    +  D+   ++V+I IKY GYI+ QQ+ I   K  ++  + +  DY  V  +S E R KL + +P+++GQASR+SG+       I + L + KKQ
  S:     5 ENYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVREIDAMGGLMATAADQAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRIALENQENLDIFQQEVTDIILDQDRVCGVVTKMGLKFHAKAVILTAGTFLSGKIHIGLENYTGGRAGDPASVMLADRLRELNLRVDRLKTGTPPRIDARTIDFSVLAKQHGDEKLPVFS-FMGSVDQHPRQIPCFITHTNEQTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFSERNSHQIYLEPEGLTSNEIYPNGISTSLPFDVQMKIVNSMKGMEKARIIKPGYAIEYDYFDPRDLKPTLETKSIRGLFFAGQINGTTGYEEAAGQGLLAGINAGLFVQEKEAWFPRRDQAYIGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADSRLTPIAHQLGLIDEKRWARFNQKMENIELERQRLRQIWLHPRSEYLDEANKVLGSPLVREASGEDLLRRPEMNYQILTSLTPFQPAMD--DQEAVEQVEIAIKYQGYIEHQQEEIARQKRHESTAIPAHFDYTVVSGLSNEVRAKLEQHRPVSIGQASRISGVTPA---AISILLVSLKKQ 622
>gi|167575406|ref|ZP_02368280.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Borrelia valaisiana VS116] (621 aa)
Score = 1246, Expect = 9.2e-135, Identities = 268/612 (43%), Positives = 390/612 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDL-----IDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++ +VIG GHAG+EAA  L++  +K  +   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL     +D  +NS++    ++ GV T     F ++ +++TTGTFL   I IG      G      +Y L K ++ L F+  RLKTGTP RI K S+++SK +++ G +    FS F    LD   Q  CY+ +TN + HEII+ N+  S +YSG I G GPRYCPSIEDK+++F DK+RHQ+F+EPE  + + +YL GLSSSLPE++Q++++ +I G ENAVI +  YA+EYD INPI+LYP LE+K++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+N++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K GY+LGL+ +  +  Y      +E     LK+   S LK+V   +   +  +   Y ILK P  S    I ++P L +   + E    +V+  +KY GYI  Q+ +I    N++ +KL    +Y+ +  +S EAR+K +KV+P TL QASR+ GI   D+  + +Y  N K +
  S:     3 FEAIVIGGGHAGIEAALALSRLNFKTLMITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGRIIDFSMIQFRVLNKSRGPAVQAPRAQADKLMYQTKAKETLERQDNLDLFQDTVVDFLLNSMR---NEIEGVVTERGNKFRASVVVLTTGTFLRGKIFIGEYRANMGRLAEFSAYGLDKTLRGLGFEMGRLKTGTPARIHKKSVNFSKTEVQFGDSDIIPFS-FSNDKLD-KSQLSCYVTYTNKRTHEIISENMHLSPLYSGEIVGNGPRYCPSIEDKIIKFKDKDRHQIFIEPEGFNTEEMYLNGLSSSLPENIQQKLINSIEGLENAVITRPGYAVEYDYINPIELYPNLESKRVKGLFIAGQTNGSSGYEEAAAQGLMAGINAALRLQNKKPMILTRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKIGYDLGLVDEDRYSRYLFKKSRVEEIKELLKQRRLS-LKDVSNEQLK-KHVSKDFYHILKDPSVSLDNLIKIDPSLNDSKVILE----QVEFDVKYEGYINRQKDLIKKLHNLELVKLPFDFNYEVIEGLSKEAREKFSKVQPATLAQASRIPGIRSTDITVLFIYFSNPKNK 614
>gi|91203577|emb|CAJ71230.1| similar to putative glucose inhibited division protein A [Candidatus Kuenenia stuttgartiensis] (604 aa)
Score = 1246, Expect = 1.0e-134, Identities = 268/612 (43%), Positives = 377/612 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSF-----IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++D +V+GAGHAG EAA   A+     AL  ++   V  M CNP+IGG AKG + REIDALGG  A   D T +Q ++LN+ KG    + RAQ DK  Y      R+E  + + +  +  + +  V+ K  GV       ++S  +I+TTGTFL   IHIG+ +   G      S  L+  +++L  +  RLKTGT PR+   +I+Y  L+ + G      FS F  K L    Q  CY+ +TN   HEI+ +NL+++ +Y+G I+ TGPRYCPS+EDK+VRF DK +HQ+F+EPE      IY  G+S+S+P DVQE+IV +I G E A I +Y YAIEYD + P QL  +LETK ++ L+ AGQINGTSGYEEAA QG+MAGIN   ++  +EP +L R+EAYIGVLI+DL+ K   +PYRL TSRAEYRL LR DNAD+RL+KYG++ GLIS   W           +TL+E E    + +    Y +   +  L +IL RP+ +F     ID E  L  KN   +  +++V+I IKY GYI+ Q   I   K ++N K+    DY  +  +  EAR KL++++PL+LGQASR+SG++  D+  + +YL  K +
  S:     4 EFDVIVVGAGHAGCEAALASARMGLNTALLSINLDTVAQMSCNPAIGGIAKGQLVREIDALGGEMAQVIDATGIQFRMLNTKKGPAVHSPRAQADKKAYQITMKKRLEHQDNLFMKQEIADGLIVVDNKAAGVVGQSGLQYKSKAVILTTGTFLKGVIHIGNYITSGGRIGELSSERLSGSLRDLGLEVQRLKTGTSPRLNSRTINYKNLKPQHGDENPRPFS-FSTKTLS-GAQVPCYITYTNQTTHEIVMSNLNRAPLYTGQISTTGPRYCPSLEDKIVRFPDKLQHQIFLEPEGLDTLEIYCNGISTSMPHDVQERIVHSIEGLEAAEIVRYGYAIEYDFVPPTQLKLSLETKAVENLYLAGQINGTSGYEEAAAQGIMAGINAALKIHEKEPFILDRSEAYIGVLIDDLVTKGTEEPYRLFTSRAEYRLLLRQDNADRRLMKYGHKYGLISDQQW-----------STLQEKERLIAETLAYLNYKTAGQD-ALAKILSRPEQTFDQLLGIDSE--LAEKNVPGDV-QEQVEIEIKYKGYIERQYSQIEKFKKMENHKIPDWLDYSHITELRREARQKLSQIRPLSLGQASRISGVSPADISILMIYLAKKAR 603
>gi|118497772|ref|YP_898822.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. novicida U112] >gi|194323744|ref|ZP_03057520.1| glucose-inhibited division protein A [Francisella tularensis subsp. novicida FTE] >gi|166222934|sp|A0Q753|GIDA_FRATN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|118423678|gb|ABK90068.1| glucose inhibited division protein A [Francisella tularensis subsp. novicida U112] >gi|194322108|gb|EDX19590.1| glucose-inhibited division protein A [Francisella tularensis subsp. novicida FTE] (627 aa)
Score = 1246, Expect = 1.0e-134, Identities = 269/607 (44%), Positives = 374/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLIS---QSHW-DEYNKNLEN---FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D++ Y K   + I   E +D+    V+ +   N  VCG  T     F +  +++T GTFL   IHIG      G      S  LA +++ L F+  RLKTGTPPRI + S+D+S ++++ G N    FS F +  ++  +Q  CY+ +TNN+ H+II +NLDKSAMYSG I G GPRYCPSIEDKVVRF DKERHQ+FVEPE  +   +Y  GLS+SLP +VQ   +++I GFE A I +  YAIEYD  +P  L PTLETK IK L+FAGQINGT+GYEEA  QGL+AGIN    +++ +     R ++YIGVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+S   Q H+  + N  +EN     NT    +T   +++++F        +TL+++LKRP+  +  ++   + N N  DE   ++++I  KY GYI+ Q K I  T  ++   + +  +Y  V  +S E   KL + KP TLG+ASR+ GI    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKKAINSLINNQENLDIFQDSVDDLVVENNTVCGAITKTGITFRAKKVVLTVGTFLGGKIHIGKVSNAGGRAGDQPSNALAARLRSLPFRVDRLKTGTPPRIDRRSVDFSVMEVQHGDNPTPYFSFFSKGKIEHPRQIPCYITYTNNETHKIITDNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFADKERHQIFVEPEGLNSIELYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVAGINAAISIDSDKSWYPTRADSYIGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSDKACELGLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPEIDYSKLQQISELNLNLQDEAVIEQIEISAKYSGYIERQNKDIEKTATLEQKAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMK 621
>gi|151570857|gb|EDN36511.1| glucose inhibited division protein A [Francisella tularensis subsp. novicida GA99-3549] (627 aa)
Score = 1245, Expect = 1.2e-134, Identities = 267/607 (43%), Positives = 374/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLIS---QSHW----DEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D++ Y K   + I   E +D+    V+ +   N  VCG  T     F +  +++T GTFL   IHIG      G      S  LA +++ L F+  RLKTGTPPRI + S+D+S ++++ G N    FS F +  ++  +Q  CY+ +TNN+ H+II +NLDKSAMYSG I G GPRYCPSIEDKVVRF DKERHQ+FVEPE  +   +Y  GLS+SLP +VQ   +++I GFE A I +  YAIEYD  +P  L PTLETK IK L+FAGQINGT+GYEEA  QGL+AGIN    +++ +     R ++YIGVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+S   Q H+    ++  +N+    NT    +T   +++++F        +TL+++LKRP+  +  ++   + N N  DE   ++++I  KY GYI+ Q K I  T  ++   + +  +Y  V  +S E   KL + KP TLG+ASR+ GI    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKKAINSLINNQENLDIFQDSVDDLVVENNTVCGAITKTGITFRAKKVVLTVGTFLGGKIHIGKVSNAGGRAGDQPSNALAARLRSLPFRVDRLKTGTPPRIDRRSVDFSVMEVQHGDNPTPYFSFFSKGKIEHPQQIPCYITYTNNETHKIITDNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFADKERHQIFVEPEGLNSIELYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVAGINAAISIDSDKSWYPTRADSYIGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSDKACELGLLSKEDQQHFISKKNDIIENIAMMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPEIDYSKLQQISELNLNLQDEAVIEQIEISAKYSGYIERQNKDIEKTATLEQKAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMK 621
>gi|109647886|ref|ZP_01371789.1| glucose inhibited division protein A [Desulfitobacterium hafniense DCB-2] >gi|109640976|gb|EAT50531.1| glucose inhibited division protein A [Desulfitobacterium hafniense DCB-2] (637 aa)
Score = 1242, Expect = 2.8e-134, Identities = 260/611 (42%), Positives = 371/611 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFL--DFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFN--------NTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG EAA   A+   +  L  L    + +M CNPS+GGPAKG + REIDALGG   I AD T LQ+++LN+ KG    ALR Q DK  Y     N I   E + L    V  IK  + KV GV T    F+ +  +I+T+GT+L   I IG  + + GP+    +  L+  +KEL  +  R KTGTPPRI + S+DY+K  ++PG +   +YSF      F   D +KQ  C+L +T  + H+II +N+ ++ +YSG I G GPRYCPSIEDKVVRF D+  HQ+F+EPE  + D +Y+ GLS+S+PE++Q  I+ +I G E A + +  YAIEYD + P QL  +LE +KI GLF AGQ+NGTSGYEEAA QGL+AGIN   +++ +EP +++R+E Y+GVLI+DL+NK + +PYRLLTSRAEYRL LR DNAD RL   G E+GL+    W  + K    +   N        + L E     L  V     +   +     E+++RP+ +  +++  +      DE    +  I IKY GYI+ Q   I     ++   +     Y  +  +S E R +L +V P  +GQA+R++G+   D+  + +YLE K++
  S:     8 YDVIVVGAGHAGCEAALAAARMGGRTLLITLSLDNIAHMDCNPSLGGPAKGHLVREIDALGGQMGITADETSLQVRMLNTGKGPAVHALRIQSDKQAYHLHMRNAILGQENLVLHQALVERIKTEDGKVSGVVTRTGAFYAAPNVILTSGTYLRGRIIIGDTMYEGGPNGQQTAMNLSGALKELGLELGRFKTGTPPRIHRRSVDYTKFTVQPGDSVPWRYSFMPTQSMFWGRDVDKQIPCWLGYTTPETHQIIQDNIHRAPLYSGKIEGIGPRYCPSIEDKVVRFADRPTHQIFLEPEGWNSDELYMAGLSTSMPEEIQYDIIHSIPGLEKAELLRPGYAIEYDYVKPYQLSLSLEVRKIPGLFTAGQLNGTSGYEEAAAQGLLAGINAALRVQGKEPFIVRRSEGYLGVLIDDLVNKGVKEPYRLLTSRAEYRLILRQDNADLRLTPRGREIGLVKDERWAAFQKKKAAIAEINALWRGTTFSPLNEHLAEVLAGVHSAPVHGGISGE---ELMRRPEITINEIKQLIPQLAEYDEEALLEAGIEIKYAGYIEKQLAEIERFAKMEERMIPEEIVYDQIKGLSTEGRQRLKEVAPANMGQATRITGVTPADISVLLVYLEQKRR 630
>gi|196192283|gb|EDX87247.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechococcus sp. PCC 7335] (629 aa)
Score = 1240, Expect = 4.4e-134, Identities = 257/613 (41%), Positives = 372/613 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-------KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+GAGHAG EAA   A+   +  L  ++   +   PCNP++GGPAK  +  E+DALGG     AD T LQ ++LNSS+G   WALRAQ DK EY+    + +E  E  +LI +E  +   V     ++ G+ T     F     I+TTGTFL+ +I +G K +  G      +  +++ +  L F+T RLKTGTP R+ K S+DYS+L+ +PG      FS FD +     +Q  CY+  T    H+++ +NL  S +Y G++   GPRYCP IEDK+VRF DKE HQ+F+EPE +    +Y+ G S+ LPE +Q  ++  + G EN  + + AYA++YD I   Q +PTL TKK++GLF AGQINGT+GYEEAA QGL+AGIN    ++ +E +V  R  +Y+G LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    W  Y +   N     + L T  +K   E             K + TL ++++RP + +  +E +      L    K+  +I IKY GYI+ QQK I+      N  L    DY  V  +S+E+R+KLNKVKPLT+GQA+R+ G+N  D+  + ++LE + +Q
  S:     8 QFDVVVVGAGHAGCEAALAAARLGCRTLLLTMNLDRIAWQPCNPAVGGPAKSQLAHEVDALGGEIGKIADRTYLQKRILNSSRGPAVWALRAQTDKREYAAVMKSVVENQE--NLILREGMATDLVLGDRGEIIGIETHFGMTFGCQAAILTTGTFLNGTIWVGKKSLSAGRAGEPAAIGMSETLSRLGFETSRLKTGTPARVDKRSVDYSRLEEQPGDPNVRWFS-FDPEVWQEREQIPCYMTRTTAATHQLVRDNLHLSPVYGGWVEAKGPRYCPCIEDKIVRFADKESHQIFIEPEGRDYPELYIQGFSTGLPEHLQVDMLHTLPGLENCTMLRPAYAVDYDYIPATQCFPTLMTKKVEGLFCAGQINGTTGYEEAAGQGLVAGINAARLVQAKELIVFPREGSYLGTLIDDLCTKDLREPYRVLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWQLYQQKQANIIAEKERLHTERVKEQTEVGQQIYADTQQKIKGSVTLADLIRRPKFHYEHLESYGLGNQALTTAEKEGAEIDIKYSGYIQRQQKQIDLVSRQTNRSLPQDLDYMTVETLSMESREKLNKVKPLTVGQATRIGGVNPADVNALLVFLEVRDRQ 627
>gi|95929980|ref|ZP_01312720.1| glucose inhibited division protein A [Desulfuromonas acetoxidans DSM 684] >gi|95133949|gb|EAT15608.1| glucose inhibited division protein A [Desulfuromonas acetoxidans DSM 684] (622 aa)
Score = 1240, Expect = 5.0e-134, Identities = 262/596 (43%), Positives = 369/596 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL--ETSTLKN---VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           KKY+ +V+GAGHAG EAA   A+  ++  L  ++   V  M CNP+IGG AKG + REIDALGG  A   D T +Q ++LN+ KG    A RAQ D+  YS+     +E  E +DL    V+ +     ++  V   +   F    +++TTGTF+   IH+G      G      S  L+ Q+K+L F   RLKTGTPPR+ + SID+SK + +PG +    FS+   +    N+Q+V CY+  TN + HEII + LD+S +YSG I G GPRYCPSIEDKVVRF +K  HQ+F+EPE  +   IY  GL +SLP DVQ + ++ I G EN  I +  YAIEYD ++PIQL P+LETK I GLF AGQ+NGTSGYEEAA QGLMAGIN + ++E + P++L+R++AYIGVLI+DLIN    +PYR+ TSRAEYRL LR DNAD+RL + GY++GL+ +  W  Y+   ++ +  LK L  E  T K+   +            +  ++LKRP+ +   ++  +   +   +    +V+I +KY GYIK Q   +   K  + +K+    DY  V ++S E  +KL K++P  LGQASR+ G+
  S:     6 KKYEVVVVGAGHAGCEAALAAARMGHETLLLNMNLDAVAQMSCNPAIGGLAKGHLVREIDALGGQMAKNIDKTGIQFRVLNTKKGPAVQASRAQADRFLYSQSMKLVVENQEKLDLKQGTVSHLVVEENRIVAVEIKEGWRFNCQCVVLTTGTFMRGLIHVGMNHYPGGRSGEPPSLGLSDQLKKLGFDVGRLKTGTPPRLYRGSIDFSKTEEQPGDDTFRPFSYVSEQV---NQQQVSCYITATNEQTHEIIRSGLDRSPLYSGVIEGVGPRYCPSIEDKVVRFPEKTTHQVFLEPEGLNSSEIYPNGLPTSLPADVQLKFLRTIPGLENVEIMRVGYAIEYDYVDPIQLKPSLETKLIDGLFHAGQVNGTSGYEEAAAQGLMAGINAVRKIEGKPPVILRRDQAYIGVLIDDLINLGSKEPYRMFTSRAEYRLLLREDNADERLTELGYQVGLVDEQRWKHYSTKKKHIDEALKLLVDERITAKDKDKIAALNVEKISNGQSAKDLLKRPNITIAQLKGVVDGLDAYSDEVLLQVEIAVKYDGYIKRQNDQVEKFKKNELVKIPETFDYTKVQSLSAEVIEKLCKIRPENLGQASRIPGV 604
>gi|134302185|ref|YP_001122154.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. tularensis WY96-3418] >gi|166222935|sp|A4IYN2|GIDA_FRATW tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|134049962|gb|ABO47033.1| glucose-inhibited division protein A [Francisella tularensis subsp. tularensis WY96-3418] (627 aa)
Score = 1239, Expect = 6.5e-134, Identities = 268/607 (44%), Positives = 373/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLIS---QSHW-DEYNKNLEN---FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D+L Y K   + I   E +D+    V+ +   N  VCG  T     F +  +++T GTFL   IHIG      G      S  LA +++ L F+  RLKTGTPPRI + S+D+S ++++ G N    FS F +  ++  +Q  CY+ +TNN+ H+II +NLDKSAMYSG I G GPRYCPSIEDKVVRF DKERHQ+FVEPE  +   +Y  GLS+SLP +VQ   +++I GFE A I +  YAIEYD  +P  L PTLETK IK L+FAGQINGT+GYEEA  QGL+A IN    +++ +     R ++YIGVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+S   Q H+  + N  +EN     NT    +T   +++++F        +TL+++LKRP+  +  ++   + N N  D+   ++++I  KY GYI+ Q K I  T  ++   + +  +Y  V  +S E   KL + KP TLG+ASR+ GI    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRLLYKKAINSLINNQENLDIFQDSVDDLVVENNTVCGAITKTGITFRAKKVVLTVGTFLGGKIHIGKVSNAGGRAGDQPSNALAARLRSLPFRVDRLKTGTPPRIDRRSVDFSVMEVQHGDNPTPYFSFFSKGKIEHPRQIPCYITYTNNETHKIITDNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFADKERHQIFVEPEGLNSIELYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSDKSWYPTRADSYIGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSDKACELGLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPEIDYSKLQQISELNLNLQDDAVIEQIEISAKYSGYIERQNKDIEKTATLEQKAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMK 621
>gi|89897800|ref|YP_521287.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Desulfitobacterium hafniense Y51] >gi|89337248|dbj|BAE86843.1| hypothetical protein [Desulfitobacterium hafniense Y51] (637 aa)
Score = 1238, Expect = 8.5e-134, Identities = 259/611 (42%), Positives = 371/611 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFL--DFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFN--------NTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG EAA   A+   +  L  L    + +M CNPS+GGPAKG + REIDALGG   I AD T LQ+++LN+ KG    ALR Q DK  Y     N I   E + L    V  IK  + KV GV T    F+ +  +I+T+GT+L   I IG  + + GP+    +  L+  +KEL  +  R KTGTPPRI + S+DY+K  ++PG +   +YSF      F   D +KQ  C+L +T  + H+II +N+ ++ +YSG I G GPRYCPSIEDKVVRF D+  HQ+F+EPE  + D +Y+ GLS+S+PE++Q  I+ +I G E A + +  YAIEYD + P QL  +LE ++I GLF AGQ+NGTSGYEEAA QGL+AGIN   +++ +EP +++R+E Y+GVLI+DL+NK + +PYRLLTSRAEYRL LR DNAD RL   G E+GL+    W  + K    +   N        + L E     L  V     +   +     E+++RP+ +  +++  +      DE    +  I IKY GYI+ Q   I     ++   +     Y  +  +S E R +L +V P  +GQA+R++G+   D+  + +YLE K++
  S:     8 YDVIVVGAGHAGCEAALAAARMGGRTLLITLSLDNIAHMDCNPSLGGPAKGHLVREIDALGGQMGITADETSLQVRMLNTGKGPAVHALRIQSDKQAYHLHMRNAILGQENLVLHQALVERIKTEDGKVSGVVTRTGAFYAAPNVILTSGTYLRGRIIIGDAMYEGGPNGQQTAMNLSGALKELGLELGRFKTGTPPRIHRRSVDYTKFTVQPGDSVPWRYSFMPTQSMFWGRDVDKQIPCWLGYTTPETHQIIQDNIHRAPLYSGKIEGIGPRYCPSIEDKVVRFADRPTHQIFLEPEGWNSDELYVAGLSTSMPEEIQYDIIHSIPGLEKAELLRPGYAIEYDYVKPYQLSLSLEVRRIPGLFTAGQLNGTSGYEEAAAQGLLAGINAALRVQGKEPFIVRRSEGYLGVLIDDLVNKGVKEPYRLLTSRAEYRLILRQDNADLRLTPRGREVGLVKDERWAAFQKKKAAIAEINALWRGTTFSPLNEHLAEVLAGVHSAPVHGGISGE---ELMRRPEITINEIKQLIPQLAEYDEEALLEAGIEIKYAGYIEKQLAEIERFAKMEERMIPEEIVYDQIKGLSTEGRQRLKEVAPANMGQATRITGVTPADISVLLVYLEQKRR 630
>gi|56708268|ref|YP_170164.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670739|ref|YP_667296.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. tularensis FSC198] >gi|123359437|sp|Q14H30|GIDA_FRAT1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|81170542|sp|Q5NFM8|GIDA_FRATT tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56604760|emb|CAG45838.1| glucose inhibited division protein A [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321072|emb|CAL09221.1| glucose inhibited division protein A [Francisella tularensis subsp. tularensis FSC 198] >gi|151568994|gb|EDN34648.1| glucose inhibited division protein A [Francisella tularensis subsp. tularensis FSC033] (627 aa)
Score = 1238, Expect = 8.6e-134, Identities = 268/607 (44%), Positives = 372/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLIS---QSHW-DEYNKNLEN---FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D+L Y K   + I   E +D+    V+ +   N  VCG  T     F +  +++T GTFL   IHIG      G      S  LA +++ L F+  RLKTGTPPRI + S+D+S ++++ G N    FS F +  ++  +Q  CY+ +TNN+ H+II +NLDKSAMYSG I G GPRYCPSIEDKVVRF DKERHQ+FVEPE  +   +Y  GLS+SLP +VQ   +++I GFE A I +  YAIEYD  +P  L PTLETK IK L+FAGQINGT+GYEEA  QGL+A IN    +++ +     R ++YIGVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+S   Q H+  + N  +EN     NT    +T   +++++F        +TL+++LKRP+  +  ++   + N N  D+   ++++I  KY GYI+ Q K I  T   +   + +  +Y  V  +S E   KL + KP TLG+ASR+ GI    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRLLYKKAINSLINNQENLDIFQDSVDDLVVENNTVCGAITKTGITFRAKKVVLTVGTFLGGKIHIGKVSNAGGRAGDQPSNALAARLRSLPFRVDRLKTGTPPRIDRRSVDFSVMEVQHGDNPTPYFSFFSKGKIEHPRQIPCYITYTNNETHKIITDNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFADKERHQIFVEPEGLNSIELYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSDKSWYPTRADSYIGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSNKACELGLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPEIDYSKLQQISELNLNLQDDAVIEQIEISAKYSGYIERQNKDIEKTATFEQKAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMK 621
>gi|150019906|ref|YP_001312160.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium beijerinckii NCIMB 8052] >gi|149906371|gb|ABR37204.1| glucose inhibited division protein A [Clostridium beijerinckii NCIMB 8052] (626 aa)
Score = 1237, Expect = 1.0e-133, Identities = 260/609 (42%), Positives = 384/609 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNK---NLENFNNTLKELETSTLKNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLEN 611
           ++D +V+GAGHAG EAA   A+      +  ++   +  MPCNP+IGG AKG + REIDALGG   I  DNT +Q ++LN+SKG    +LRAQ DK  Y       +EE E + +   EV  +   N KV GV T +   F+   +I+ TGT+L   I IG      GP+    +  L++ + +L     R KTGTP RI + S+D+SK+  + G +    FS          +Q  CYL +TN++  +II +N+ +S +Y+G I G GPRYCPSIEDK++RF DK +HQ+F+EPE      +Y+GG SSSLPE+VQ +++K + G EN  + + AYAIEYD+I+P QL PTLE K I+GL+ AGQ+NG+SGYEEA  QGL+AGIN   +++ +EPL+L R++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL   GY +GL+++  +D++ K   N+EN    LK L+ +  K + EF    NS   +   T YE+L+RP+  + D++     +  L     ++++I  KY GYI+SQ + +   K  +   L    +Y D+  +  EA  KL+ ++P+++GQA+R+SG++  D+  + +YLE+
  S:     9 QFDIVVVGAGHAGCEAALASARLGLNTLVCTINLDSIALMPCNPNIGGTAKGHLVREIDALGGEMGINIDNTFIQSRMLNTSKGPAVHSLRAQADKKSYQFRMKRILEEQENLKIRQIEVTELNVENGKVTGVVTKNGAIFKCKAVILATGTYLKGKIIIGEVSYSGGPNGLFPANDLSQSLLDLGVSLRRFKTGTPARINRRSVDFSKMIEQNGDDNIIPFSFMSENIE--REQVSCYLTYTNDETRKIIRDNIGRSPIYNGSIKGVGPRYCPSIEDKIMRFPDKPQHQIFIEPEGLDTLEMYVGGFSSSLPEEVQIKMLKTLPGLENVEMMRTAYAIEYDSIDPTQLKPTLEFKDIEGLYGAGQLNGSSGYEEAGAQGLIAGINAALKIKEKEPLILTRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLLLRQDNADFRLTNLGYRVGLVTEERYDKFIKRKQNIENELERLKNLKVTNKKEINEFLISLNSAELRKPITFYELLQRPELDYFDLKQIDSERPELPHDVGEQINILTKYEGYIQSQLEQVAQFKKFEKKLLPKDINYSDIKGLRTEAIQKLSDIRPISIGQATRISGVSPADISVLLIYLEH 622
>gi|157122081|gb|EDO66221.1| glucose-inhibited division protein A [Francisella tularensis subsp. holarctica FSC022] (627 aa)
Score = 1236, Expect = 1.3e-133, Identities = 267/607 (43%), Positives = 374/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLIS---QSHW-DEYNKNLENFN---NTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D++ Y K   + I   E +D+    V+ +   N  VCG  T     F +  +++T GTFL   IHIG      G      S  LA +++ L F+  RLKTGTPPRI + S+D+S ++++ G N    FS F +  ++  +Q  CY+ +TNN+ H+II +NLDKSAMYSG I G GPRYCPSIEDKVVRF DKERHQ+FVEPE  +   +Y  GLS+SLP +VQ   +++I GFE A I +  YAIEYD  +P  L PTLETK IK L+FAGQINGT+GYEEA  QGL+A IN    +++ +     R ++YIGVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+S   Q H+  + N  +EN +   NT    +T   +++++F        +TL+++LKRP+  +  ++   + N N  D+   ++++I  KY GYI+ Q K I  T  ++   + +  +Y  V  +S E   KL + KP TLG+ASR+ GI    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKKAINSLINNQENLDIFQDSVDDLVVENNTVCGAITKTGITFRAKKVVLTVGTFLGGKIHIGKVSNAGGRAGDQPSNALAARLRSLPFRVDRLKTGTPPRIDRRSVDFSVMEVQHGDNPTPYFSFFSKGKIEHPRQIPCYITYTNNETHKIITDNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFADKERHQIFVEPEGLNSIELYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSDKSWYPTRADSYIGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSDKACELGLLSKEDQQHFISKKNAIIENISMMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPEIDYSKLQQISELNLNLQDDAVIEQIEISAKYSGYIERQNKDIEKTATLEQKAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMK 621
>gi|186458386|ref|ZP_02968695.1| glucose-inhibited division protein A [bacterium Ellin514] >gi|184205254|gb|EDU02304.1| glucose-inhibited division protein A [bacterium Ellin514] (651 aa)
Score = 1236, Expect = 1.3e-133, Identities = 272/609 (44%), Positives = 384/609 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYS---KWFLNRIEENEYIDLIDKEVNSIKFVNQ--KVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHF-DRKF------------------------LD-FNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           KKYD +V+GAGHAG+EAA   A+   +  L  ++   +G M CNP+IGG AKG +TREIDALGG    A D T LQ ++LN+ KG   WA RAQ DK  Y    KW   R E N  +D+  K+  +IK V+Q  +V GV T     + S  +++TTGTFL   +HIG      G    + +  L+  +KE+  +  RLKTGTPPR+L+ SID++K   + G      F+++ D  F                        LD  N Q  CY+ +T +   +II  N+ KS MYSG I G GPRYCPSIEDK+V+F +KER Q+F+EPE    D IY+ G S+ LP +VQ Q+V+ I+G ENA I + AYA+EYD   P QLYP+LETK    LF AGQINGTSGYEEA  QGLMAGIN   +++ +EP++L+R++AYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DNAD RL + G+++GL+ + ++ ++    E     +  LE             +R+    L ++L+RP  ++ D+      +  L E    +V+I IKY GYI  Q+  +   K +++ ++ +  DY  V ++  EAR KL K++P TLGQASR+SG++  D+  + ++L+
  S:     6 KKYDVIVVGAGHAGVEAALAAARMGCQTLLLTINADTIGQMSCNPAIGGLAKGHLTREIDALGGEMGKATDMTGLQFRMLNTKKGPAVWAPRAQCDKKAYQFRLKWVCER-EPN--LDV--KQGQTIKLVHQNGQVTGVETSLEVQYLSATVVITTGTFLRGLMHIGQNQQSGGRAGESAAMNLSASLKEVGLELGRLKTGTPPRLLRRSIDFTKTAEQSGDEPIPFFTYWKDDLFHVEHSGVNPRDIGHSAGKYPPGSILDRLNGQLHCYITYTTDATAKIIRENIHKSPMYSGVIEGVGPRYCPSIEDKIVKFPEKERQQIFLEPEGIATDEIYVNGFSTCLPYEVQVQMVQTIIGCENAEILRPAYAVEYDFAFPTQLYPSLETKVCSHLFLAGQINGTSGYEEAGAQGLMAGINAARKVQGKEPIILRRDQAYIGVLIDDLVTKGTIEPYRMFTSRAEYRLILRQDNADLRLSETGHQIGLLPERNYIKFKAKREAIAAEIDRLE------------KTRQGTDLLAQLLRRPQVTYQDLP---GKRTDLSEDVIQQVEIAIKYEGYIDRQELEVEKFKTLEDKQIPTAFDYDTVHSLRTEARQKLKKIRPATLGQASRISGVSPSDIGILMVWLK 625
>gi|89256126|ref|YP_513488.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. holarctica] >gi|115314600|ref|YP_763323.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. holarctica OSU18] >gi|156502147|ref|YP_001428212.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009829|ref|ZP_02274760.1| glucose-inhibited division protein A [Francisella tularensis subsp. holarctica FSC200] >gi|187931542|ref|YP_001891526.1| glucose inhibited division protein [Francisella tularensis subsp. mediasiatica FSC147] >gi|122325376|sp|Q0BMJ8|GIDA_FRATO tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|122500919|sp|Q2A464|GIDA_FRATH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166222933|sp|A7NBA3|GIDA_FRATF tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|89143957|emb|CAJ79178.1| glucose inhibited division protein A [Francisella tularensis subsp. holarctica LVS] >gi|115129499|gb|ABI82686.1| glucose inhibited division protein A [Francisella tularensis subsp. holarctica OSU18] >gi|134253267|gb|EBA52361.1| glucose inhibited division protein A [Francisella tularensis subsp. holarctica 257] >gi|156252750|gb|ABU61256.1| glucose-inhibited division protein A [Francisella tularensis subsp. holarctica FTNF002-00] >gi|187712451|gb|ACD30748.1| glucose inhibited division protein [Francisella tularensis subsp. mediasiatica FSC147] (627 aa)
Score = 1236, Expect = 1.4e-133, Identities = 267/607 (43%), Positives = 373/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLIS---QSHW-DEYNKNLEN---FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLK-NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D++ Y K   + I   E +D+    V+ +   N  VCG  T     F +  +++T GTFL   IHIG      G      S  LA +++ L F+  RLKTGTPPRI + S+D+S ++++ G N    FS F +  ++  +Q  CY+ +TNN+ H+II +NLDKSAMYSG I G GPRYCPSIEDKVVRF DKERHQ+FVEPE  +   +Y  GLS+SLP +VQ   +++I GFE A I +  YAIEYD  +P  L PTLETK IK L+FAGQINGT+GYEEA  QGL+A IN    +++ +     R ++YIGVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+S   Q H+  + N  +EN     NT    +T   +++++F        +TL+++LKRP+  +  ++   + N N  D+   ++++I  KY GYI+ Q K I  T  ++   + +  +Y  V  +S E   KL + KP TLG+ASR+ GI    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAASASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGVMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKKAINSLINNQENLDIFQDSVDDLVVENNTVCGAITKTGITFRAKKVVLTVGTFLGGKIHIGKVSNAGGRAGDQPSNALAARLRSLPFRVDRLKTGTPPRIDRRSVDFSVMEVQHGDNPTPYFSFFSKGKIEHPRQIPCYITYTNNETHKIITDNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFADKERHQIFVEPEGLNSIELYPNGLSTSLPFEVQCNYIRSIKGFEKAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLYFAGQINGTTGYEEAGAQGLVASINAAISIDSDKSWYPTRADSYIGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSDKACELGLLSKEDQQHFISKKNAIIENIAMMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPEIDYSKLQQISELNLNLQDDAVIEQIEISAKYSGYIERQNKDIEKTATLEQKAIPTDFNYSQVKGLSNEVLQKLTEQKPTTLGEASRIPGITPAAISLLTIYMK 621
