>gi|26554023|ref|NP_757957.1| IS1202-like transposase [Mycoplasma penetrans HF-2] >gi|26454031|dbj|BAC44361.1| transposase for IS1202-like insertion sequence element [Mycoplasma penetrans HF-2] (562 aa)
Score = 2253, Expect = 0.0e+00, Identities = 518/518 (100%), Positives = 518/518 (100%)
  Q:     1 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI
  S:    45 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 562
>gi|26553469|ref|NP_757403.1| transposase [Mycoplasma penetrans HF-2] >gi|26453475|dbj|BAC43807.1| transposase [Mycoplasma penetrans HF-2] (518 aa)
Score = 2250, Expect = 0.0e+00, Identities = 517/518 (99%), Positives = 518/518 (100%)
  Q:     1 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           +SLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI
  S:     1 MSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
>gi|26553992|ref|NP_757926.1| IS1202-like transposase [Mycoplasma penetrans HF-2] >gi|26454000|dbj|BAC44330.1| transposase for IS1202-like insertion sequence element [Mycoplasma penetrans HF-2] (518 aa)
Score = 2214, Expect = 0.0e+00, Identities = 508/518 (98%), Positives = 514/518 (99%)
  Q:     1 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           +SLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSK+ITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGK LGFW+DDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIK+SK+DLKDLFYTTKICKVLKGFYFF NGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEI DNEFLKLEKIKRKSIA SKAIYQKNENTRIALERWS+SLKEREEKIKIREIELSLNI
  S:     1 MSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKRITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKFLGFWMDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKLSKNDLKDLFYTTKICKVLKGFYFFHNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIQDNEFLKLEKIKRKSIAASKAIYQKNENTRIALERWSNSLKEREEKIKIREIELSLNI 518
>gi|26554233|ref|NP_758167.1| IS1202 transposase [Mycoplasma penetrans HF-2] >gi|26454242|dbj|BAC44571.1| transposase for IS1202-like insert sequence element [Mycoplasma penetrans HF-2] (518 aa)
Score = 2204, Expect = 0.0e+00, Identities = 514/518 (99%), Positives = 515/518 (99%)
  Q:     1 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           +SLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKK TRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFF NGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIA SKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI
  S:     1 MSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKTTRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFHNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIAASKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
>gi|26553684|ref|NP_757618.1| IS1202-like transposase [Mycoplasma penetrans HF-2] >gi|26453690|dbj|BAC44022.1| transposase for IS1202-like insertion sequence element [Mycoplasma penetrans HF-2] (518 aa)
Score = 2202, Expect = 0.0e+00, Identities = 507/518 (97%), Positives = 511/518 (98%)
  Q:     1 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           +SLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDE KDKFNVKYGFVNKLLNENFLLTSYSK+ITRKTMKKKLKE NLAELKIQEKI EFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGA NIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIK+SKDDLKDLFYTTKICKVLKGFYFF NGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKN+KYFAREINDDLLNEYINEI DNEFLKLEKIKRKSIA SKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI
  S:     1 MSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDETKDKFNVKYGFVNKLLNENFLLTSYSKRITRKTMKKKLKEDNLAELKIQEKIFEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGASNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKLSKDDLKDLFYTTKICKVLKGFYFFHNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNSKYFAREINDDLLNEYINEIQDNEFLKLEKIKRKSIAASKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
>gi|26553686|ref|NP_757620.1| transposase [Mycoplasma penetrans HF-2] >gi|26453692|dbj|BAC44024.1| transposase [Mycoplasma penetrans HF-2] (518 aa)
Score = 2200, Expect = 0.0e+00, Identities = 506/518 (97%), Positives = 513/518 (99%)
  Q:     1 LSLKKTNQLFVILSLLEFNLVRCFFMKEIIKNNLTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           +SLKKTNQLFVILSLLEFNL+RCFFMKEIIKNNLTK ENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKEN NK+KDEVKRAIIEKYIEVTTP KEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKK TRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFW+DDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIK+SKDDLKDLFYTTKICKVLKGFYFF NGKA+GLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWS+SLKEREEKIKIREIELSLNI
  S:     1 MSLKKTNQLFVILSLLEFNLLRCFFMKEIIKNNLTKLENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENANKVKDEVKRAIIEKYIEVTTPYKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKSTRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWMDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKLSKDDLKDLFYTTKICKVLKGFYFFHNGKAIGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSNSLKEREEKIKIREIELSLNI 518
>gi|26554024|ref|NP_757958.1| IS1202-like transposase [Mycoplasma penetrans HF-2] >gi|26454032|dbj|BAC44362.1| transposase for IS1202-like insertion sequence element [Mycoplasma penetrans HF-2] (471 aa)
Score = 2005, Expect = 0.0e+00, Identities = 460/471 (97%), Positives = 467/471 (99%)
  Q:    48 MGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIHDNEFLKLEKIKRKSIATSKAIYQKNENTRIALERWSDSLKEREEKIKIREIELSLNI 518
           MGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKR+IIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSK+I RKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDAC+SVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWS+NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIK+SKDDLKDLFYTTKICKVLKGFYFF NGKAMGLFTKEDKRV+MKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEI DNEFLKLEKIKRKSIA SKAIYQKNENTRIALERWS+SLKEREEKIKIREIELSLNI
  S:     1 MGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDNTFLISHKNKNKENVNKIKDEVKRSIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKRIIRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACISVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSKNSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKLSKDDLKDLFYTTKICKVLKGFYFFHNGKAMGLFTKEDKRVSMKNQILLRTNMLTGEKFVLDKNTKYFAREINDDLLNEYINEIQDNEFLKLEKIKRKSIAASKAIYQKNENTRIALERWSNSLKEREEKIKIREIELSLNI 471
>gi|149006098|ref|ZP_01829827.1| putative transposase protein [Streptococcus pneumoniae SP18-BS74] >gi|147762454|gb|EDK69415.1| putative transposase protein [Streptococcus pneumoniae SP18-BS74] (350 aa)
Score = 179, Expect = 3.8e-11, Identities = 74/315 (23%), Positives = 147/315 (46%)