>gi|119952976|ref|YP_945185.1| putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Borrelia turicatae 91E135] >gi|119861747|gb|AAX17515.1| putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Borrelia turicatae 91E135] (628 aa)
Score = 1234, Expect = 2.4e-133, Identities = 271/612 (44%), Positives = 385/612 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNS--IKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENF-----NNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYS---FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EA+  L++  +K  L   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E    +DL    V+   +  +  ++ GV T     F S  +++TTGTFL   I IG      G      +Y L K + EL F+  RLKTGTP R+ + SI+++K +I+ G +    FS F    +D   Q  CY+ +TN K H II++N+  S +YSG I G GPRYCPSIEDK+V+F DK++HQ+F+EPE    + +YL GLSSSLPEDVQ++++ +I G ENAVI +  YA+EYD INPI+LY +LETK++KGLF AGQ NG+SGYEEAA QGLMAGIN   +L+ ++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+K+GYE+GL+S+  +  Y    K +E          LKE E STL+  K    +        Y I+K P  +    ID++P L     + E    +V++ IKY GYI  Q+ +I    N++ IKL    DY ++  +S EAR+K  K++P  L QASR+SG+   D+  + +Y  + K +
  S:    11 FDAIVIGGGHAGIEASLALSRLNFKTLLITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGCLVDFSMIQFRILNKSRGPAVQAPRAQADKLVYQVKAKETLERQINLDLFQDTVSDFLLNSMRNRIEGVVTERGNKFTSRVVVLTTGTFLRGKIFIGEYRACMGRISEPAAYGLEKILLELGFEMGRLKTGTPARVHRKSINFAKTEIQFGDSDIIPFS-FSNTKID-KVQLSCYITYTNKKTHAIISDNMHLSPLYSGEIIGNGPRYCPSIEDKIVKFKDKDKHQIFIEPEGLSTEEMYLNGLSSSLPEDVQKRLINSIDGLENAVITRPGYAVEYDYINPIELYASLETKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALKLQGKDPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKWGYEVGLVSEEKYSRYFFKEKQVEEIKELLRQRRLKEREASTLQLKKHISKD-------FYHIIKDPYINLSDLIDIDPKLNASKVILE----QVELDIKYEGYINRQKDLIRKMNNLELIKLPLDFDY-EIDGLSREAREKFVKIQPANLAQASRISGVRNTDIQVLLIYFSSPKNK 621
>gi|28209870|ref|NP_780814.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium tetani E88] >gi|73919634|sp|Q899S1|GIDA_CLOTE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|28202305|gb|AAO34751.1| glucose inhibited division protein A [Clostridium tetani E88] (623 aa)
Score = 1233, Expect = 2.9e-133, Identities = 265/611 (43%), Positives = 385/611 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE-----FKYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           YD +V+GAGHAG EAA   A+   KV +  +    V  MPCNP+IGG AKG + REIDALGG   +  DNT +Q ++LN+SKG    +LRAQ DK  YS      +E  E + L   EV SI   N KV G+ T +  ++ +  +++ TGT+L++ I IG      GP+    +  L K + +L     R KTGTP R+ K +ID+SK+  +PG  K   FS    K     +Q  CYL +TN   HE+I  NL +S M++G I G G RYCPSIEDKV RF DK +HQ+F+EPE ++ + +Y+ GLSSSLPE++Q  + + + G EN    + AYAIEYD I+P +L  +LE+K I+GLF  GQING+SGYEEAA QGL+AGIN   +++ ++PL+L R++ YIGVLI+DL+ K   +PYR++TSR+EYRL LR  NAD RL + GY++GL+S+  +  Y    E+  + ++ ++   + N KE        NS   K   +LYE++KRP+  +  +E   K +  L E  +++V+   KY GYI+ Q + +N  K  +N  L +  DY  V  + +E+  KL+K++P+ +GQASR+SG++  D+  + +YLE+K K
  S:     8 YDVVVVGAGHAGCEAALAAARIGCKVLICTISLDSVALMPCNPNIGGTAKGHLVREIDALGGEMGVNIDNTFIQSRMLNTSKGPAVHSLRAQADKSRYSNRMKYILENEENVTLKQIEVISIDIENGKVKGILTKNGAYYNAKTVVLATGTYLNARIIIGEVAYSGGPNGLFPAKELTKNLMDLGISIRRFKTGTPARVNKKTIDFSKMIEQPGDEKIVPFSFLTDKLE--REQVSCYLTYTNENTHEVIRKNLHRSPMFNGSIEGVGARYCPSIEDKVNRFPDKNKHQVFIEPEGEYTNEMYVSGLSSSLPEEIQVAMYRTVPGLENVEFLRTAYAIEYDCIDPQELKLSLESKNIEGLFSGGQINGSSGYEEAAAQGLIAGINAAMKVKEKDPLLLTRSDGYIGVLIDDLVTKGTNEPYRMMTSRSEYRLLLRQGNADLRLTQKGYDVGLVSEERYKRYINRRESIKSEIERIKNVQITNKKEVNEFLLSLNSSELKKPISLYELIKRPELDYYKVEQLDKGRINLPEDVQEEVNTTAKYEGYIEKQLEQVNQFKKFENKLLPNDIDYSKVYGLRIESVQKLSKIRPMNIGQASRISGVSPADISVLLIYLEHKYK 623
>gi|124004897|ref|ZP_01689740.1| glucose-inhibited division protein A [Microscilla marina ATCC 23134] >gi|123989575|gb|EAY29121.1| glucose-inhibited division protein A [Microscilla marina ATCC 23134] (620 aa)
Score = 1232, Expect = 3.4e-133, Identities = 259/607 (42%), Positives = 370/607 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNK----NTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           KYD +V+G GHAG EAA   A    KV L  +D   +  M CNP++GG AKG + REIDALGGM  I  D T +Q ++LN SKGA  W+ R Q D++ +++ +   +E+N  +D     V  +   + +V GV T       SN +I+T+GTF++  IHIG K    G      S  + +Q+ +L F+  R+KTGTPPR+   SI+Y  ++ + G      FS+ D   L   +Q  C++ +TN K+H I+    DKS M++G I G GPRYCPSIEDK+ RF ++ERHQ+FVEPE  +   +Y+ G S+SLPE+VQ + + +IVGFENA + +  YAIEYD   P QL  TLETK ++ LFFAGQINGT+GYEEAACQG+MAGIN   +++   P +L R+EAYIGVLI+DLINK   +PYR+ TSRAEYR+ LR DNAD RL +  Y+LGL S+       +         +EL     K      +++     S K  + L  ++KRP+ SF  +     +     N  D    ++V+I  KY  YI  ++K+      ++  ++    DY ++  IS E R+KL  ++P T+GQASR+SG++  D+  + +YL
  S:     4 KYDVIVVGGGHAGCEAASAAANLGSKVLLITMDMNKIAQMSCNPAMGGVAKGQIVREIDALGGMSGIVTDKTMIQFRMLNRSKGAAMWSPRCQSDRMRFAEEWRITLEQNLNVDFWQDMVVGMVVKDNQVSGVVTSMGLEVLSNSVILTSGTFMNGLIHIGEKQFGGGRAGERASKGITEQLVQLGFEAGRMKTGTPPRVDARSINYEVMEEQAGDVDPGKFSYTDTPKL--KEQRSCHITYTNKKVHAILEKGFDKSPMFAGRIKGIGPRYCPSIEDKINRFAERERHQIFVEPEGWNTVEVYVNGFSTSLPEEVQYEALHSIVGFENAKMFRPGYAIEYDYFPPTQLKMTLETKLVENLFFAGQINGTTGYEEAACQGMMAGINAHLKVKEENPFILSRSEAYIGVLIDDLINKGTDEPYRMFTSRAEYRILLRQDNADLRLTEKSYKLGLASEKRMQRVREKRGQIKQMSEELAKIKYKPNEINNHLETLGTASIKEKSALINLVKRPEVSFEKLRSLEGSVAEFLNQFDHEVVEQVEILTKYASYIDKEEKMAQKLYELEGFRIPVSFDYDNLKAISSEGREKLKTIRPDTIGQASRISGVSPSDISILMVYL 618
>gi|189220413|ref|YP_001941053.1| Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Methylokorus infernorum V4] >gi|189187271|gb|ACD84456.1| Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Methylacidiphilum infernorum V4] (623 aa)
Score = 1231, Expect = 4.5e-133, Identities = 265/607 (43%), Positives = 368/607 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNK-----------------QEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKD---KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLY 608
           KKYD +V+G GHAG+EAA   A+   +  L  ++   +G M CNPSIGG  KG + REIDALGG   I  D T +Q ++LN  KG    A RAQ DK  Y        E    +DL    V+ +     K+ G+ T       ++ +IVTTGTFL   +H+G    K G      S  L+  +++  F+  RLKTGTPPR+   +ID+SK  ++PG      FS F    LD +K                 Q  C + +TN K H II  NL  S +Y G I G GPRYCPSIEDK+VRF DKERHQ+F+EPE +H +  Y+ G S+SLP +VQ+Q + +I G E+  I +  YA+EYD     Q+YPT+ETK I+GLFFAGQINGT+GYEEAA QGL+AGIN   +++N  PL+L R++AYIGVLI+DL  K I +PYR+ TSRAE+RL LR DNAD RL + GY LGL S++      +         K L   T + +++++ N      +L E+LKRP+YS+  + P            KD    ++  IKY GYI  ++++I   + ++   + +  DY+ +P +  EAR+KL+++KPLT GQASR+ G+N  D+  I ++
  S:     9 KKYDVIVVGGGHAGVEAALACARMGCQTLLLTMNLDTIGQMSCNPSIGGIGKGHLVREIDALGGEMGINTDLTGIQFRMLNLKKGYSVQAPRAQCDKKAYQFRLKAVCERTSNLDLFQASVSDLIVKEDKIKGIITELGIVIHASAVIVTTGTFLRGLLHVGRNK-KTGGRMGESSSSLSDVLRKYGFEVGRLKTGTPPRVNGKTIDFSKCMMQPGDTPPPHFS-FALSDLDTDKEGMYTLNRWKEGMFHVEQLACAITYTNAKTHAIIRENLHTSPLYCGEIQGVGPRYCPSIEDKIVRFADKERHQIFLEPEGRHTEEYYVNGCSTSLPFEVQDQFIHSIEGLEHCQIIRPGYAVEYDYCPATQIYPTMETKTIEGLFFAGQINGTTGYEEAASQGLIAGINAARKIQNNPPLILGRDQAYIGVLIDDLTTKPIREPYRIFTSRAEHRLVLRQDNADLRLTEIGYSLGLASKARLMRVQEK--------KRLIEETFQKIRQYRLNG----LSLEEMLKRPEYSWSHL-PL-----EFQGVPKDVALHIECEIKYAGYIARERELILKRQKLEESIIPANIDYEKIPGLKQEAREKLSRMKPLTFGQASRIPGVNPTDVAIIMIW 615
>gi|150020716|ref|YP_001306070.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermosipho melanesiensis BI429] >gi|166224335|sp|A6LL84|GIDA_THEM4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|149793237|gb|ABR30685.1| glucose inhibited division protein A [Thermosipho melanesiensis BI429] (624 aa)
Score = 1231, Expect = 4.6e-133, Identities = 277/608 (45%), Positives = 388/608 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSG--FITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVK------------EFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           ++D +V+G GHAG+EAA   A+   +  +   +   VG  PCNP+IGGPAKGIV REID LGG  A   D T + +++LN+ KG    ALRAQIDK  YS+   N+++  E + L    V  I   + KV GV       + +  +I+TTGTFL   I IG   ++ G      +  L+K + ++ F+  R KTGTP R+LK+SI++SK+  +   ++  +FSHF    +   K   C+L  TN K H+II + L  S +Y     I   GPRYCPSIEDKVV+FN ++ HQ+FVEPE K+    YL GLS+SLP   Q ++++ I G EN VI + AYAIEYD I+P+QLY TLE+K I+GL+FAGQINGTSGYEEAA QGL+AGIN   ++   +PL+LKR+E+YIG+LI+DL  K + +PYRLLTSRAEYRL LR+DNA  RL KYGY +GLI +  W  + + + N    +K L+   LKNVK            +      K  T LY +LKRP+ S+ D+E  L ++   D+   ++++IYIKY GYI+   + +   +  +++ +S I +   VPN+S EAR+KL KV P ++GQA R+ G+   D+ NI  Y+E
  S:    11 EFDVIVVGTGHAGIEAALAPARLGLRTLILTTNLDNVGWAPCNPAIGGPAKGIVVREIDVLGGEMAKTTDETMINVRMLNTGKGPAVRALRAQIDKYAYSQMMKNKLQSQENLVLRFGLVEKILVKDGKVYGVVDSFGIDYRAKAVILTTGTFLRGKIFIGRDTMEAGRMGDLPAKGLSKSLMDIGFKLSRFKTGTPSRVLKSSINFSKMIRQDTDDEPRAFSHFSEPKV-LPKDHPCWLTHTNEKTHKIIRDYLVYSPLYGKVKLIQSVGPRYCPSIEDKVVKFN-RDSHQVFVEPEGKNSQEYYLNGLSTSLPYAAQIKMLRTIPGLENVVIVRPAYAIEYDYIDPLQLYQTLESKLIEGLYFAGQINGTSGYEEAAGQGLVAGINAAMKILGEKPLILKRSESYIGILIDDLTTKGVDEPYRLLTSRAEYRLLLRHDNAHIRLAKYGYRVGLIPK--W--FYEKVLNLEKNIK-LQIERLKNVKVPVSDRVNDILVKLGSTPLKEGTKLYNLLKRPEISYNDIEE-LDSERITDKELLEQIEIYIKYEGYIEKMLEEVKIFEEYESVDISKI-NLDKVPNLSTEAREKLKKVMPRSIGQAMRIPGVTPADIANIISYIE 623
>gi|196240711|ref|ZP_03139478.1| glucose inhibited division protein A [Cyanothece sp. PCC 7425] >gi|196215161|gb|EDY09813.1| glucose inhibited division protein A [Cyanothece sp. PCC 7425] (647 aa)
Score = 1231, Expect = 5.6e-133, Identities = 259/607 (42%), Positives = 373/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQ-KVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY-------NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +D +V+GAGHAG EAA   A+   +  L  L+   +   PCNP++GGPAK  +T E+DALGG     AD T LQ +LLN S+G   WALRAQ DK EY+      +E    + + +  V  +   +  +V GV T     F    +I+TTGTFL   I +G K +  G      +  L + +  L F+T RLKTGTP R+ K ++DYSK++ +P  N    FS FD +     +Q  CY+  T    H++I +NL  S +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE++Q ++++++ G E+  + + AYA+EYD +   Q YPTL TKKI GLF AGQINGT+GYEEAA QGL+AGIN   + + +E +V  R ++YIG LI+DL  K++ +PYR+LTSR+EYRL LR+DNADQRL   G E+GLI    WD + +  EN     + L+ + LK  +              K + TL ++L+RP + ++D+  +      L E  +  V+I +KY GYI+ QQ+ I+        KL    +Y  +  +S+EAR+KL +VKPLT+GQASR+ G+N  D+  + +YLE
  S:    25 FDVIVVGAGHAGCEAALAAARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLTHEVDALGGEIGKMADRTYLQKRLLNDSRGPAVWALRAQTDKREYAAVMKALVENQPNLTVREGMVTDLLLNSHAEVIGVETYFGVTFACQAVILTTGTFLGGRIWVGKKSMAAGRAGEFPAIGLTETLNRLGFETGRLKTGTPARVDKRTVDYSKMEAQPPDNHIRWFS-FDPEVWIEREQMPCYITRTTALTHQLIRDNLHLSPVYGGWVDAKGPRYCPSIEDKIVRFADKESHQIFIEPEGREIPELYIQGFSTGLPENIQLELLRSLPGLEHCAMLRPAYAVEYDYLPATQCYPTLMTKKIAGLFCAGQINGTTGYEEAAAQGLVAGINAARRAQGQEMIVFPREQSYIGTLIDDLCTKDLREPYRMLTSRSEYRLLLRSDNADQRLTPLGREIGLIDDRRWDLFIQKQENIATEKERLQLTRLKEQEAIGQAIATETGQVIKGSITLADLLRRPGFHYVDLNRYQLGNPRLTEAEQQGVEIDLKYSGYIQRQQRQIDQIIRQAGRKLPPDLNYAQIGTLSMEAREKLTQVKPLTIGQASRIGGVNPADINALLVYLE 638
>gi|94987388|ref|YP_595321.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lawsonia intracellularis PHE/MN1-00] >gi|94731637|emb|CAJ55000.1| NAD/FAD-utilizing enzyme apparently involved in cell division [Lawsonia intracellularis PHE/MN1-00] (622 aa)
Score = 1230, Expect = 7.4e-133, Identities = 248/607 (40%), Positives = 360/607 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +DC+V+G GHAG EA+  LA+   KV L   +   +G++ CNP++GG AKG + REIDALGGM  + AD   +Q + LN SKG    A RAQ+D+  Y +     I     + +    V +I   +    GV T   Q F S Y+I+TTGTFL   +HIG K    G     G+  L+  +  +     RLKTGT PR+LK SID++ ++++ G     SFS    K      Q  CY+ +TN   H++I + +D+S M++G ITGTG RYCPSIEDKV RF D++RHQ+FVEPE       Y+ G+S+SLP D+Q  ++  I G ENA + +  YAIEYD ++P+QL+PTLETK + GL+ AGQINGTSGYEEAA QGL A +NV C++  +EP +L R+ AY+ VL++DL+ +   +PYR+ TSRAEYRL LR  NAD RL   G ++GL+    W+ + K + + +  +  L+   +K          E   +      TL E+LKRP  +F  +     +     E    + +  IKY GY+  Q++++  +  +++  L    DY  V  +S E  +KL  V+P TLGQA R+SG+    +  +++YL+
  S:     5 FDCIVVGGGHAGCEASMALARLGQKVLLITGNVDRIGHLSCNPAVGGIAKGHIVREIDALGGMMGLWADKAGIQFRTLNRSKGPAVRATRAQVDRDLYMQAVKQDIFSQPNLSVWQDTVEAIIVKDGHTGGVKTALGQLFNSQYVILTTGTFLSGLMHIGQKNFSGGRLGDVGTSKLSSSLHSIGLHLGRLKTGTTPRLLKTSIDFTSMEMQLGDTPIPSFSFHGPK--PSQPQVPCYITWTNEYTHDVIRSGMDRSPMFTGVITGTGARYCPSIEDKVARFADRDRHQIFVEPEGLTSQECYINGISTSLPLDIQLALIATIPGLENAHMVRPGYAIEYDYVDPMQLHPTLETKVLPGLWLAGQINGTSGYEEAAGQGLWAALNVFCKITRQEPFILGRDNAYLAVLVDDLVTQGTKEPYRMFTSRAEYRLLLREANADIRLTPLGRKIGLVGDYQWNLFQKKISDIDTLVNRLQNIRIKPDTLDPSIFLELGESIPNRAYTLEELLKRPSITFQTLRKIYSDLPITSEDVYLETETIIKYAGYLDRQEELVQRSAKLEHSYLPKEIDYTKVAGLSSEVIEKLQIVRPQTLGQAGRISGVTPAAITCLEIYLK 616
>gi|187918052|ref|YP_001883615.1| putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Borrelia hermsii DAH] >gi|119860900|gb|AAX16695.1| putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase subunit GidA [Borrelia hermsii DAH] (626 aa)
Score = 1229, Expect = 9.6e-133, Identities = 268/612 (43%), Positives = 384/612 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNS--IKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENF-----NNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM---EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +VIG GHAG+EA+  LA+  +K  L   +   +G + CNP+IGG AKG + REIDALGG      D + +Q ++LN S+G    A RAQ DKL Y       +E  + +DL    V+   +  +  K+ GV T     F S  +++TTGTFL   I IG      G      +  L K + EL F   RLKTGTP R+ + SI+++K +I+ G +    FS F    +D   Q  CY+ +TN K HEII++N+  S +YSG I G GPRYCPSIEDK+V+F DK++HQ+F+EPE    + +YL GLSSSLPED+Q++++ +I G ENAVI +  YA+EYD INPI+LY +LETK+IKGLF AGQ NG+SGYEEAA QG+MAGIN   +L+ ++P++L R  +YIGVLI+DL+ K   +PYR+ TSRAE+RL LR+D +D+RL+++GYE+GL+S+  +  Y    K +E          LKE E STL+  K         N   Y I+K P  +  D+   +P L     + E    +V++ IKY GYI  Q+ +I    N++ IKL    +Y ++  +S EA++K  +++P  L QASR+SG+   D+  + ++  N K +
  S:     9 FDAIVIGGGHAGIEASLALARLNFKTLLITQNLDTIGKLSCNPAIGGLAKGNMVREIDALGGEMGCLIDFSMIQFRILNKSRGPAVQAPRAQADKLVYQVKAKETLERQDNLDLFQDTVSDFLLNSMRNKIEGVITERGNKFTSRVVVLTTGTFLRGKIFIGEYRACMGRISEPAACGLEKILLELGFDMGRLKTGTPARVHRKSINFAKTEIQFGDSDIIPFS-FSNTKID-KAQLSCYITYTNKKTHEIISDNMHLSPLYSGEIVGNGPRYCPSIEDKIVKFKDKDKHQIFIEPEGLSTEEMYLNGLSSSLPEDIQKRLINSIDGLENAVITRPGYAVEYDYINPIELYASLETKRIKGLFVAGQTNGSSGYEEAAAQGIMAGINAALRLQGKDPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIRWGYEVGLVSEEKYSRYFCKEKQVEEIKELLRQRRLKEKEASTLQLKKHI-------NKDFYHIIKDPYVNLSDLLNIDPKLNASKVILE----QVELDIKYEGYINRQRDLIRKMNNLELIKLPLDFNY-EIEGLSREAKEKFARIQPANLAQASRISGVRNTDIQVLLIHFSNPKNK 619
>gi|108562639|ref|YP_626955.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Helicobacter pylori HPAG1] >gi|123373846|sp|Q1CUU1|GIDA_HELPH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|107836412|gb|ABF84281.1| glucose inhibited division protein A [Helicobacter pylori HPAG1] (621 aa)
Score = 1228, Expect = 9.8e-133, Identities = 269/613 (43%), Positives = 373/613 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG-TNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +K+ D LV+G GHAG+EA+ I AK   +V L  +    +G   CNP+IGG  KG +T+E+D LGG   I  DN+ LQ ++LN+SKG      RAQID   Y  +  N +     + +  +   S+   N +V GV T  N  + +  +I+TTGTFL   +HIG    + G    N S  LA  ++EL F+  RLKTGT PR+  NSID+  L+   G TN  Y    F  K  DFN  ++ C++ +TN   H+II +N  ++ ++SG I G GPRYCPSIEDK+ RF++KERHQLF+EP++ H    Y+ GLS+SLP DVQE+++ +I G ENA+I +Y YAIEYD I P +L  TLETKKIKGL+ AGQINGT+GYEEAA QGLMAGIN +  L+N+ P +LKRNEAYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DN   RL ++ Y LGL+ Q  + E  K+ +     LK L+          LK + E   N          +L R  ++   M  F      L+E   +++ I  KY  YI+ Q + I    ++  + +     +K +P +SLEA +KL K +P +L +AS +SGI   +L  + LY+  +K
  S:     2 VKESDILVVGGGHAGIEASLIAAKMGARVHLITMLIDTIGLASCNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTYRIFARNLVLNTPNLSVSQEMTESLILENDEVVGVTTNINNTYRAKKVIITTGTFLKGVVHIGEHQNQNGRFGENASNSLALNLRELGFKVDRLKTGTCPRVAGNSIDFEGLEEHFGDTNPPY----FSYKTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPSIEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIEYDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAPFILKRNEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAYRLGLMEQDFYKELKKDQQAIQENLKRLKEYVLTPSKEVLKRLNELDENPINDKVDGISLLARDSFNAEKMRSFFSFLAPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSIPKDFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRK 619
>gi|30250397|ref|NP_842467.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Nitrosomonas europaea ATCC 19718] >gi|81170562|sp|Q82S78|GIDA_NITEU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|30181192|emb|CAD86388.1| gidA; glucose inhibited division protein A [Nitrosomonas europaea ATCC 19718] (639 aa)
Score = 1228, Expect = 1.1e-132, Identities = 250/596 (41%), Positives = 362/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS-----TLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPF-LKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           K +D +V+G GHAG EAA   A+   K  L   +   +G M CNPSIGG  KG + +EIDALGG  A A D   +Q ++LNSSKG    A RAQ D++ Y +    R+E    + L+   V+ +     K+ GV T     F +  +++T GTFL    H+GH+  + G      S  LA +++E++    RLKTGTPPRI   +ID+  L+ +PG      FS F        +Q  C++  TN + HEII   LD+S +Y+G I G GPRYCPSIEDKVVRF++++ H +F+EPE      IY  G+S+SLP DVQ ++V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N   +++ +EP    R+EAYIGVL++DL+ + +T+PYR+ TSRAE+RL+LR DNAD RL + GY LGL+S+  W  +    E        L  +     TL  ++     +   + +LY++L+RP+  + ++     + ++ +D     +V+I +KY GYI+ Q++ +      + + L    DY+ V  +S E   KLN+ +P T+GQA+R+SGI
  S:     5 KDFDIIVVGGGHAGTEAALAAARMGQKTLLLTQNLDTLGQMSCNPSIGGIGKGHLVKEIDALGGAMAAATDEAGIQFRILNSSKGPAVRATRAQADRVLYRQAIRRRLEAQPDLLLLQSTVDDLLLNGDKITGVVTHLGMTFSARAVVLTVGTFLGGVAHVGHQNFQAGRAGDPASIRLAHRLREMNLSVGRLKTGTPPRIDARTIDFRILREQPGDEPVPVFS-FLGNITQHPRQISCWMTRTNERTHEIIRTGLDRSPLYTGKIEGIGPRYCPSIEDKVVRFSERDAHTIFLEPEGLETSEIYPNGISTSLPFDVQVELVRSIAGLENAHITRPGYAIEYDYFDPRTLKKSLETKVIDGLFFAGQINGTTGYEEAAAQGLLAGLNASLKIKEQEPWCPSRDEAYIGVLVDDLVTRGVTEPYRMFTSRAEFRLQLREDNADMRLTETGYRLGLVSEERWQAFAAKREAIETEKTRLRNTWISPGTLSKLQTPDQPADDRSYSLYDLLRRPEIGYAELVSLSARGQSVIDSQVAQQVEIDVKYEGYIERQRQEVVRHAQHEAMILPKDMDYRAVRGLSNEVTQKLNQHQPETIGQAARISGI 605
>gi|118443722|ref|YP_876980.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium novyi NT] >gi|166222928|sp|A0PX78|GIDA_CLONN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|118134178|gb|ABK61222.1| glucose-inhibited division protein A [Clostridium novyi NT] (632 aa)
Score = 1227, Expect = 1.5e-132, Identities = 254/612 (41%), Positives = 392/612 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFNNTLKELETSTLKNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++D  VIGAGHAG EAA   A+      +F  D   V  MPCNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK +Y++   + +E  + + L   E+  +   + KV GV T +  +++    I+ TG +L S I IG    + GP     + +L++ + E   +  R KTGTP RI + ++D+SK+  + G      FS          +Q  CYL ++ ++  +++  N+D+S +Y+G I   GPRYCPS EDK++RF +K++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++++++ G ENA + + AYAIEYD I+P QL  +LE K I GLF AGQ+NG+SGYEEA CQGL+AGIN   +L+ +EPL+LKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + G+++GL+ +  ++ + K    +E+    LK ++ +  + V +F    NS   K   +LYE++KRP+ ++  ++   K++  L    +++V+I  KY GYI+ Q + +   K ++N  +    DYK V  +  EA  KL+K+KP+ +GQASR+SG++  D+  + + LE   +
  S:     7 EFDVAVIGAGHAGCEAALASARLGVSTVVFATDLASVAMMPCNPNIGGTAKGHLVREIDALGGEMGINIDHTYIQSRMLNTSKGPAVHSLRAQADKRKYAERMKHVLETTDNLHLKQAEIIKVDIEDSKVKGVLTKNGAYYKVKAAILCTGVYLKSRIIIGDINYEGGPSGLAPANMLSQSLIESGIKITRFKTGTPARINRRTVDFSKMIEQKGDENIVPFSFMSENIE--REQISCYLTYSGDETKKVVLENIDRSPLYNGSIKSVGPRYCPSFEDKIMRFPEKDKHQIFIEPEGENTEEMYVGGMSSSLPEDVQLKMLRSVPGLENAEMMRTAYAIEYDCIDPTQLELSLEFKDIDGLFSAGQMNGSSGYEEAGCQGLIAGINAALKLQGKEPLILKRSDAYIGVLIDDLVTKGTQEPYRMMTSRAEYRLLLRQDNADLRLTEMGHKIGLVKEDRYERFTKRKTAIEDEIERLKNIQITNKQEVNKFLEGLNSAGLKKPISLYELIKRPELNYFVVKDLDKDRAELPRDVQEQVNIISKYEGYIQKQLEQVEQFKKLENRLIPKEFDYKLVKGLRTEAIQKLDKIKPVNIGQASRISGVSPADISVLLIVLEQYNR 623
>gi|150392472|ref|YP_001322521.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Alkaliphilus metalliredigens QYMF] >gi|166989733|sp|A6TXE4|GIDA_ALKMQ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|149952334|gb|ABR50862.1| glucose inhibited division protein A [Alkaliphilus metalliredigens QYMF] (630 aa)
Score = 1227, Expect = 1.6e-132, Identities = 264/612 (43%), Positives = 382/612 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKN---VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNT-LDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +D +V+GAGHAG EAA   A+   K  +  +    +  MPCNPSIGG  KG + REIDA+GG   I  D T +Q ++LN+ KG    +LRAQ DK +Y       IE    + L   EV  +   +  V GV T     F S+ +I+ TG +L   I+IG    + GP+    S  L++++ +L     R KTGTP RI ++S+D+SK++   G  +   FS  +       KQ  C+L  T  + H +I  NL++SAMY G +   GPRYCPSIEDKVVRF+DK  HQ+F+EPE      +Y+ G+S+SLPE+VQ+ ++K ++G E+AVI + AYAIEYD I+P QL PTLE K I+ LF  GQ NGTSGYEEAA QGLMAGIN + + +  EP VL R+EAYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL +  Y++GL S+   + Y     ++E     LK+   S  K    ++E K +  K   +LY++LKRP+ ++  ++   +N+N  +    +++ +I IKY GYI+ Q + I+  K ++N  L    DY  +  + LEAR KL+ ++P+++GQASR+SG++  D+  + +YLE +++Q
  S:     8 FDVIVVGAGHAGCEAALAAARMGAKTLMLTMTLDSIAMMPCNPSIGGTGKGHLVREIDAIGGEMGINTDKTFIQSRMLNTGKGPAVHSLRAQADKNKYHTEMKKTIENEPNLLLKQAEVVDLIIEDNTVKGVVTRSGASFYSHSVILATGVYLRGKIYIGEVNYESGPNGLFPSMHLSEKLTKLGCNMRRFKTGTPARIHQDSVDFSKMEEHLGDEEIVPFSFMNDGIE--KKQVPCWLTRTTGETHRVIMENLNRSAMYRGDMESVGPRYCPSIEDKVVRFSDKPSHQIFIEPEGLDTKEMYVQGMSTSLPEEVQDAMLKTVIGLESAVIMRPAYAIEYDCIDPTQLKPTLEVKHIENLFSGGQFNGTSGYEEAAAQGLMAGINAVLKTKGEEPFVLDRSEAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLILRQDNADMRLTEKSYKIGLASKERLERYLLKKSHIEEEITRLKKTNVSPEKANPILEENKSSLIKAGMSLYDLLKRPEVTYKVLKKIDENRNVDIVRDAQEQCEIIIKYEGYIEKQLRQIDQFKKLENKILPQEIDYHGIDGLRLEARQKLSDIQPMSVGQASRISGVSPSDISVLMIYLEQRRRQ 624
>gi|188527017|ref|YP_001909704.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Helicobacter pylori Shi470] >gi|188143257|gb|ACD47674.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Helicobacter pylori Shi470] (621 aa)
Score = 1226, Expect = 2.0e-132, Identities = 267/613 (43%), Positives = 375/613 (61%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG-TNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +K+ D LVIG GHAG+EA+ I AK   +V L  +    +G   CNP+IGG  KG +T+E+D LGG   I  DN+ LQ ++LN+SKG      RAQID   Y  +  N +     + +  +   S+   N ++ GV T  N  +++  +I+TTGTFL   +HIG    + G    N S  LA  ++EL F+  RLKTGT PR+  NSID+  L+   G TN  Y    F  K  DFN  ++ C++ +TN   H+II +N  ++ ++SG I G GPRYCPSIEDK+ RF++KERHQLF+EP++ H    Y+ GLS+SLP DVQE+++ +I G ENA+I +Y YAIEYD I P +L  TLETKKIKGL+ AGQINGT+GYEEAA QGLMAGIN +  L+N++P +LKRNEAYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DN   RL ++ Y LGL+ +  +    K+ +   + LK L+          LK + E   N          +L R  ++   M  F      L+E   +++ I  KY  YI+ Q + I    ++  + +     +K +P +SLEA +KL K +P +L +AS +SGI   +L  + LY+  +K
  S:     2 VKESDILVIGGGHAGIEASLIAAKMGARVHLITMLIDTIGLASCNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTYRIFARNLVLNTPNLSVSQEMTESLIIENDEMVGVTTNINNTYKAKKVIITTGTFLKGVVHIGEHQNQNGRFGENASNSLALNLRELGFRVERLKTGTCPRVAGNSIDFEGLEEHFGDTNPPY----FSYKTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPSIEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIEYDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQDPFILKRNEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAYRLGLMEEDFYKGLKKDQQEIQDNLKRLKECVLTPSKEVLKRLNELDENPINDKVDGVSLLARDSFNLEKMRSFFSFLTPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSIPKGFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRK 619
>gi|169832369|ref|YP_001718351.1| glucose inhibited division protein A [Candidatus Desulforudis audaxviator MP104C] >gi|169639213|gb|ACA60719.1| glucose inhibited division protein A [Candidatus Desulforudis audaxviator MP104C] (657 aa)
Score = 1226, Expect = 2.1e-132, Identities = 256/607 (42%), Positives = 374/607 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK--KYSFSHFDRKFLDFNKQEV---CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN---------VKEFKYNSRKTNTT----LYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           KYD +V+G GHAG EAA   A+   +  L  L    V  MPCNP+IGGP K  + REIDALGG      D   +Q+++LN+ KG    ALRAQ DK  Y +     +E    +DL    V  I        GV T     F +  +IVTTGT+L S + +G    + GP+    +  LA  ++E  F+  R KTGTPPRI + ++D+S++  + G      +SF+  +R      K+++   C+L +T  + HEII  NLD+S +Y+G I GTGPRYCPSIEDKVVRF D+ERHQ+FVEPE  H + +Y+ G+S+SLPEDVQ  +++++ G E   I +Y YAIEYD + P QL PTLETK + GLF AGQINGTSGYEEAA QG++AGIN    ++N EPLV+ R +AYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DNAD RL +  + +GL+S +H++ + +  +     L+ L+ + + +         V+++         +    L E+L+RP+  + D+         +      +V+  IKY GYI+ Q   +   + ++  ++ +  DY +V  +S EA  KL +++P+++GQA R+SG++  D+  + +YL
  S:     7 KYDVIVVGGGHAGCEAALASARLGCRTLLLTLSIDFVALMPCNPAIGGPGKSHLVREIDALGGEMGRNTDRAAIQVRMLNTGKGPAVRALRAQTDKRLYQEGMRRTVEGQPLLDLKQAMVEKIIVDGGSARGVVTRTGARFLAPAVIVTTGTYLRSRVLVGETSFESGPNGQFPAVGLAANLRENGFELGRFKTGTPPRIDRRTLDFSRMTPQHGDEDCPGFSFAAGNR-----GKEQIQVPCWLTYTTARTHEIIRENLDRSPLYTGIIQGTGPRYCPSIEDKVVRFADRERHQVFVEPEGLHTNEMYVQGMSTSLPEDVQLLLLRSLPGLEKVEIVRYGYAIEYDYVVPTQLAPTLETKAVSGLFLAGQINGTSGYEEAAAQGIVAGINAAQSVKNGEPLVVSRAQAYIGVLIDDLVTKGTREPYRIFTSRAEYRLALRQDNADLRLTERAHRIGLVSGAHYERFAQKKDRVRAELERLDRTVVPDPLGRVSRAEVQDWLAARGSAPLSRPCRLSELLRRPEIRYADLVGLGVADPDVAPDVAAEVENQIKYAGYIQKQAAQVARFEKLEARRIPADLDYSEVRGLSNEAAQKLAEIRPVSVGQAGRISGVSPADIAVLLVYL 626
>gi|148323696|gb|EDK88946.1| glucose-inhibited cell division protein A [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (633 aa)
Score = 1225, Expect = 2.6e-132, Identities = 271/610 (44%), Positives = 384/610 (62%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQK----VCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK---KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKD-----KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           M+++D +V+GAGHAG EAA   A+   K A+F +    +G M CNPS+GGPAK  + REIDALGG      D T +Q+++LN+ KG    +LRAQ DK+ Y+      +E  + + +I   V+ +    +     + G+   +   + +  +I+ TGTFL   IHIG      G      S  L   ++++  +  R KTGTP RI   +ID+S L+ +PG      K+S    D++ L   +Q  CY+A TN K+HEII N+ ++S M++G I G GPRYCPSIEDKV R+ DK +H LF+E E    + IYLGG+SSSLP DVQE+++KN+ GFENA I +YAYAIEYD + P ++  TLE++ I  LF AGQINGTSGYEEA  QGLMAGIN + +L N EP++L R ++YIG LI+DL++K   +PYR+ T+R+EYRL LR DNAD RL K GYELGLI +  +    K   +      EL T  L        N R             K  +TL E+L+RP+ +F D+E   +    +D    D     +V+I +KY GYI    K+I   K+++N K+ +  DY D+  I  EA+DKL ++KP+ +GQASR+SG++  D+  I +YL+