  Q:    54 KGKLNPKTLSNKTGYSIKQSRRFIKSFKDN-TFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           +GK   K    +   S +Q  R + +++        H N+N++  + I DE+K  I++KY+   T           + H    L E ++   +    V K+L +  +L+  S + T+K ++K+      A+L  ++ +   +      + E  K  +P   +  +  G ++++DA    W G++   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  IKTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E+        +  +N+++    K
  S:    15 QGKKTKKRACVELNLSERQINRLLLAYQQKEKEAFRHGNRNRKPKHAIPDEIKERILKKYLSYQTY-------KPNVRHFCELLAE-EEGIQLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNPKQPLDNPILPTAENFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGVETSNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQIKTDKRTVFTYQASNSKKMEDDTHTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNNIHTLEEANTFLPSYIQTFNEQFGNKTK 324
>gi|182684945|ref|YP_001836692.1| putative IS1202 transposase [Streptococcus pneumoniae CGSP14] >gi|182630279|gb|ACB91227.1| putative IS1202 transposase [Streptococcus pneumoniae CGSP14] (423 aa)
Score = 179, Expect = 3.9e-11, Identities = 75/315 (23%), Positives = 147/315 (46%)
  Q:    54 KGKLNPKTLSNKTGYSIKQSRRFIKSFKDN---TFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDF-YLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           +GK   K    +   S +Q  R + +++      F   H N+N++  + I DE+K  +++KYI   T         Y+   L F  L   ++   +    V K+L +  +L+  S + T+K ++K+      A+L + + +   +      + E  K  +P   +  +  G ++++DA    W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  +KTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E         +  +N+++    K
  S:    22 QGKKTKKRACVELNLSERQINRLLLAYQQKGKEAFRHGHGNRNRKPKHAIPDEIKERVLKKYISYET---------YKPNVLHFCELLAEEEGIKLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNLNQPLDNPILPTAKDFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGPETTNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQMKTDKRTVFTYQASNSKKMEDDTYTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNNIHTLEDANTFLLSYIQTFNEQFGNKTK 333
>gi|68642815|emb|CAI33157.1| putative IS1202 transposase [Streptococcus pneumoniae] (469 aa)
Score = 176, Expect = 9.4e-11, Identities = 74/315 (23%), Positives = 147/315 (46%)
  Q:    54 KGKLNPKTLSNKTGYSIKQSRRFIKSFKDN-TFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           +GK   K    +   S +Q  R + +++        H+N+N++  + I DE+K  I++KY+   T           + H    L E ++   +    V K+L +  +L+  S + T+K ++K+      A+L  ++ +   +      + E  K  +P   +  +  G ++++DA    W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  IKTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E+        +  +N+++    K
  S:    15 QGKKTKKRACVELNLSERQINRLLLAYQQKGKEAFRHRNRNRKPKHAIPDEIKERILKKYLSYETY-------KPNVRHFCELLAE-EEGIQLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNPKQPLDNPILPTAEKFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGAETSNLHLAIDDASGNILGSYFDKQETLNAYYHVLEQILANHGIPLQIKTDKRTVFTYQASNSKKMEDDTYTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNNIHTLEEANTFLPSYIQTFNEQFGNKTK 324
>gi|2497378|sp|Q54513|TRA2_STRPN Transposase for insertion sequence IS1202 >gi|551466|gb|AAA21852.1| transposase [Streptococcus pneumoniae] (465 aa)
Score = 174, Expect = 1.4e-10, Identities = 69/280 (24%), Positives = 134/280 (47%)
  Q:    89 HKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDF-YLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           H N+N++  + I DE+K  I++KY+   T         Y+   L F  L   ++   +    V K+L +  +L+  S + T+K ++K+      A+L + + +   +      + E  K  +P   +  +  G ++++DA    W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  +KTD+R  F           ++S T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E+        +  +N+++    K
  S:    51 HGNRNRKPKHAIPDEIKERILKKYLSYET---------YKPNVLHFCELLAEEEGIKLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNLNQPLDNPILPTAKDFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGPETTNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQMKTDKRTVFTYQASNSKKMEDDSYTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNKIHTLEEANTFLLSYIQTFNEQFGNKTK 324
>gi|149011392|ref|ZP_01832639.1| nicotinic acid mononucleotide adenyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|147764382|gb|EDK71313.1| nicotinic acid mononucleotide adenyltransferase [Streptococcus pneumoniae SP19-BS75] (465 aa)
Score = 172, Expect = 2.4e-10, Identities = 74/315 (23%), Positives = 147/315 (46%)
  Q:    54 KGKLNPKTLSNKTGYSIKQSRRFIKSFKDN-TFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDF-YLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           +GK   K    +   S +Q  R + +++        H N+N++  + I DE+K  I++KY+   T         Y+   L F  L   ++   +    V K+L +  +L+  S + T+K ++K+      A+L + + +   +      + E  K  +P   +  +  G ++++DA    W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  +KTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E+        +  +N+++    K
  S:    15 QGKKTKKRACVELNLSERQINRLLLAYQQKGKEAFRHGNRNRKPKHAIPDEIKERILKKYLSYET---------YKPNVLHFCELLAEEEGIKLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNLNQPLDNPILPTAKDFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGPETTNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQMKTDKRTVFTYQASNSKKMEDDTYTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNKIHTLEEANTFLLSYIQTFNEQFGNKTK 324
>gi|149012191|ref|ZP_01833300.1| putative transposase protein [Streptococcus pneumoniae SP19-BS75] >gi|147763793|gb|EDK70727.1| putative transposase protein [Streptococcus pneumoniae SP19-BS75] (465 aa)
Score = 172, Expect = 2.7e-10, Identities = 74/315 (23%), Positives = 146/315 (46%)
  Q:    54 KGKLNPKTLSNKTGYSIKQSRRFIKSFKDN-TFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDF-YLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           +GK   K    +   S +Q  R + +++        H N+N++  + I DE+K  I++KY+   T         Y+   L F  L   ++   +    V K+L +  +L+  S + T+K ++K+      A+L + + +   +      + E  K  +P   +  +  G ++++DA    W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  +KTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E         +  +N+++    K
  S:    15 QGKKTKKRACVELNLSERQINRLLLAYQQKGKEAFRHGNRNRKPKHAIPDEIKERILKKYLSYET---------YKPNVLHFCELLAEEEGIKLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNLNQPLDNPILPTAKDFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGPETTNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQMKTDKRTVFTYQASNSKKMEDDTYTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNNIHTLEDANTFLLSYIQTFNEQFGNKTK 324
>gi|68642499|emb|CAI32899.1| putative IS1202 transposase [Streptococcus pneumoniae] (465 aa)
Score = 170, Expect = 4.6e-10, Identities = 73/315 (23%), Positives = 147/315 (46%)