  S:     1 MQEFDIIVVGAGHAGCEAALASARMGMKTAVFTISLDNIGVMSCNPSLGGPAKSHLAREIDALGGEMGRNIDKTFIQIRVLNTKKGPAVRSLRAQADKMTYANEMKKTLEHTDNLSVIQGMVSELIVEEENGKKVIKGIKIREGLEYRAKIVILATGTFLRGLIHIGEVNFSAGRMGELSSEDLPLSLEKVGLKLGRFKTGTPARIDGRTIDFSVLEEQPGDKSQVLKFSNRTTDKEALS-RRQISCYIAHTNEKVHEIIKNSKERSPMFNGKIQGLGPRYCPSIEDKVFRYPDKNQHHLFLEREGYETNEIYLGGMSSSLPVDVQEEMIKNLQGFENAKIMRYAYAIEYDYVPPEEIKYTLESRTIDNLFLAGQINGTSGYEEAGAQGLMAGINAVRKLRNEEPIILDRADSYIGTLIDDLVSKGTNEPYRMFTARSEYRLYLREDNADLRLSKIGYELGLIPEEEYQRVEKKRRDV-----ELITEILTKTSVGPSNPRVNETLLKRGENPIKDGSTLLELLRRPEVTFKDIEYISEEIKGVDLQGYDHDTTYQVEITVKYQGYINRALKMIEKHKSMENKKIPADIDYDDLKTIPKEAKDKLKRIKPINIGQASRISGVSPADIQAILIYLK 629
>gi|167626321|ref|YP_001676821.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189039342|sp|B0TY78|GIDA_FRAP2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|167596322|gb|ABZ86320.1| glucose inhibited division protein A [Francisella philomiragia subsp. philomiragia ATCC 25017] (627 aa)
Score = 1225, Expect = 2.6e-132, Identities = 263/607 (43%), Positives = 374/607 (61%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-------NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           YD +V+G GHAG+EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNS KG    A RAQ D++ Y K   + + + E +D+    V+ +   N  VCGV T     F+S  +++T GTFL   IHIG    + G      S  LA +++ L F+  RLKTGTPPRI   S+D+S + ++ G      FS F +  ++  +Q  CY+ +TN+K HEII NNLDKSAMYSG I G GPRYCPSIEDKVVRF +K+RHQ+FVEPE  +   +Y  GLS+SLP +VQ + +++I GFENA I +  YAIEYD  +P  L PTLETK IK LFFAGQINGT+GYEEA  QGL+AGIN    +++ +     R+ +Y+GVLI+DLI K   +PYR+ TSRAEYRL LR DNAD RL     ELGL+++   + +       ++N+    NT    +T   +++++F        +TL+++LKRP+  +  ++        L DE   ++++I  KY GYI+ Q K I     +++  +    DY  V  +S E   KL++ KP TLG+ASR+ G+    +  + +Y++
  S:     7 YDVIVVGGGHAGVEAAAASARIGAKTLLLTHNIDTIGQMSCNPAIGGIGKGHLVKEIDAMGGIMAKAIDMAGIQFRILNSRKGPAVRATRAQADRVLYKKAINSLLNDQENLDIFQDSVDDLVVENDTVCGVITKTGIIFKSKKVVLTVGTFLGGKIHIGQVSKEGGRAGDQPSNALAARLRALPFRVDRLKTGTPPRIDSRSVDFSVMDVQHGDTPTPYFSFFSKGKIEHPRQIPCYITYTNSKTHEIITNNLDKSAMYSGLIEGIGPRYCPSIEDKVVRFAEKDRHQIFVEPEGLNSIELYPNGLSTSLPFEVQCEYIRSIKGFENAFIMRPGYAIEYDFFDPRDLKPTLETKHIKNLFFAGQINGTTGYEEAGAQGLVAGINAAISIDSDKSWYPTRSNSYMGVLIDDLITKGTKEPYRMFTSRAEYRLILREDNADLRLSDKACELGLLNKQDQEIFINKKTAIDENIAIMKNTWIGPQTQKARDLEKFLDKKMTRESTLFDLLKRPELDYKKLQQIPDTNLKLEDESVIEQIEISAKYSGYIERQSKDIAKISTLESKTIPESFDYSQVKGLSNEVLQKLSEQKPTTLGEASRIPGVTPAAVSLLTIYMK 621
>gi|116334861|ref|YP_796388.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Lactobacillus brevis ATCC 367] >gi|122268460|sp|Q03N65|GIDA_LACBA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|116100208|gb|ABJ65357.1| tRNA uridine 5-carboxymethylaminomethyl modification FAD-utilizing enzyme [Lactobacillus brevis ATCC 367] (636 aa)
Score = 1225, Expect = 2.6e-132, Identities = 261/612 (42%), Positives = 371/612 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG--TNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-YNSRKTNTTLYE------ILKRPDYSFIDMEPFLK----NKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           + YD +V+GAGHAG EAA   A+   +  L  ++  +V  MPCNPS+GGPAKGIV REIDALGG      D T +QM++LN+ KG    ALRAQ DK  Y     + IE    + L    V+ +   + +  GV T     + +  +++  GT     I IG  +   GP++   +  L   + +  F   R KTGTPPR+  N+I Y + + +PG      +SF+  D  +LD   Q  C+L +TN K HEII  NLD++ M++G I G GPRYCPSIEDK+VRF DK RHQLF+EPE +  D  Y+ GLS+S+PE+VQ++I+ +I G E+A + +  YAIEYD ++P QL PTLETK +K LF AGQ NGTSGYEEAA QGL+AGIN   +   +    LKR++AYIGV+++DL+ K   +PYRLLTSRAEYRL LR+DNAD RL   G+ELGLIS   + ++          L  L    +K   E   +     +  L +       L+RP   ++D +  L+     +  LD +  ++++I +KY GYIK  ++ +   K ++   + +  DY  +  ++ EA  KL K++P TL QASR+SG+N  D+  + +Y+E  K
  S:    10 QDYDVIVVGAGHAGSEAALAAARMGNRTLLMTINLDMVAFMPCNPSVGGPAKGIVVREIDALGGEMGRNIDKTYVQMRMLNTGKGPAVRALRAQADKHAYHAEMKHTIEREPNLTLRQGIVDDLIVEDGECQGVITNTGARYRAKAVVIAAGTAARGKIIIGELMYSSGPNNSQPATKLTANLPKYGFDLERFKTGTPPRVDGNTIHYDETEEQPGDVEPNHFSFTTPDSAYLDLKNQLSCWLTYTNEKTHEIIKANLDRAPMFTGVIEGVGPRYCPSIEDKIVRFADKPRHQLFLEPEGRKTDEWYVQGLSTSMPEEVQQKILHSIKGLEDAQMMRPGYAIEYDVVSPYQLRPTLETKPLKNLFTAGQTNGTSGYEEAAGQGLLAGINAGLRALGKPGFTLKRSDAYIGVMVDDLVTKGTKEPYRLLTSRAEYRLILRHDNADLRLTAKGHELGLISDERYADFLAKKATLQAELDRLNQIRIKPNDEINAFVESHGDKPLQDGVLAAAFLRRP---YVDYQTLLQFIDAPEQPLDRHIIEEIEISLKYAGYIKKAEENVAKLKRMEAKAIPAQIDYDAIDGLATEAHQKLKKIQPETLAQASRISGVNPADIAILSVYIEQGK 631
>gi|37520450|ref|NP_923827.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Gloeobacter violaceus PCC 7421] >gi|35211444|dbj|BAC88822.1| glucose inhibited division protein A [Gloeobacter violaceus PCC 7421] (656 aa)
Score = 1225, Expect = 2.7e-132, Identities = 248/610 (40%), Positives = 371/610 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYN--SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + ++D +V+GAGH+G EAA   A+   +  L  ++   +   PCNP++GGPAK  +  E+DALGG  A   D T LQ ++LNSS+G   WALRAQ DK EY++     +E    + L   ++  I    + ++CGV T  +  F    +I+TTGTFL   I IG K +  G      +  L   ++ L F+T RLKTGTP R+ + ++D+  ++++P   +   FS   R +++  +Q  CYL  T    H++I ++L  S MYSG I   GPRYCPSIEDK+VRF DKE HQ+F+EPE +    +Y+ G S+SLPE VQ  +++ + G E   + + AYA+EYD +   Q Y TL TK+++GLF AGQINGT+GYEEAA QG++AGIN    +     ++L R  +YIG LI+DL+ KEI +PYR+LTSR+EYRL LR+DNAD+RL   G E+GL+    W  Y K +       + LET+ L N ++   +  ++  + TL ++L+RP   + D+E  L     LD   ++ V+I +KY GYI+ Q + I          + +  DY+ +  +S E+R+KLN+++P T+GQA R+ G+N  D+  + +YLE
  S:    35 LAEFDVVVVGAGHSGCEAALAAARLGCRTLLVTMNLDTIAWQPCNPAVGGPAKSQLVHEVDALGGEMAKITDRTYLQKRVLNSSRGPAVWALRAQTDKREYARELKQVLEATPNLTLRQGQITDIHLGPHDEICGVGTFFDVHFACRAVILTTGTFLGGRIWIGRKSMSAGRAGEFAAEGLTATLERLGFETGRLKTGTPARVDRRTVDFGVMEVQPPDPELRWFSFDPRAWVE-REQLNCYLTRTTAATHQVIRDHLHLSPMYSGDIEARGPRYCPSIEDKIVRFADKESHQIFIEPEGRDTPELYVQGFSTSLPETVQIAMLRTLPGLEACAVLRPAYAVEYDYLPATQCYATLMTKRVEGLFCAGQINGTTGYEEAAAQGIVAGINAARLVRGEALVILPREGSYIGTLIDDLVTKEIREPYRMLTSRSEYRLVLRSDNADRRLTPLGREIGLVDDERWGLYQKKIAAITCERQRLETTRL-NARDLPVHLAAKPGSITLADLLRRPGLHYGDLES-LNQGVLLDAQVREGVEIEVKYSGYIERQNEQIERVSAQHARVIPADLDYERLSTLSKESREKLNRIRPRTIGQAGRIGGVNPADVSALLVYLE 644
>gi|86605018|ref|YP_473781.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechococcus sp. JA-3-3Ab] >gi|86553560|gb|ABC98518.1| glucose-inhibited division protein A [Synechococcus sp. JA-3-3Ab] (643 aa)
Score = 1224, Expect = 3.0e-132, Identities = 254/615 (41%), Positives = 363/615 (59%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +  YD +V+G GHAG EAA   A+      +  L+   +   PCNP++GGPAK  +  EIDALGG      D T LQ ++LN S+G   WALRAQ DK EY++   + +E    + + +  V  +    N +V GV T     F    +I+TTGTFL   I IG      G         L   +++L F+T RLKTGTP R+ + S+D+S ++ +PG      FS FD +     +Q  CYL  T  + H II  NL ++ +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + L  +Y+ G S+ +PE +Q Q+++++ G E  V+ + AYA+EYD +   QLYPTL TKK++GLF AGQINGT+GYEEAA QGL+AGIN    ++ +  + L R  +YIG LI+DL  KE+ +PYR+LTSR+EYRL LR DNADQRL   G E GLI    W  +          ++ LET  +K       ++ +      K + TL E+L+R    + D+         LD + ++  +I +KY GYI+ QQ  I       +  L    DY  +P +S E+R+KL  V+PLT+GQA+R+ G+N  D+  + +YLE +++Q
  S:    12 LDHYDVIVVGGGHAGCEAALAAARLGCNTLMLTLNLDKIAWQPCNPAVGGPAKSQLVHEIDALGGEMGKVTDRTYLQKRVLNRSRGPAVWALRAQTDKREYARVMRSVVENQPNLSIREGTVTDLVLGRNDEVVGVVTHFGSVFGCGAVILTTGTFLGGRIWIGRHWQPAGRAGEFAVEGLTDTLRQLGFETGRLKTGTPARVDRRSVDFSVMERQPGDPDLRWFS-FDPEVWVPREQMDCYLTRTTPETHRIIRENLHETPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDLPELYIQGFSTGMPEKIQIQMLRSLPGLERCVMLRPAYAVEYDYLPATQLYPTLMTKKVQGLFCAGQINGTTGYEEAAAQGLIAGINAARLVQGKPLVTLPRESSYIGTLIDDLCTKELREPYRMLTSRSEYRLILRADNADQRLTPLGREWGLIDDRRWALFQAKQARIAAEIERLETQRVKAHDPAGIHLSQLTGQGIKGSATLAELLRRNPIHYADLLELGLGNEELDPFEQEAAEIAVKYSGYIQRQQAQIEQVSKQYHRPLPPDLDYHSIPTLSKESREKLAAVRPLTVGQAARIGGVNPADINALLIYLEVRQRQ 633
>gi|156972768|ref|YP_001443675.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio harveyi ATCC BAA-1116] >gi|166224337|sp|A7N0X6|GIDA_VIBHB tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|156524362|gb|ABU69448.1| hypothetical protein VIBHAR_00433 [Vibrio harveyi ATCC BAA-1116] (631 aa)
Score = 1224, Expect = 3.3e-132, Identities = 257/596 (43%), Positives = 361/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  N +E    + L  + V+ +     +V GV T     F++  +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   S+D+S L+ + G N    FS   ++     +Q  C++  TN K H++I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T ETK I GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL +   ELGLI  + W  +N+ +EN     + L+++ +         + +          +  ++L+RP+ S+ D+         L D+   ++V+I +KY GYIK QQ+ I  +   ++ KL +  DYKDV  +S E   KL + KP ++G ASR+SGI
  S:     5 ENFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRNALENAPNLTLFQQSVDDLIVDQDRVVGVVTQMGLKFQAKAVVLTVGTFLGGKIHIGMESSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARSVDFSVLEAQHGDNPTPVFSFMGKREHQ-PRQIPCFITHTNEKTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFISGLFFAGQINGTTGYEEAAAQGLMAGLNASLHSQGKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEYRLLLREDNADLRLTEKARELGLIDDARWARFNEKIENMETERQRLKSTWMNPNSAGIDELNKLLKTPMAREASGEDLLRRPEISYSDLTQLDAFAPALEDQQASEQVEIQVKYDGYIKRQQEEIEKSLRHEHTKLPADLDYKDVKGLSNEVVAKLTEAKPESIGIASRISGI 607
>gi|81301232|ref|YP_401440.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechococcus elongatus PCC 7942] >gi|123556262|sp|Q31KG6|GIDA_SYNP7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|81170113|gb|ABB58453.1| glucose inhibited division protein A [Synechococcus elongatus PCC 7942] (635 aa)
Score = 1223, Expect = 3.8e-132, Identities = 252/614 (41%), Positives = 376/614 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++D +VIGAGHAG EAA   A+   +  L  L+   +G  PCNP++GGPAK  +  E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+      +E+   + L +  V  +    N +V GV T     F +  +I+TTGTFL   I +G+K +  G      +  L + ++ L F+T RLKTGTP R+ K S+DYS+L+ +PG  +   FS FD +     +Q  CYL  T  + H++I +NL  + +Y G+I   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPED+Q  +++ + G E+ V+ + AYA+EYD +   Q  PTL T++++GLF AGQ+NGT+GYEEAA QG++AGIN    ++ ++ +V  R  +YIG LI+DL  K++ +PYR+LTSR+EYRL LR DNADQR+   G E+GLI    W  + +           L    +K        + +      K + TL ++L+RP++ +ID+E       +L    K+  +I IKY GY++ QQ  ++         L    DY  + ++ LEAR+KL + +PLTLGQASR+ G+N  D+  + ++LE +++Q
  S:     5 EEFDVIVIGAGHAGCEAALAAARLGCQTLLLTLNLDRIGWQPCNPAVGGPAKSQLAHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAAVIKQVLEQQPNLRLREGMVTDLLIGPNDEVQGVTTYFGSSFRAKAVILTTGTFLGGCIWVGNKSMPAGRAGEFAAVGLTETLQRLGFETDRLKTGTPARVDKRSVDYSRLEPQPGDPEVRWFS-FDPEAWVEREQLPCYLTRTTAETHKLIRDNLHLTPVYGGYIDAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPEDLQLALLQTLPGLEDCVMLRPAYAVEYDYLPATQCLPTLMTRRVEGLFSAGQLNGTTGYEEAAAQGIVAGINAARFVQGQDAIVFPREGSYIGTLIDDLCTKDLREPYRVLTSRSEYRLLLRADNADQRMTPLGREIGLIDDRRWALFEQKQARIAAEQTRLTQQRVKEHDPVGQAIAQQTQAPIKGSATLADLLRRPNFHYIDLEAHGLGDPSLAIAEKEGAEIAIKYAGYLQRQQAQVDQVVRQSQRPLPVDLDYSAITSMRLEAREKLARFRPLTLGQASRIGGVNPADINALLIWLEVQERQ 625
>gi|187933395|ref|YP_001887733.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum B str. Eklund 17B] >gi|187721548|gb|ACD22769.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum B str. Eklund 17B] (626 aa)
Score = 1223, Expect = 4.6e-132, Identities = 252/607 (41%), Positives = 383/607 (63%)
  Q:     5 DCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEFKYNS----RKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLEN 611
           D +V+GAGHAG EAA   A+      +  ++   +  MPCNP+IGG AKG + REIDALGG   +  D+T +Q ++LN+SKG    +LRAQ DK +Y       +EE E + +   EV  +   + K+ GV T +   F +  +I++TGT+L   I IG      GP+    +  L++ + +L     R KTGTP RI + S+D+SK+  +PG +K   FS       + +K+++ CYL +TN + H +I  N+ +S +Y+G I G GPRYCPSIEDKV+RF DK +HQ+FVEPE      +Y+GG+SSSLPE+VQ ++++ + G EN  I + AYAIEYD+++P +L PTLE K ++GL+ AGQ NG+SGYEEA  QGL+AGIN   +++  EP++L R++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + G ++GL+++  ++ +      +EN    LK+L+ +  +   EF   S     K   + YE++KRP+  +  ++     +  L E   ++++I  KY GYI +Q + +   +  +   L    DY +V  +  EA  KLN +KP+++GQASR+SG++  D+  + +YLE+
  S:    11 DVVVVGAGHAGCEAALASARMGLNTLICTINLDSIAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSRMLNTSKGPAVHSLRAQADKKDYQFRMKRVLEEQENLQIRQIEVTELLVEDNKITGVITKNGAIFRAKAVILSTGTYLKGKIIIGEVSYSGGPNGLFPANDLSQSLLDLGISLRRFKTGTPARINRRSVDFSKMIEQPGDDKIVPFSFMSG---NIDKEQISCYLTYTNEQTHNVIKENIGRSPIYNGSIKGVGPRYCPSIEDKVMRFPDKLQHQIFVEPEGLDTLEMYVGGMSSSLPEEVQLKMMRTLPGLENVEIMRTAYAIEYDSVDPTELEPTLEFKNVEGLYGAGQFNGSSGYEEAGAQGLVAGINAALKIKGEEPMILTRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLILRQDNADFRLTEIGKKVGLVTEERYETFLNRKNTIENELERLKKLQITNKRETNEFLLASGSAELKKPISFYELIKRPEVDYFSLKDLDPEREELSEDIGEQINIIAKYEGYISNQLEQVAQFRKFEKKLLPKDIDYSNVKGLRTEAEQKLNSIKPISIGQASRISGVSPADISVLLIYLEH 622
>gi|167405590|ref|ZP_02310344.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria monocytogenes FSL J2-003] (601 aa)
Score = 1222, Expect = 5.8e-132, Identities = 252/579 (43%), Positives = 366/579 (63%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNK 582
           +D +V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F+  R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL +
  S:     9 FDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKE 592
>gi|145347894|ref|XP_001418395.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578624|gb|ABO96688.1| predicted protein [Ostreococcus lucimarinus CCE9901] (693 aa)
Score = 1222, Expect = 5.8e-132, Identities = 253/612 (41%), Positives = 374/612 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQL------ENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF-------KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNK--NTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           +YD +V+GAGHAG EAA   A+      L  L+   V   PCNP++GGPAK  +  EIDALGG   I +D T LQ ++LN+S+G   WALRAQ DK EYS+     +E    + + +  V  +    N  V GV T     FE+  +++TTGTF+   I +G K +  G      S  L + ++E+ F+  RLKTGTP R+   SIDY+ L+ +PG      FS FD       +Q  C++  T    H++I +NL ++  Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPE +Q ++++ + G EN  I + AYA+EYD +   Q  PTLETKKI GLFF+GQINGT+GYEEAA QGL+AGIN   QL         + L+L R  +Y+G L++DL  K++ +PYR+LTSR+EYRL LR+DNAD RL   G E+GLIS + W ++ K  +  +N +  L+++ L    EF         +  + + TL E+L+RP   +  +E F +      L  +  + V+I +KY G+IK Q+  +    +     +    DY  +  + +EAR+KL +V+P T+GQASR+ G+   D+ ++ ++LE +++
  S:    58 RYDVIVVGAGHAGCEAALASARAGASTLLLTLNLDRVAWQPCNPAVGGPAKSQLVHEIDALGGAMGIISDKTYLQKRVLNASRGPAVWALRAQTDKWEYSREMRTTLEAEPNLSIREGMVTELVLGTNDDVRGVRTHFGMEFEAPSVVLTTGTFMGGQIWVGRKTLAAGRAGEAPSEGLTEYLQEIGFEIDRLKTGTPARVDSRSIDYTNLEEQPGDEDMRWFS-FDEDAHVVREQMACHMTRTTAATHKLIQDNLLETPTYGGWVGAKGPRYCPSIEDKIVRFADKESHQIFLEPEGRTVPEVYVQGFSTGLPETLQLELLRTLPGLENCKILRPAYAVEYDFLPAYQCKPTLETKKISGLFFSGQINGTTGYEEAAAQGLLAGINA-AQLAKGGASNGAKELILPREGSYLGTLVDDLCTKDLREPYRMLTSRSEYRLVLRSDNADMRLTPLGREVGLISDARWAKFEKKRDAVDNEMARLQSTRLNVKDEFCQRALDVSGSGSRQSYTLEELLRRPQVPYSMLEEFGQGNVDAPLTRWEAEAVEIRVKYSGFIKRQELQVERESSKFGKPIPDDVDYASISTLRMEAREKLARVRPATIGQASRIGGVTPADVSSLLVHLEVRRR 683
>gi|162139859|ref|YP_413449.2| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Nitrosospira multiformis ATCC 25196] (632 aa)
Score = 1222, Expect = 5.9e-132, Identities = 260/594 (43%), Positives = 369/594 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL--KNVKEFKY-----NSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +D +VIG GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +EIDALGG+ A AAD   +Q ++LNS KG    A RAQ D++ Y +    R+E    + L  + V+ +    ++V GV T     F +  +I+T GTFL    H+G    + G      S  LA +++EL     RLKTGTPPRI   +IDYS +  +PG      FS F        KQ  C++  TN++ H+II + LD+S ++SG I G GPRYCPSIEDKVVRF+ KE HQ+F+EPE      +Y  G+S+SLP D+Q ++V++I G ENA I +  YAIEYD  +P  L  +LET+ I+GLFFAGQINGT+GYEEAA QGL+AGIN   + ++REP   +R+EAY+GVL++DLI + +T+PYR+ TSRAEYRL+LR DNAD RL + G  LG+++ + W  +N  LE        L+T+ L  K++ E         + +   +L+++L+RP+ S+ ++       +  +D    ++V+I  KY GYI+ Q+  +      ++I+L    DYK V  +S E + KLN+ KP T GQASR+SGI
  S:     7 FDVIVIGGGHAGTEAALAAARIGQKTLLLSHNIETLGQMSCNPSIGGIGKGHLVKEIDALGGVMAEAADEAGIQFRILNSRKGPAVRATRAQADRVLYRQAIRQRLESQPNLWLFQQGVDDLVLEGERVAGVVTQLGIRFNARAVILTAGTFLAGLAHVGSANFQAGRAGDLPSNSLAGRLRELKLPVGRLKTGTPPRIDGRTIDYSAVAAQPGDAPVPVFS-FMGNAASHPKQVSCWITHTNSQTHDIIRSGLDRSPLFSGAIEGIGPRYCPSIEDKVVRFSAKESHQIFLEPEGLTTHEVYPNGISTSLPFDMQVKLVRSIKGLENAHITRPGYAIEYDYFDPRALKSSLETRMIEGLFFAGQINGTTGYEEAAAQGLLAGINAALKTQDREPWCPRRDEAYLGVLVDDLITRGVTEPYRMFTSRAEYRLQLREDNADLRLTEVGRRLGVVNDARWVAFNIKLEAIAQEQNRLKTTWLSPKSLSETDALRVIGKNIEHECSLHDLLRRPNVSYAELMTLPGAGEPVVDLAAAEQVEIQAKYQGYIERQKDEVARNAYYEDIRLPQDLDYKTVRGLSNEVQQKLNQFKPETAGQASRISGI 607
>gi|82411948|gb|ABB76057.1| glucose inhibited division protein A [Nitrosospira multiformis ATCC 25196] (647 aa)
Score = 1222, Expect = 5.9e-132, Identities = 260/594 (43%), Positives = 369/594 (62%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL--KNVKEFKY-----NSRKTNTTLYEILKRPDYSFIDMEPFL-KNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +D +VIG GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +EIDALGG+ A AAD   +Q ++LNS KG    A RAQ D++ Y +    R+E    + L  + V+ +    ++V GV T     F +  +I+T GTFL    H+G    + G      S  LA +++EL     RLKTGTPPRI   +IDYS +  +PG      FS F        KQ  C++  TN++ H+II + LD+S ++SG I G GPRYCPSIEDKVVRF+ KE HQ+F+EPE      +Y  G+S+SLP D+Q ++V++I G ENA I +  YAIEYD  +P  L  +LET+ I+GLFFAGQINGT+GYEEAA QGL+AGIN   + ++REP   +R+EAY+GVL++DLI + +T+PYR+ TSRAEYRL+LR DNAD RL + G  LG+++ + W  +N  LE        L+T+ L  K++ E         + +   +L+++L+RP+ S+ ++       +  +D    ++V+I  KY GYI+ Q+  +      ++I+L    DYK V  +S E + KLN+ KP T GQASR+SGI
  S:    22 FDVIVIGGGHAGTEAALAAARIGQKTLLLSHNIETLGQMSCNPSIGGIGKGHLVKEIDALGGVMAEAADEAGIQFRILNSRKGPAVRATRAQADRVLYRQAIRQRLESQPNLWLFQQGVDDLVLEGERVAGVVTQLGIRFNARAVILTAGTFLAGLAHVGSANFQAGRAGDLPSNSLAGRLRELKLPVGRLKTGTPPRIDGRTIDYSAVAAQPGDAPVPVFS-FMGNAASHPKQVSCWITHTNSQTHDIIRSGLDRSPLFSGAIEGIGPRYCPSIEDKVVRFSAKESHQIFLEPEGLTTHEVYPNGISTSLPFDMQVKLVRSIKGLENAHITRPGYAIEYDYFDPRALKSSLETRMIEGLFFAGQINGTTGYEEAAAQGLLAGINAALKTQDREPWCPRRDEAYLGVLVDDLITRGVTEPYRMFTSRAEYRLQLREDNADLRLTEVGRRLGVVNDARWVAFNIKLEAIAQEQNRLKTTWLSPKSLSETDALRVIGKNIEHECSLHDLLRRPNVSYAELMTLPGAGEPVVDLAAAEQVEIQAKYQGYIERQKDEVARNAYYEDIRLPQDLDYKTVRGLSNEVQQKLNQFKPETAGQASRISGI 622
>gi|188588132|ref|YP_001922716.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum E3 str. Alaska E43] >gi|188498413|gb|ACD51549.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum E3 str. Alaska E43] (626 aa)
Score = 1221, Expect = 6.4e-132, Identities = 254/607 (41%), Positives = 380/607 (62%)
  Q:     5 DCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEF----KYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLEN 611
           D +V+GAGHAG EAA   A+      +  ++   +  MPCNP+IGG AKG + REIDALGG   +  D+T +Q ++LN+SKG    +LRAQ DK +Y       +EE E + +   EV  +     KV G+ T +   F +  +I+ TGT+L   I IG      GP+    +  L++ + +L     R KTGTP RI + S+D+SK+  +PG +K   FS F  K +D  +Q  CYL +TN + H +I +N+ +S +Y+G I G GPRYCPSIEDKV+RF DK +HQ+FVEPE      +Y+GG+SSSLPE+VQ ++++ + G EN  I + AYAIEYD+++P +L PTLE K ++GL+ AGQ NG+SGYEEA  QGL+AGIN   +++  EP++L R++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + G ++GL++   ++ +      +EN    LK+L+ +  +   EF         K   + YE++KRP+  +  ++     +  L E   ++++I  KY GYI +Q + +   +  +   L    DY +V  +  EA  KLN +KP+++GQASR+SG++  D+  + +YLE+
  S:    11 DVVVVGAGHAGCEAALASARMGLNTLICTINLDSIAMMPCNPNIGGTAKGHLVREIDALGGEMGVNIDHTFIQSRMLNTSKGPAVHSLRAQADKKDYQFRMKRVLEEQENLQIRQIEVTELLVEGNKVTGIITRNGAIFRAKAVILATGTYLKGKIIIGEVSYSGGPNGLFPANDLSQSLLDLGISLRRFKTGTPARINRRSVDFSKMIEQPGDDKIVPFS-FMSKNID-KEQISCYLTYTNEQTHNVIKDNIGRSPIYNGSIKGVGPRYCPSIEDKVMRFPDKLQHQIFVEPEGLDTLEMYVGGMSSSLPEEVQLKMMRTLPGLENVEIMRTAYAIEYDSVDPTELEPTLEFKNVEGLYGAGQFNGSSGYEEAGAQGLVAGINAALKIKGEEPMILTRSDAYIGVLIDDLVTKGTNEPYRMMTSRAEYRLILRQDNADFRLTEIGKKVGLVTAERYETFLNRKNTIENELERLKKLQITNKRETNEFLLAVGSAELKKPISFYELIKRPEVDYFSLKNLDTEREELSEDIGEQINIIAKYEGYISNQLEQVAQFRKFEKKLLPKDIDYSNVKGLRTEAEQKLNSIKPISIGQASRISGVSPADISVLLIYLEH 622
>gi|56751692|ref|YP_172393.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechococcus elongatus PCC 6301] >gi|81170584|sp|Q5N1E7|GIDA_SYNP6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56686651|dbj|BAD79873.1| glucose inhibited division protein [Synechococcus elongatus PCC 6301] (635 aa)
Score = 1221, Expect = 6.6e-132, Identities = 252/614 (41%), Positives = 376/614 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +++D +VIGAGHAG EAA   A+   +  L  L+   +G  PCNP++GGPAK  +  E+DALGG     AD T LQ ++LN+S+G   WALRAQ DK EY+      +E+   + L +  V  +    N +V GV T     F +  +I+TTGTFL   I +G+K +  G      +  L + ++ L F+T RLKTGTP R+ K S+DYS+L+ +PG  +   FS FD +     +Q  CYL  T  + H++I +NL  + +Y G+I   GPRYCPSIEDK+VRF DKE HQ+F+EPE + +  +Y+ G S+ LPED+Q  +++ + G E+ V+ + AYA+EYD +   Q  PTL T++++GLF AGQ+NGT+GYEEAA QG++AGIN    ++ ++ +V  R  +YIG LI+DL  K++ +PYR+LTSR+EYRL LR DNADQR+   G E+GLI    W  + +           L    +K        + +      K + TL ++L+RP++ +ID+E       +L    K+  +I IKY GY++ QQ  ++         L    DY  + ++ LEAR+KL + +PLTLGQASR+ G+N  D+  + ++LE +++Q
  S:     5 EEFDVIVIGAGHAGCEAALAAARLGCQTLLLTLNLDRIGWQPCNPAVGGPAKSQLAHEVDALGGEIGKMADRTYLQKRVLNASRGPAVWALRAQTDKREYAAVIKQVLEQQPNLRLREGMVTDLLIGPNDEVQGVTTYFGSSFRAKAVILTTGTFLGGCIWVGNKSMPAGRAGEFAAVGLTETLQRLGFETDRLKTGTPARVDKRSVDYSRLEPQPGDPEVRWFS-FDPEAWVEREQLPCYLTRTTAETHKLIRDNLYLTPVYGGYIDAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDIPELYIQGFSTGLPEDLQLALLQTLPGLEDCVMLRPAYAVEYDYLPATQCLPTLMTRRVEGLFSAGQLNGTTGYEEAAAQGIVAGINAARFVQGQDAIVFPREGSYIGTLIDDLCTKDLREPYRVLTSRSEYRLLLRADNADQRMTPLGREIGLIDDRRWALFEQKQARIAAEQTRLTQQRVKEHDPVGQAIAQQTQAPIKGSATLADLLRRPNFHYIDLEAHGLGDPSLAIAEKEGAEIAIKYAGYLQRQQAQVDQVVRQSQRPLPVDLDYSAITSMRLEAREKLARFRPLTLGQASRIGGVNPADINALLIWLEVQERQ 625
>gi|15644841|ref|NP_207011.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Helicobacter pylori 26695] >gi|2494734|sp|P56138|GIDA_HELPY tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|2313303|gb|AAD07281.1| glucose inhibited division protein (gidA) [Helicobacter pylori 26695] (621 aa)
Score = 1221, Expect = 7.5e-132, Identities = 268/613 (43%), Positives = 373/613 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG-TNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +K+ D LV+G GHAG+EA+ I AK   +V L  +    +G   CNP+IGG  KG +T+E+D LGG   I  D++ LQ ++LN+SKG      RAQID   Y     N +     + +  +   S+   N +V GV T  N  + +  +I+TTGTFL   +HIG    + G    N S  LA  ++EL F+  RLKTGT PR+  NSID+  L+   G TN  Y    F  K  DFN  ++ C++ +TN   H+II +N  ++ ++SG I G GPRYCPSIEDK+ RF++KERHQLF+EP++ H    Y+ GLS+SLP DVQE+++ +I G ENA+I +Y YAIEYD I P +L  TLETKKIKGL+ AGQINGT+GYEEAA QGLMAGIN +  L+N+ P +LKRNEAYIGVLI+DLI K   +PYR+ TSRAEYRL LR DN   RL ++ Y LGL+ +  + E  K+ +   + LK L+          LK + E   N          +L R  ++   M  F      L+E   +++ I  KY  YI+ Q + I    ++  + +     +K +P +SLEA +KL K +P +L +AS +SGI   +L  + LY+  +K
  S:     2 VKESDILVVGGGHAGIEASLIAAKMGARVHLITMLIDTIGLASCNPAIGGLGKGHLTKEVDVLGGAMGIITDHSGLQYRVLNASKGPAVRGTRAQIDMDTYRILARNLVLNTPNLSVSQEMTESLILENDEVVGVTTNINNTYRAKKVIITTGTFLKGVVHIGEHQNQNGRFGENASNSLALNLRELGFKVDRLKTGTCPRVAGNSIDFEGLEEHFGDTNPPY----FSYKTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPSIEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIEYDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAPFILKRNEAYIGVLIDDLITKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAYRLGLMEEDFYKELKKDKQEIQDNLKRLKEYILTPSKEVLKRLDELDENPINDKVDGVSLLARDSFNAEKMRSFFSFLAPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSIPKGFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRK 619
>gi|168187284|ref|ZP_02621919.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum C str. Eklund] >gi|169294820|gb|EDS76953.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Clostridium botulinum C str. Eklund] (632 aa)
Score = 1220, Expect = 8.4e-132, Identities = 255/612 (41%), Positives = 392/612 (64%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKELETSTLKNVKEF--KYNSR--KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++D  VIGAGHAG EAA   A+      +F  D   V  MPCNP+IGG AKG + REIDALGG   I  D+T +Q ++LN+SKG    +LRAQ DK +Y++   + +E  E ++L   E+  +   +  V GV T +  +++    I+ TG +L S I IG    + GP     + +L++ + +   +  R KTGTP RI + ++D+SK+  + G +    FS          +Q  CYL ++ ++  +++  N+D+S +Y+G I   GPRYCPS EDK++RF +K++HQ+F+EPE ++ + +Y+GG+SSSLPEDVQ ++++++ G ENA + + AYAIEYD I+P QL  +LE K I GLF AGQ+NG+SGYEEA CQGL+AGIN   +L+ +EPLVLKR++AYIGVLI+DL+ K   +PYR++TSRAEYRL LR DNAD RL + GY +GL+ +  + ++    K +E+    LK ++ +  + V +F    NS   K   +LYE++KRP+ ++  ++   K++  L    +++V+I  KY GYI+ Q + +   K ++N  +    DYK V  +  EA  KL+K+KP+ +GQASR+SG++  D+  + + LE   +
  S:     7 EFDVAVIGAGHAGCEAALASARIGVSTVVFATDLASVAMMPCNPNIGGTAKGHLVREIDALGGEMGINIDHTYIQSRMLNTSKGPAVHSLRAQADKGKYAERMKHVLETTENLNLKQAEIIKVDIEDGNVKGVLTKNGAYYKVKAAILCTGVYLKSRIIIGDINYEGGPSGLAPANMLSQSLIDSGIKITRFKTGTPARINRRTVDFSKMIEQKGDDNIVPFSFMSENIE--REQISCYLTYSGDETKKVVLENIDRSPLYNGSIKSVGPRYCPSFEDKIMRFPEKDKHQIFIEPEGENTEEMYVGGMSSSLPEDVQIKMLRSVPGLENAEMMRTAYAIEYDCIDPTQLKISLEFKNINGLFSAGQMNGSSGYEEAGCQGLIAGINAALKLQGKEPLVLKRSDAYIGVLIDDLVTKGTHEPYRMMTSRAEYRLLLRQDNADLRLTEMGYNIGLVKEDRYIKFIKRKKAIEDEIERLKNIQITNKQEVNKFLEGLNSAGLKKPISLYELIKRPELNYFVVKDLDKDREELPRDVQEQVNIISKYEGYIQKQLEQVEQFKKLENRLIPKEFDYKLVKGLRTEAIQKLDKIKPVNIGQASRISGVSPADISVLLIVLEQYNR 623
>gi|15611269|ref|NP_222920.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Helicobacter pylori J99] >gi|7674056|sp|Q9ZML9|GIDA_HELPJ tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|4154720|gb|AAD05783.1| GLUCOSE INHIBITED DIVISION PROTEIN A [Helicobacter pylori J99] (621 aa)