  Q:    54 KGKLNPKTLSNKTGYSIKQSRRFIKSFKDN-TFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDF-YLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           +GK   K    +   S +Q  R + +++        H N+N++  + I DE+K  +++KY+   T         Y+   L F  L   ++   +    V K+L +  +L+  S + T+K ++K+      A+L + + +   +      + E  K  +P   +  +  G ++++DA    W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  +KTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E+        +  +N+++    K
  S:    15 QGKKTKKRACVELNLSERQINRLLLAYQQKGKEAFRHGNRNRKPKHAIPDEIKERVLKKYLSYET---------YKPNVLHFCELLAEEEGIKLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNLNQPLDNPILPTTKDFLEDPKKVHPSRPRKKFA-GELIQMDASPHAWFGPETTNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQMKTDKRTVFTYQASNSKKMEDDTYTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELERNKIHTLEEANTFLLSYIQTFNEQFGNKTK 324
>gi|148996757|ref|ZP_01824475.1| putative transposase protein [Streptococcus pneumoniae SP11-BS70] >gi|147757332|gb|EDK64371.1| putative transposase protein [Streptococcus pneumoniae SP11-BS70] (469 aa)
Score = 170, Expect = 4.8e-10, Identities = 67/280 (23%), Positives = 132/280 (47%)
  Q:    89 HKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF---------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           H N+N++  + I DE+K  I++KY+   T           + H    L E ++   +    V K+L +  +L+  S + T+K ++K+      A+L  ++ +   +      + E  K  +P   +  +  G ++++D     W G +   ++ AID  +G +LG + D +ET   Y  +L+Q+L  +G P  IKTD+R  F           +++ T   Y  ++L I +++ S P  K  VER  +  Q        ++ ++T E+        +  +N+++    K
  S:    51 HGNRNRKPKHAIPDEIKERILKKYLSYETY-------KPNVRHFCELLAE-EEGIQLSDTTVRKILYKKNILSPKSHRKTKKRVRKQ------AKLNPKQPLDNLILPTAEDFLENPKKVHPSRPRKKFA-GELIQMDTSPHAWFGAETSNLHLAIDDASGNILGAYFDKQETLNAYYHVLEQILANHGIPLQIKTDKRTVFTYQASNSKKMEDDTHTQFGYACHQLGILLETTSIPQAKGRVERLNQTLQSRLPIELEQNNIHTLEEANTFLLSYIQTFNEQFGNKTK 324
>gi|169350532|ref|ZP_02867470.1| hypothetical protein CLOSPI_01300 [Clostridium spiroforme DSM 1552] >gi|169292852|gb|EDS74985.1| hypothetical protein CLOSPI_01300 [Clostridium spiroforme DSM 1552] (267 aa)
Score = 149, Expect = 1.1e-07, Identities = 35/105 (33%), Positives = 61/105 (58%)
  Q:   220 GHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRR---------KTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVER 324
           G ++++DA    WI    ++++ A+D  TG+++G + D +ET  GY  +L Q+L  YG P +  TDRR          TF  +++ T  +Y  + L + +K+ S    K  +ER
  S:     2 GEMIQMDASSFEWIDGHIWHLHLAVDDATGEVVGAYFDTQETLNGYYNVLYQILTNYGIPAMFYTDRRTVFEYKKKNNTFDDDDTFTQFSYACHNLGVDIKTTSIAQAKGRIER 115
>gi|110004497|emb|CAK98834.1| putative transposase of is1202 family protein [Spiroplasma citri] (405 aa)
Score = 149, Expect = 1.1e-07, Identities = 41/125 (32%), Positives = 71/125 (56%)
  Q:   206 KTKNPPYVKHNYDFGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW---------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQ 330
           K K+ P  +    FG +++ DA   +W+GI   K +++ AID  T  ++G + D +ET  GY  +L Q+L+ YG P    TD+R  F           +++ T  + C N+L +++ + S P  K  +ER +  +Q
  S:   114 KDKSHPLRERRKYFGELLQADASEHLWLGINHPKIFLHGAIDDATNTVVGLYFDYQETLNGYYNVLYQILKNYGIPMTFYTDKRTFFTYQKNNSKNEEKDTFTQFSICCNELSVEIITTSIPQAKGWIERLWGTSQ 249
>gi|78355788|ref|YP_387237.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78355792|ref|YP_387241.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218193|gb|ABB37542.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78218197|gb|ABB37546.1| putative transposase protein [Desulfovibrio desulfuricans G20] (442 aa)
Score = 148, Expect = 1.6e-07, Identities = 41/127 (32%), Positives = 63/127 (49%)
  Q:   220 GHIVEVDACVSVWIGIKKYYIYH-AIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKE 346
           G +V++DA    W+G       H AID  TG+++G WI+  E   GY ++L+Q+LE++G P  I  DR   F S  +                T     L  L ++  +   P  K  +ER ++  Q      F   G+ T E
  S:   136 GDLVQMDASPFDWLGDGVMRSLHGAIDDATGEVVGLWIEKNECLSGYLRVLRQMLERHGVPRAIYADRHTIFVSPKTGKLTIEEELQGKVAPQTQFGRVLETLGVRFIAARSPQAKGRIERLWRTLQSRLVIAFRLAGIRTVE 278
>gi|78355581|ref|YP_387030.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78356336|ref|YP_387785.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78356569|ref|YP_388018.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78356691|ref|YP_388140.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78356987|ref|YP_388436.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78357075|ref|YP_388524.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78357556|ref|YP_389005.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78357900|ref|YP_389349.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78358631|ref|YP_390080.1| putative transposase protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78217986|gb|ABB37335.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78218741|gb|ABB38090.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78218974|gb|ABB38323.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78219096|gb|ABB38445.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78219392|gb|ABB38741.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78219480|gb|ABB38829.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78219961|gb|ABB39310.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78220305|gb|ABB39654.1| putative transposase protein [Desulfovibrio desulfuricans G20] >gi|78221036|gb|ABB40385.1| putative transposase protein [Desulfovibrio desulfuricans G20] (450 aa)
Score = 148, Expect = 1.6e-07, Identities = 41/127 (32%), Positives = 63/127 (49%)
  Q:   220 GHIVEVDACVSVWIGIKKYYIYH-AIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKE 346
           G +V++DA    W+G       H AID  TG+++G WI+  E   GY ++L+Q+LE++G P  I  DR   F S  +                T     L  L ++  +   P  K  +ER ++  Q      F   G+ T E
  S:   144 GDLVQMDASPFDWLGDGVMRSLHGAIDDATGEVVGLWIEKNECLSGYLRVLRQMLERHGVPRAIYADRHTIFVSPKTGKLTIEEELQGKVAPQTQFGRVLETLGVRFIAARSPQAKGRIERLWRTLQSRLVIAFRLAGIRTVE 286
>gi|110003994|emb|CAK98334.1| putative transposase of is1202 family protein [Spiroplasma citri] (377 aa)
Score = 141, Expect = 1.1e-06, Identities = 48/183 (26%), Positives = 88/183 (48%)
  Q:   206 KTKNPPYVKHNYDFGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW---------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
           K K+ P  +    FG +++ DA   +W+GIK  K ++  AID  T   +G + + +ET  GY  +L Q+L+ YG P    TD+R  F           +++ T  + C N+L +++ + S P  K  +ER +   Q           + T E+  K  +  +  +N+ +        + F+   + D  +L  +
  S:    86 KDKSHPLRECRKCFGELLQADASEHLWLGIKHPKIFLRGAIDDATNTAVGLYFNYQETLNGYYNVLYQILKNYGIPMEFYTDKRTIFTYQKNNSKNEEKDTFTQFSRCCNELGVEIITTSIPQAKGRIERLWGALQDRLKNELSLAKVTTLEETNKFLKEFLPKFNKHFALPIDYNNSAFVDAPESDKINLLLS 279