Score = 1220, Expect = 9.1e-132, Identities = 265/613 (43%), Positives = 371/613 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +K+ D LV+G GHAG+EA+ I AK   +V L  +    +G   CNP+IGG  KG +T+E+D LGG   I  D++ LQ ++LN+SKG      RAQID   Y  +  N +     + +  +   S+   N +V GV T  N  + +  +I+TTGTFL   +HIG    + G    N S  LA  ++EL F+  RLKTGT PR+  NSID+  L+   G      FS+   K  DFN  ++ C++ +TN   H+II +N  ++ ++SG I G GPRYCPSIEDK+ RF++KERHQLF+EP++ H    Y+ GLS+SLP DVQE+++ +I G ENA+I +Y YAIEYD I P +L   LETKKIKGL+ AGQINGT+GYEEAA QGLMAGIN +  L+N+ P +LKRNEAYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DN   RL ++ Y LGL+ Q  + E  K+ +     LK L+          LK + E   N          +L R  ++   M  F      L+E   +++ I  KY  YI+ Q + I    ++  + +     +K +P +SLEA +KL K +P +L +AS +SGI   +L  + LY+  +K
  S:     2 VKESDILVVGGGHAGIEASLIAAKMGVRVHLITMLIDTIGLASCNPAIGGLGKGHLTKEVDVLGGAMGIITDHSGLQYRVLNASKGPAVRGTRAQIDMDTYRIFARNLVLNTPNLSVSQEMTESLILENDEVVGVTTNINNTYRAKKVIITTGTFLKGVVHIGEHQNQNGRFGENASNSLALNLRELGFKVERLKTGTCPRVAGNSIDFEGLEEHFGDANPPYFSY---KTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPSIEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIEYDFIQPTELTHALETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAPFILKRNEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAYRLGLMEQDFYKELEKDKQAIQENLKRLKECVLTPSKEVLKRLNELGENPINDKMDGVSLLARDSFNLEKMRSFFSFLVPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSIPKHFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRK 619
>gi|94967111|ref|YP_589159.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Acidobacteria bacterium Ellin345] >gi|166222901|sp|Q1IVL5|GIDA_ACIBL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|94549161|gb|ABF39085.1| glucose inhibited division protein A [Acidobacteria bacterium Ellin345] (649 aa)
Score = 1220, Expect = 9.3e-132, Identities = 264/614 (42%), Positives = 385/614 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLN--------RIEENEYIDLIDKEVNSIKFVNQ-KVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY---NKNLENFNNTLKE--LETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDME--------PFLKNKNTLDEYWKD------KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGIN--LVDLINIKLYLENKKKQ 615
           ++YD +V+GAGHAG EAA   A+   + AL+ L+  L+  M CNP++GG AKG + RE+DALGG+     D   +Q +LLN+S+G   W+ RAQ DK +Y              +I++ E  DLI ++V+      + K+  G+   D +   +  +++TTGTFL+  IH G +    G      S LL + +K++  +  RLKTGTPPR+   SID+SK  ++PG  +   FS   +K     KQ  CY+A T  + H++I  N+ +S MYSG I  TGPRYCPSIEDK+V+F DKE HQ+F+EPE  +   +Y+ G+S+SLP DVQ ++V +IVG ENA + +  YAIEYD+I+P +L  TLETKKI  L+  GQINGTSGYEEAACQGLMAGIN    +++  PLVL R EAY  +LI+DLI+K   +PYR+ TSRAE+RL LR DNAD+RL  +G  +GLI    W  +    + ++    TL++  + TS L      K+ +    +T+ ++LKRP+      E         F +  ++  E+  D       V+  IKY GY+  Q K I+  K  +   +    DY  V  +S E  +K+ +V+P T+GQASR+ G+    V LIN+ + ++ +K++
  S:     5 EQYDVVVVGAGHAGCEAAMAAARMGLRTALYTLNVDLIAQMSCNPAVGGIAKGHLVREVDALGGIMGEVTDAVGIQFRLLNTSRGPAVWSPRAQCDKQQYRLKMREVLESEPNLKIKQAEVADLIVEDVSDPTHPERMKIARGIKLRDGRTVGALAVVITTGTFLNGLIHCGEEQYPAGRSGEPASVLLGESLKKMGLRGCRLKTGTPPRLDGRSIDWSKFAVQPGDAEPTPFSFRTKKIT--QKQVPCYIAHTTPETHQLIRENVHRSPMYSGQIQSTGPRYCPSIEDKIVKFPDKETHQIFLEPEGLNTYEVYVNGMSTSLPIDVQLRMVHSIVGLENAEMLRPGYAIEYDSIDPTELQRTLETKKIGSLYLGGQINGTSGYEEAACQGLMAGINAALAVKHEPPLVLDRTEAYTAILIDDLISKGTNEPYRMFTSRAEFRLHLRIDNADRRLTPHGRRVGLIKDEAWHAHLAKQQRMDELKMTLEKTRIRTSELPVELAEKFGNID-GSTVVQLLKRPESDVAAFEQIIRRVQPTFFERGDSEREFVSDIRNELKAVETEIKYAGYLDQQTKAIDRLKRSEQRVIPEWFDYASVSGLSREMCEKMQRVRPQTIGQASRIPGVTPAAVSLINVYIEIQGRKQK 646
>gi|160944276|ref|ZP_02091505.1| hypothetical protein FAEPRAM212_01785 [Faecalibacterium prausnitzii M21/2] >gi|158444458|gb|EDP21462.1| hypothetical protein FAEPRAM212_01785 [Faecalibacterium prausnitzii M21/2] (624 aa)
Score = 1219, Expect = 1.1e-131, Identities = 256/612 (41%), Positives = 371/612 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGT--NKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN---LENFNNTLKE--LETSTLKNVKE-FKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           YD +VIGAGHAG+EAA   A    K A+F +    +GNMPCNPSIGG AKG + RE+DALGG+  +AAD T LQ ++LN  KG    ALR Q D+  Y+++  + +E+   + +   EV +++  N  V GV T  +  + +  +++ TGT L   I +G      GPD  + +  L   +K       R KTGTP R+ + SID+SKL+ +PG   ++   FS      L  NK E C++A+TN + H+II +N+ +S +Y G I G GPRYCPSIEDKVVRF+ K+RH LFVEP  ++ + +YL G SSSLPEDVQ     +I GFE+  I + AYAIEYD ++P  L  TLE+K ++GL+ AGQ NGTSGYEEAA QGL+AG+N       +E LVL R+ +Y+G L++DL+ K + DPYR++TSR+EYRL LR DNADQRL   G E GL+    W +Y      LE     L E  L T+ L+   E              E+L+RP+ S+  +   +   + +     ++++  IKY GYI  Q ++I +    +   +    +Y  +  ++LEAR+KL +++P  LGQA R+ G++  D+  + + L  K+++
  S:     7 YDVIVIGAGHAGIEAAHAAAVLGAKTAVFTMSLDAIGNMPCNPSIGGTAKGTLVREVDALGGVMGLAADATYLQSRMLNKGKGPAVHALRVQTDRRRYNEYMKHALEQTPGLAIHQAEVVALEVENGHVKGVITQLHGEYTAKCVVLATGTNLGGKIFVGDAWYASGPDGMHAANALTDSLKAAGLPLRRFKTGTPARVHRRSIDFSKLECQPGDPDSELQPFSFLTDAPLH-NKVE-CWIAYTNPETHKIILDNIQRSPLYGGIIEGVGPRYCPSIEDKVVRFSGKDRHPLFVEPCGENTEEMYLQGASSSLPEDVQNAFYHSIKGFEHLEIMRPAYAIEYDCVDPTSLEATLESKVVRGLYGAGQFNGTSGYEEAAAQGLLAGLNAARNALGKEQLVLPRHTSYLGTLVDDLVTKGVMDPYRMMTSRSEYRLTLRQDNADQRLTPIGREYGLVQDDRWAKYQHTQQILEAERRRLHEAHLRTADLRAAMEAVGLAPAAEGGIAEELLRRPEISYPLVAGIIGWGDEITPMLAERLETEIKYAGYIARQDRMIREVARHEKTLIPEDFEYAALTGLTLEAREKLARIRPRNLGQAGRIPGVSPSDVAQLSIALAGKQQK 624
>gi|86610246|ref|YP_479008.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558788|gb|ABD03745.1| glucose-inhibited division protein A [Synechococcus sp. JA-2-3B'a(2-13)] (643 aa)
Score = 1218, Expect = 1.6e-131, Identities = 255/615 (41%), Positives = 364/615 (59%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKF-VNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +  YD +V+G GH+G EAA   A+      +  L+   +   PCNP++GGPAK  +  EIDALGG      D T LQ ++LN S+G   WALRAQ DK EY++   + +E    + + +  V  +    N +V GV T     F    +I+TTGTFL   I IG      G         L   +++L F+T RLKTGTP R+ + S+D+S ++ +PG      FS FD +     +Q  CYL  T  + H II  NL ++ +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE + L  +Y+ G S+ +PE +Q Q+++++ G E  V+ + AYA+EYD +   QLYPTL TKK++GLF AGQINGT+GYEEAA QGL+AGIN    ++ +  + L R  +YIG LI+DL  KE+ +PYR+LTSR+EYRL LR+DNADQRL   G E GLI    W  +          ++ LET  +K        + +      K + TL EIL+R    + D+         LD + ++  +I +KY GYI+ QQ  I       +  L    DY  +P +S E+RDKL+ V+PLT+GQA+R+ G+N  D+  + +YLE +++Q
  S:    12 LDHYDVVVVGGGHSGCEAALAAARLGCNTLMLTLNLDKIAWQPCNPAVGGPAKSQLVHEIDALGGEMGKVTDRTYLQKRVLNRSRGPAVWALRAQTDKREYARVMRSVVENQPNLTIREGTVTDLVLGRNDEVVGVVTHFGTIFGCRAVILTTGTFLGGRIWIGRHWQAAGRAGEFAVEGLTDTLRQLGFETGRLKTGTPARVDRRSVDFSVMERQPGDPDVRWFS-FDPEVWVPREQMDCYLTRTTPETHRIIRENLHETPVYGGWVEAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRDLPELYIQGFSTGMPEKIQIQMLRSLPGLERCVMLRPAYAVEYDYLPATQLYPTLMTKKVQGLFCAGQINGTTGYEEAAAQGLIAGINAARLVQGKPLVTLPRESSYIGTLIDDLCTKELREPYRMLTSRSEYRLILRSDNADQRLTPLGREWGLIDDRRWALFQAKQARIAAEIERLETQRVKAHDLAGIQLSQLTGQGIKGSATLAEILRRNQIHYSDLLELGLGDAELDPFEQEAAEIAVKYSGYIQRQQSQIEQVSKQYHRPLPPDLDYHSIPTLSKESRDKLSAVRPLTVGQAARIGGVNPADINALLIYLEVRQRQ 633
>gi|2258459|gb|AAB63296.1| GidA [Helicobacter pylori] (621 aa)
Score = 1218, Expect = 1.6e-131, Identities = 266/613 (43%), Positives = 373/613 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETST-------LKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +K+ D LVIG GHAG+EA+ I AK   +V L  +    +G   CNP+IGG  KG +T+E+D LGG   I  D++ LQ ++LN+SKG      RAQID   Y  +  N +     + +  +   S+   N +V GV T  N  + +  +I+TTGTFL   +HIG    + G    N S  LA  ++EL F+  RLKTGT PR+  NSID+  L+   G      FS+   K  DFN  ++ C++ +TN   H+II +N  ++ ++SG I G GPRYCPSIEDK+ RF++KERHQLF+EP++ H +  Y+ GLS+SLP DVQE+++ +I G ENA+I +Y YAIEYD I P +L   LETKKIKGL+ AGQINGT+GYEEAA QGLMAGIN +  L+N+ P +LKRNEAYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DN   RL ++ Y LGL+ Q  + E  K+ +   + LK L+          LK + E   N          +L R  ++   M  F      L+E   +++ I  KY  YI+ Q + I    ++  + +     +K +P +SLEA +KL K +P +L +AS +SGI   +L  + LY+  +K
  S:     2 VKESDILVIGGGHAGIEASLIAAKMGARVHLITMLIDTIGLASCNPAIGGLGKGHLTKEVDVLGGAMGIITDHSGLQYRVLNASKGPAVRGTRAQIDMDTYRIFARNLVLNTPNLSVSQEMTESLILENDEVVGVTTNINNTYRAKKVIITTGTFLKGVVHIGEHQNQNGRFGENASNSLALNLRELGFKVERLKTGTCPRVAGNSIDFEGLEEHFGDANPPYFSY---KTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPSIEDKINRFSEKERHQLFLEPQTIHKNEYYINGLSTSLPLDVQEKVIHSIKGLENALITRYGYAIEYDFIQPTELTHALETKKIKGLYLAGQINGTTGYEEAADQGLMAGINAVLALKNQAPFILKRNEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAYRLGLMEQDFYKELKKDKQEIQDNLKRLKECVLTPSKKLLKRLNELDENPINDKVNGVSLLARDSFNAEKMRSFFSFLAPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSIPKGFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRK 619
>gi|154250326|ref|YP_001411151.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Fervidobacterium nodosum Rt17-B1] >gi|154154262|gb|ABS61494.1| glucose inhibited division protein A [Fervidobacterium nodosum Rt17-B1] (626 aa)
Score = 1215, Expect = 3.2e-131, Identities = 273/610 (44%), Positives = 390/610 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGP-DDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYS--GFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLEN--------FNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSF-----IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           +++ +V+G GHAG+EAAF  A+  +K  L   +   +G   CNP+IGG AKGIV REIDALGG  A   D T + +++LN+SKG    ALRAQIDK  YS+    ++EE E + +    V  I   N KV GV       + +  +I+TTGTFL   I IG + ++ G   DF+   L    IK L F   R KTGTP R+LK SID+SK+  +   +K ++FSHF+   +   K   C+L  T  + H+II + L  S +Y     I   GPRYCPSIEDKVV+F ++E HQ+FVEPE K     YL GLS+SLP   Q ++++ I G EN  I + AYA+EYD I+P QLYPTLE+K I+ L+FAGQINGTSGYEEAA QGL+AGIN   +L   +P+VLKR+E+YIGV+I+DL+ K + +PYRLL+SRAEYRL LR+DNA  RL KYGY++GLI +  +D+   NLEN          N      +S  + ++          T L ++L+RP+ S+     +D EP + + + +++     ++I +KY GYI S  + +   +  +N+ + ++  + +VPN+S EAR+KL K+KPL++GQASR+ G+   D++ +  Y++ K
  S:    12 RFEVIVVGGGHAGIEAAFASARMGFKTLLITGNPDNIGWASCNPAIGGSAKGIVVREIDALGGEMAKTTDETMINVRMLNTSKGPAVQALRAQIDKYSYSRTMKRKLEEQENLLIRYGIVEEILVENGKVKGVVDSFGIDYMAKAVILTTGTFLRGKIFIGRETMEAGRMGDFSARGLTNSLIK-LGFTVGRFKTGTPARVLKKSIDFSKMVRQDTDDKPWAFSHFNEPKV-LEKDYPCWLTHTTPESHKIIRDYLIFSPLYGEVKLIQAKGPRYCPSIEDKVVKF-ERESHQIFVEPEGKDTQEYYLNGLSTSLPYAAQIKMLRTIPGLENVKIVRPAYAVEYDYIDPTQLYPTLESKIIENLYFAGQINGTSGYEEAAAQGLIAGINAGLKLRGEKPIVLKRSESYIGVMIDDLVTKGVDEPYRLLSSRAEYRLLLRHDNAHLRLAKYGYQVGLIPRWFYDKI-INLENNIKYHIERLENVKVPASSSVNELLQSLGTTPLTEGTRLAKLLRRPEVSYNALKHLDPEP-ISDTDVIEQ-----IEIQLKYEGYINSMLEQVQIFEEYENLPIVNVI-FSEVPNLSTEAREKLEKIKPLSIGQASRIPGVTPADILALLTYIKKK 626
>gi|186477785|ref|YP_001859255.1| glucose inhibited division protein A [Burkholderia phymatum STM815] >gi|184194244|gb|ACC72209.1| glucose inhibited division protein A [Burkholderia phymatum STM815] (652 aa)
Score = 1215, Expect = 3.5e-131, Identities = 250/595 (42%), Positives = 365/595 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS-----TLKNVKEFKYNSRKTN--TTLYEILKRPDYSFIDM----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D   +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F S  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   +ID+SKL+ +PG         F  +     +Q  C++  TN + H+II + LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V+++VG E+A I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++++ P   +R++AY+GVL++DL+ + +++PYR+ TSRAEYRL LR DNAD RL + G ELG++    WD +++  +  +   + L T+     TL + +      +  +   +L ++L+RP  S+  +          +  L + + L    K++++I +KY GYI+ Q   I   +  +N +L    DY +V  +S EAR KL + +P T+GQASR+SGI
  S:     6 EFDVIVVGGGHAGTEAALASARMGNKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQSVDDLMVEGDRVVGAVTQVGVRFRSRAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRTIDFSKLEEQPGDLDPIPVFSFLGRVEQHPRQVPCWVTHTNAQTHDIIRSGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVRSMVGLEHAHILRPGYAIEYDYFDPRGLKASLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQSKGPWCPRRDQAYLGVLVDDLVTRGVSEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGVVDDVRWDAFSRKRDAVSRETERLRTTWVNPKTLSSEEATALLGKPIDHEYSLADLLRRPGVSYDGICGLREGTCGPDEALAHDDVLLAQIKEQIEIGVKYQGYIERQAGEIERNEAHENTRLPENLDYTEVRGLSFEARQKLTQFRPETIGQASRISGI 617
>gi|50123437|ref|YP_052604.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Pectobacterium atrosepticum SCRI1043] >gi|81170541|sp|Q6CYI6|GIDA_ERWCT tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|49613963|emb|CAG77416.1| glucose inhibited division protein A [Erwinia carotovora subsp. atroseptica SCRI1043] (629 aa)
Score = 1214, Expect = 4.3e-131, Identities = 261/594 (43%), Positives = 350/594 (58%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL-------ETSTLKNVKEFKYNSRKTNTTLYEILKRP--DYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +D +VIG GHAG EAA   A+   +  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A A D   +Q ++LNSSKG    A RAQ D++ Y +     +E    + +  + V+ +   N +V G  T     F +  +++T GTFLD  IHIG      G      S  LA++++EL  +  RLKTGTPPRI   +ID+S L  + G N    FS F         Q  CY+  TN K HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+  HQ+F+EPE    + IY  G+S+SLP DVQ QIV+++ G ENA I +  YAIEYD  +P  L PTLE K + GLFFAGQINGT+GYEEAA QG++AG+N      ++E    +R++AY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL + G ELG++    W  +N+ LEN     + L       ++  L  V               E+L+RP  DY+ +   P      T DE   ++V+I +KY GYI  QQ  I      +N  L +  DYK V  +S E   KLN  KP ++GQASR+SGI
  S:     7 FDVIVIGGGHAGTEAAMASARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDAMGGLMARAVDQAGIQFRILNSSKGPAVRATRAQADRVLYRQAIRTALENQPNLTIFQQAVDDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPSIPLARRLRELPLRVNRLKTGTPPRIDARTIDFSVLPQQHGDNPMPVFS-FLGNAGQHPAQMPCYITHTNEKTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFADRNTHQIFLEPEGLTSNEIYPNGISTSLPFDVQWQIVRSMAGMENARIVRPGYAIEYDFFDPRDLKPTLENKFVHGLFFAGQINGTTGYEEAAAQGMLAGLNAARLSADKEGWSPRRDQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEMGRELGMVDDHRWARFNEKLENIEKERQRLRDIHVHPQSELLDQVNSLLKTPLSREANGEELLRRPEVDYAQLTALPLFAPGLT-DEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENALLPADLDYKQVNGLSNEVIAKLNDHKPSSIGQASRISGI 607
>gi|109947998|ref|YP_665226.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Helicobacter acinonychis str. Sheeba] >gi|123066121|sp|Q17VU9|GIDA_HELAH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|109715219|emb|CAK00227.1| glucose inhibited division protein A [Helicobacter acinonychis str. Sheeba] (621 aa)
Score = 1214, Expect = 4.9e-131, Identities = 266/613 (43%), Positives = 370/613 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG-TNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           +K+ D LV+G GHAG+EA+ I AK   K  L  +    +G   CNP+IGG  KG +T+E+D LGG   I  DN+ LQ ++LN+SKG      RAQID   Y  +  N +     + +  +   S+   N +V GV T  N  + +  +I+TTGTFL   +HIG    + G    N S  LA  ++EL F+  RLKTGT PR+   SI++  L+   G TN  Y    F  K  +FN  ++ C++ +TN   H+II +N  ++ ++SG I G GPRYCPSIEDK+ RF++KERHQLF+EP++ H    Y+ GLS+SLP DVQE+ + +I G ENA+I +Y YAIEYD I P +L  TLETKKIKGL+ AGQINGT+GYEEAA QGLMAGIN +  L+N+ P +LKRNEAYIGVLI+DL+ K   +PYR+ TSRAEYRL LR DN   RL ++ Y LGL+ +  + E  K+ +     LK L+          LK + E   N         ++L R  +S   M  F      L E   +++ I  KY  YI+ Q + I    ++  + +     +K +P +SLEA +KL K +P +L +AS +SGI   +L  + LY+  +K
  S:     2 VKESDILVVGGGHAGIEASLIAAKMGAKTHLITMLIDTIGLASCNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTYRIFARNLVLNTPNLSVSQEMTESLIIENDEVVGVTTNINNTYRAKKVIITTGTFLKGVVHIGEHQNQNGRFGENASNSLALNLRELGFKVERLKTGTCPRVAGKSINFEGLEEHFGDTNPPY----FSYKTKNFNPTQLSCFITYTNPTTHQIIRDNFHRAPLFSGQIEGIGPRYCPSIEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEETIHSIKGLENALITRYGYAIEYDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLALKNQAPFILKRNEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAYHLGLMEKDFYKELKKDKQEIQENLKRLKECVLTPSKEVLKRLSELDENPINDKINGVDLLARDSFSLEKMRSFFSFLAPLSERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSIPKDFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRK 619
>gi|148653578|ref|YP_001280671.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Psychrobacter sp. PRwf-1] >gi|148572662|gb|ABQ94721.1| glucose inhibited division protein A [Psychrobacter sp. PRwf-1] (642 aa)
Score = 1214, Expect = 5.2e-131, Identities = 256/596 (42%), Positives = 361/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENR---EPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENF---NNTLKELETSTLKNV-KEFKYNSRKT---NTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           K YD +VIG GHAG EAA   A+   +  L   + + +G M CNP+IGG  K  + REIDALGG  A+A D   +Q ++LNS KGA   A RAQ D++ Y     + +E    +DL  +  + I   N K C V T     F +  +++T+GTFL   IHIG    K G      S  LA++++EL     RLKTGTP RI   ++D+S +Q +PG       S      +D + ++V C++  TN K H+II  +LD+S ++SG I G GPRYCPSIEDK+ RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ + ++ + G ENA I +  YAIEYD  NP  L PTLETK I  L+FAGQINGT+GYEEA  QGL+AG+N     ++    +    +R++AY+GVL++DLI     +PYR+ TSRAEYRL LR DNADQRL + G +LGL+  + W  Y + +E+    +  LK+L  +    + K+F   + +      T Y++LKRP+  F D+      +   D    ++++I +KY GYI  QQ+ I+  K ++N +L +  DYK V  +S E   KLN ++P TL QASR+SG+
  S:    16 KAYDVVVIGGGHAGTEAALAAARMGAQTLLLTHNIETLGQMSCNPAIGGIGKSHLVREIDALGGAMALATDKAGIQFRVLNSRKGAAVRATRAQADRILYKAAIRHTLENQPNLDLFQQGADDILVENGKACAVVTATGIIFRTKTVVLTSGTFLGGVIHIGLDNSKGGRAGDQPSIKLAERLRELKLPVGRLKTGTPARIDARTVDFSVMQTQPGDTPLPVMSFMGN--VDMHPEQVNCFITHTNEKTHDIIRKHLDRSPLFSGTIEGVGPRYCPSIEDKIHRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQLEFIRTMAGLENAHITRPGYAIEYDYFNPQNLKPTLETKSIDSLYFAGQINGTTGYEEAGVQGLLAGVNAALSTQDNPVMDSWTPRRDQAYLGVLVDDLITHGTKEPYRMFTSRAEYRLLLREDNADQRLTEIGRKLGLVDDTRWQAYQQKMESMATESARLKDLWATPHNELGKKFTEQTGEVLSKEATAYDLLKRPNVGFNDIAAVTGAQVAADV--GEQIEISVKYAGYIDRQQEDIDQMKRLENTQLPADFDYKAVSGLSNEIVQKLNDIRPATLAQASRISGV 618
>gi|148827804|ref|YP_001292557.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittGG] >gi|166222938|sp|A5UHB8|GIDA_HAEIG tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|148719046|gb|ABR00174.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittGG] (629 aa)
Score = 1213, Expect = 6.3e-131, Identities = 260/614 (42%), Positives = 367/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF+D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G ENA I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ ++    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI ++ W  +N+ +EN     + L +  L    E+   + K          +  ++L+RP+ ++  +      K  + D+   ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLIFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSHRLRDLGLRVNRLKTGTPPRIDARTINFDILAKQHGDEVLPVFS-FMGSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFSDRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKDAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDEARWARFNQKMENIEQERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYNKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|110639868|ref|YP_680078.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cytophaga hutchinsonii ATCC 33406] >gi|122966492|sp|Q11PC8|GIDA_CYTH3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|110282549|gb|ABG60735.1| glucose-inhibited division protein A [Cytophaga hutchinsonii ATCC 33406] (621 aa)
Score = 1213, Expect = 6.7e-131, Identities = 259/607 (42%), Positives = 386/607 (63%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN------VKEFKYNSRKTNTTLYEILKRPDYSF-IDMEPFLKNKNTLDEYWKDKVD---IYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           +YD +V+GAGHAG EAA   A    KV L  ++ + +  M CNP++GG AKG + REIDALGG+  I +D + +Q ++LN SKG   W+ R+Q D+  ++  +  ++E    +D   + ++ +   N KVCGV T          +++T GTFL+  IHIG K +  G      +  + +Q+ EL F++ R+KTGTPPR+   S+DYS +Q + G      FS + ++     KQ  C++ +TN  +H+ +    D+S M++G I G GPRYCPS+EDK+ RF +KERHQ+FVEPE  +   +Y+ G S+SLPEDVQ + ++ I GFENA + +  YAIEYD   P QL  +LET+ +K LFFAGQINGT+GYEEAACQGLMAGIN     ++ E L+LKR+EAYIGVLI+DL+NK   +PYR+ TSRAEYR+ LR DNAD RL   GYE+GL ++  + +      N    ++E++ + +K       ++E      K    LY +LKRP+    +  E   + K  ++ Y +++++   I +KY  YI  ++++      ++N+ L+   DYK +  +SLEAR+KL+K+KP TLGQASR+SG+N  D+  + +Y+
  S:     4 EYDVIVVGAGHAGCEAAAAAANMGSKVLLATMNMQTIAQMSCNPAMGGVAKGQIVREIDALGGLSGIVSDKSMIQFRMLNRSKGPAMWSPRSQNDRHMFAWEWRMQLEALPNVDFWQEMISGLIVKNGKVCGVRTGLGIEIPCKSVVLTNGTFLNGIIHIGEKKLGGGRTGEKAATGITEQLVELGFESGRMKTGTPPRVDGRSLDYSVMQEQEGDENPSKFS-YSKQTTSLTKQRSCHITYTNQAVHDTLKEGFDRSPMFTGRIKGLGPRYCPSVEDKINRFAEKERHQIFVEPEGWNTVEVYVNGFSTSLPEDVQYKAIRKIAGFENAKMFRPGYAIEYDFFPPTQLQLSLETRLVKNLFFAGQINGTTGYEEAACQGLMAGINAHKAAKDHEALILKRSEAYIGVLIDDLVNKGTEEPYRMFTSRAEYRILLRQDNADLRLTPIGYEIGLATEERYQDMLLKKHNSEKLVEEIKNTKIKPETANEILEENGSAPIKEKVVLYNLLKRPNMEVSLFAEKVEEIKTLIEPYTQEEIEQAMIEVKYRDYIDKEEQMALKMTQLENMALNPDFDYKKIQALSLEAREKLSKLKPATLGQASRISGVNPADISILMIYM 619
>gi|16272526|ref|NP_438740.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae Rd KW20] >gi|1169896|sp|P44763|GIDA_HAEIN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|1573570|gb|AAC22240.1| glucose inhibited division protein (gidA) [Haemophilus influenzae Rd KW20] (629 aa)
Score = 1213, Expect = 7.0e-131, Identities = 261/614 (42%), Positives = 367/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +I+T GTFL   IHIG +  + G    + S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G ENA I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ ++    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI ++ W  +N+ +EN     + L +  L    E+   + K          +  ++L+RP+ ++  +      K  + D+   ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQSDRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLTFRAKSVILTAGTFLAGKIHIGLENYEGGRAGDSASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILAKQHGDEVLPVFS-FMGSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFADRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKDAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDEARWARFNQKMENIEQERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|52843084|ref|YP_096883.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|81170552|sp|Q5ZRJ2|GIDA_LEGPH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|52630195|gb|AAU28936.1| glucose inhibited division protein A [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (624 aa)
Score = 1212, Expect = 7.1e-131, Identities = 264/610 (43%), Positives = 363/610 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-----VKEFKYNSRKTNTTLYEILKRPD--YSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+G GHAG EAA   A+   K  L   +  L+G M CNP+IGG  KG + +EIDAL G  A AAD   +Q ++LN+SKG    A RAQ D++ Y K    +++    + +  + V+ +K     V GV T      ++  +++T GTFL   IH+G      G      S  L+K +++LD    RLKTGTPPRI + +ID+S++  +PG      FS+      D  +Q  C++  T    H+II NNLDKS MY+G I G GPRYCPSIEDK+VRF DK  HQ+FVEPE    + IY  G+S+SLP +VQ Q V+ I GFENA I +  YAIEYD  +P  L   L+TK I  LFFAGQINGT+GYEEAA QG++AG+N   Q++++E    +R+EAYIGVLI+DLI     +PYR+ TSRAEYRL LR DNAD RL + G +LGL+    WD ++K  E   +T   L  S ++       KE  +N  + +    E LKRP+  Y  + M   L N   L +   ++++I  KY GYI  QQ+ I   +  +N  L    DY DV  +S E   KLN++KP +L QA R+SG+    L  + ++L+  +
  S:     7 YDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMSCNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRKAIRTQLQSQANLTIFQQAVDDLKIEGGLVTGVVTQMGLTLKARAVVLTVGTFLGGKIHVGMNQYAGGRAGDPPSIALSKSLRDLDLPVGRLKTGTPPRIDRRTIDFSQMVEQPGDTPVPVFSYLGAAS-DHPQQVPCHITHTTEATHDIIRNNLDKSPMYAGVIEGVGPRYCPSIEDKIVRFADKTSHQIFVEPEGLTTEEIYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIEYDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKDQELWCPRRDEAYIGVLIDDLITCGTQEPYRMFTSRAEYRLLLREDNADLRLTEKGRQLGLVGDERWDSFSKKREAIESTQALLYNSWVRVHHNDLFKETLFNPMQHDCRAVEFLKRPEINYQHLLMMDDL-NLPELPQEITEQIEIQNKYAGYIDRQQQEIEKLRKHENTLLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKKSR 621
>gi|53733340|ref|ZP_00156400.2| COG0445: NAD/FAD-utilizing enzyme apparently involved in cell division [Haemophilus influenzae R2866] >gi|145629760|ref|ZP_01785555.1| glucose-inhibited division protein A [Haemophilus influenzae 22.1-21] >gi|145638508|ref|ZP_01794117.1| glucose-inhibited division protein A [Haemophilus influenzae PittII] >gi|144977999|gb|EDJ87783.1| glucose-inhibited division protein A [Haemophilus influenzae 22.1-21] >gi|145272103|gb|EDK12011.1| glucose-inhibited division protein A [Haemophilus influenzae PittII] (629 aa)
Score = 1212, Expect = 7.1e-131, Identities = 260/614 (42%), Positives = 367/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF+D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G ENA I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ ++    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI ++ W  +N+ +EN     + L +  L    E+   + K          +  ++L+RP+ ++  +      K  + D+   ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIKQDRVTGVSTKMGLTFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILAKQHGDAVLPVFS-FMGSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFSDRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKDAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDEARWARFNQKMENIEQERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|148361201|ref|YP_001252408.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Legionella pneumophila str. Corby] >gi|166222940|sp|A5II62|GIDA_LEGPC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|148282974|gb|ABQ57062.1| glucose inhibited division protein A [Legionella pneumophila str. Corby] (624 aa)
Score = 1212, Expect = 7.2e-131, Identities = 264/610 (43%), Positives = 362/610 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-----VKEFKYNSRKTNTTLYEILKRPD--YSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+G GHAG EAA   A+   K  L   +  L+G M CNP+IGG  KG + +EIDAL G  A AAD   +Q ++LN+SKG    A RAQ D++ Y K    +++    + +  + V+ +K     V GV T      ++  +++T GTFL   IH+G      G      S  L+K +++LD    RLKTGTPPRI + +ID+S++  +PG      FS+      D  +Q  C++  T    H+II NNLDKS MY+G I G GPRYCPSIEDK+VRF DK  HQ+FVEPE    + IY  G+S+SLP +VQ Q V+ I GFENA I +  YAIEYD  +P  L   L+TK I  LFFAGQINGT+GYEEAA QG++AG+N   Q++++E    +R+EAYIGVLI+DLI     +PYR+ TSRAEYRL LR DNAD RL + G +LGL+    WD ++K  E   +T   L  S ++       KE   N  + +    E LKRP+  Y  + M   L N   L +   ++++I  KY GYI  QQ+ I   +  +N  L    DY DV  +S E   KLN++KP +L QA R+SG+    L  + ++L+  +
  S:     7 YDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMSCNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRKAIRTQLQSQANLTIFQQAVDDLKIEGGLVTGVVTQMGLTLKARAVVLTVGTFLGGKIHVGMNQYAGGRAGDPPSIALSKSLRDLDLPVGRLKTGTPPRIDRRTIDFSQMVEQPGDTPVPVFSYLGTAS-DHPQQVPCHITHTTEATHDIIRNNLDKSPMYAGVIEGVGPRYCPSIEDKIVRFADKTSHQIFVEPEGLTTEEIYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIEYDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKDQELWCPRRDEAYIGVLIDDLITCGTQEPYRMFTSRAEYRLLLREDNADLRLTEKGRQLGLVGDERWDSFSKKREAIESTQALLHNSWVRVHHNDLFKEALLNPMQHDCRAAEFLKRPEINYQHLLMMDDL-NLPELPQEITEQIEIQNKYAGYIDRQQQEIEKLRKHENTMLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKKSR 621
>gi|77920731|ref|YP_358546.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Pelobacter carbinolicus DSM 2380] >gi|77546814|gb|ABA90376.1| glucose inhibited division protein GidA [Pelobacter carbinolicus DSM 2380] (619 aa)
Score = 1212, Expect = 7.4e-131, Identities = 252/596 (42%), Positives = 348/596 (58%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNN-----TLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           K Y+ +V+GAGHAG EAA   A+      L  L    V  M CNP+IGG AKG + REIDALGG  A   D T +Q + LN+ KG    A RAQ D+  Y       +E    +DL    V+ +     KV GV T D   F    +++TTGTF+   IH+G +    G      S  L+  + EL  +  RLKTGTP R+  N+IDY +L  + G      FS    K    + Q  C++  TN   H+II   LD+S +Y G I G GPRYCPSIEDK++RF DK+ H +F+EPE      +Y  G+S+SLP DVQ   ++ I G E+  I +  YAIEYD ++PIQL P+LETKKI+ LF AGQINGTSGYEEAA QGLMAGIN +  L +  P+VL R++AYIGV+I+DL+    ++PYR+ TSRAEYRL LR DNADQRL   G+++GL+S   W  + + ++           + L +S  + +        K   +L +IL+RPD +  D+         + E  ++++ I IKY GYI  Q +++   +  + I + S  DY  +  +S+E R+KL KV+P  LGQA+R+ G+
  S:     6 KDYEVIVVGAGHAGCEAALASARMGCNTLLLNLHLDAVAQMSCNPAIGGLAKGHLVREIDALGGEMARVIDATGIQFRTLNTKKGPAVRATRAQADRRAYQFHMKQVVENQPALDLKQGSVSRLILQGDKVSGVETTDGLRFFGQTVVLTTGTFMRGLIHVGLQHFPGGRAGEPPSLGLSDHLAELGLRVGRLKTGTPARLDGNTIDYDRLVPQHGDVPPKPFSADTEKIT--SPQVPCFITATNAHTHDIIRQGLDRSPLYQGVIEGVGPRYCPSIEDKIMRFPDKDSHHVFLEPEGLGTREVYPNGVSTSLPPDVQLAFLRTIPGLEHVEIMRPGYAIEYDFVDPIQLKPSLETKKIRNLFLAGQINGTSGYEEAAAQGLMAGINAVHALRDCPPVVLGRDQAYIGVMIDDLVTCGTSEPYRMFTSRAEYRLLLREDNADQRLTPLGHQVGLVSDERWQRFTRKMDKIVEGRDFLEKRRLSSSDKEAIGRLGLEDLKNGLSLVQILRRPDINIEDLVFCDDRLADIPENVREQLQIEIKYEGYIARQYEMVERFRRSEQIAIPSDMDYSPIEGLSIEVREKLQKVRPQNLGQAARIPGV 604
>gi|153002872|ref|YP_001368553.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella baltica OS185] >gi|166200612|sp|A6WUK1|GIDA_SHEB8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|151367490|gb|ABS10490.1| glucose inhibited division protein A [Shewanella baltica OS185] (629 aa)
Score = 1212, Expect = 7.8e-131, Identities = 269/596 (45%), Positives = 361/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FES  +++TTGTFL   IHIG +    G      +  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G +     S F        KQ  C++  TN K HEII   LD+S MYSG I G GPRYCPSIEDK+ RF DK  HQ+F+EPE  + + IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W E+++ LE+    L+ L        S L +      N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQPNLRIFQQAVDDLIVENHQVVGVVTQMGLAFESPAVVLTTGTFLSGKIHIGLENYSGGRAGDPPAIALANRLRELPIRVGRLKTGTPPRIDANTIDFSQMTEQKGDSPLPVMS-FMGDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFADKSSHQIFIEPEGLNTNEIYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIEYDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGKEAWCPRRDEAYLGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGRELGLVDDARWAEFSEKLESIELELQRLRGQWVHPNSPLIHALNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLEDPQAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGI 607
>gi|28899854|ref|NP_799459.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio parahaemolyticus RIMD 2210633] >gi|31076670|sp|Q87K98|GIDA_VIBPA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|28808106|dbj|BAC61343.1| glucose inhibited division protein A [Vibrio parahaemolyticus RIMD 2210633] (631 aa)
Score = 1211, Expect = 9.6e-131, Identities = 257/596 (43%), Positives = 359/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS-------TLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  N +E    + L  + V+ +     +V GV T     F +  +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   ++D+S L+ + G N    FS F  K     +Q  C++  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T ETK I GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL +   ELGLI    W  +N+ +EN     + L+++        +  + +          +  ++L+RP+ S+  +         L D+   ++V+I +KY GYIK QQ+ I  +   ++ KL +  DYKDV  +S E   KL++ KP ++G ASR+SGI
  S:     5 ENFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRNALENAPNLTLFQQSVDDLIVEQDRVVGVVTQMGLKFHAKAVVLTVGTFLGGKIHIGMESSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARTVDFSVLEAQHGDNPTPVFS-FMGKREHHPRQIPCFITHTNEQTHEVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFISGLFFAGQINGTTGYEEAAAQGLMAGLNASLYSQGKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEYRLLLREDNADLRLTEKARELGLIDDVRWARFNEKIENMETERQRLKSTWVNPNSAGIDELNKLLKTPMAREASGEDLLRRPEISYSQLTQLDAFAPALEDQQAAEQVEIQVKYDGYIKRQQEEIEKSLRHEHTKLPADLDYKDVKGLSNEVVAKLSEAKPESIGIASRISGI 607
>gi|153838485|ref|ZP_01991152.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio parahaemolyticus AQ3810] >gi|149748108|gb|EDM58967.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio parahaemolyticus AQ3810] (631 aa)
Score = 1211, Expect = 1.1e-130, Identities = 257/596 (43%), Positives = 359/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS-------TLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  N +E    + L  + V+ +     +V GV T     F +  +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   ++D+S L+ + G N    FS F  K     +Q  C++  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T ETK I+GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL +   ELGLI    W  +N+ +EN     + L+++        +  + +          +  ++L+RP+ S+  +         L D+   ++V+I +KY GYIK QQ+ I  +   ++ KL    DYKDV  +S E   KL++ KP ++G ASR+SGI
  S:     5 ENFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRNALENAPNLTLFQQSVDDLIVEQDRVVGVVTQMGLKFHAKAVVLTVGTFLGGKIHIGMESSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARTVDFSVLEAQHGDNPTPVFS-FMGKREHHPRQIPCFITHTNEQTHEVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFIRGLFFAGQINGTTGYEEAAAQGLMAGLNASLYSQGKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEYRLLLREDNADLRLTEKARELGLIDDVRWARFNEKIENMETERQRLKSTWVNPNSAGIDELNKLLKTPMAREASGEDLLRRPEISYSQLTQLDAFAPALEDQQAAEQVEIQVKYDGYIKRQQEEIEKSLRHEHTKLPVDLDYKDVKGLSNEVVAKLSEAKPESIGIASRISGI 607
>gi|89889742|ref|ZP_01201253.1| glucose-inhibited division protein, GIDA (NAD/FAD-utilizing enzyme) [Flavobacteria bacterium BBFL7] >gi|89518015|gb|EAS20671.1| glucose-inhibited division protein, GIDA (NAD/FAD-utilizing enzyme) [Flavobacteria bacterium BBFL7] (623 aa)
Score = 1210, Expect = 1.2e-130, Identities = 249/601 (41%), Positives = 377/601 (62%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPG--TNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETST-----LKNVKEFKYNSRKT-NTTLYEILKRPDYSFIDMEPFLKNK-----NTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDL 602
           ++YD +V+GAGHAG EAA + A       L  ++ + +G M CNP++GG AKG + REIDALGG+  I +D + +Q K+LN SKG   W+ R Q D++ +S+ +  ++E    +D   + V  +   ++KV GV T       S  +++T GTFL+  IHIG K    G      S  +  Q+ +L F++ R+KTGTPPR+   S+DYSK++ +PG     K+S+S+          Q  C++ +T+ ++H ++    D+S M++G I   GPRYCPSIEDK+ RF DK+RHQLFVEPE  +   +Y+ G S+SLPEDVQ + ++++VGFE     +  YAIEYD   P QL  TLETK I GL+FAGQINGT+GYEEAA QGLMAGIN + ++   EP +LKR+EAYIGVL++DLI K   +PYR+ TSRAEYR  LR DNAD RL     +LG+++        +        ++ L  ++     + N+   K + + T N  L+++  RP  +  D++   + K     N LD+   ++V++++KY GYI  ++   +    ++N+K+ S  D+K + ++S EAR+KL  ++P T+ QASR+SG++  D+
  S:     4 REYDVIVVGAGHAGSEAAAVAANMGSSTLLVTMNLETIGQMSCNPAMGGIAKGQIVREIDALGGLSGIVSDKSAIQFKMLNQSKGPAMWSPRTQNDRMRFSEEWRMQLEAIPLLDFYQEMVAGLIIEDEKVVGVRTSLGIEIRSKAVVLTNGTFLNGLIHIGDKQFGGGRAGERASTGITGQLVDLGFESGRMKTGTPPRVDGRSLDYSKMEPQPGDAVTSKFSYSNLTSSL---KNQRDCHMTYTSPEVHNLLREGFDRSPMFNGRIKSLGPRYCPSIEDKIDRFADKDRHQLFVEPEGWNTCEVYVNGFSTSLPEDVQFKALRSVVGFEKVKFFRPGYAIEYDYFPPTQLKHTLETKLIDGLYFAGQINGTTGYEEAASQGLMAGINAVRKIREEEPFILKRDEAYIGVLVDDLITKGTEEPYRMFTSRAEYRTLLRQDNADLRLTPRAVDLGIVTDESLKRVERKATESEKMVQFLRDTSYDFKEMNNLLVAKGSKQVTQNDKLFKVFSRPQVNLEDIKTISQVKGYLKENDLDDDILEQVEVHVKYAGYIAKEKDNADKLHRLENVKIPSDYDFKSIKSLSYEAREKLTTIQPATVSQASRISGVSPSDI 614
>gi|53733098|ref|ZP_00155574.2| COG0445: NAD/FAD-utilizing enzyme apparently involved in cell division [Haemophilus influenzae R2846] (629 aa)
Score = 1210, Expect = 1.4e-130, Identities = 261/614 (42%), Positives = 365/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF+D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G ENA I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ ++    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI  + W  +NK +EN     + L    L    E+   + K          +  ++L+RP+ ++  +      K  + D+   ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLTFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILAKQHGDAVLPVFS-FMGSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFSDRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKDAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDDARWARFNKKMENIEQERQRLRNIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|196158889|ref|YP_002128378.1| glucose inhibited division protein A [Alteromonas macleodii 'Deep ecotype'] >gi|88771976|gb|EAR03284.1| glucose inhibited division protein A [Alteromonas macleodii 'Deep ecotype'] >gi|196114668|gb|ACG68384.1| glucose inhibited division protein A [Alteromonas macleodii 'Deep ecotype'] (633 aa)
Score = 1209, Expect = 1.8e-130, Identities = 254/609 (41%), Positives = 363/609 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL-------ETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDE-YWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + +D +V+G GHAG EAA   A+      L   + + +G M CNP+IGG  KG + +EIDALGG  A+A D   +Q + LNSSKG    A RAQ D+  Y     + +E  E + L  + V+ +   N +VCGV T     F++  +++T GTFL  +IHIG +  + G      S  LA +++ L F+  RLKTGTP R+   S+D+S +Q +PG +    FS    + +    Q  CY+  TN K H+II   LD+S M++G I G GPRYCPSIEDK+ RF DK  HQ+FVEPE  +   +Y  G+S+SLP DVQ  +V++I GFENA I +  YAIEYD  +P  L  TLETK I+GLFFAGQINGT+GYEEA  QGL+AG N   Q++ ++P +L+R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL   G E+GL+  + W +YN  +E     L+ L       + +    +     N      +L E+++RP+ ++  +         +D+    ++V+I IKY GYI  Q   I  T+  +N  L    D+  +  +S E   KL + +P T+G+ASR+SGI    +  + +YL+
  S:     5 EAFDVIVVGGGHAGTEAALAAARMGANTLLLTHNIETIGQMSCNPAIGGIGKGHLVKEIDALGGAMALAIDKGGIQFRTLNSSKGPAVRATRAQADRTLYKNAIRDIVENQENLTLFQQSVDDLIVENDRVCGVVTQMGLKFKAKSVVLTVGTFLGGTIHIGLENYRGGRAGDPPSIALADRLRALPFRVDRLKTGTPARLDARSLDFSVMQPQPGDSPTPVFSFMGDRAMH-PTQIPCYITHTNEKTHDIIRGGLDRSPMFTGVIEGIGPRYCPSIEDKITRFADKTSHQIFVEPEGLNSIEVYPNGISTSLPFDVQMNLVRSIKGFENAHIVRPGYAIEYDFFDPRDLKQTLETKFIQGLFFAGQINGTTGYEEAGAQGLVAGANAALQVQQKDPFILRRDQAYMGVLIDDLATMGTKEPYRMFTSRAEYRLLLREDNADSRLTAMGREIGLVDDARWAKYNDKMEAVETELQRLRGQWIHPDHAATPQLNTMLKNPVSREHSLEELIRRPEMTYSQLMKIESVGPGIDDPIAAEQVEIQIKYAGYIARQMDEIAKTQRHENTLLPIDMDFSKISGLSNEVVAKLTEARPETIGKASRISGITPAAISLLLVYLK 620
>gi|172059160|ref|YP_001806812.1| glucose inhibited division protein A [Burkholderia ambifaria MC40-6] >gi|171991677|gb|ACB62596.1| glucose inhibited division protein A [Burkholderia ambifaria MC40-6] (656 aa)
Score = 1209, Expect = 1.8e-130, Identities = 251/595 (42%), Positives = 358/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSF-----------IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   SID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+++ +       K        +     +L E+L+RP  S+              EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKLDEQPGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPPKEATALLGKAIDHEYSLAELLRRPGISYDGVCSLKGGECAPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|158335338|ref|YP_001516510.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Acaryochloris marina MBIC11017] >gi|189039326|sp|B0BZY6|GIDA_ACAM1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|158305579|gb|ABW27196.1| glucose-inhibited dvision protein A [Acaryochloris marina MBIC11017] (635 aa)
Score = 1208, Expect = 2.1e-130, Identities = 256/610 (41%), Positives = 370/610 (60%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + +++ +V+GAGHAG EAA   A+      L  L+   +   PCNP++G PAK  +T E+DALGG     AD T LQ +LLN S+G   WALRAQ DK EY+   +  I EN+  +L  +E      V   N +V GV T     F    +I+TTGTFL   I +G K +  G      +  L + + +L F+T RLKTGTP R+ K S D+S ++ +P   +   FS FD       +Q  CY+  T  + H++I +NL  S +Y G++   GPRYCPSIEDK+VRF DK  HQ+F+EPE + +  +Y+ G S+ LPE +Q ++++++ G E+  + + AYA+EYD +   Q YPTL TK+I+GLF AGQINGT+GYEEAA QG++AGIN   ++  +E L+  R E+YIG LI+DL  K++ +PYR+LT R+EYRL LR+DNADQRL   G E+GLI    W  + +         + L  + LK        + +      K + TL ++L+RP + + D++       TL+   ++ V+I IKY GYI+ QQ+ I      +  KL    DY  +  +S+EAR+KL KV+PLT+GQASR+ G+N  D+  +  YLE
  S:    10 LDEFEVIVVGAGHAGCEAALASARMGCSTLLLTLNLDKIAWQPCNPAVGAPAKSQLTHEVDALGGEIGKMADRTYLQKRLLNHSRGPAVWALRAQTDKREYAA-VMKTIVENQG-NLTVREGMVTDLVLGDNDEVVGVQTYFGVAFRCQAVILTTGTFLGGRIWVGDKSMPAGRAGEFAAEGLTETLNQLGFETGRLKTGTPARVDKRSADFSVMEPQPPDQQVRWFS-FDPAVWIEREQMNCYITRTTPETHQLIQDNLHLSPVYGGWVDAKGPRYCPSIEDKIVRFADKASHQIFIEPEGRDIPELYIQGFSTGLPEALQLRMLRSLPGLEHCAMLRPAYAVEYDYLPATQCYPTLMTKRIEGLFCAGQINGTTGYEEAAAQGIVAGINAARRVNQQEMLIFPRAESYIGTLIDDLCTKDLREPYRMLTGRSEYRLLLRSDNADQRLTPLGREVGLIDDRRWHLFTRKQATITAEKERLHATRLKERDPAAQAIVQTTGEKIKGSITLSDLLRRPKFHYCDLQQHGLGIETLERSERESVEIEIKYAGYIQRQQRQIEQVSRQEQRKLPENIDYASIETLSMEAREKLAKVRPLTVGQASRIGGVNPSDINALLFYLE 626
>gi|145635868|ref|ZP_01791558.1| glucose-inhibited division protein A [Haemophilus influenzae PittAA] >gi|148825138|ref|YP_001289891.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittEE] >gi|166222937|sp|A5U9Q7|GIDA_HAEIE tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|145266880|gb|EDK06894.1| glucose-inhibited division protein A [Haemophilus influenzae PittAA] >gi|148715298|gb|ABQ97508.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittEE] (629 aa)
Score = 1208, Expect = 2.2e-130, Identities = 259/614 (42%), Positives = 366/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+ +TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF+D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G ENA I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ ++    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI  + W  +N+ +EN     + L    L    E+   + K          +  ++L+RP+ ++  +      K  + D+   ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V ++S E R KL + +P+++ QASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLIFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILAKQHGDEVLPMFS-FMGSVDDHPQQIPCYITYTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFSDRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLENARIVKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKDAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDDARWARFNQKMENIEQERQRLRNIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSSLSNEVRAKLEQHRPVSISQASRISGITPA---AISIILVNLKKQ 622
>gi|54295714|ref|YP_128129.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Legionella pneumophila str. Lens] >gi|81170553|sp|Q5WSS4|GIDA_LEGPL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|53755546|emb|CAH17045.1| hypothetical protein [Legionella pneumophila str. Lens] (624 aa)
Score = 1208, Expect = 2.3e-130, Identities = 263/610 (43%), Positives = 361/610 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-----VKEFKYNSRKTNTTLYEILKRPD--YSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+G GHAG EAA   A+   K  L   +  L+G M CNP+IGG  KG + +EIDAL G  A AAD   +Q ++LN+SKG    A RAQ D++ Y K    +++    + +  + V+ +K     V GV T      ++  +++T GTFL   IH+G      G      S  L+K +++LD    RLKTGTPPRI + +ID+S++  +PG      FS+      D  +Q  C++  T    H+II NNLDKS MY+G I G GPRYCPSIEDK+VRF DK  HQ+FVEPE    + IY  G+S+SLP +VQ Q V+ I GFENA I +  YAIEYD  +P  L   L+TK I  LFFAGQINGT+GYEEAA QG++AG+N   Q++ ++    +R+EAYIGVLI+DLI     +PYR+ TSRAEYRL LR DNAD RL + G +LGL+    WD ++K  E   +T   L  S ++       KE   N  + +    E LKRP+  Y  + M   L N   L +   ++++I  KY GYI  QQ+ I   +  +N  L    DY DV  +S E   KLN++KP +L QA R+SG+    L  + ++L+  +
  S:     7 YDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMSCNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRKAIRTQLQSQANLTIFQQAVDDLKIEGGLVTGVVTQMGLTLKARAVVLTVGTFLGGKIHVGMNQYAGGRAGDPPSIALSKSLRDLDLPVGRLKTGTPPRIDRRTIDFSQMVEQPGDTPVPVFSYLGTAS-DHPQQVSCHITHTTEATHDIIRNNLDKSPMYAGVIEGVGPRYCPSIEDKIVRFADKTSHQIFVEPEGLTTEEIYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIEYDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKGQDLWCPRRDEAYIGVLIDDLITCGTQEPYRMFTSRAEYRLLLREDNADLRLTEKGRQLGLVGDERWDSFSKKREAIESTQALLHNSWVRVHHNDLFKEALLNPMQHDCRAAEFLKRPEINYRHLLMMDDL-NLPELPQEITEQIEIQNKYAGYIDRQQQEIEKLRKHENTMLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKKSR 621
>gi|54298881|ref|YP_125250.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Legionella pneumophila str. Paris] >gi|81170551|sp|Q5X0Z8|GIDA_LEGPA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|53752666|emb|CAH14101.1| hypothetical protein [Legionella pneumophila str. Paris] (624 aa)
Score = 1208, Expect = 2.5e-130, Identities = 263/610 (43%), Positives = 362/610 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-----VKEFKYNSRKTNTTLYEILKRPD--YSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           YD +V+G GHAG EAA   A+   K  L   +  L+G M CNP+IGG  KG + +EIDAL G  A AAD   +Q ++LN+SKG    A RAQ D++ Y K    +++    + +  + V+ +K     V GV T      ++  +++T GTFL   IH+G      G      S  L+K +++LD    RLKTGTPPRI + +ID+S++  +PG      FS+      D  +Q  C++  T    H+II NNLDKS MY+G I G GPRYCPSIEDK+VRF DK  HQ+FVEPE    + IY  G+S+SLP +VQ Q V+ I GFENA I +  YAIEYD  +P  L   L+TK I  LFFAGQINGT+GYEEAA QG++AG+N   Q++++E    +R+EAYIGVLI+DLI     +PYR+ TSRAEYRL LR DNAD RL + G +LGL+    W+ ++K  E   +T   L  S ++       KE   N  + +    E LKRP+  Y  + M   L N   L +   ++++I  KY GYI  QQ+ I   +  +N  L    DY DV  +S E   KLN++KP +L QA R+SG+    L  + ++L+  +
  S:     7 YDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDLLGQMSCNPAIGGIGKGHLVKEIDALDGAMAKAADQAGIQFRILNASKGPAVRATRAQADRVLYRKAIRTQLQSQANLTIFQQAVDDLKIEGGLVTGVVTQMGLTLKARAVVLTVGTFLGGKIHVGMNQYAGGRAGDPPSIALSKSLRDLDLPVGRLKTGTPPRIDRRTIDFSQMVEQPGDTPVPVFSYLGTAS-DHPQQVPCHITHTTEATHDIIRNNLDKSPMYAGVIEGVGPRYCPSIEDKIVRFADKTSHQIFVEPEGLTTEEIYPNGISTSLPFEVQVQFVRTIKGFENAHITRPGYAIEYDYFDPRGLTSFLQTKAIPNLFFAGQINGTTGYEEAAAQGIIAGMNAALQIKDQELWCPRRDEAYIGVLIDDLITCGTQEPYRMFTSRAEYRLLLREDNADLRLTEKGRQLGLVGDERWESFSKKREAIESTQALLHNSWVRVHHNDLFKEALLNPMQHDCRAAEFLKRPEINYQHLLMMDDL-NLPELPQEITEQIEIQNKYAGYIDRQQQEIEKLRKHENTMLPETLDYNDVVGLSSEVIQKLNRIKPTSLAQAGRISGVTPAALSLLLVHLKKSR 621
>gi|126176558|ref|YP_001052707.1| glucose inhibited division protein A [Shewanella baltica OS155] >gi|166200611|sp|A3DAS5|GIDA_SHEB5 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|125999763|gb|ABN63838.1| glucose inhibited division protein A [Shewanella baltica OS155] (629 aa)
Score = 1207, Expect = 3.1e-130, Identities = 268/596 (44%), Positives = 360/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FES  +++TTGTFL   IHIG +    G      +  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G +     S F        KQ  C++  TN K HEII   LD+S MYSG I G GPRYCPSIEDK+ RF DK  HQ+F+EPE  + + IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ LE+    L+ L        S L +      N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQPNLRIFQQAVDDLIVENHQVVGVVTQMGLAFESPAVVLTTGTFLSGKIHIGLENYSGGRAGDPPAIALANRLRELPIRVGRLKTGTPPRIDANTIDFSQMTEQKGDSPLPVMS-FMGDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFADKSSHQIFIEPEGLNTNEIYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIEYDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGKEAWCPRRDEAYLGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGRELGLVDDARWAAFSEKLESIELELQRLRGQWVHPNSPLIHALNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLEDPQAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGI 607
>gi|149117384|ref|ZP_01844077.1| glucose inhibited division protein A [Shewanella baltica OS223] >gi|146862533|gb|EDK48196.1| glucose inhibited division protein A [Shewanella baltica OS223] (629 aa)
Score = 1207, Expect = 3.2e-130, Identities = 268/596 (44%), Positives = 360/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FES  +++TTGTFL   IHIG +    G      +  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G +     S F        KQ  C++  TN K HEII   LD+S MYSG I G GPRYCPSIEDK+ RF DK  HQ+F+EPE  + + IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ LE+    L+ L        S L +      N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQPNLRIFQQAVDDLIVENHQVVGVVTQMGLAFESPAVVLTTGTFLSGKIHIGLENYSGGRAGDPPAIALANRLRELPIRVGRLKTGTPPRIDANTIDFSQMAEQKGDSPLPVMS-FMGDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFADKSSHQIFIEPEGLNTNEIYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIEYDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGKEAWCPRRDEAYLGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGRELGLVDDARWAAFSEKLESIELELQRLRGQWVHPNSPLIHALNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLEDPQAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGI 607
>gi|115442371|ref|NP_001045465.1| Os01g0960300 [Oryza sativa (japonica cultivar-group)] >gi|57900292|dbj|BAD87125.1| putative glucose inhibited division protein A [Oryza sativa Japonica Group] >gi|113534996|dbj|BAF07379.1| Os01g0960300 [Oryza sativa (japonica cultivar-group)] (717 aa)
Score = 1207, Expect = 3.3e-130, Identities = 246/613 (40%), Positives = 373/613 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           ++YD +V+G GHAG EAA   A+   +  L  L+   +   PCNP++GGPAK  +  E+DALGG     AD   LQ ++LNSSKG    ALRAQ DK EY+      +E  +  +L  +E  + + +   N  V GV T     F +  +++TTGTF+   I +G   +  G    + S+ L + +++L F+T RLKTGTPPRI + ++++S L+ + G  +   FS FD +F     Q  CYL  T  + H+I+ +NLD++  Y G++   GPRYCP+IEDK+VRF DKE HQ+F+EPE + +  +YL G S+ LPE +Q  +V+ + G EN V+ + AYA+EYD +   Q   +L TKK +GLFF+GQINGT+GYEEAA QG+++GIN     + +  ++L+R  +YIG LI+DL+ K++ +PYR+LTSR+E+RL LR DNAD RL   G ++GLI    W+ Y           + L+++ +        V        K ++TL  ILK+P   +  ++        L    K+ V+I IKY G+I  QQ  +    N ++ KL    DY  + N+SLEAR+KL+KV+P T+GQASR+ G++  D+  + +++E+ ++
  S:    66 ERYDVIVVGGGHAGCEAALASARLGARTLLLTLNIDRIAWQPCNPAVGGPAKSQLVHEVDALGGEMGKIADRCYLQKRVLNSSKGPAVRALRAQTDKREYAVEMKKVVESTQ--NLFIREAMATEVMIGQNDNVEGVRTFFGMDFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQQLGFETDRLKTGTPPRIDRRTVNFSGLEPQHGDEEVGWFS-FDPEFHIERDQMCCYLTRTTKETHQIVRDNLDETPTYGGWVEAKGPRYCPAIEDKIVRFKDKESHQVFLEPEGRDVPELYLQGFSTGLPERLQLSLVRTLPGLENCVMLRPAYAVEYDYLPAYQCSRSLMTKKFEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKPLIILERESSYIGTLIDDLVTKDLREPYRMLTSRSEHRLLLRADNADSRLTPLGRDIGLIDDRRWELYQSKQARIKEEKERLKSTKIPGGEFAAAVTSVSNQPVKESSTLEAILKKPHVQYKLLDKHGYGNEHLSRIEKECVEIDIKYEGFIARQQSQLQQIVNQEHKKLPEDLDYHSMTNLSLEAREKLSKVRPQTIGQASRIGGVSPADMTVLLIWMESNRR 684
>gi|167455272|ref|ZP_02321495.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Listeria monocytogenes FSL J2-064] (607 aa)
Score = 1206, Expect = 3.5e-130, Identities = 251/575 (43%), Positives = 362/575 (62%)
  Q:     8 VIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFD--RKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNK 582
           V+GAGHAG+EA     +   K  +  ++  +V  MPCNPS+GGPAKG+V REIDALGG      D T +QM++LN+ KG    ALRAQ DK +Y     + IE+ E I L    V+ +  +   VC GV T     + +  +++TTGTF    I +G      GP++   S  L++ ++EL F   R KTGTPPR+  ++IDYSK + +PG +   +FS FD     LD   Q  C+L +TN   HEII  NL +S M++    GTG RYCPSIEDK+VRF+DK RHQ+F+EPE K+ + +Y+ GLS+SLPE+VQ ++++ I G EN  + +  YAIEYDA+ P QL+P+LETK ++GLF AGQINGTSGYEEAA QGLMAGIN   ++  +EP++L R++AYIGVLI+DL+ K   +PYRLLTSRAEYRL LR+DNAD RL + G+E+GLIS   ++ +           + L+ + +K        +KE      K      ++L+RP+ ++  +   +  +  + +   ++V+I IKY GYI+     +   K +++ K+    DY  +  ++ EA +KL +
  S:     1 VVGAGHAGVEAGLASGRMGAKTLMLTINLDMVAFMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKWDYQHEMKHTIEKEENITLRQGLVDRL-VIEDGVCKGVITNSGAIYYAKTVVITTGTFSRGEIIVGELRYSSGPNNQQPSVKLSEHLEELGFGLRRFKTGTPPRVKSSTIDYSKTEEQPGDDHPRAFS-FDTVEMLLD---QLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSIEDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRVGYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEKEPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGLISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRPEITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDYDAISGLATEALEKLKE 580
>gi|160877619|ref|YP_001556935.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella baltica OS195] >gi|189039356|sp|A9KX17|GIDA_SHEB9 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|160863141|gb|ABX51675.1| glucose inhibited division protein A [Shewanella baltica OS195] (629 aa)
Score = 1206, Expect = 3.8e-130, Identities = 268/596 (44%), Positives = 359/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FES  +++TTGTFL   IHIG +    G      +  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G +     S F        KQ  C++  TN K HEII   LD+S MYSG I G GPRYCPSIEDK+ RF DK  HQ+F+EPE  +   IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ LE+    L+ L        S L +      N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQPNLRIFQQAVDDLIVENHQVVGVVTQMGLAFESPAVVLTTGTFLSGKIHIGLENYSGGRAGDPPAIALANRLRELPIRVGRLKTGTPPRIDANTIDFSQMAEQKGDSPLPVMS-FMGDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFADKSSHQIFIEPEGLNTSEIYPNGISTSLPFDVQLNLVRSIKGMENAEIMRPGYAIEYDYFDPRDLKNSLETKAINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGKEAWCPRRDEAYLGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGRELGLVDDARWAAFSEKLESIELELQRLRGQWVHPNSPLIHALNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLEDPQAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLTLDYKEVPGLSNEVIAKLNNHKPETIGQASRISGI 607