>gi|121534611|ref|ZP_01666433.1| Integrase, catalytic region [Thermosinus carboxydivorans Nor1] >gi|121306863|gb|EAX47783.1| Integrase, catalytic region [Thermosinus carboxydivorans Nor1] (449 aa)
Score = 132, Expect = 1.2e-05, Identities = 44/145 (30%), Positives = 71/145 (48%)
  Q:   220 GHIVEVDACVSVWIGIKKYYI--YHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYK 364
           G ++++D     W+G  K YI    AID  TGK++G      E   GY ++L+Q++ KYG P  + TDR   F S N+               +T L   L++L I+         K  VER ++  Q          G+ T E+  +  Q  +  +N  ++
  S:   147 GMLIQMDGSPHAWLGEDKPYISLIGAIDDATGKIVGAIFRPTEDLNGYFEVLRQIITKYGIPIAVYTDRHSIFVSPNADKLTIEDQLEGKKANLTQLGRALSELGIEHIKARSAQAKGRVERLWETLQDRLRIEMALAGIQTIEQANEFLQKFILKHNAMFE 308
>gi|153814476|ref|ZP_01967144.1| hypothetical protein RUMTOR_00689 [Ruminococcus torques ATCC 27756] >gi|145847970|gb|EDK24888.1| hypothetical protein RUMTOR_00689 [Ruminococcus torques ATCC 27756] (446 aa)
Score = 128, Expect = 3.5e-05, Identities = 42/161 (26%), Positives = 77/161 (47%)
  Q:   220 GHIVEVDACVSVWIGIK-KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQL-IVDAYNQRYKKSEKGKRNQFIKISKD 380
           G ++++DA    W G   KY ++ AID  TG+++G ++   E  +GY + ++Q    +G P  + +D    F S  +               +T     L++L I +     P  K  +ER +   Q      F K G+ T  +  +  +    + +NQR+   E    + F+  +KD
  S:   141 GQLIQIDATPYEWFGGNIKYALHGAIDDATGQVVGLFLTQNECLYGYLETMRQCCSDFGIPQTVYSDNHTIFRSPKTGKLTVDELIAGKTVHLTQFGRSLHELGIDLIFAKTPQAKGRIERLWVTLQSRLPVEFAKRGITTVSEANRFLETEYRELFNQRF-AVEPEAESIFVSAAKD 317
>gi|153814474|ref|ZP_01967142.1| hypothetical protein RUMTOR_00687 [Ruminococcus torques ATCC 27756] >gi|145848870|gb|EDK25788.1| hypothetical protein RUMTOR_00687 [Ruminococcus torques ATCC 27756] (449 aa)
Score = 127, Expect = 3.8e-05, Identities = 42/161 (26%), Positives = 77/161 (47%)
  Q:   220 GHIVEVDACVSVWIGIK-KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQL-IVDAYNQRYKKSEKGKRNQFIKISKD 380
           G ++++DA    W G   KY ++ AID  TG+++G ++   E  +GY + ++Q    +G P  + +D    F S  +               +T     L++L I +     P  K  +ER +   Q      F K G+ T  +  +  +    + +NQR+   E    + F+  +KD
  S:   144 GQLIQIDATPYEWFGGNIKYALHGAIDDATGQVVGLFLTQNECLYGYLETMRQCCSDFGIPQTVYSDNHTIFRSPKTGKLTVDELIAGKTVHLTQFGRSLHELGIDLIFAKTPQAKGRIERLWVTLQSRLPVEFAKRGITTVSEANRFLETEYRELFNQRF-AVEPEAESIFVSAAKD 320
>gi|89071918|ref|ZP_01158514.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89072116|ref|ZP_01158712.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89072117|ref|ZP_01158713.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89072563|ref|ZP_01159135.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89072564|ref|ZP_01159136.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89074553|ref|ZP_01161025.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89074810|ref|ZP_01161264.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89076345|ref|ZP_01162682.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89076588|ref|ZP_01162895.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89076597|ref|ZP_01162904.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89076675|ref|ZP_01162967.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89076743|ref|ZP_01163024.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89047599|gb|EAR53210.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89047656|gb|EAR53261.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89047740|gb|EAR53340.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89047749|gb|EAR53349.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89047977|gb|EAR53567.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89049385|gb|EAR54947.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89049657|gb|EAR55216.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89051667|gb|EAR57120.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89051668|gb|EAR57121.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89052019|gb|EAR57470.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89052217|gb|EAR57668.1| probable transposase protein [Photobacterium sp. SKA34] >gi|89052218|gb|EAR57669.1| probable transposase protein [Photobacterium sp. SKA34] (452 aa)
Score = 125, Expect = 7.4e-05, Identities = 52/200 (26%), Positives = 87/200 (43%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW-------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKI--SKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNM 419
           G ++++D     W   +  K  +   ID  T  ++  +  D E+ F Y    KQ ++++G P  + TD+   F          N +T     L +L I++   + P  K  VER+    Q    K     G+N  E+  +     +D YN+R+ K  K + N    I  +  +L D+F      KV K      + K M L  K  +  N+
  S:   149 GELIQLDGSPHDWFEGRADKCTLLVFIDDATSAIMHLYFCDSESTFSYMAATKQYIQQHGKPVALYTDKHGVFRVNHASNEDRNKLTQYGRALKELNIELICANTPQAKGRVERANLTLQDRLVKEMRLAGINGIEEANEWLSGFIDNYNRRFAKPAKRQLNVHRPIYETPKELYDIFSWQTSRKVTKSLTLQYD-KVMYLLEKNSENENL 358
>gi|186475849|ref|YP_001857319.1| integrase catalytic region [Burkholderia phymatum STM815] >gi|184192308|gb|ACC70273.1| Integrase catalytic region [Burkholderia phymatum STM815] (494 aa)
Score = 124, Expect = 1.1e-04, Identities = 71/355 (20%), Positives = 139/355 (39%)
  Q:    34 LTKFENSRFWILEEMGSLNKKGKLNPKTLSNKTGYSIKQSRRFIKSFKDN--TFLISHKNKNKENVNKIKDEVKRAII---EKYIEV--TTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYV----KHNYDFGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
           +T  E  RF +++++     +G+L P   + + G + +Q RR +  ++++    LIS K     N     +  +RA+    E+Y +   T  C+++ + H                                       ++ ++T++K + E  L               + P      + + PP V          G +V++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P  + +D+   F         NSVT+    + +L I     +    K  VER+ +  Q    K     G+NT  +      + + AYN R+ K  K   +    +  D+  +L  T
  S:     9 MTMRELDRFKVIQDV----TEGRLKPWRAAERLGLTTRQVRRLVARYRESGAAGLISCKRGMPGNRRLDGELAQRALAIVRERYADFGPTLACEKLRECH-------------------------------------GIRLAKETVRKLMTEAGL---------------WIP------RRQRPPKVYQPRARRACLGELVQIDGSDHRWFEDRAPACTLLVY--VDDATSRLMALHFTATESTFSYFEATRAYIERHGKPGALYSDKYSVFRKTGANKDGNSVTHFGRAMYELNIDTFCANSSPAKGRVERAHQTLQDRLVKELRLRGINTVAEANAYAPIFMAAYNARFAKPPKSDFDAHRPLRADESLELVMT 320
>gi|188584670|ref|YP_001916215.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188584827|ref|YP_001916372.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188585026|ref|YP_001916571.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188585166|ref|YP_001916711.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188585370|ref|YP_001916915.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188586878|ref|YP_001918423.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188587067|ref|YP_001918612.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|188587301|ref|YP_001918846.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349357|gb|ACB83627.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349514|gb|ACB83784.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349713|gb|ACB83983.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349853|gb|ACB84123.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350057|gb|ACB84327.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351565|gb|ACB85835.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351754|gb|ACB86024.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351988|gb|ACB86258.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] (454 aa)
Score = 123, Expect = 1.2e-04, Identities = 45/161 (27%), Positives = 79/161 (49%)
  Q:   220 GHIVEVDACVSVWIGIK-KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEK----IQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKD 380
           G +V++DA    W        ++ AID  TG LLG +  + E   GY +++ Q++  YG P  + +D+   F S  S                T     + +L + +   + P  K  VER F   Q     LF  H + T EK    +QK++   +  +N+R+    + + + F  +++D
  S:   151 GLLVQIDASPYDWFDTGFDCDLHAAIDDATGALLGLFFVENECLEGYFQIMHQLISNYGIPASLYSDKHTIFRSPKSDKLSIDEQLAGKQVKPTQFGAAMEELGVTIIPANSPQAKGRVERLFDTLQSRLPTLFKLHNITTMEKANEFLQKDF---LPDFNKRFALKPENELSAFTCLNQD 328
>gi|188587420|ref|YP_001918965.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352107|gb|ACB86377.1| Integrase catalytic region [Natranaerobius thermophilus JW/NM-WN-LF] (464 aa)
Score = 122, Expect = 1.5e-04, Identities = 45/161 (27%), Positives = 79/161 (49%)
  Q:   220 GHIVEVDACVSVWIGIK-KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS---------------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEK----IQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKD 380
           G +V++DA    W        ++ AID  TG LLG +  + E   GY +++ Q++  YG P  + +D+   F S  S                T     + +L + +   + P  K  VER F   Q     LF  H + T EK    +QK++   +  +N+R+    + + + F  +++D
  S:   161 GLLVQIDASPYDWFDTGFDCDLHAAIDDATGALLGLFFVENECLEGYFQIMHQLISNYGIPASLYSDKHTIFRSPKSDKLSIDEQLAGKQVKPTQFGAAMEELGVTIIPANSPQAKGRVERLFDTLQSRLPTLFKLHNITTMEKANEFLQKDF---LPDFNKRFALKPENELSAFTCLNQD 338
>gi|163729891|ref|ZP_02137369.1| putative insertion sequence transposase protein [Vibrio fischeri MJ11] >gi|161396990|gb|EDQ21281.1| putative insertion sequence transposase protein [Vibrio fischeri MJ11] (456 aa)
Score = 122, Expect = 1.6e-04, Identities = 46/182 (25%), Positives = 81/182 (44%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSV-------TNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQF--IKISKDDLKDLFYTTKICKVLKGFYF 400
            G ++++D     W   +  K  +   ID  TG+L+     + E+ F Y    ++ ++++G P    +DR   F S N         T     L+ L I++   +    K  VER+    Q    K      +NT E+        +  +NQR+ K     ++    ++ SKD+L D+F   +I K+ K   F
  S:   139 LGELIQIDGSHHDWFEGRSSKCCLLVFIDDATGRLMNLRFSETESAFDYMMATREYIDEHGKPVAFYSDRHAIFHSSNKQAVESKHPTQYGRMLHDLGIELICANSSQAKGRVERANLTLQDRLVKEMRLQHINTIEEANAWLPYFIADFNQRFAKPANYPKDMHRPVRESKDELTDIFSWQEIRKLSKSLTF 331
>gi|21492773|ref|NP_659848.1| putative insertion sequence transposase protein [Rhizobium etli CFN 42] >gi|21467198|gb|AAM54861.1| putative insertion sequence transposase protein [Rhizobium etli CFN 42] (473 aa)
Score = 120, Expect = 2.6e-04, Identities = 40/154 (25%), Positives = 67/154 (43%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS--------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
           FG +V++D     W   +  K  +   ID  TGKLL       E  F Y    K  L+++G P    +D+   F S ++        +T     L +L I +   + P  K  VER+ +  Q    K     G++T E+        +  +N R+ K  +  ++
  S:   141 FGELVQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFAGSENTFDYLHATKAYLQQWGKPLAFYSDKHGVFRSTHASEKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANQTLQDRLVKEMRLRGIDTIEEANAYAPEFIADFNARFGKQPRNPKD 304
>gi|167362502|ref|ZP_02297027.1| Integrase catalytic region [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167070645|gb|EDR74596.1| Integrase catalytic region [Rhizobium leguminosarum bv. trifolii WSM1325] (474 aa)
Score = 119, Expect = 3.3e-04, Identities = 40/154 (25%), Positives = 66/154 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS--------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
           FG +V++D     W   +  K  +   ID  TGKLL       E  F Y    K  L+++G P    +D+   F S ++        +T     L +L I +   + P  K  VER+ +  Q    K     G++T E         +  +N R+ K  +  ++
  S:   141 FGELVQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFAGSENTFDYLHATKAYLQQWGKPLAFYSDKHGVFRSTHASEKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANQTLQDRLVKEMRLRGIDTIEAANAYAPEFIADFNSRFGKQPRNPKD 304
>gi|118589867|ref|ZP_01547271.1| putative insertion sequence transposase protein [Stappia aggregata IAM 12614] >gi|118437364|gb|EAV44001.1| putative insertion sequence transposase protein [Stappia aggregata IAM 12614] (469 aa)
Score = 118, Expect = 4.1e-04, Identities = 42/154 (27%), Positives = 68/154 (44%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDR----RKTFWSE----NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
           FG ++++D     W   +  K  +   ID  TGKLL       E  F Y +  K  LE++G P    +D+    R T  SE    + +T     L +L I +   + P  K  VER+ +  Q    K     G+N  E+        +  +N R+ K  +  ++
  S:   135 FGELIQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFALSENTFDYLQATKAYLEQWGKPLAFYSDKHGVFRTTHASETDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANRTLQDRLVKELRLRGINMLEEANAFAPEFIADFNGRFGKEPRNPKD 298
>gi|134291613|ref|YP_001115382.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] >gi|134134802|gb|ABO59127.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] (462 aa)
Score = 117, Expect = 6.7e-04, Identities = 38/170 (22%), Positives = 71/170 (41%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D C   W   +       +Y  +D  T +L+       E+ F Y +  +  LE++G P    +D+   F + +      SVT+    + +L I     +  + K  VER+    Q    K     G++T           +  YN+R+ K  +   N    +  D+  D+  T
  S:   135 LGELIQIDGCDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYLERHGKPVAFYSDKYSVFRNTSAGKTGQSVTHFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKEMRLRGISTVADANAYAPSFIATYNERFAKPPRSDFNAHRPLRSDEDLDVLLT 312
>gi|169200187|ref|ZP_02859469.1| Integrase catalytic region [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169085639|gb|EDS66358.1| Integrase catalytic region [Rhizobium leguminosarum bv. trifolii WSM2304] (475 aa)
Score = 116, Expect = 6.9e-04, Identities = 40/154 (25%), Positives = 65/154 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS--------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
            G +V++D     W   +  K  +   ID  TGKLL       E  F Y    K  L+++G P    +D+   F S ++        +T     L +L I +   + P  K  VER+ +  Q    K     G+NT E         +  +N R+ K  +  ++