>gi|113972263|ref|YP_736056.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella sp. MR-4] >gi|114049512|ref|YP_740062.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella sp. MR-7] >gi|123129966|sp|Q0HD68|GIDA_SHESM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|123325561|sp|Q0HPF0|GIDA_SHESR tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|113886947|gb|ABI40999.1| glucose inhibited division protein A [Shewanella sp. MR-4] >gi|113890954|gb|ABI45005.1| glucose inhibited division protein A [Shewanella sp. MR-7] (629 aa)
Score = 1206, Expect = 4.0e-130, Identities = 267/596 (44%), Positives = 360/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET------STLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FE+  +++T GTFL   IHIG +    G      S  LA +++EL  +  RLKTGTPPRI  N+ID++++  + G       S F        KQ  C++  TN K H+II   LD+S MYSG I G GPRYCPSIEDK+ RF+DK  HQ+F+EPE  + + IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAYIGVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ LE+    L+ L +      S L  V     N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQPNLRIFQQAVDDLVVENDRVVGVITQMGLAFEAPAVVLTAGTFLSGKIHIGLENYSGGRAGDPPSIALAHRLRELPIRVGRLKTGTPPRIDANTIDFTQMTEQKGDTPLPVMS-FMGDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFSDKSSHQIFIEPEGLNTNEIYPNGISTSLPFDVQLNLVRSIQGMENAEIVRPGYAIEYDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNAALQVQGKEAWCPRRDEAYIGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADLRLTAKGRELGLVDDARWASFSEKLESIELELQRLRSQWIHPNSPLVPVLNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLADPLAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGI 607
>gi|161505600|ref|YP_001572712.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189039354|sp|A9MJQ9|GIDA_SALAR tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|160866947|gb|ABX23570.1| hypothetical protein SARI_03776 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (629 aa)
Score = 1206, Expect = 4.1e-130, Identities = 256/594 (43%), Positives = 357/594 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLY-------EILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +D ++IG GHAG EAA   A+   +  L   +   +G M CNP+IGG  KG + +E+DALGG+ A A D   +Q ++LN+SKG    A RAQ D++ Y +     +E    + L  + V  +   N +V G  T     F +  +++T GTFLD  IHIG      G      S  L+++++EL  +  RLKTGTPPRI   +ID+S L  + G N    FS F        +Q  CY+  TN K H++I NNLD+S MY+G I G GPRYCPSIEDKV+RF+D+ +HQ+F+EPE    + IY  G+S+SLP DVQ QIV+++ G ENA I +  YAIEYD  +P  L PTLE+K I+GLFFAGQINGT+GYEEAA QGL+AG+N      ++E     R++AY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL + G +LGL+    W  +N+ LEN     + L+++ +    EF  +     TT         ++L+RP+ ++  +         L DE   ++V+I +KY GYI  QQ  I      +N  L +  DY+ V  +S E   KLN  KP ++GQASR+SG+
  S:     7 FDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAAAIDRAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMLFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPSIPLSRRLRELPLRVSRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFS-FMGNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFSDRNQHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRDLGLVDDERWARFNEKLENIERERQRLKSTWVTPSAEFAADVNAHLTTPLSREASGEDLLRRPEMTYAQLTSLSAFAPALEDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRLVSGLSNEVIAKLNDHKPASIGQASRISGV 607
>gi|56461730|ref|YP_157011.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Idiomarina loihiensis L2TR] >gi|81170548|sp|Q5QZI8|GIDA_IDILO tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|56180740|gb|AAV83462.1| NAD/FAD-utilizing enzyme apparently involved in cell division [Idiomarina loihiensis L2TR] (631 aa)
Score = 1206, Expect = 4.2e-130, Identities = 260/596 (43%), Positives = 361/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS-------TLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG+ A AAD   +Q + LNSSKG    A RAQ D+  Y +     +E    + +  +  + +   N +V GV T     F +  +++T GTFL   IHIG    + G      S  LAK+++ L  +  RLKTGTPPRI  +S+D+S +Q +PG N    FS+   +  D  +Q  CY+  TN   HEII + LD+S MYSG I G GPRYCPSIEDK+VRF DK  HQ+FVEPE  +   IY  G+S+SLP DVQ+++V++I GFENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q +++E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL + G  LGL+    W  +NK +E+     + L+T+       +++ +     +      +  E+L+RP+  + D+       P L+     D    ++V+I IKY GYI  QQ+ I   +  +N  L S  DY  +  +S E   KLN  +P T+G+A+R+SGI
  S:     7 QHFDVIVVGGGHAGTEAALAAARLGVKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGVMAKAADKAGIQFRTLNSSKGPAVRATRAQADRQLYKQAIRYALETQPNLSIFQQGCDDLIVENDRVTGVVTQMGLKFTAKTVVLTVGTFLGGQIHIGLDNYQGGRAGDPPSNALAKRLRALPLRVERLKTGTPPRIASHSVDFSVMQEQPGDNPTPVFSYMGSRS-DHPQQIPCYITHTNENTHEIIRSGLDRSPMYSGVIEGVGPRYCPSIEDKIVRFADKGSHQIFVEPEGLNTFEIYPNGISTSLPFDVQQRLVQSIKGFENAHITRPGYAIEYDYFDPRDLKQSLETKVINGLFFAGQINGTTGYEEAGAQGLIAGLNAALQAQDKESWAPRRDQAYMGVLIDDLSTLGTQEPYRMFTSRAEYRLLLREDNADMRLTEIGRNLGLVDDERWAAFNKKMESVEQEKQRLKTTWVHKDHASVEQINALVKSPVTKEVSGEELLRRPEIHYKDLALTDFFAPGLE-----DPLAAEQVEIQIKYAGYITRQQEEIAKQQRHENTLLPSPFDYAKIKGLSNEVVAKLNDHQPETVGKAARISGI 609
>gi|189499008|ref|YP_001958478.1| glucose inhibited division protein A [Chlorobium phaeobacteroides BS1] >gi|189494449|gb|ACE02997.1| glucose inhibited division protein A [Chlorobium phaeobacteroides BS1] (623 aa)
Score = 1206, Expect = 4.4e-130, Identities = 262/602 (43%), Positives = 370/602 (61%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVC-GVYTVDNQFFESNYLIVTTGTFLDSSIHIGH------KVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-VKEFKYNSRKTNTTLYE--------------ILKRPDYSFIDM-EPFLKNKNTLDEYWKD-----KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDL 602
           M  YD +V GAGHAG EAA   A+   K  L   D   +  M CNP+IGG AKG +TREIDALGG    A D T +Q ++LN SKG    + RAQ D+  YS +    IE+   IDL+   V  I   NQ  C G      +  E+  +I++ GTFL+  IHIG       + I + P    G   L + +  L F+  RLKTGTPPRI + S+DY+++ ++PG      FS F  + L   KQ  C+L  T    H I+    ++S ++SG + G GPRYCPSIEDK+ RF +K  H +F+EPE    + +Y+ G S+SLPED+Q + +++I G EN ++ +  YAIEYD   P QL+PTLETK+IK L+FAGQINGTSGYEEAA QG+MAGIN    +  +EPL+LKR+EAYIGVLI+DLI KE  +PYR+ TS AE+R+ LR DNAD RL+ +GY  GL+S++ +    +NLE     +K    +++K  +   +  S   N  L E              ILKRP  +   +   F +  + + E  +D     +V+I  KY GYI+ ++ +      +D+ ++ +  +Y  +  +S E ++KL+KVKP T+GQASR+ G+   D+
  S:     1 MNIYDLIVAGAGHAGCEAALAGARMGLKCLLITSDFSAIARMSCNPAIGGVAKGQITREIDALGGEMGKAIDATGIQFRMLNRSKGPAMHSPRAQADRTNYSAYMRKIIEQETNIDLLQDSVIRIA-TNQGTCNGAIVSSGRTIEAKAVILSCGTFLNGLIHIGMNHYPGGRTIAEPP--VQG---LTESLASLGFEHGRLKTGTPPRIDQRSVDYARVSVQPGDRDPSPFS-FSTESLAGRKQVECFLTATTENTHRILQEGFERSPLFSGKVQGVGPRYCPSIEDKIHRFREKNSHHIFLEPEGFETNEMYVNGFSTSLPEDIQLKGLRSIPGLENVIMMRPGYAIEYDYFYPFQLHPTLETKRIKNLYFAGQINGTSGYEEAAAQGIMAGINAALNIRQKEPLILKRSEAYIGVLIDDLITKETNEPYRMFTSSAEHRIILRQDNADLRLMPFGYACGLLSENTY----RNLE-----IKRRNIASVKELISSIRVASDSINALLAEQGSPSISGSTRIATILKRPKITLSSLVNAFPEVADQISEVTQDNTVLEQVEIDCKYEGYIQRERLMAEKIARLDSHRIPASFNYSALKGLSNEGKEKLSKVKPSTVGQASRILGVTPADI 614
>gi|115350140|ref|YP_771979.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Burkholderia ambifaria AMMD] >gi|122324420|sp|Q0BJM8|GIDA_BURCM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|115280128|gb|ABI85645.1| glucose inhibited division protein A [Burkholderia ambifaria AMMD] (656 aa)
Score = 1205, Expect = 5.0e-130, Identities = 250/595 (42%), Positives = 358/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSF-----------IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   SID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+++ +       +        +     +L E+L+RP  S+              EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKLDEQPGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPPEEATALLGKAIDHEYSLAELLRRPGISYDGVCSLKGGECAPTEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|145637945|ref|ZP_01793586.1| glucose-inhibited division protein A [Haemophilus influenzae PittHH] >gi|145268859|gb|EDK08821.1| glucose-inhibited division protein A [Haemophilus influenzae PittHH] (629 aa)
Score = 1205, Expect = 5.4e-130, Identities = 261/614 (42%), Positives = 363/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G E A I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ +E    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI  + W  +NK +EN     + L    L    E+   + K          +  ++L+RP+ ++  +      K  + D+   ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEAIDILIEQDRVTGVSTKMGLIFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILTKQHGDEVLPVFS-FMGSVEDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFADRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLEKARIIKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKEAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDDARWARFNKKMENIEQERQRLRNIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|170699462|ref|ZP_02890505.1| glucose inhibited division protein A [Burkholderia ambifaria IOP40-10] >gi|170135611|gb|EDT03896.1| glucose inhibited division protein A [Burkholderia ambifaria IOP40-10] (656 aa)
Score = 1205, Expect = 5.5e-130, Identities = 250/595 (42%), Positives = 359/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   SID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+++ +       +        +     +L E+L+RP  S+  +           EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKLDEQPGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPPEEATALLGKAIDHEYSLAELLRRPGISYDGVCGLKGGECGPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|124547724|ref|ZP_01706570.1| glucose inhibited division protein A [Shewanella putrefaciens 200] >gi|124508988|gb|EAY53074.1| glucose inhibited division protein A [Shewanella putrefaciens 200] (629 aa)
Score = 1205, Expect = 5.8e-130, Identities = 267/596 (44%), Positives = 361/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FES  +++TTGTFL   IHIG +    G      +  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G +     S F        KQ  C++  TN K HEII   LD+S MYSG I G GPRYCPSIEDK+ RF+DK  HQ+F+EPE  +   IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N   Q++ ++    +R+EAY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ LE+    L+ L        S L +      N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SG+
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQANLRIFQQAVDDLIVENDRVVGVVTQMGLAFESPAIVLTTGTFLSGKIHIGLENYSGGRAGDPPAIALANRLRELPIRVGRLKTGTPPRIDANTIDFSQMAEQKGDSPLPVMS-FMGDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFSDKSSHQIFIEPEGLNTTEIYPNGISTSLPFDVQLNLVRSIKGMENAEIVRPGYAIEYDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAAAQGLLAGMNASLQVQGKDAWCPRRDEAYLGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGRELGLVDDTRWAAFSEKLESIELELQRLRAQWVHPNSPLIHALNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLEDPLAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLHLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGV 607
>gi|19705044|ref|NP_602539.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22095722|sp|Q8RI88|GIDA2_FUSNN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA 2 (Glucose-inhibited division protein A 2) >gi|19712960|gb|AAL93838.1| Glucose inhibited division protein A [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (633 aa)
Score = 1204, Expect = 6.9e-130, Identities = 266/610 (43%), Positives = 381/610 (62%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTV----DNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNK---KYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL----KNVKEFKY----NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKD-----KVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           M+++D +V+G GHAG EAA   A+   K A+F +    +G M CNPS+GGPAK  + REIDALGG      D T +Q+++LN+ KG    +LRAQ DK+ Y+      +E  + + +I   V+ +    +    +       +   +++  +I+ TGTFL   IHIG      G      S  L   ++++  +  R KTGTP RI   +IDYS L+ +PG      K+S    D   L   +Q  CY+A TN K+HEII N  ++S +++G I G GPRYCPSIEDK+ R+ DK +H LF+E E    + IYLGGLSSSLP DVQE+++KNI GFENA I +YAYAIEYD + P ++  TLE++ ++ LF AGQINGTSGYEEA  QGLMAGIN + +L N EP++L R ++YIG LI+DL++K   +PYR+ T+R+EYRL LR DNAD RL K GYELGL+ +  +    K  ++     + L  + +      V E       N  K  +TL E+L+RP+ SF D++   +    +D    D     +V+I +KY GYI    K+I   K+++N K+    DY D+  I  EA+DKL ++KP+ +GQASR+SG++  D+  I +YL+
  S:     1 MQEFDIIVVGGGHAGCEAALASARMGMKTAIFTISLDTIGVMSCNPSLGGPAKSHLAREIDALGGEMGRNIDKTFIQIRVLNTRKGPAVRSLRAQADKMAYANEMKKTLEHTDNLSVIQGMVSELVVEEENGKKIIKGIKIREGLEYKAKAVIIATGTFLRGLIHIGEINFSAGRMGELSSEELPLSLEKIGLKLERFKTGTPTRIDGRTIDYSVLEEQPGDKSQVLKFSNRTKDEDALS-RRQISCYIAHTNEKVHEIIRNAKERSPLFNGTIQGLGPRYCPSIEDKIFRYPDKNQHHLFLEREGYETNEIYLGGLSSSLPVDVQEEMLKNIKGFENAKIMRYAYAIEYDYVPPEEIKYTLESRTVENLFLAGQINGTSGYEEAGAQGLMAGINAVRKLRNEEPVILDRADSYIGTLIDDLVSKGTNEPYRMFTARSEYRLYLREDNADLRLTKLGYELGLVPEEEYQRVEKKRKDVKIITEILAKTNVGPSNPRVNEILLKRGENPIKDGSTLLELLRRPEVSFEDIKYISEEIRGIDLQGYDHDTTYQVEITVKYEGYINRALKMIEKHKSMENKKIPVDIDYDDLKTIPKEAKDKLKRIKPINIGQASRISGVSPADIQAILIYLK 629
>gi|117918461|ref|YP_867653.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella sp. ANA-3] >gi|166200615|sp|A0KR28|GIDA_SHESA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|117610793|gb|ABK46247.1| glucose inhibited division protein A [Shewanella sp. ANA-3] (629 aa)
Score = 1204, Expect = 6.9e-130, Identities = 266/596 (44%), Positives = 360/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET------STLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FE+  +++T GTFL   IHIG +    G      S  LA +++EL  +  RLKTGTPPRI  N+ID++++  + G       S F        KQ  C++  TN K H+II   LD+S MYSG I G GPRYCPSIEDK+ RF+DK  HQ+F+EPE  + + IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAYIGVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ +E+    L+ L +      S L  V     N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQANLRIFQQAVDDLVVDNDRVVGVVTQMGLAFEAPAVVLTAGTFLSGKIHIGLENYSGGRAGDPPSIALAHRLRELPIRVGRLKTGTPPRIDANTIDFTQMTEQKGDTPLPVMS-FMGDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFSDKSSHQIFIEPEGLNTNEIYPNGISTSLPFDVQLNLVRSIQGMENAEIVRPGYAIEYDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNAALQVQGKEAWCPRRDEAYIGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADLRLTAKGRELGLVDDARWASFSEKMESIELELQRLRSQWIHPNSPLVPVLNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLADPLAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGI 607
>gi|170731465|ref|YP_001763412.1| glucose inhibited division protein A [Burkholderia cenocepacia MC0-3] >gi|169814707|gb|ACA89290.1| glucose inhibited division protein A [Burkholderia cenocepacia MC0-3] (656 aa)
Score = 1204, Expect = 7.1e-130, Identities = 253/595 (42%), Positives = 359/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE--------------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   +ID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE       Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+              T+ L    E +Y       +L E+L+RP  S+  +           EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTHEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPAEEATALLGKAIEHEY-------SLAELLRRPGVSYDGVCGLKGGECGPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|145633461|ref|ZP_01789190.1| glucose-inhibited division protein A [Haemophilus influenzae 3655] >gi|144985830|gb|EDJ92438.1| glucose-inhibited division protein A [Haemophilus influenzae 3655] (629 aa)
Score = 1203, Expect = 7.9e-130, Identities = 260/614 (42%), Positives = 363/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G E A I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ +E    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI ++ W  +N+ +EN     + L +  L    E+   + K          +  ++L+RP+ ++  +      K  + D    ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLIFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSYRLRDLGLRVDRLKTGTPPRIDARTINFDILAKQHGDAVLPVFS-FMGSVSDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGVGPRYCPSIEDKVMRFADRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLEKARIIKPGYAIEYDYFDPRDLKPTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKEAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDEARWARFNQKMENIELERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAIEDREAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|149190485|ref|ZP_01868756.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio shilonii AK1] >gi|148835739|gb|EDL52705.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio shilonii AK1] (631 aa)
Score = 1203, Expect = 8.0e-130, Identities = 259/611 (42%), Positives = 364/611 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK---------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENK 612
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  N +E    + L  + V+ +     +V GV T     F S  +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   S+D+S L+++ G N    FS    +      Q  C++  TN   HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T ETK I GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL ++ + LGLI +  W  +N+ L N     + L+ + +          NV      SR+ +    ++L+RP+ ++  +         + D+   ++V+I +KY GYI+ QQ  I  +   +N K+ +  DY DV  +S E   KL + KP T+G ASR+SGI    +  + +YL+ +
  S:     5 ETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRNALENTPNLTLFQQSVDDLIVEQDQVRGVVTEMGLKFHSRSVVLTVGTFLGGKIHIGMESSSGGRMGDQPSIALAARLRELPFRVDRLKTGTPPRIDARSVDFSALEVQHGDNPTPVFSFMGNRN-QHPTQIPCFITHTNESTHEVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFISGLFFAGQINGTTGYEEAAAQGLMAGLNASLYSQGKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEYRLLLREDNADIRLTEHAHNLGLIDEKRWSRFNEKLNNMATERQRLKETWVNPKSEGIEALNVLLKSPISREASGE--DLLRRPELNYSQLTSLDAFAPAMEDQQASEQVEIQVKYEGYIQRQQDEIAKSLRHENTKIPADLDYSDVKGLSNEVVAKLTEAKPETVGIASRISGITPAAISILLVYLKKQ 622
>gi|39998553|ref|NP_954504.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Geobacter sulfurreducens PCA] >gi|81170544|sp|Q746Q4|GIDA_GEOSL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|39985500|gb|AAR36854.1| glucose inhibited division protein A [Geobacter sulfurreducens PCA] (627 aa)
Score = 1203, Expect = 8.2e-130, Identities = 258/596 (43%), Positives = 365/596 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           K+YD +V GAGHAG EAA   A+   +  L  ++   +  M CNP+IGG AKG + +EIDALGG      D T +Q ++LN+ KG    A RAQ DK  Y     + +EE E++ L   EV  +   + +V GV T     F    +I+TTGTF+   IH+G      G      S  L+ Q+++L F   RLKTGTP R+  N+ID+S+L+ + G +    FS F  + +D   Q  CY+A+TN + HEII + LD+S +YSG I G GPRYCPSIEDKV+RF DK+RHQ F+EPE +     Y  GLS+SLP D+Q ++ ++I G EN  I + AYAIEYD ++PIQL+ +LETK I+ L+ AGQINGTSGYEEAA QGLMAGIN   +++  EPLVL R+EAYIGV+I+DL+     +PYR+ TSRAEYRL LR DNAD RL + G+ +GL+    +  + +  E     L+ L T+ L         ++ +     +   T  ++L+RPD ++ ++         +    K++V+I IKY GYI+ Q   +   + ++  ++    DY  +P +S E R+KL +  P TLGQASR+ G+
  S:     8 KQYDVIVAGAGHAGCEAALAAARMGCETLLLTINLDAIALMSCNPAIGGLAKGHLVKEIDALGGEMGKNIDATGIQYRILNTRKGPAVRASRAQADKQLYRLRMKHVMEEQEHLSLKQGEVTGLVVEDGRVRGVVTKVGVRFLGKTVILTTGTFMRGLIHVGLTNYPGGRAGDLPSVGLSDQLRDLGFTVGRLKTGTPARLDGNTIDFSRLEPQYGDDPPVPFS-FSTERID-RPQLPCYIAYTNERTHEIIRSGLDRSPLYSGVIEGVGPRYCPSIEDKVMRFPDKDRHQSFLEPEGRDTVEYYPSGLSTSLPIDIQYRLYRSIEGLENVEIMRPAYAIEYDYVDPIQLHTSLETKLIRNLYHAGQINGTSGYEEAAGQGLMAGINAALRVQGEEPLVLGRDEAYIGVMIDDLVTLGTREPYRMFTSRAEYRLLLREDNADLRLRERGHAVGLVRDEEYRLFLEKRERIGAELERLRTAKLLPSEADPSFLETYGMTDLRNALTFEQLLRRPDITYEELSQIDPVAGMVPPSVKEQVEIQIKYQGYIERQLDQVARARKLEGTRIPDDLDYTVIPGLSAEVREKLLRFLPDTLGQASRIQGV 608
>gi|78780152|ref|YP_398264.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Prochlorococcus marinus str. MIT 9312] >gi|78713651|gb|ABB50828.1| glucose inhibited division protein A [Prochlorococcus marinus str. MIT 9312] (662 aa)
Score = 1203, Expect = 8.9e-130, Identities = 254/609 (41%), Positives = 373/609 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEV-------------NSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSR-------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + +D +VIG GHAG EAA   AK  +  ALF ++   +   PCNP++GGPAK  +  E+DALGG+    AD T +Q ++LN+SKG   WALRAQ DK EYSK  +  ++  + + L +  +             NS K V +++ GV T    ++ +  +I+T GTFL+  I IG+K +  G      +  L K + E+  +T RLKTGTP R+ K SI + +L  +P T     FS FD    +   Q  C++  T  K H++I +NL  + +Y GFI   GPRYCPSIEDK+V+F DKE HQ+F+EPE  +   IY+ G S+ LPE++Q ++++ + G     + + AYA+EYD I   QL  +LETK+I+ LF AGQINGT+GYEEAA QGL+AG+N   +L  ++P++  R  +YIG +I DLI K++ +PYR+LTSR+EYRL LR DNAD+RL   GY++GLI +  W  Y + +         L  + LKN  E   N         K +TTL E+LKRP++ + D+  +   +  L    ++ V+I IKY GY+K Q+  I          L    +Y+ +  +SLEAR+ LNK+KP   G AS++ G++  DL  + ++L+
  S:     9 ESFDIVVIGGGHAGCEAAITSAKLGFSTALFTINLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADKTAIQKRILNASKGPAVWALRAQTDKREYSKKMIEILQNTDNLSLKEAMITELDIAKTEEIGLNSKKIVKKRIKGVRTFFGSYYSARSVIITAGTFLEGRIWIGNKSMSAGRSGEQAAKGLTKNLHEIGIKTERLKTGTPARVDKRSIIFDELDAQPSTAADKYFS-FDPNIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYGGFIDSKGPRYCPSIEDKIVKFADKESHQIFLEPEGINTPEIYVQGFSTGLPENIQLELLRTLPGLSECKMLRPAYAVEYDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLNEKDPIIFTRESSYIGTMINDLITKDLKEPYRVLTSRSEYRLTLRGDNADRRLTPLGYQIGLIDEKRWWAYQEKMNLLEEEKLRLNNTRLKNTDEISKNIELDTGSKIKGSTTLKELLKRPNFHYSDLIKYNLTEKNLGSSIQEGVEIDIKYEGYLKRQKNNIEQINRQSCKSLPQEINYEKIDTLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLK 636
>gi|154483916|ref|ZP_02026364.1| hypothetical protein EUBVEN_01622 [Eubacterium ventriosum ATCC 27560] >gi|149735407|gb|EDM51293.1| hypothetical protein EUBVEN_01622 [Eubacterium ventriosum ATCC 27560] (626 aa)
Score = 1203, Expect = 9.3e-130, Identities = 265/613 (43%), Positives = 379/613 (61%)
  Q:     1 MKKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEV-CYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKK 613
           ++ YD +++GAGHAG EAA   A+      +F +    +  MPCNP+IGG +KG + RE+DALGG      D T +Q K+LN SKG    +LRAQ DK +Y++     +E  E + +   EV  +   +  + GV TV    + +  +++ TG +L +    G      GP+    +  L   + E   +  R KTGTP R+ K SID+SK++ + G  +   FS F        K ++ C+L +TN K HEII  N+++S ++SG I GTGPRYCPSIEDKVV+F DK RHQ+F+EPE    + +YLGG+SSSLPEDVQ  + K + G EN  I + AYAIEYD I   QL P LE KKIKGLF AGQ NG+SGYEEAA QG++AGIN    ++N+E +VL R++AYIGVLI+DL+ KE  +PYR++TSRAEYRL LR DNAD RL K GYE+GL+ Q  ++   +  +     ++ LE   +   KE +         + KT TTL E+++RP+  +  ++P  K +  L+    ++V+I IKY GYI  Q+K + + K I+N K+    DY  V ++  EA  KL   +P+ +GQASR+SG++  D+  + +Y+E  K
  S:     5 VENYDVVIVGAGHAGCEAALASARLGLNTIVFTVSVDSIALMPCNPNIGGTSKGHLVRELDALGGEMGKNIDKTFIQSKMLNKSKGPAVHSLRAQADKQDYTREMRKTLENTENLTIRQAEVAKLLVEDGVIKGVETVSGATYYAKSVVLATGVYLKAKCIYGDVCQYTGPNGLMAANNLTASLIENGIKVRRFKTGTPARVDKKSIDFSKMEEQFGDERVVPFS-FSTDPESVQKDQISCWLTYTNEKTHEIIRENINRSPLFSGMIEGTGPRYCPSIEDKVVKFADKNRHQVFIEPEGLFTNEMYLGGMSSSLPEDVQYAMYKTVPGLENVKIVRNAYAIEYDCIEYGQLLPNLEFKKIKGLFSAGQFNGSSGYEEAAAQGIIAGINAARYVQNKESIVLDRSQAYIGVLIDDLVTKESHEPYRMMTSRAEYRLLLRQDNADLRLTKIGYEVGLVPQERYNYVCEKEKMIEKEIERLENYKVGANKEVQSVLESLGSTTLKTATTLAELIRRPELDYDKIKPLDKERQPLNYDVIEQVNINIKYSGYISRQKKQVENFKKIENKKIPEGFDYTKVNSLRKEAVQKLEFYRPINIGQASRISGVSPADISVLLIYMEQHK 624
>gi|27364443|ref|NP_759971.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio vulnificus CMCP6] >gi|29611746|sp|Q8DDH9|GIDA_VIBVU tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|27360562|gb|AAO09498.1|AE016800_103 Glucose inhibited division protein A [Vibrio vulnificus CMCP6] (632 aa)
Score = 1203, Expect = 1.0e-129, Identities = 255/596 (42%), Positives = 360/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHF-DRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE-------TSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEY-WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  + +E    + L  + V+ +     +V GV T     F +  +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   S+D+S L+ + G N    FS   DR      +Q  C++  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T ETK I+GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAE+RL LR DNAD RL +   ELGL+  + W  +N+ ++N     + L+       ++ ++ + +   +      +  ++L+RP+ ++  +         LD+    ++V+I +KY GYIK QQ  I  +   ++ KL +  DY DV  +S E   KLN  KP TLG ASR+SGI
  S:     5 ETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRDFLENAPNLTLFQQAVDDLIVEQDQVRGVITQMGLKFHAKAVVLTVGTFLGGKIHIGLQSSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARSVDFSVLEAQHGDNPTPVFSFMGDRT--HHPRQIPCFITHTNEQTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFIQGLFFAGQINGTTGYEEAAAQGLMAGLNASLFSQEKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEHRLLLREDNADLRLTEKARELGLVDDARWARFNQKIDNMEQERQRLKSTWMNPASTGIEELNQLLKSPMNREASGEDLLRRPEMTYEQLTSLAAFAPALDDLEAAEQVEIQVKYEGYIKRQQDEIEKSLRHEHTKLPADLDYSDVKGLSNEVVLKLNTAKPETLGIASRISGI 607
>gi|52426409|ref|YP_089546.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Mannheimia succiniciproducens MBEL55E] >gi|81170554|sp|Q65PZ9|GIDA_MANSM tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|52308461|gb|AAU38961.1| GidA protein [Mannheimia succiniciproducens MBEL55E] (629 aa)
Score = 1202, Expect = 1.1e-129, Identities = 261/614 (42%), Positives = 368/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKEL-------ETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSF-----IDM-EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F++  +I+T GTFL   IHIG      G      S  LA ++++L+ +  RLKTGTPPR+   +I++  L  + G  +   FS F        +Q  C++  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+  HQ+++EPE      IY  G+S+SLP DVQ +IV ++VG E   I K  YAIEYD  +P  L PTLETK IKGLFFAGQINGT+GYEEAA QGL+AGIN    ++ +E    +R++AY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI ++ W  +N+ +EN     + L        +  L  + E   +      +  ++L+RP+ ++     +D+ +P + +K  +++     V+I +KY GYI+ QQ+ I   K  +N  +    DY  V  +S E R KL + +P+++GQASR+SG+       I + L N KKQ
  S:     5 ENYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDAMGGLMATAADQAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVKVALENQPNLDIFQQEATDILIEQDRVTGVATRMGLKFKTKSVILTAGTFLGGKIHIGLDNYTGGRAGDPASIALADRLRDLNLRVARLKTGTPPRLDARTINFDILAKQHGDAQLPVFS-FMGSVDQHPRQIPCFITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFADRNSHQIYLEPEGLTSQEIYPNGISTSLPFDVQMKIVNSMVGLEKTRIVKPGYAIEYDFFDPRDLKPTLETKAIKGLFFAGQINGTTGYEEAASQGLLAGINAGLFVQEKESWFPRRDQAYMGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADSRLTPIAHELGLIDENRWARFNQKMENIERERQRLRNIWIHPRSEHLDVINEVLSSPLVREASGEDLLRRPEINYQILTALDLFKPAMDDKEAVEQ-----VEIAVKYQGYIEHQQEEIEKQKRHENTAIPDNFDYTLVAGLSNEVRAKLEQHRPVSIGQASRISGVTPA---AISILLVNLKKQ 622