  S:   141 LGELVQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFAASENTFDYLHATKAYLQQWGKPIAFYSDKHGVFRSTHASMKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANQTLQDRLVKELRLRGINTIEAANLYAPAFIADFNARFGKPPRNPKD 304
>gi|10954692|ref|NP_066627.1| hypothetical protein pRi1724_p047 [Agrobacterium rhizogenes] >gi|8918692|dbj|BAA97757.1| riorf46 [Agrobacterium rhizogenes] >gi|10567356|dbj|BAB16165.1| riorf46 [Agrobacterium rhizogenes] (475 aa)
Score = 116, Expect = 7.1e-04, Identities = 40/154 (25%), Positives = 65/154 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWS--------ENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
           FG +V++D     W   +  K  +   ID  TGKLL       E  F Y    K  L+++G P    +D+   F S         + +T     L +L I +   + P  K  VER+ +  Q    K     G++T E         +  +N R+ K  +  ++
  S:   141 FGELVQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFAGSENTFDYLHATKAYLQQWGKPLAFYSDKHGVFRSTHPSKKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANQTLQDRLVKEMRLRGIDTIEAANAYAPEFIADFNTRFGKPPRNPKD 304
>gi|163729888|ref|ZP_02137366.1| putative insertion sequence transposase protein [Vibrio fischeri MJ11] >gi|161396987|gb|EDQ21278.1| putative insertion sequence transposase protein [Vibrio fischeri MJ11] (456 aa)
Score = 116, Expect = 9.0e-04, Identities = 45/182 (24%), Positives = 82/182 (45%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSV-------TNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN--QFIKISKDDLKDLFYTTKICKVLKGFYF 400
            G ++++D     W   +  K  +   ID  TG+L+     + E+ F Y    ++ ++++G P    +DR   F S N         T     L+ L I++   +    K  VER+    Q    K      +NT E+        +  +NQR+ K     ++  + ++ SK++L D+F   +I K+ K   F
  S:   139 LGELIQIDGSHHDWFEGRSSKCCLLVFIDDSTGRLMNLRFSETESAFDYMMATREYIDEHGKPVAFYSDRHAIFHSSNKQAVESKHPTQYGRMLHDLGIELICANSSQAKERVERANLTLQDRLVKEMRLQHINTIEEANAWLPYFIADFNQRFAKPANYPKDMHRSVRESKNELTDIFSWQEIRKLSKSLTF 331
>gi|194563316|ref|YP_002098339.1| Transposase [Burkholderia dolosa AUO158] >gi|124894940|gb|EAY68820.1| Transposase [Burkholderia dolosa AUO158] (513 aa)
Score = 115, Expect = 9.7e-04, Identities = 39/170 (22%), Positives = 70/170 (41%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G +V++D     W   +  +  +   +D  T +L+       E+ F Y +  +  +E++G P  + +D+   F       S+N VT+    + +L I     +    K  VER+    Q    K     G++T           + AYN R+ K  K   +    +  D+  DL  T
  S:   160 LGELVQIDGSEHRWFEERAPQCTLLVYVDDATSRLMMLHFTATESTFSYFEATRAYIERHGKPGALYSDKYSVFRNVNPGKSDNRVTHFGRAMYELNIDTFCANSSPAKGRVERAHLTLQDRLVKELRLRGISTVADANAYAPSFIAAYNARFAKPPKSDFDAHRPLRTDESLDLVLT 337
>gi|84060734|ref|YP_444089.1| putative transposase [Escherichia coli] >gi|83743323|gb|AAX22102.2| putative transposase [Escherichia coli] (349 aa)
Score = 115, Expect = 1.1e-03, Identities = 40/168 (23%), Positives = 78/168 (46%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN--QFIKISKDDLKDLF 386
            G +V++D     W   +  K  +   +D  T +L+     + E+ F Y    ++ LE++G P    +D+   F   N       VT     L++L I +   + P  K  V+R+ +  Q    K     G+++ E+        +  +N+R+ + EK  ++  + +  S D+L D+F
  S:    36 LGELVQIDGSPHDWFEGRAPKCCLLVFVDDATSRLMHLRFGETESAFDYMMATREYLEQHGKPLAFYSDKHGIFRVNNGGSTTTGVTQFGRVLSELGIGLICANSPQAKGRVKRANQTLQDRLIKEMRLEGISSIEEANAWLDTFIADFNRRFARPEKYPKDLHRPVAESNDELDDIF 213
>gi|194565050|ref|YP_002100072.1| Transposase [Burkholderia dolosa AUO158] >gi|194566331|ref|YP_002101352.1| Transposase [Burkholderia dolosa AUO158] >gi|124898710|gb|EAY70553.1| Transposase [Burkholderia dolosa AUO158] >gi|124901083|gb|EAY71833.1| Transposase [Burkholderia dolosa AUO158] (437 aa)
Score = 114, Expect = 1.4e-03, Identities = 39/170 (22%), Positives = 70/170 (41%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G +V++D     W   +  +  +   +D  T +L+       E+ F Y +  +  +E++G P  + +D+   F       S+N VT+    + +L I     +    K  VER+    Q    K     G++T           + AYN R+ K  K   +    +  D+  DL  T
  S:    84 LGELVQIDGSEHRWFEERAPQCTLLVYVDDATSRLMMLHFTATESTFSYFEATRAYIERHGKPGALYSDKYSVFRNVNPGKSDNRVTHFGRAMYELNIDTFCANSSPAKGRVERAHLTLQDRLVKELRLRGISTVADANAYAPSFIAAYNARFAKPPKSDFDAHRPLRTDESLDLVLT 261
>gi|194562809|ref|YP_002097832.1| Transposase [Burkholderia dolosa AUO158] >gi|124894433|gb|EAY68313.1| Transposase [Burkholderia dolosa AUO158] (488 aa)
Score = 114, Expect = 1.4e-03, Identities = 39/170 (22%), Positives = 70/170 (41%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G +V++D     W   +  +  +   +D  T +L+       E+ F Y +  +  +E++G P  + +D+   F       S+N VT+    + +L I     +    K  VER+    Q    K     G++T           + AYN R+ K  K   +    +  D+  DL  T
  S:   135 LGELVQIDGSEHRWFEERAPQCTLLVYVDDATSRLMMLHFTATESTFSYFEATRAYIERHGKPGALYSDKYSVFRNVNPGKSDNRVTHFGRAMYELNIDTFCANSSPAKGRVERAHLTLQDRLVKELRLRGISTVADANAYAPSFIAAYNARFAKPPKSDFDAHRPLRTDESLDLVLT 312
>gi|170733025|ref|YP_001764972.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|169816267|gb|ACA90850.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] (496 aa)
Score = 112, Expect = 2.3e-03, Identities = 40/170 (23%), Positives = 68/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P    +D+   F       + N VT     + +L I     +  + K  VER+    Q    K     G+NT           + AYN R+ K  K   N    +  D+  DL  T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYIERHGKPGAFYSDKASVFRNVKPGKTGNRVTPFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKEMRLRGINTMADANAYAPSFMAAYNTRFAKPPKSDFNAHRPLRADESLDLALT 320
>gi|170734705|ref|YP_001773819.1| integrase catalytic region [Burkholderia cenocepacia MC0-3] >gi|169820743|gb|ACA95324.1| Integrase catalytic region [Burkholderia cenocepacia MC0-3] (496 aa)
Score = 111, Expect = 2.8e-03, Identities = 40/170 (23%), Positives = 68/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P    +D+   F       + N VT     + +L I     +  + K  VER+    Q    K     G+NT           + AYN R+ K  K   N    +  D+  DL  T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYIERHGKPGAFYSDKASVFRNVKPGKTGNRVTPFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKEMRLRGINTVADANAYAPSFMAAYNTRFAKPPKSDFNAHRPLRADESLDLALT 320
>gi|194556394|ref|YP_002091420.1| Transposase [Burkholderia cenocepacia PC184] >gi|194556987|ref|YP_002092013.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870185|gb|EAY61901.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870778|gb|EAY62494.1| Transposase [Burkholderia cenocepacia PC184] (496 aa)
Score = 111, Expect = 3.0e-03, Identities = 40/170 (23%), Positives = 68/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P    +D+   F       + N VT     + +L I     +  + K  VER+    Q    K     G+NT           + AYN R+ K  K   N    +  D+  DL  T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYIERHGKPGAFYSDKASVFRNVKPGKTGNRVTPFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKEMRLRGINTVADANAYAPSFMAAYNTRFAKPPKSDFNAHRPLRADESLDLALT 320
>gi|110005076|emb|CAK99406.1| putative transposase of is1202 family c-terminal truncated protein [Spiroplasma citri] (220 aa)
Score = 111, Expect = 3.0e-03, Identities = 29/85 (34%), Positives = 48/85 (56%)
  Q:   206 KTKNPPYVKHNYDFGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF 290
           K K+ P  +    FG +++ DA   +W+GI   K +++ AID  T  ++G + D +ET  GY  +L Q+L+ YG      TD++  F
  S:   129 KDKSHPLRERRKYFGELLQADASEHLWLGINHPKIFLHGAIDDATNTVVGLYFDYQETLNGYYNVLYQILKNYGITMTFYTDKQTIF 215
>gi|121583457|ref|YP_973888.1| integrase catalytic subunit [Polaromonas naphthalenivorans CJ2] >gi|121604890|ref|YP_982219.1| integrase catalytic subunit [Polaromonas naphthalenivorans CJ2] >gi|120593859|gb|ABM37298.1| Integrase, catalytic region [Polaromonas naphthalenivorans CJ2] >gi|120596711|gb|ABM40146.1| Integrase, catalytic region [Polaromonas naphthalenivorans CJ2] (464 aa)
Score = 111, Expect = 3.2e-03, Identities = 40/172 (23%), Positives = 71/172 (41%)
  Q:   220 GHIVEVDACVSVWIGIKK----YYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWS-------ENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKI 391
           G ++++D     W   +       +Y  ID  T +L+       E+ F Y +  +  LE++G P    +D+   F S           T     L +L I +   +    K  VER+    Q    K     G+NT+E         +  +N R+ K  K + +    +  D+  DL +T ++
  S:   145 GELIQIDGSDHAWFESRSAPCTLLVY--IDDATSRLMQLHFVPTESAFAYFEATRAYLEQHGKPVAFYSDKASIFRSVRDSTDFGRGTTQFGRVLFELNIDIWCANSSQAKGRVERANLTLQDRLVKELRLRGINTREAANAFAPHFMADFNARFAKPPKSQFDAHRPVRDDEDLDLLFTWRL 325
>gi|167077114|ref|YP_001661476.1| integrase [Acinetobacter venetianus] >gi|167077119|ref|YP_001661481.1| integrase [Acinetobacter venetianus] >gi|83833716|gb|ABC47672.1| integrase [Acinetobacter venetianus] >gi|83833721|gb|ABC47677.1| integrase [Acinetobacter venetianus] (445 aa)
Score = 110, Expect = 4.2e-03, Identities = 42/181 (23%), Positives = 82/181 (45%)
  Q:   206 KTKNPPYVKHNYD-FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISK--DDLKDLF 386
           + K P   ++N D +G ++++D     W   +  K  +   ID  TGKL      + E+ F Y    +  +E++G P    +D+   F    S      +T     L+ L I +   + P  K  VER+ +  Q    K     G+ + E+         + +N+++ K+    +N    +++  ++L D+F
  S:   125 RLKRPYQPRYNRDCYGELIQIDGSHHDWFEGRAAKCCLLVFIDDATGKLQHLRFCESESTFDYMISTRLYVEQHGKPLAFYSDKHSVFRVNQSSKKDTKITQFGRVLSTLNIDIIFANSPQAKGRVERANRTLQDRLIKEMRLEGICSIEQANAWLPCFTEQFNRKFAKTAFNSKNLHRNVTETAEELDDIF 316
>gi|190410390|ref|YP_001965893.1| Y4bF [Klebsiella pneumoniae] >gi|146151184|gb|ABQ02950.1| Y4bF [Klebsiella pneumoniae] (331 aa)
Score = 109, Expect = 4.5e-03, Identities = 40/168 (23%), Positives = 71/168 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN-----SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKI--SKDDLKDLF 386
           +G ++++D     W   +  K  +   ID  T  L+       ET   Y + L+  L  +G P  + +DR   F   N      +T  T  +  L I+    + P  K  VER+ +  Q    K     G++  E         ++AYN R+    +   N  + +  S+++L  +F
  S:    27 YGELIQIDGSPHDWFEGRGPKCTLIVFIDDATSALMALRFAPAETTRAYMETLRGYLNDHGVPLALYSDRHSIFRVNNPEREGELTQFTRAIKTLGIEPIHANSPQAKGRVERANQTLQDRLVKEMRLQGISDIETANAWLPTFIEAYNNRFATPPRIADNAHLDVHHSEEELGYIF 203
>gi|186474381|ref|YP_001863352.1| integrase catalytic region [Burkholderia phymatum STM815] >gi|184198340|gb|ACC76302.1| Integrase catalytic region [Burkholderia phymatum STM815] (374 aa)
Score = 108, Expect = 6.3e-03, Identities = 41/192 (21%), Positives = 77/192 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE-------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLF 410
           FG ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  LE++G P    +D+   F+ +         VT     + +L I     +    K  VER+    Q    K     G++T E         + AYN R+ K  +   +    +  D+  D   T ++ + +      LN + + L 
  S:   143 FGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMTLHFTPTESTFSYFEATRAYLERHGKPVAFYSDKASVFYVKRRAETAGKGVTQFGRAMYELNIDTFCANSSPAKGRVERAHLTLQDRLVKELRLRGISTIEAANAWAPAFMAAYNARFAKPPRSTFDAHRPLRTDENLDAILTWRVRRKVSRSLTVLNDRVIWLL 343
>gi|188591689|ref|YP_001796288.1| transposase, ISNCY family [Cupriavidus taiwanensis] >gi|170939084|emb|CAP64102.1| transposase, ISNCY family [Cupriavidus taiwanensis] (456 aa)
Score = 108, Expect = 6.7e-03, Identities = 38/169 (22%), Positives = 67/169 (39%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF-------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFY 387
           +G ++++D C   W   +       +Y  +D  T +++       E  F Y    +  LE++G P    +D+   F        S +  T     L +L I+    +    K  VER+    Q    K     G++T E         +  YN R+ K  +   N    +  D+  DL +
  S:   133 YGELIQIDGCDHRWFEERAPACTLLVY--VDDATSRIMELRFTHSEATFTYFAATRAYLERHGKPVAFYSDKASVFRVNKQGATSGDGHTQFARALFELNIEGICANSSQAKGRVERTHLTLQDRLVKELRLRGISTMEAANGFMAEFIADYNARFAKVPRNNHNAHRPLRPDENLDLIF 310
>gi|115358582|ref|YP_775720.1| integrase catalytic subunit [Burkholderia ambifaria AMMD] >gi|115361257|ref|YP_778394.1| integrase catalytic subunit [Burkholderia ambifaria AMMD] >gi|115283870|gb|ABI89386.1| Integrase, catalytic region [Burkholderia ambifaria AMMD] >gi|115286585|gb|ABI92060.1| Integrase, catalytic region [Burkholderia ambifaria AMMD] (496 aa)
Score = 108, Expect = 7.3e-03, Identities = 39/170 (22%), Positives = 68/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P    +D+   F       + N VT     + +L I     +  + K  VER+    Q    K     G+NT           + AYN R+ K  K   +    +  D+  DL  T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRAYIERHGKPGAFYSDKASVFRNVKPGKTGNRVTPFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKEMRLRGINTVADANAYAPSFMAAYNARFAKPPKSDFDAHRPLRADENLDLVLT 320
>gi|54297513|ref|YP_123882.1| hypothetical protein lpp1558 [Legionella pneumophila str. Paris] >gi|53751298|emb|CAH12709.1| hypothetical protein [Legionella pneumophila str. Paris] (401 aa)
Score = 108, Expect = 7.4e-03, Identities = 45/224 (20%), Positives = 95/224 (42%)
  Q:   206 KTKNPPYVK---HNYDFGHIVEVDACVSVWIGIKKYY-IYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN---SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQL-IVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDKRVNMKNQILLRTNM 429
           + K  PY +       FG ++++D  +  W+G  K++ + + +D  T   L      E T   + +  K+ LEKYG P  I  D +  + S        +     NKL I++     P  K  VER+    Q  + K      ++T ++  +  +   +D  N+++ K  + + +    + + DL  +       ++   + F+  G    +   +   +  K  + +R ++
  S:   120 QRKRSPYRRKRERKAQFGELIQMDGSIHDWLGTGKHHCLLNMVDDATSTSLSTLASGETTRVVF-ECFKKWLEKYGIPLAIYVDLKNVYVSNKRHPGFCHFEVACNKLGIRIIKAYSPQAKGRVERNHAVYQDRFVKELRLENIHTVDEANEVLENGFIDHLNEKFSKPAQNQESAHRPLGRTDLDQILCWEYQRQIQHDWTFYFQGTLYQVKKHQGDWIKPKVSVFVRKHL 350