>gi|78064752|ref|YP_367521.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Burkholderia sp. 383] >gi|123569642|sp|Q39KY9|GIDA_BURS3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|77965497|gb|ABB06877.1| Glucose-inhibited division protein A subfamily [Burkholderia sp. 383] (656 aa)
Score = 1202, Expect = 1.2e-129, Identities = 249/595 (41%), Positives = 359/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   SID+S+L  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+++ +       +        +     +L E+L+RP  S+  +           EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRSIDFSQLTEQPGDLDPVPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDTRWDAFSRKRDAVSRETERLKSTWVTPKTLPPEEATALLGKAIDHEYSLAELLRRPGISYDGVCGLKGGECGPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|24376230|ref|NP_720274.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella oneidensis MR-1] >gi|81170576|sp|Q8E8A9|GIDA_SHEON tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|24351293|gb|AAN57717.1|AE015908_2 glucose-inhibited division protein A [Shewanella oneidensis MR-1] (629 aa)
Score = 1202, Expect = 1.3e-129, Identities = 267/596 (44%), Positives = 359/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELET------STLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ I   N  V GV T     FE++ +++T GTFL   IHIG +    G      S  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G       S F        KQ  C++  TN K H+II   LD+S MYSG I G GPRYCPSIEDK+ RF+DK  HQ+F+EPE    + IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEA  QGL+AG+N   Q++ +E    +R+EAYIGVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+  + W  +++ +E+    L+ L +      S L  V     N+  +   +  E+L+RP  DY+  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SGI
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNLDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQANLRIFQQAVDDIVVENDHVVGVVTQMGLAFEASAVVLTAGTFLSGKIHIGLENYSGGRAGDPPSIALAHRLRELPIRVGRLKTGTPPRIDANTIDFSQMTEQKGDTPLPVMS-FMGDVSHHPKQISCWITHTNEKTHDIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFSDKSSHQIFIEPEGLTTNEIYPNGISTSLPFDVQLNLVRSIKGMENAEIVRPGYAIEYDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGKEAWCPRRDEAYIGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADLRLTAKGRELGLVDDARWAAFSEKMESIELELQRLRSQWIHPNSPLVPVLNPHLNTPISREASFEELLRRPEMDYNKLMQIEGF--GPGLADPLAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLNLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGI 607
>gi|107024504|ref|YP_622831.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Burkholderia cenocepacia AU 1054] >gi|116688117|ref|YP_833740.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Burkholderia cenocepacia HI2424] >gi|123371037|sp|Q1BR97|GIDA_BURCA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166222913|sp|A0K2X0|GIDA_BURCH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|105894693|gb|ABF77858.1| glucose inhibited division protein A [Burkholderia cenocepacia AU 1054] >gi|116646206|gb|ABK06847.1| glucose inhibited division protein A [Burkholderia cenocepacia HI2424] (656 aa)
Score = 1202, Expect = 1.3e-129, Identities = 251/595 (42%), Positives = 356/595 (59%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKN-------LENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   +ID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE       Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++         E   +T    +T  ++        +     +L E+L+RP  S+  +           EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDLDPIPVFSFLGRADQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTHEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPVEEATALLGKAIDHEYSLAELLRRPGVSYDGVCGLKGGECGPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|171315838|ref|ZP_02905069.1| glucose inhibited division protein A [Burkholderia ambifaria MEX-5] >gi|171099027|gb|EDT43812.1| glucose inhibited division protein A [Burkholderia ambifaria MEX-5] (656 aa)
Score = 1201, Expect = 1.4e-129, Identities = 249/595 (41%), Positives = 357/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTL-------KNVKEFKYNSRKTNTTLYEILKRPDYSF-----------IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   SID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+++ +       +        +     +L E+L+RP   +              EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQSNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKLDEQPGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPPEEATALLGKAIDHEYSLAELLRRPGIGYDGVCGLKGGECAPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|33241285|ref|NP_876227.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|81170569|sp|Q7V9J7|GIDA_PROMA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|33238815|gb|AAQ00880.1| NAD/FAD-utilizing enzyme apparently [Prochlorococcus marinus subsp. marinus str. CCMP1375] (667 aa)
Score = 1201, Expect = 1.4e-129, Identities = 255/615 (41%), Positives = 388/615 (63%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQ----------------KVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN-------VKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNK---NTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           +K+D +V+G GHAG EAA   AK     ALF L+   +   PCNP++GGPAK  +  E+DALGG+    AD+T LQ ++LN+S+G   WALRAQ DK +YS   L  ++E   + L +  V  ++  +                 +V G+ T     + +  +I+TTGTFL   I IG++ +  G      +  L + +++L F+T RLKTGTPPR+ + +ID   L+ E  ++    F  FD +     +Q  CY+  T  K H++I NNL  + +Y GFI   GPRYCPSIEDK+VRF+DKE HQ+F+EPE ++   IY+ GLS+ LPE +Q Q+++ + G +N V+ + AYA+EYD +   QL  +LETKKI+GLF AGQ+NGT+GYEEAA QGL+AG+N    + N++ ++  R E+YIG +I+DLI K++ +PYR+LTSR+EYRL LR DNAD+RL   GY++GL++   W+ +     N     K LE   +K+       +++    S K + TL  +L+RP    + M   +++K   N+L    ++ V+I IKY GY+K Q   I   K  +   L S  +Y ++  +S EAR+KLN  +P T G+AS++ G++  DL  + ++L+ + +++
  S:     9 EKFDVIVVGGGHAGCEAAIATAKLGLSTALFTLNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADSTALQKRILNASRGPAVWALRAQTDKRQYSIEMLQMLQETPNLSLREAMVTDLEIKSSPNRKKIKEQSEEKTIGQVQGIKTYFGSIYLAKAVILTTGTFLKGKIWIGNQSMDAGRAGEQAATGLTEALQKLGFETSRLKTGTPPRVDRRTIDLGSLE-EQKSDAADRFFSFDPERWKSGQQMSCYMTRTTQKTHQLIKNNLHLTPIYGGFINSKGPRYCPSIEDKIVRFSDKESHQIFLEPEGRNTPEIYIQGLSTGLPEGMQLQLLRTLPGLKNCVMLRPAYAVEYDYLPATQLLASLETKKIEGLFSAGQLNGTTGYEEAAAQGLVAGLNAARYVNNQDAIIFPREESYIGTMIDDLIKKDLREPYRVLTSRSEYRLILRGDNADRRLTPLGYKVGLVNDYQWNIFQIKQSNMEKEKKRLEQQRIKDSDPIALKIEKESGASIKGSITLANLLRRPG---MHMNNLIRHKLANNSLPLDVREGVEIDIKYSGYLKRQNLQIEQIKKQNKRALPSEVNYTNIKTLSQEAREKLNATQPKTFGEASQLPGVSKADLSALLIWLKIQNRKS 645
>gi|170766699|ref|ZP_02901152.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Escherichia albertii TW07627] >gi|170124137|gb|EDS93068.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Escherichia albertii TW07627] (629 aa)
Score = 1201, Expect = 1.5e-129, Identities = 256/594 (43%), Positives = 359/594 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKE--FKYNSRKTNTTLYE-----ILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +D ++IG GHAG EAA   A+   +  L   +   +G M CNP+IGG  KG + +E+DALGG+ A A D   +Q ++LN+SKG    A RAQ D++ Y +     +E    + +  + V  +   N +V G  T     F +  +++T GTFLD  IHIG      G      S  L+++++EL  +  RLKTGTPPRI   +ID+S L  + G N    FS F        +Q  CY+ +TN K H++I +NLD+S MY+G I G GPRYCPSIEDKV+RF D+ +HQ+F+EPE    + IY  G+S+SLP DVQ QIV+++ G ENA I +  YAIEYD  +P  L PTLE+K I+GLFFAGQINGT+GYEEAA QGL+AG+N      ++E     R++AY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL + G ELGL+    W  +N+ LEN     + L+++ +    E   + N+  T     E     +L+RP+ ++  +   +     L DE   ++V+I +KY GYI  QQ  I   +  +N  L +  DY+ V  +S E   KLN  KP ++GQASR+SGI
  S:     7 FDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPSIPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFS-FMGNVAQHPQQVPCYITYTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVRSMKGMENAKIVRPGYAIEYDFFDPRDLKPTLESKFIEGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEMGRELGLVDDERWARFNEKLENIERERQRLKSTWVTPSAEAAAEVNAHLTTPLSREASGEDLLRRPEMTYEKLTSLVPFAPALRDEQAAEQVEIQVKYEGYIARQQDEIEKQQRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGI 607
>gi|126697203|ref|YP_001092089.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Prochlorococcus marinus str. MIT 9301] >gi|126544246|gb|ABO18488.1| Glucose inhibited division protein A [Prochlorococcus marinus str. MIT 9301] (660 aa)
Score = 1201, Expect = 1.6e-129, Identities = 251/609 (41%), Positives = 376/609 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEV-------------NSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY-------NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + +D +VIG GHAG EAA   AK  +  ALF ++   +   PCNP++GGPAK  +  E+DALGG+    AD T +Q ++LN+S+G   WALRAQ DK EYSK  +  ++  + + L +  +             NS + V +++ GV T    ++ +  +I+T GTFL+  I IG+K +  G      +  L + + E+  +T RLKTGTP R+ K SI +  L I+P T     FS FD    +   Q  C++  T  K H++I +NL  + +Y GFI   GPRYCPSIEDK+V+F DKE HQ+F+EPE  +   IY+ G S+ LPE++Q ++++ + G     + + AYA+EYD I   QL  +LETK+I+ LF AGQINGT+GYEEAA QGL+AG+N   +L  ++P++  R  +YIG +I DLI K++ +PYR+LTSR+EYRL LR DNAD+RL + GY++GLI++  W  Y + ++        L  + LKN +E          +  K + TL E+LKRPD+ + D+  +   +  L    ++ V+I IKY GY+K Q+  I          L    +Y+ +  +SLEAR+ LNK+KP   G AS++ G++  DL  + ++L+
  S:     9 ESFDVIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSKKMIEILQNTDNLSLKEAMITELDIAKTEEIGLNSKRTVKKRIKGVRTFFGSYYSARSVIITAGTFLEGRIWIGNKSMSAGRSGEQAAKGLTENLHEIGIKTERLKTGTPARVDKRSIIFDDLDIQPSTAADKYFS-FDPDIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYGGFIDSKGPRYCPSIEDKIVKFADKESHQIFLEPEGINTPEIYVQGFSTGLPENIQLELLRTLPGLNECKMLRPAYAVEYDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLSKKDPIIFTRESSYIGTMINDLITKDLKEPYRVLTSRSEYRLTLRGDNADRRLTQLGYQIGLINEKRWSAYQEKMKLLEEEKFRLNKTRLKNTEEISKKIELETGSKIKGSITLKELLKRPDFHYSDLIKYNLTEKNLGSSIQEGVEIDIKYEGYLKRQKNNIEQINRQSCKSLPQEINYEKIETLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLK 636
>gi|120602377|ref|YP_966777.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166222930|sp|A1VD34|GIDA_DESVV tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|120562606|gb|ABM28350.1| glucose inhibited division protein A [Desulfovibrio vulgaris subsp. vulgaris DP4] (629 aa)
Score = 1201, Expect = 1.7e-129, Identities = 246/606 (40%), Positives = 361/606 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-NVKEFKYNSR------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           YDC+V+GAGHAG EAA  LA+  +   L   +   +G++ CNP+IGG AKG + +EIDALGGM  + AD   +Q + LNSSKG    A RAQID+  Y +     I     + +      SI     +  GV T   Q F ++++++TTGTFL   IH+G      G      +  L+  ++ +  +  RLKTGT PR+L++SID+S ++++P  +    FS F    +    Q  C++ +TN + HE I    D+S M++G I GTG RYCPSIEDKV RF +KERHQ+FVEPE       Y  G+ +SLP +VQ+ ++  I G ENA I +  YAIEYD  +P+QL  TLETK ++GL+ AGQINGTSGYEEAA QGL A +NV C L +  P +  R+ AY+ VL++DL+ K   +PYR+ TSRAE+RL LR +NAD RL + G  LGL+  +HW  ++      ++ L ELE   +  +       SR          +L +IL+RP  +  D+ PF +      +  +++ +  +KY GY+  QQ+++  +  +++  L    DY  +P ++ E  +KL KV+P TLGQA+R+SG+    L  +++ L
  S:    13 YDCIVVGAGHAGCEAAMALARMGHATLLLTGNADRIGHLSCNPAIGGLAKGHMVKEIDALGGMMGLWADEAGIQFRTLNSSKGPAVRATRAQIDRDAYLRVVRRDIFAQPNLRVWQDMAESIIVEGGRAAGVRTAYGQEFRAHHVLLTTGTFLQGRIHVGLNNFPGGRLGDAPATGLSASLRAIGLELGRLKTGTTPRLLRDSIDFSLMEVQPPDDPPRPFS-FRGPGVRL-PQLPCHVTWTNERTHEAIRAGFDRSPMFTGVIKGTGARYCPSIEDKVARFPEKERHQVFVEPEGLESPECYPNGIPTSLPLEVQKAMIATIPGLENAQIVRPGYAIEYDYADPVQLRSTLETKALRGLWLAGQINGTSGYEEAAAQGLWAALNVSCTLRSMPPFLPGRDTAYMAVLVDDLVTKGTREPYRMFTSRAEHRLLLRENNADARLTETGRALGLVDDTHWQRFSTKRAALHSLLDELENRRITPDAAARDIFSRLGEPAPTKGVSLADILRRPSLTLPDLAPFWEGVTRFADDVREEAETIVKYSGYLARQQELVARSARMEDTVLPEDMDYTVIPGLTREIVEKLGKVRPHTLGQAARISGVTPAALTCLEIQL 623
>gi|109900604|ref|YP_663859.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Pseudoalteromonas atlantica T6c] >gi|123063991|sp|Q15MT3|GIDA_PSEA6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|109702885|gb|ABG42805.1| glucose inhibited division protein A [Pseudoalteromonas atlantica T6c] (633 aa)
Score = 1201, Expect = 1.7e-129, Identities = 265/609 (43%), Positives = 369/609 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN------------VKEFKYNSRKTNTTLYEILKRPDYSF---IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +++D +V+G GHAG EAA   A+   K  L   + + +G M CNP+IGG  KG + +EIDALGG  A A D   +Q + LNSSKG    A RAQ D+  Y     + +E  + + L  +  + +   N +V GV T     F +  +++T GTFL  +IHIG +  K G      S  LA +++ L F+  RLKTGTP R+   ++DYS +Q + G +    FS F  K  D  +Q  CY+  TN+K H+II   LD+S MY+G I G GPRYCPSIEDK+ RF DK+ HQ+FVEPE  +   +Y  G+S+SLP DVQ ++V++I GFENA I +  YAIEYD  +P  L  TLETK IKGLFFAGQINGT+GYEEA  QGL+AG N   Q + ++PL+L+R+EAY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL   G+ELGL+ +  W  +N  LE       ELE   L++            +     N+     TL ++++RP+ ++   +++  F       D    ++V+I IKY GYI+ QQ  I  ++  +N  +    DY  +  +S E   KL+  KP TLG ASR+SGI    +  + +YL+
  S:     5 QQFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNVETLGQMSCNPAIGGIGKGHLVKEIDALGGSMAKAIDKGGIQFRTLNSSKGPAVRATRAQADRSLYRSAIRDIVEHQDNLTLFQQSCDDLIVENDQVTGVVTQMGLKFRAKSVVITVGTFLGGTIHIGMENYKGGRAGDPPSIALADRLRALPFRVSRLKTGTPARLDARTLDYSVMQEQLGDSPTPVFS-FMGKREDHPRQIACYITHTNSKTHDIIRGGLDRSPMYTGVIEGIGPRYCPSIEDKINRFADKDSHQIFVEPEGLNSIEVYPNGISTSLPFDVQFELVRSIKGFENAHIIRPGYAIEYDFFDPRDLKQTLETKFIKGLFFAGQINGTTGYEEAGAQGLIAGANASLQCQGKDPLILRRDEAYMGVLIDDLATMGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGHELGLVDEERWQAFNIKLEAI-----ELERQRLRDTWVHPKHAAAEALNPLLKNALSKENTLEDLIRRPEMTYETLMNVTEF--GPGITDPKAAEQVEIQIKYAGYIERQQDEIAKSRKNENTLIPLDFDYSQISGLSNEVVAKLSDAKPETLGLASRISGITPAAISLLLVYLK 620
>gi|120600846|ref|YP_965420.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella sp. W3-18-1] >gi|146295047|ref|YP_001185471.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Shewanella putrefaciens CN-32] >gi|166200614|sp|A4YCI9|GIDA_SHEPC tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|166200616|sp|A1RQC1|GIDA_SHESW tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|120560939|gb|ABM26866.1| glucose inhibited division protein A [Shewanella sp. W3-18-1] >gi|145566737|gb|ABP77672.1| glucose inhibited division protein A [Shewanella putrefaciens CN-32] (629 aa)
Score = 1201, Expect = 1.7e-129, Identities = 267/596 (44%), Positives = 360/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELE------TSTLKNVKEFKYNSRKT-NTTLYEILKRP--DYS-FIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +++D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +EIDALGG  AIA D   +Q + LNSSKG    A RAQ D+  Y +   N ++    + +  + V+ +   N +V GV T     FES  +++TTGTFL   IHIG +    G      +  LA +++EL  +  RLKTGTPPRI  N+ID+S++  + G +     S F        KQ  C++  TN K HEII   LD+S MYSG I G GPRYCPSIEDK+ RF+DK  HQ+F+EPE  +   IY  G+S+SLP DVQ  +V++I G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N   Q++ ++    +R+EAY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL   G ELGL+    W  +++ LE+    L+ L        S L +      N+  +   +  E+L+RP  DYS  + +E F       D    ++V I +KY GYI+ QQ+ IN     +N  L    DYK+VP +S E   KLN  KP T+GQASR+SG+
  S:     5 ERFDVIVVGGGHAGTEAALAAARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEIDALGGAMAIATDYAGIQFRTLNSSKGPAVRATRAQADRALYRQKIQNILQNQANLRIFQQAVDDLIVENDRVVGVVTQMGLAFESPAIVLTTGTFLSGKIHIGLENYSGGRAGDPPAIALANRLRELPIRVGRLKTGTPPRIDANTIDFSQMAEQKGDSPLPVMS-FMGDVSHHPKQISCWITHTNEKTHEIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKIHRFSDKSSHQIFIEPEGLNTTEIYPNGISTSLPFDVQLNLVRSIKGMENAEIVRPGYAIEYDYFDPRDLKNSLETKTINGLFFAGQINGTTGYEEAAAQGLLAGMNASLQVQGKDAWCPRRDEAYLGVLVDDLSTLGTKEPYRMFTSRAEYRLLLREDNADIRLTAKGRELGLVDDIRWAAFSEKLESIELELQRLRAQWVHPNSPLIHALNPHLNTPISREASFEELLRRPEMDYSKLMQIEGF--GPGLEDPLAAEQVQIQVKYSGYIQRQQEEINKAVRNENTGLPLHLDYKEVPGLSNEVIAKLNSHKPETIGQASRISGV 607
>gi|167587941|ref|ZP_02380329.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Burkholderia ubonensis Bu] (656 aa)
Score = 1200, Expect = 1.9e-129, Identities = 250/595 (42%), Positives = 354/595 (59%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-------NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   +ID+SKL+ +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G E A I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+    WD +       ++  E   +T    +T            +     +L E+L+RP  S+  +           EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGVKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVTLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLEEQPGDLDPIPVFSFLGRAEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLEQAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGVNAGLYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDVRWDAFCRKRDAVSRETERLKSTWVTPKTLPADEATALLGKAIDHEYSLAELLRRPGVSYDGVCGLKGGECGPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQANEIERNDANENTRLPEGIDYREVRGLSFEVSQKLNQFRPETIGQASRISGV 617
>gi|145640560|ref|ZP_01796144.1| glucose-inhibited division protein A [Haemophilus influenzae R3021] >gi|145275146|gb|EDK15008.1| glucose-inhibited division protein A [Haemophilus influenzae 22.4-21] (629 aa)
Score = 1200, Expect = 2.1e-129, Identities = 257/614 (41%), Positives = 367/614 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSF------IDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+  +K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNL++S MY+G I G GPRYCPSIEDKV+RF+D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G E A I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ ++    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI  + W  +N+ +EN     + L +  L    E+   + K          +  ++L+RP+ ++         +P ++++  +++     V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLIFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILDKQHGDAVLPVFS-FMGSVEDHPQQIPCYITHTNEQTHEVIRNNLNRSPMYTGVIEGIGPRYCPSIEDKVMRFSDRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLEKARIIKPGYAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKDAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDDARWARFNQKMENIEQERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYQPAMEDREAVEQ-----VEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|194557671|ref|YP_002092697.1| Glucose-inhibited division protein [Burkholderia cenocepacia PC184] >gi|124871462|gb|EAY63178.1| Glucose-inhibited division protein [Burkholderia cenocepacia PC184] (656 aa)
Score = 1200, Expect = 2.2e-129, Identities = 251/595 (42%), Positives = 360/595 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETS-----TLKNVKEFKYNSRKTN--TTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y     +R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   +ID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE       Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+  + WD +++  +  +   + L+++     TL   +      +  +   +L E+L+RP  S+  +           EP L +   L E  K++V+I IKY GYI+ Q   I      +N +L    DY++V  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRILYKAAIRHRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSSRLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDLDPIPVFSFLGRADQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTHEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDARWDAFSRKRDAVSRETERLKSTWVTPKTLPAEEATALLGKAIDHEYSLAELLRRPGVSYDGVCGLKGGECGPAEP-LADDPVLLEQIKEQVEIGIKYQGYIERQASEIERNDANENTRLPDGIDYREVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|194476846|ref|YP_002049025.1| glucose-inhibited division protein A [Paulinella chromatophora] >gi|171191853|gb|ACB42815.1| glucose-inhibited division protein A [Paulinella chromatophora] (638 aa)
Score = 1199, Expect = 2.4e-129, Identities = 255/615 (41%), Positives = 368/615 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQK------VCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYN--------SRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQT 616
           + ++ +V+G GHAG EAA   A+     ALF L+   +G  PCNP++GGPAK  +  E+DALGG+    AD T LQ ++LNSS+G   WALRAQ DK +Y+   L  ++    + L +  V SI+ VN        VCGV T     +    +I+TTGTFL   I +G + +  G      +  L + ++ L F   RLKTGTP R+ + SI    L+ +P +N    F  FD      +KQ  CY+  T +  H++I  NL  + +Y G I   GPRYCPSIEDKVVRF DKE HQ+F+EPE +    +Y+ G S+ LPE +Q  +++ + G EN V+ K AYA++YD +   QL  TLETK + GLF AGQINGT+GYEEAA QGL+AG+N    +   + +   R  +YIG LI+DL+ + + +PYR+LTSR+EYRL LR DNAD+RL   GYE+GLI +  W+ Y   L+   N    LE   LK V +F  +        S K + TL E+L+RP    ID+       + L +  ++ V+I  KY GY+  QQ+ I+  K  ++  +   ++Y  +  +S EAR+ L+K+KP  LGQA+R+ G++  D+  + ++L   K+ T
  S:     9 ETFELIVVGGGHAGCEAAIAAARLGISTALFSLNLDRIGWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADATALQKRVLNSSRGPAVWALRAQTDKRQYACQMLQTLQNTPNLALREAMVTSIETVNSSNTGINVVCGVRTYFGSLYAGKAIILTTGTFLGGQIWVGKQSMPAGRAGEAPAEGLTENLRNLGFIIERLKTGTPARVDRRSISIHALEAQP-SNASNRFFSFDPSLWISSKQMNCYMTRTTSSTHKLIRQNLHLTPIYGGSIESKGPRYCPSIEDKVVRFADKESHQIFLEPEGRDTPELYIQGFSTGLPERLQLALLRTLPGLENCVMLKPAYAVDYDYLPATQLKSTLETKHVAGLFCAGQINGTTGYEEAAAQGLVAGLNASRFISGEKTITFARENSYIGTLIDDLVKQNLREPYRVLTSRSEYRLTLRGDNADRRLTPLGYEIGLIDKRRWELYQHKLQAIENEKNRLEKVRLK-VTDFANSVIVSETGVSIKGSITLAELLRRPGMHAIDLVRHGLMSDNLRKDVRESVEIDTKYRGYLSRQQQQIDQVKKQEHKPIPMDTNYLSIHTLSKEARENLSKIKPTNLGQAARIPGVSQADMTALIIWLALHKQST 635
>gi|46447473|ref|YP_008838.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Protochlamydia amoebophila UWE25] >gi|81170564|sp|Q6MA36|GIDA_PARUW tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|46401114|emb|CAF24563.1| putative glucose-inhibited division protein [Candidatus Protochlamydia amoebophila UWE25] (625 aa)
Score = 1199, Expect = 2.5e-129, Identities = 251/600 (41%), Positives = 365/600 (60%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFID-MEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDL 602
           +YD +VIG GHAG EAA   A+   +  L  ++   +  M CNP++GG AKG + REIDALGG      D T +Q ++LN++KG   WA RAQ DKL Y     +R+E    +D+    +  +   N  +CGV T +   ++   +++++GTFL   +HIG      G      S  ++  +++   +  RLKTGTPPRI K SID+S  + +PG +    FS +D + +    Q  CY+ +T  +  +II +N+ +S MYSG I G GPRYCPSIEDKVVRF+DKERHQ+F+EPE      +Y+ G+SSSLP DVQ   +K+I    +A I + AYAIEYD +   Q+  +LE KKI GLF AGQINGTSGYEEAA QGLMAGIN   ++  + PL+LKR+EAYIGV+I+DL+ K + +PYR+ TSRAE+RL LR DNAD RL +YGYE+GL+ Q+ +D   +         + +E  + +  K FK  S K   TL ++L RP+ ++   ++ +        E    ++++ +KY GYI  Q   +    +++ I++    D+  V  +  EA+ KLN++ P  LGQA R+SG++  D+
  S:     9 RYDVIVIGGGHAGCEAALASARMGLRTLLLTMNLDTIAKMSCNPAVGGIAKGHIVREIDALGGEMGKVIDVTGIQYRMLNATKGPAVWAPRAQADKLAYQSEMKHRMERVSNLDIKQGTIEDLLIENDHICGVITKEGISYDCQAIVLSSGTFLRGLLHIGETNYSGGRAGDQPSVGMSASLEKYGLKLGRLKTGTPPRINKRSIDFSCTEEQPG-DPGVKFS-YDNEGIPRLPQVSCYITYTTEETKQIILSNIHRSPMYSGKIKGVGPRYCPSIEDKVVRFSDKERHQIFLEPEGLQTQEVYVNGVSSSLPFDVQLAFIKSIPALRHAEIMRPAYAIEYDYVISGQIDFSLECKKIGGLFLAGQINGTSGYEEAAGQGLMAGINAANKVMGKAPLILKRSEAYIGVMIDDLVTKGLDEPYRMFTSRAEHRLLLRQDNADLRLRRYGYEVGLVDQTRYDRVKEK-------QRIMEEESERLAKTFKQVSNK-GYTLTQLLCRPENTYASLLKEYPDVMQNFGEEINFQIELNLKYAGYIDRQTSEVAKLAHVEKIQIPIGFDFSTVNGLRNEAKQKLNQIAPRHLGQALRISGVSPADI 599
>gi|46580238|ref|YP_011046.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|81170537|sp|Q72B11|GIDA_DESVH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|46449655|gb|AAS96305.1| glucose inhibited division protein A [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (629 aa)
Score = 1199, Expect = 2.6e-129, Identities = 246/606 (40%), Positives = 361/606 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-NVKEFKYNSR------KTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYL 609
           YDC+V+GAGHAG EAA  LA+  +   L   +   +G++ CNP+IGG AKG + +EIDALGGM  + AD   +Q + LNSSKG    A RAQID+  Y +     I     + +      SI     +  GV T   Q F ++++++TTGTFL   IH+G      G      +  L+  ++ +  +  RLKTGT PR+L++SID+S ++++P  +    FS F    +    Q  C++ +TN + HE I    D+S M++G I GTG RYCPSIEDKV RF +KERHQ+FVEPE       Y  G+ +SLP +VQ+ ++  I G ENA I +  YAIEYD  +P+QL  TLETK ++GL+ AGQINGTSGYEEAA QGL A +NV C L +  P +  R+ AY+ VL++DL+ K   +PYR+ TSRAE+RL LR +NAD RL + G  LGL+  +HW  ++      ++ L ELE   +  +       SR          +L +IL+RP  +  D+ PF +      +  +++ +  +KY GY+  QQ+++  +  +++  L    DY  +P ++ E  +KL KV+P TLGQA+R+SG+    L  +++ L
  S:    13 YDCIVVGAGHAGCEAAMALARMGHATLLLTGNADRIGHLSCNPAIGGLAKGHMVKEIDALGGMMGLWADEAGIQFRTLNSSKGPAVRATRAQIDRDAYLRVVRRDIFAQPNLRVWQDMAESIIVEEGRAAGVRTAYGQEFRAHHVLLTTGTFLQGRIHVGLSNFPGGRLGDAPATGLSASLRAIGLELGRLKTGTTPRLLRDSIDFSMMEVQPPDDPPRPFS-FRGPGVRL-PQLPCHVTWTNERTHEAIRAGFDRSPMFTGVIKGTGARYCPSIEDKVARFPEKERHQVFVEPEGLESPECYPNGIPTSLPLEVQKAMIATIPGLENAQIVRPGYAIEYDYADPVQLRSTLETKALRGLWLAGQINGTSGYEEAAAQGLWAALNVSCTLRSMPPFLPGRDTAYMAVLVDDLVTKGTREPYRMFTSRAEHRLLLRENNADARLTETGRALGLVDDTHWQLFSTKRAALHSLLDELENRRITPDAAARDIFSRLGEPAPTKGVSLADILRRPSLTLPDLAPFWEGVTRFADDVREEAETIVKYSGYLARQQELVARSARMEDTVLPEDMDYTVIPGLTREIVEKLGKVRPHTLGQAARISGVTPAALTCLEIQL 623
>gi|33866912|ref|NP_898471.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Synechococcus sp. WH 8102] >gi|81170585|sp|Q7U3P8|GIDA_SYNPX tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|33639513|emb|CAE08897.1| glucose inhibited division protein A [Synechococcus sp. WH 8102] (641 aa)
Score = 1199, Expect = 2.6e-129, Identities = 246/614 (40%), Positives = 375/614 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV----NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + +D +V+G GHAG EAA   A+     ALF L+   +   PCNP++GGPAK  +  E+DALGG+    AD T +Q ++LN+S+G   WALRAQ DK  YS   L  ++    + L +  V  ++       Q++ G+ T     + +  +I+T GTFL   I +GH+ +  G      +  L + +++L FQT RLKTGTP R+ + SI   +L+ +P     + FS FD       +Q  C++  T  + H++I +NL  +A+Y G I   GPRYCPSIEDK+VRF DK+ HQ+F+EPE +    IY+ G S+ LPE +Q Q+++++ G E AV+ + AY+++YD +   QL P+LETK+++GLF AGQ+NGT+GYEEAA QGL+AG+N    +  +EP+   R  +YIG +I+DL++K++ +PYR+LTSR+EYRL LR DNAD+RL   G +LGLI    W  +   L+      + LET  LK        V+E    + K + TL ++L+RP     D+         L    ++  +I IKY GY++ QQ+ I+  K     KL +  +Y  +  +S EAR+KL  ++P TLGQASR+ G++  D+  + ++LE +K++
  S:     9 ESFDVIVVGGGHAGCEAAITAARLGLNTALFTLNLDRIAWQPCNPAVGGPAKSQLVHEVDALGGVIGRLADGTAIQKRILNASRGPAVWALRAQTDKRLYSHQMLQLLQHTPNLALREAMVTGLETTAEADQQRISGIRTYFGSVYGAEAVILTAGTFLGGRIWVGHQSMAAGRAGEQAAEGLTEALQQLGFQTDRLKTGTPARVDRRSIALDQLEEQPSDAADHFFS-FDPAAWVSGEQMSCHITRTTAETHQLIRDNLHLTAIYGGVIDSKGPRYCPSIEDKIVRFADKDSHQIFLEPEGRDTPEIYVQGFSTGLPEPIQLQLLRSLPGLEQAVMLRPAYSVDYDYLPATQLKPSLETKRVRGLFSAGQLNGTTGYEEAAAQGLVAGVNAARHIGGQEPVHFPREGSYIGTMIDDLVSKDLREPYRVLTSRSEYRLILRGDNADRRLTPLGRDLGLIDDRRWQLFEDKLQAMEREKQRLETVRLKVSDPVAPAVEEETGAAIKGSITLADLLRRPGMHAADLVRHGLADADLPLPVREGAEIDIKYSGYLQRQQQQIDQVKRQSQRKLPADLNYAGIGTLSNEAREKLGSIQPTTLGQASRIPGVSQADITALLMWLELRKRE 632
>gi|16762452|ref|NP_458069.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143940|ref|NP_807282.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|21263667|sp|Q8Z2Q7|GIDA_SALTI tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|25300013|pir||AE0953 glucose inhibited division protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504757|emb|CAD03121.1| glucose inhibited division protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139576|gb|AAO71142.1| glucose inhibited division protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (629 aa)
Score = 1199, Expect = 2.9e-129, Identities = 257/594 (43%), Positives = 355/594 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYE-----ILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           +D ++IG GHAG EAA   A+   +  L   +   +G M CNP+IGG  KG + +E+DALGG+ A A D   +Q K+LN+SKG    A RAQ D++ Y +     +E    + +  + V  +   N +V G  T     F +  +++T GTFLD  IHIG      G      S  L+++++EL  +  RLKTGTPPRI   +ID+S L  + G N    FS     F    +Q  CY+  TN K H++I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+ +HQ+F+EPE    + IY  G+S+SLP DVQ QIV+++ G ENA I +  YAIEYD  +P  L PTLE+K I GLFFAGQINGT+GYEEAA QGL+AG+N      ++E     R++AY+GVL++DL      +PYR+ TSRAEYRL LR DNAD RL + G ELGL+    W  +N+ LEN     + L+++ +    E   + N+  T     E     +L+RP+ ++  +         L DE   ++V+I +KY GYI  QQ  I      +N  L +  DY+ V  +S E   KLN  KP ++GQASR+SG+
  S:     7 FDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPTIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFKILNASKGPAVRATRAQADRVLYRQAVRIALENQPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPSIPLSRRLRELPLRVSRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNAF-QHPQQVPCYITHTNEKTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADRNQHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESKFIHGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEMGRELGLVDDERWARFNEKLENIERERQRLKSTWVTPSAESADEVNAHLTTPLSREASGEDLLRRPEMTYAQLTSLAAFAPALEDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGV 607
>gi|15618527|ref|NP_224813.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Chlamydophila pneumoniae CWL029] >gi|15836149|ref|NP_300673.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Chlamydophila pneumoniae J138] >gi|16752423|ref|NP_444682.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Chlamydophila pneumoniae AR39] >gi|33241974|ref|NP_876915.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Chlamydophila pneumoniae TW-183] >gi|7674055|sp|Q9Z7T7|GIDA_CHLPN tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|4376914|gb|AAD18756.1| FAD-dependent oxidoreductase [Chlamydophila pneumoniae CWL029] >gi|7189065|gb|AAF38013.1| gidA protein [Chlamydophila pneumoniae AR39] >gi|8978989|dbj|BAA98824.1| FAD-dependent oxidoreductase [Chlamydophila pneumoniae J138] >gi|33236484|gb|AAP98572.1| GidA [Chlamydophila pneumoniae TW-183] (611 aa)
Score = 1198, Expect = 3.0e-129, Identities = 248/599 (41%), Positives = 363/599 (60%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM--EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDL 602
           YD +V+GAGHAG EAA+  AK    V +   +   +  + CNP++GG  KG + REIDALGG+ A   D + +Q ++LN +KG    A RAQ+DK  Y       +E    + ++   V S+      + GV T +   F    +++++GTF+   IHIG +    G      S  L++ +K+  F   RLKTGTPPR+L +SI++S ++ +PG +    F H    F     Q  C++  T  K   II+ NL +SA+Y G I G GPRYCPSIEDK+V+F+DKERH +F+EPE  H   IY  GLS+S+P DVQ  ++++++G ENA+I + AYAIEYD I+   ++PTLE+K I+GLF  GQINGT+GYEEAA QGL+AGIN + ++ NR P +  R E+YIGV+++DL  + + +PYR+ T RAE+RL LR DNA  RL  YGYELGL+S+  ++   K     N  L+E +    K  +++     ++  +L + L RP+ S+ DM  E F  +   L       +++ IKY GYI  Q+ +I   +  +++ +    DYK +  +SLEA++KL K  P TLG ASR+SGI   D+
  S:     8 YDVIVVGAGHAGCEAAYCSAKMGVSVLMLTSNLDTIAKLSCNPAVGGIGKGHIVREIDALGGIMAEVTDQSGIQFRILNQTKGPAVRAPRAQVDKQLYHIHMKRLLENTPGLHIMQATVESLLDKEGVISGVTTKEGWMFSGKTVVLSSGTFMRGLIHIGDRNFSGGRLGDPSSQGLSEDLKKRGFPISRLKTGTPPRLLASSINFSCMEEQPG-DLGVGFVHRTEPFQPPLPQLSCFITHTMEKTKAIISANLHRSALYGGCIEGVGPRYCPSIEDKIVKFSDKERHHVFLEPEGLHTQEIYANGLSTSMPFDVQYDMIRSVLGLENAIITRPAYAIEYDYIHGNVIHPTLESKLIEGLFLCGQINGTTGYEEAAAQGLIAGINAVNKVFNRPPFIPSRQESYIGVMLDDLTTQILDEPYRMFTGRAEHRLLLRQDNACARLSHYGYELGLLSEERYELVKKQ----NQLLEEEKVRLQKTFRQYG----QSVVSLAKALSRPEVSY-DMLREAFPNDIRDLGAVLNASLEMEIKYSGYIDRQKILIQSLEKAESLLIPEDLDYKQITALSLEAQEKLAKFTPRTLGSASRISGIASADI 598
>gi|188997499|ref|YP_001931750.1| glucose inhibited division protein A [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932566|gb|ACD67196.1| glucose inhibited division protein A [Sulfurihydrogenibium sp. YO3AOP1] (620 aa)
Score = 1198, Expect = 3.3e-129, Identities = 260/613 (42%), Positives = 382/613 (62%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQK--VCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRK----FLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGIN-VLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDE--YWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           +YD +VIG GHAG+EAA   AK   K AL  +DK+ +G MPCNPSIGG AKGIV RE+DALGG  A A D T +Q K+LN+ KG    + RAQ DK EY K+ +N+    E + +I+ EV  I     K  V GV T      ++  ++VTTGTFL+  IHIG K    G  +   S  L +  K   F+  R KTGTP R+ KN+I++S L+  PG N    FS +       +     Q  CY+ +T  + H II  NL ++A+Y G ITG GPRYCPS+EDK+V+F  K+RH +++EPE++   +IY  GLS+SL E++Q Q+ ++I G EN V+ K AYAIEYD + P +LYPTLETK+I+GL+ AG  NGT+GYEEAA QG++AGIN  L  L   EP +++R+EAYIGV+I+DL  K + +PYRL TSR+EYRL LR DNA  RL +  Y +G++++  +    +  E   N +   + + +K+  +          +++  L++P+   +D++   +    + E  Y +++++I +KY GY++ ++K+    K ++ IK+    DY  V  +  E   KL K KP+TLGQASR+ GI    +  + +++E  +++
  S:     6 EYDVVVIGGGHAGIEAALASAKLGTKTALITIDKEKIGLMPCNPSIGGIAKGIVVREVDALGGEMAKAIDQTGIQFKVLNTRKGPAVRSPRAQADKEEYRKYMVNKTNNTENLTVIEDEVIDIVLKENKNEVDGVITDKGLKIKTKAVVVTTGTFLNGLIHIGDKRFPAGRMEEKPSTKLPEFYKRAGFELFRFKTGTPARLDKNTINFSILEEAPGDNPPPKFSFWTEPKGSYWFKEKDQIPCYITYTTPETHRIIKENLHRTALYGGAITGIGPRYCPSVEDKIVKFEGKDRHTVWLEPETRDGISIYPNGLSTSLSEEIQWQMYRSIPGLENVVLLKPAYAIEYDIVMPTELYPTLETKRIRGLYHAGNFNGTTGYEEAAGQGIVAGINAALRALGKDEPFIIRRDEAYIGVMIDDLTTKGVIEPYRLFTSRSEYRLHLRQDNAILRLYQKAYNIGMLNEEEYKFVKETEEEIKNWINIYKETFIKDGDK--------KVSIFTYLQKPE---VDIQKLKEMGIAVPESDYIQEEIEINVKYDGYLEREEKLNEKMKYLEGIKIPEDIDYSQVAGLRKEIVQKLTKFKPMTLGQASRLEGITPAAITALLVHIEKMREK 616
>gi|68249206|ref|YP_248318.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae 86-028NP] >gi|81170546|sp|Q4QMT9|GIDA_HAEI8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|68057405|gb|AAX87658.1| glucose inhibited division protein A [Haemophilus influenzae 86-028NP] (629 aa)
Score = 1198, Expect = 3.5e-129, Identities = 259/614 (42%), Positives = 362/614 (58%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKYNSRKT-------NTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           + YD +VIG GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A AAD   +Q + LNSSKG    A RAQ D++ Y +     +E    +D+  +E   I     +V GV T     F +  +++T GTFL   IHIG +  + G      S  L+ ++++L  +  RLKTGTPPRI   +I++  L  + G      FS F     D  +Q  CY+  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF D+  HQ+++EPE    + +Y  G+S+SLP DVQ  IV ++ G E A I K  YAIEYD  +P  L PTLETK I GLFFAGQINGT+GYEEAA QGL+AGIN    ++ +E    +R+++Y GVL++DL      +PYR+ TSRAEYRL LR DNAD RL    +ELGLI ++ W  +N+ +E      + L +  L    E+   + K          +  ++L+RP+ ++  +      K  + D    ++V+I IKY GYI+ QQ+ I   K  +N  + +  DY  V  +S E R KL + +P+++GQASR+SGI       I + L N KKQ
  S:     5 ETYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLYRQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLIFRAKSVVLTAGTFLAGKIHIGLENYEGGRAGDPASVNLSYRLRDLGLRVDRLKTGTPPRIDARTINFDILAKQHGDAVLPVFS-FMGSVSDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGVIEGIGPRYCPSIEDKVMRFADRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLEKARIIKPGYAIEYDYFDPRDLKPTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKEAWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLIDEARWARFNQKMEKIEQERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPEMTYDILTSLTPYKPAIEDREAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDYSKVSGLSNEVRAKLEQHRPVSIGQASRISGITPA---AISIILVNLKKQ 622
>gi|42525229|ref|NP_970609.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Bdellovibrio bacteriovorus HD100] >gi|81170524|sp|Q6MGL6|GIDA_BDEBA tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|39577440|emb|CAE81263.1| glucose inhibited division protein A [Bdellovibrio bacteriovorus HD100] (642 aa)
Score = 1197, Expect = 4.1e-129, Identities = 262/613 (42%), Positives = 361/613 (58%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKE-LETSTLKNVKEFK-------YNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKK 614
           KKYD +V+GAGHAG+EA    A+      +   +   +G M CNPSIGG AKG + REID LGG   +AAD T +Q K LN+SKG      R Q DK  YS++    +     ++++  EV  +        GV   D         I+TTGTF++  +HIG +    G      S  L+ Q+ +  F+  RLKTGTP R+LK+SID+SK   + G  K Y FS      L    Q +CYL  T  + H+II  NLDKS MY G I G GPRYCPSIEDK+ RF ++  HQ F+EPE    D IYL G+S+SLPEDVQ++ +K I G EN  + +Y YA+EYD I P Q++  LET+ I+ LF AGQINGTSGYEEAA QGL+AGIN    +  RE  +L R++AY+GV+I+DL+ K   +PYR+ TSRAE+RL LR DN   RL   G +LGL+S   + E   NL      L + L+ + L   K+ +         +   + T  E+L+RP+ +   +E  L  +   D    + V+I +KY GY+K Q  +I  +K ++ + L     Y ++  +S E +DKL +VKP TLGQA R+SG+N   +  I ++L+  KK
  S:     4 KKYDVIVVGAGHAGIEACLSSARLGLNTLMVTTNTDRIGYMSCNPSIGGLAKGHMVREIDVLGGQMGVAADETCIQYKRLNASKGPAVRGTRVQNDKHLYSQFQKEALYNQPNLEVLQGEVKRLILEKDLCVGVVLQDGSEIFGKATIITTGTFMNGVMHIGLRQEAGGRVGDQPSIGLSDQLAQFGFEVKRLKTGTPARLLKDSIDWSKTIPQAGDEKVYPFSFRSSDKLKL-PQVLCYLTRTTEETHDIIRGNLDKSPMYCGIIEGVGPRYCPSIEDKITRFAERTSHQTFLEPEGLSTDLIYLQGISTSLPEDVQDRFLKTIPGLENVKVARYGYAVEYDYIEPTQIWHRLETRTIRQLFLAGQINGTSGYEEAAAQGLIAGINAAHSILGREEFILGRDQAYMGVMIDDLVTKGTREPYRMFTSRAEHRLVLREDNTIDRLSDLGRKLGLVSAESF-ELLTNLRERRQVLHDRLKNTVLYPTKDIQAILATIPTPAMSKSLTFEELLRRPELTSSHLE-LLNFELDPDPNVVEPVEIEVKYSGYVKRQMDLIVQSKRLEEMLLPDDLAYAEIRGLSNEEKDKLLRVKPRTLGQAQRISGVNPSAIQAIMIHLKGHKK 621
>gi|37681446|ref|NP_936055.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio vulnificus YJ016] >gi|56749077|sp|Q7MGG9|GIDA_VIBVY tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|37200198|dbj|BAC96026.1| glucose inhibited division protein A [Vibrio vulnificus YJ016] (632 aa)
Score = 1197, Expect = 4.2e-129, Identities = 254/596 (42%), Positives = 358/596 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHF-DRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEY-WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  + +E    + L  + V+ +     +V GV T     F +  +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   S+D+S L+ + G N    FS   DR      +Q  C++  TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T ETK I+GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAE+RL LR DNAD RL +   ELGL+  + W  +N+ ++N     + L+++ +         + +          +  ++L+RP+ ++  +         +D+    ++V+I +KY GYIK QQ  I  +   ++ KL +  DY DV  +S E   KLN  KP TLG ASR+SGI
  S:     5 ETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRDFLENAPNLTLFQQAVDDLIVEQDQVRGVITQMGLKFHAKAVVLTVGTFLGGKIHIGLQSSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARSVDFSVLEAQHGDNPTPVFSFMGDRT--HHPRQIPCFITHTNEQTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPGYAIEYDFFDPRDLKQTYETKFIQGLFFAGQINGTTGYEEAAAQGLMAGLNASLFSQEKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEHRLLLREDNADLRLTEKARELGLVDDARWARFNQKIDNMEQERQRLKSTWMNPASTGIDELNQLLKTPMNREASGEDLLRRPEMTYDQLTSLTAFAPAIDDLEAAEQVEIQVKYEGYIKRQQDEIEKSLRHEHTKLPADLDYSDVKGLSNEVVLKLNTAKPETLGIASRISGI 607
>gi|194561969|ref|YP_002096992.1| Glucose-inhibited division protein A subfamily [Burkholderia dolosa AUO158] >gi|124893593|gb|EAY67473.1| Glucose-inhibited division protein A subfamily [Burkholderia dolosa AUO158] (656 aa)
Score = 1197, Expect = 4.3e-129, Identities = 250/595 (42%), Positives = 353/595 (59%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEY-------NKNLENFNNTLKELETSTLKNVKEFKYNSRKTNTTLYEILKRPDYSFIDM-----------EPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           ++D +V+G GHAG EAA   A+   K  L   + + +G M CNPSIGG  KG + +E+DALGG  A A D + +Q ++LNSSKG    A RAQ D++ Y      R+E    + L  + V+ +     +V G  T     F +  +++T GTFLD  IH+G      G      +  L+ ++KEL     RLKTGTPPRI   +ID+SKL  +PG         F  +     +Q  C++  TN + H+II   LD+S MY+G I G GPRYCPSIEDK+ RF  KE HQ+F+EPE    +  Y  G+S+SLP DVQ ++V ++ G ENA I +  YAIEYD  +P  L  +LETK I GLFFAGQINGT+GYEEAA QGL+AG+N    ++ ++    +R++AY+GVL++DL+ + + +PYR+ TSRAEYRL LR DNAD RL + G ELGL+    WD +       ++  E   +T    +T   +        +     +L E+L+RP  S+  +           EP   +   L +  K++V+I IKY GYI+ Q   I      +N +L    DY+DV  +S E   KLN+ +P T+GQASR+SG+
  S:     6 EFDVIVVGGGHAGTEAALASARMGAKTLLLTHNIETLGQMSCNPSIGGIGKGHLVKEVDALGGAMAAATDESGIQFRILNSSKGPAVRATRAQADRVLYKAAIRRRLENQPNLWLFQQAVDDLMVEGDRVVGAVTQIGIRFRARAVVLTAGTFLDGKIHVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRTIDFSKLDEQPGDLDPIPVFSFLGRVEQHPQQLPCWVTHTNERTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFASKESHQIFLEPEGLTTNEFYPNGISTSLPFDVQLELVHSMRGLENAHILRPGYAIEYDYFDPRALKASLETKAINGLFFAGQINGTTGYEEAAAQGLLAGLNAGRYVQEKDAWCPRRDQAYLGVLVDDLVTRGVAEPYRMFTSRAEYRLSLREDNADMRLTEIGRELGLVDDVRWDAFCRKRDAVSRETERLKSTWVTPKTLPAEEATALLGKAIDHEYSLAELLRRPGVSYDGVCGLKGGECGPAEPLADDPVLLAQI-KEQVEIGIKYQGYIERQANEIERNDANENTRLPDGIDYRDVRGLSFEVSQKLNEFRPETIGQASRISGV 617
>gi|90581140|ref|ZP_01236939.1| glucose-inhibited division protein A [Vibrio angustum S14] >gi|90437661|gb|EAS62853.1| glucose-inhibited division protein A [Vibrio angustum S14] (629 aa)
Score = 1197, Expect = 4.3e-129, Identities = 263/609 (43%), Positives = 365/609 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN--VKEFKYNSRKTNTTLY----------EILKRPDYSFIDMEPFLKNKNTLDEY-WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +K+D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DALGG+ A A D   +Q + LNSSKG    A RAQ D+  Y     N +E  E + +  + V  +   N +  GV T     F    +++T GTFL   IHIG +    G      S  LA +++EL  +  RLKTGTPPRI   S+D+S L+ + G N   +FS F  K  D  +Q  C++ +TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE    + +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T E K I GLFFAGQINGT+GYEEAA QGLMAG+N   Q++++E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL   G E GL+  + W  +N+ +EN      ELE   LK+  +     +  + N  L           ++L+RP+ ++  +         LD+   +++V+I +KY GYI  Q+  +  +   +  KL    DY +V  +S E   KLN  KP ++G ASR+SGI    +  + +YL+
  S:     5 EKFDVIVVGGGHAGTEAALAAARMGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAQAIDKGGIQFRTLNSSKGPAVRATRAQADRALYKAAVRNVLENQENLMVFQQAVTDLIVENHRAVGVVTEMGLKFHGKAVVLTVGTFLGGKIHIGMENYSGGRTGDPASNALADRLRELPLRVDRLKTGTPPRIDARSVDFSVLEEQHGDNPTPTFS-FMGKSSDHPRQIPCFITYTNERTHEVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTNELYPNGISTSLPFDVQMQIVRSMQGFENATIMRPGYAIEYDFFDPRDLKQTFENKYIDGLFFAGQINGTTGYEEAAAQGLMAGMNAALQVQDKEGWSPRRDQAYMGVLIDDLSTIGTKEPYRMFTSRAEYRLLLREDNADLRLTPMGREFGLVDDARWSRFNQKIENM-----ELERQRLKDIWINPKSDHVDELNKILKAPIAREASGEDLLRRPEVTYEQLTSIETFAPALDDIEAREQVEIQVKYQGYIDRQRDEVEKSLRHETTKLPFDIDYSNVKGLSNEVVVKLNDAKPESIGMASRISGITPAAISLLLVYLK 620
>gi|22298078|ref|NP_681325.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Thermosynechococcus elongatus BP-1] >gi|34222556|sp|Q8DLF8|GIDA_SYNEL tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|22294256|dbj|BAC08087.1| glucose inhibited division protein [Thermosynechococcus elongatus BP-1] (637 aa)
Score = 1197, Expect = 4.4e-129, Identities = 258/613 (42%), Positives = 378/613 (61%)
  Q:     3 KYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFV---NQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLV-LKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRP--DYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLENKKKQ 615
           ++D +V+GAGHAG EAA   A+   +  L  L+   +   PCNP++GGPAK  +  E+DALGG     +D T +Q +LLN+S+G   WALRAQ DK EYS   + ++ EN+  +L+ +E      V   N  V GV T     F    +I+TTGTFL   I +G+K +  G      +  L++ +  L F+  RLKTGTP R+ + S+DYSK++ +P   +   FS FD        Q  CYL  T  + H +I  +L  + +Y G++   GPRYCPSIEDK+VRF DKE HQ+F+EPE ++   +Y+ G S+ LPE +Q Q+++ + G EN ++ + AYA+EYD +   Q +PTL TKKI+GLF AGQINGT+GYEEAA QG++AGIN   +   R+P++   R E+YIG LI+DL  KE+ +PYR+LTSR+EYRL LR+DNADQRL   GYE+GL+S++ W  +           + L+T+ +K        +      + K+   L E+L+R    Y  +D         T  E  K+ V+I IKY GYI+ QQ+ I      +   L    DY  +P +S+EAR+KL+ ++PLT+GQASR+ G+N  D+  + +YL+ ++++
  S:    10 EFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGRVSDRTYVQKRLLNASRGPAVWALRAQTDKREYSA-VMKQVVENQ-PNLLVREGMVTDLVLDANDTVIGVETYFGVAFRCQAVILTTGTFLGGRIWVGNKSMPAGRAGEFAAEGLSQTLARLGFEVDRLKTGTPARVDRRSVDYSKMEPQPPDEQVRWFS-FDPTVWVERPQMNCYLTRTTPETHRLIREHLHLTPVYGGWVDAKGPRYCPSIEDKIVRFADKESHQIFIEPEGRNTPELYIQGFSTGLPEPLQLQLLRTLPGLENCIMLRPAYAVEYDYLPATQCFPTLMTKKIQGLFCAGQINGTTGYEEAAAQGIVAGINA-ARFVQRKPMITFPRQESYIGTLIDDLCTKELREPYRMLTSRSEYRLVLRSDNADQRLTPLGYEIGLVSEAQWQVFQAKQRRLAAETQRLQTTRIKAHEPVGEAIVTATGQAIKSAIALEELLRRSGVHYELLDRHGLGNPDLTPQE--KEAVEIAIKYAGYIERQQREIEQIARQEQRPLPVDLDYFAIPTLSMEAREKLSAIRPLTIGQASRIGGVNPADINALLVYLQVQQQR 629
>gi|163803608|ref|ZP_02197474.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio campbellii AND4] >gi|159172602|gb|EDP57460.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Vibrio campbellii AND4] (631 aa)
Score = 1197, Expect = 4.4e-129, Identities = 251/596 (42%), Positives = 357/596 (59%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLK-------NVKEFKYNSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI 597
           + +D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DA+GG+ A A D+  +Q + LN+SKG    A RAQ D+  Y  +  N +E    + L  + V+ +     +V GV T     F +N +++T GTFL   IHIG +    G      S  LA +++EL F+  RLKTGTPPRI   S+D+S L+ + G N    FS   ++     +Q  C++  TN + H++I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE      +Y  G+S+SLP DVQ QIV+++ GF NA I +  YAIEYD  +P  L  T ETK I GLFFAGQINGT+GYEEAA QGLMAG+N     + +E    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL +   ELGL+  + W  +N+ ++N     + L+++ +         + +          +  ++L+RP+  +  +         L D+   ++V+I +KY GYIK QQ  I  +   ++ KL +  DY+DV  +S E   KL + KP ++G ASR+SGI
  S:     5 ENFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAMGGLMAEAIDHAGIQFRTLNASKGPAVRATRAQADRALYKAYVRNALENTPNLTLFQQSVDDLIVNQDRVVGVVTQMGLKFHANAVVLTVGTFLGGKIHIGMESSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARSVDFSVLEAQHGDNPTPVFSFMGKREHQ-PRQIPCFITHTNEQTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFGNAHIVRPGYAIEYDFFDPRDLKQTYETKFINGLFFAGQINGTTGYEEAAAQGLMAGLNASLHSQGKEGWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEYRLLLREDNADLRLTEKARELGLVDDARWARFNQKIDNMETERQRLKSTWMNPNSAGIDELNKLLKTPMAREASGEDLLRRPEIVYSTLTQLDAFAPALEDQQASEQVEIQVKYDGYIKRQQDEIEKSLRHEHTKLPTDLDYQDVKGLSNEVVAKLTEAKPESIGIASRISGI 607
>gi|89074717|ref|ZP_01161175.1| glucose-inhibited division protein A [Photobacterium sp. SKA34] >gi|89049481|gb|EAR55042.1| glucose-inhibited division protein A [Photobacterium sp. SKA34] (629 aa)
Score = 1197, Expect = 4.5e-129, Identities = 262/609 (43%), Positives = 367/609 (60%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKN--VKEFKYNSRKTNTTLY----------EILKRPDYSFIDMEPFLKNKNTLDEY-WKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           +K+D +V+G GHAG EAA   A+   K  L   +   +G M CNP+IGG  KG + +E+DALGG+ A A D   +Q + LNSSKG    A RAQ D++ Y     N +E  E + +  + V  +   N +  GV T     F +  +++T GTFL   IHIG +    G      S  LA +++EL  +  RLKTGTPPRI   S+D+S L+ + G N   +FS F  K  D  +Q  C++ +TN + HE+I NNLD+S MY+G I G GPRYCPSIEDKV+RF DK  HQ+F+EPE    + +Y  G+S+SLP DVQ QIV+++ GFENA I +  YAIEYD  +P  L  T E K I GLFFAGQINGT+GYEEAA QGLMAG+N   Q+++++    +R++AY+GVLI+DL      +PYR+ TSRAEYRL LR DNAD RL   G E GL+  + W  +N+ +EN      ELE   LK+  +     +  + N  L           ++L+RP+ ++  +         LD+   +++V+I +KY GYI  Q+  +  +   +  KL    DY +V  +S E   KLN  KP ++G ASR+SGI    +  + +YL+
  S:     5 EKFDVIVVGGGHAGTEAALAAARMGQKTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAQAIDKGGIQFRTLNSSKGPAVRATRAQADRVLYKAAVRNVLENQENLMIFQQAVTDLIVENHRAVGVVTEMGLKFHAKAVVLTVGTFLGGKIHIGMENYSGGRTGDPASNALADRLRELPLRVDRLKTGTPPRIDARSVDFSVLEEQHGDNPTPTFS-FMGKSSDHPRQIPCFITYTNERTHEVIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADKNSHQIFIEPEGLTTNELYPNGISTSLPFDVQMQIVRSMQGFENASIMRPGYAIEYDFFDPRDLKQTFENKYIDGLFFAGQINGTTGYEEAAAQGLMAGMNAALQVQDKDGWSPRRDQAYMGVLIDDLSTIGTKEPYRMFTSRAEYRLLLREDNADLRLTPMGREFGLVDDARWSRFNQKIENM-----ELERQRLKDIWINPKSDHVDELNKILKAPIAREASGEDLLRRPEVTYEQLTSIETFAPALDDREAREQVEIQVKYQGYIDRQRDEVEKSLRHETTKLPFDIDYSNVKGLSNEVVAKLNDAKPESIGMASRISGITPAAISLLLVYLK 620
>gi|91070437|gb|ABE11348.1| glucose inhibited division protein A [uncultured Prochlorococcus marinus clone HOT0M-10E12] (655 aa)
Score = 1197, Expect = 4.5e-129, Identities = 251/609 (41%), Positives = 375/609 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSI-------------KFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY-------NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + +D +VIG GHAG EAA   AK  +  ALF ++   +   PCNP++GGPAK  +  E+DALGG+    AD T +Q ++LN+S+G   WALRAQ DK EYSK  +  ++  + + L +  +  +             K   +++ GV T    ++ +  +I+T GTFL+  I IG+K +  G      +  L + + E+  +T RLKTGTP R+ K SI + +L I+P T     FS FD    +   Q  C++  T  K H++I +NL  + +Y GFI   GPRYCPSIEDK+V+F DKE HQ+F+EPE  +   IY+ G S+ LPE++Q ++++ + G     + + AYA+EYD I   QL  +LETK+I+ LF AGQINGT+GYEEAA QGL+AGIN   +L  ++P++  R  +YIG +I DLI K++ +PYR+LTSR+EYRL LR DNAD+RL   GY++GLI++  W  Y + ++        L  + LKN  E          +  K +TTL E+LKRP++ + D+  +  N+  L    ++ V+I IKY GY+K Q+  I          L    +Y+ +  +SLEAR+ LNK+KP   G AS++ G++  DL  + ++L+
  S:     9 ESFDVIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSKKMIEILQNTDNLSLKEAMITELDIAKTEEIGLISKKIFKKRIKGVRTFFGSYYSAKSVIITAGTFLEGRIWIGNKSMSAGRSGEQAAKGLTQNLHEIGIKTERLKTGTPARVDKRSIIFDELDIQPSTAADKYFS-FDPDIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYGGFIDSKGPRYCPSIEDKIVKFADKESHQIFLEPEGINTPEIYVQGFSTGLPENIQLELLRTLPGLGECKMLRPAYAVEYDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGINATRKLNKKDPIIFTRESSYIGTMINDLITKDLKEPYRVLTSRSEYRLTLRGDNADRRLTPLGYQIGLINEKRWSVYQEKMKLLEEEKFRLNNTRLKNTDEISKKIELETGSKIKGSTTLKELLKRPNFHYSDLIKYNLNERNLGSSIQEGVEIDIKYEGYLKRQKNNIEQINRQSCKSLPEEINYEKIDTLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLK 636
>gi|123969416|ref|YP_001010274.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Prochlorococcus marinus str. AS9601] >gi|166222719|sp|A2BTQ6|GIDA_PROMS tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|123199526|gb|ABM71167.1| Glucose inhibited division protein A [Prochlorococcus marinus str. AS9601] (655 aa)
Score = 1197, Expect = 4.6e-129, Identities = 250/609 (41%), Positives = 376/609 (61%)
  Q:     2 KKYDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEV-------------NSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEFKY-------NSRKTNTTLYEILKRPDYSFIDMEPFLKNKNTLDEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGINLVDLINIKLYLE 610
           + +D +VIG GHAG EAA   AK  +  ALF ++   +   PCNP++GGPAK  +  E+DALGG+    AD T +Q ++LN+S+G   WALRAQ DK EYSK  +  ++  + + L +  +             NS K + +++ GV T    ++ +  +I+T GTFL+  I IG+K +  G      +  L + + E+  +T RLKTGTP R+ K SI + +L ++P T     FS FD    +   Q  C++  T  K H++I +NL  + +Y GFI   GPRYCPSIEDK+V+F +KE HQ+F+EPE  +   IY+ G S+ LPE++Q ++++ + G     + + AYA+EYD I   QL  +LETK+I+ LF AGQINGT+GYEEAA QGL+AG+N   +L  ++P++  R  +YIG +I DLI K++ +PYR+LTSR+EYRL LR DNAD+RL   GY++GLI++  W  Y + +         L  + LKN  E          +  K +TTL E+LKRP++ + D+  +  N+  L    ++ V+I IKY GY+K Q+  I          L    +Y+ +  +SLEAR+ LNK+KP   G AS++ G++  DL  + ++L+
  S:     9 ESFDVIVIGGGHAGCEAAITTAKLGFSTALFTINLDRIAWQPCNPAVGGPAKSQLVHEVDALGGIIGKLADETAIQKRILNASRGPAVWALRAQTDKREYSKKMIEILQNTDNLSLKEAMITELDIAKTEQIGLNSKKILKKRIKGVKTFFGSYYSARSVIITAGTFLEGRIWIGNKSMSAGRSGEQAAQGLTQNLHEIGIKTERLKTGTPARVDKRSIIFDELDVQPSTAVDKYFS-FDPDIKNNMPQVSCHITRTTTKTHQLIRDNLHLTPIYGGFIDSKGPRYCPSIEDKIVKFANKESHQIFLEPEGINTPEIYVQGFSTGLPENIQLELLRTLPGLGECKMLRPAYAVEYDYIPATQLQTSLETKEIEYLFSAGQINGTTGYEEAAAQGLVAGVNATRKLNKKDPIIFSRESSYIGTMINDLITKDLKEPYRVLTSRSEYRLTLRGDNADRRLTPLGYQIGLINEKRWSAYQEKMNLLEEEKFRLNNTRLKNTDEISKKIELETGSKIKGSTTLKELLKRPNFHYSDLIKYNLNERNLGSSIQEGVEIDIKYEGYLKRQKNNIEQINRQSCKSLPQEINYEKIETLSLEARENLNKIKPKNFGDASKIPGVSKADLTALLVWLK 636
>gi|62182357|ref|YP_218774.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|75479634|sp|Q57HW9|GIDA_SALCH tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) >gi|62129990|gb|AAX67693.1| associate with glucose-inhibited division [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (629 aa)
Score = 1197, Expect = 5.0e-129, Identities = 258/609 (42%), Positives = 363/609 (59%)
  Q:     4 YDCLVIGAGHAGLEAAFILAKKKYKVALFVLDKKLVGNMPCNPSIGGPAKGIVTREIDALGGMQAIAADNTQLQMKLLNSSKGAGTWALRAQIDKLEYSKWFLNRIEENEYIDLIDKEVNSIKFVNQKVCGVYTVDNQFFESNYLIVTTGTFLDSSIHIGHKVIKKGPDDFNGSYLLAKQIKELDFQTIRLKTGTPPRILKNSIDYSKLQIEPGTNKKYSFSHFDRKFLDFNKQEVCYLAFTNNKIHEIINNNLDKSAMYSGFITGTGPRYCPSIEDKVVRFNDKERHQLFVEPESKHLDTIYLGGLSSSLPEDVQEQIVKNIVGFENAVIKKYAYAIEYDAINPIQLYPTLETKKIKGLFFAGQINGTSGYEEAACQGLMAGINVLCQLENREPLVLKRNEAYIGVLIEDLINKEITDPYRLLTSRAEYRLELRNDNADQRLLKYGYELGLISQSHWDEYNKNLENFNNTLKELETSTLKNVKEF--KYNSRKTNTTLYE-----ILKRPDYSFIDMEPFLKNKNTL-DEYWKDKVDIYIKYGGYIKSQQKIINDTKNIDNIKLSSISDYKDVPNISLEARDKLNKVKPLTLGQASRVSGI