>gi|170020082|ref|YP_001725036.1| integrase catalytic region [Escherichia coli ATCC 8739] >gi|169755010|gb|ACA77709.1| Integrase catalytic region [Escherichia coli ATCC 8739] (437 aa)
Score = 108, Expect = 7.5e-03, Identities = 40/168 (23%), Positives = 71/168 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN-----SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKI--SKDDLKDLF 386
           +G +++VD     W   +  +  +   ID  T  L+       ET   Y + L+  L  +G P  + +DR   F   N      +T  T  +  L I+    + P  K  VER+ +  Q    K      ++  E         ++AYN R+  S +   N  + +  S+++L  +F
  S:   133 YGELIQVDGSPHDWFENRGPRCTLIVFIDDATSALMALRFVPAETTRAYMETLRGYLNDHGVPLALYSDRHSIFRVNNPEREGELTQFTRAIKTLGIEPIHANSPQAKGRVERANQTLQDRLVKEMRLQNISDIETANAWLPTFIEAYNNRFATSPRTTDNAHLDVHHSEEELGYIF 309
>gi|71906939|ref|YP_284526.1| integrase catalytic subunit [Dechloromonas aromatica RCB] >gi|71907284|ref|YP_284871.1| integrase catalytic subunit [Dechloromonas aromatica RCB] >gi|71907341|ref|YP_284928.1| integrase catalytic subunit [Dechloromonas aromatica RCB] >gi|71907905|ref|YP_285492.1| integrase catalytic subunit [Dechloromonas aromatica RCB] >gi|71846560|gb|AAZ46056.1| Integrase, catalytic region [Dechloromonas aromatica RCB] >gi|71846905|gb|AAZ46401.1| Integrase, catalytic region [Dechloromonas aromatica RCB] >gi|71846962|gb|AAZ46458.1| Integrase, catalytic region [Dechloromonas aromatica RCB] >gi|71847526|gb|AAZ47022.1| Integrase, catalytic region [Dechloromonas aromatica RCB] (275 aa)
Score = 107, Expect = 7.8e-03, Identities = 39/156 (25%), Positives = 80/156 (51%)
  Q:   211 PYVKHNYDFGHIVEVDACVSVWIGIKKYYIYHA--IDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKAN--VERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKS 366
           PY+  +       +V A  + +I +++ ++Y +  +D  T ++L + + +  T+      L++ + KYG P I+ TD+   F S   +      L +  IQV  + +  ++ N  VER +K+ +  Y +++L HG +T  ++++      D YN+R   S
  S:   102 PYLLRDLAIDRPNQVWAMDTTYIPMRRGFVYLSAVLDWATRRVLAWRLSNSLTSDPCVDALEEAIMKYGRPEIMNTDQGSQFTSSAFIG----LLQESTIQVSMDGKGCWRDNVFVERLWKSVK--YEEIYL-HGYDTVSEVRQALARYFDFYNRRRPHS 254
>gi|172063328|ref|YP_001810979.1| integrase catalytic region [Burkholderia ambifaria MC40-6] >gi|171995845|gb|ACB66763.1| Integrase catalytic region [Burkholderia ambifaria MC40-6] (468 aa)
Score = 107, Expect = 8.5e-03, Identities = 47/195 (24%), Positives = 80/195 (41%)
  Q:   205 LKTKNPPYV----KHNYDFGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKD-DLKDLFY---TTKICKVLKGFY 399
           L+ + PP V          G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P    +D+   F S N      SVT+    + +L I     +  + K  VER+    Q    K     G++T           +  YN R+ K  +   N    +  D DL  L     T ++ K L   Y
  S:   117 LRRQRPPKVYQPRARRACLGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMHLHFTATESTFSYFEATRAYIERHGKPVAFYSDKYSVFRSTNAGKTGSSVTHFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKELRLRGISTVADANAYAPSFIAMYNARFAKPPRSDFNAHRPLRDDEDLDRLLTWRETRRVSKSLTVLY 327
>gi|170704266|ref|ZP_02894824.1| Integrase catalytic region [Burkholderia ambifaria IOP40-10] >gi|170130825|gb|EDS99594.1| Integrase catalytic region [Burkholderia ambifaria IOP40-10] (380 aa)
Score = 107, Expect = 9.2e-03, Identities = 39/170 (22%), Positives = 69/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E++G P+   +D+   F       + N VT     + +L I     +  + K  VER+    Q    K     G+NT           + AYN R+ K  K   +    +  D+  DL  T
  S:    27 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYIERHGKPSAFYSDKASVFRNVKPGKTGNRVTPFGRAMYELNIDTFCANSSSAKGRVERAHLTLQDRLVKEMRLRGINTVADANAYAPSFMAAYNARFAKPPKSDFDAHRPLRADENLDLVLT 204
>gi|152973464|ref|YP_001338515.1| Sea24 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150958256|gb|ABR80285.1| Sea24 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (452 aa)
Score = 107, Expect = 9.9e-03, Identities = 44/182 (24%), Positives = 81/182 (44%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKI--SKDDLKDLFYTTKICKVLKGFYF 400
            G +V++D     W   +  K  +   ID  TG+L+     + E+ F Y    +  LE++G P    +D+   F   N       +T     L++L I++   + P  K  VER+ +  Q    K     G+++ E         +  +N+R+ +  K  ++    +  S +DL D+F   +  K+ K   F
  S:   139 LGELVQIDGSPHDWFEGRAPKCCLLVFIDDATGRLMHLRFGETESAFDYMMATRAYLEQHGKPLAFYSDKHGIFRVNNGGTTTTGITQFGRVLSELGIELICANSPQAKGRVERANQTLQDRLIKEMRLEGISSIEDANAWLDSFIIDFNRRFARPAKYPKDLHRPVLESSEDLDDIFAWQESRKLSKTLTF 330
>gi|18466594|ref|NP_569402.1| putative transposase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|160431836|ref|YP_001551950.1| putative transposase [Salmonella enterica subsp. enterica serovar Choleraesuis] >gi|16505910|emb|CAD09789.1| putative transposase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|159885377|dbj|BAF92981.1| putative transposase [Salmonella enterica subsp. enterica serovar Choleraesuis] (465 aa)
Score = 107, Expect = 9.9e-03, Identities = 41/169 (24%), Positives = 69/169 (40%)
  Q:   220 GHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
           G ++++D C   W   +       +Y  +D  T +L+       E+ F Y +  +  +EKYG P I+ +D+   F   N         T     +  L I          K  VER+    Q    K     G++T E      +  +  YN+R+ K+     N    ++ DD  D  +T
  S:   144 GELIQIDGCDHHWFENRGRPCTALVY--VDDATSRLMHLLFVKSESTFSYFEATRGYIEKYGKPMILYSDKASVFRVNNKHATTGPGETQFARAMRCLNITPLCAETSQAKGRVERAHLTLQDRLVKELRLKGISTIEAANAFAEEYMADYNRRFAKAPLHDFNAHRPLALDDDLDAEFT 321
>gi|194436616|ref|ZP_03068717.1| Y4bF [Escherichia coli 101-1] >gi|194424648|gb|EDX40634.1| Y4bF [Escherichia coli 101-1] (437 aa)
Score = 106, Expect = 1.1e-02, Identities = 39/168 (23%), Positives = 71/168 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN-----SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKI--SKDDLKDLF 386
           +G ++++D     W   +  +  +   ID  T  L+       ET   Y + L+  L  +G P  + +DR   F   N      +T  T  +  L I+    + P  K  VER+ +  Q    K      ++  E         ++AYN R+  S +   N  + +  S+++L  +F
  S:   133 YGELIQIDGSPHDWFENRGPRCTLIVFIDDATSALMALRFVPAETTRAYMETLRGYLNDHGVPLALYSDRHSIFRVNNPEREGELTQFTRAIKTLGIEPIHANSPQAKGRVERANQTLQDRLVKEMRLQNISDIETANAWLPTFIEAYNNRFATSPRTTDNAHLDVHHSEEELGYIF 309
>gi|169197443|ref|ZP_02856791.1| Integrase catalytic region [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169090153|gb|EDS68865.1| Integrase catalytic region [Rhizobium leguminosarum bv. trifolii WSM2304] (475 aa)
Score = 106, Expect = 1.2e-02, Identities = 40/154 (25%), Positives = 65/154 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF----WSE----NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
            G +V++D     W   +  K  +   ID  TGKLL       E  F Y    K  L+++G P    +D+   F     SE    + +T     L +L I +   + P  K  VER+ +  Q    K     G++T E         +  +N R+ K  +  ++
  S:   141 LGELVQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFAGSENTFDYLHATKAYLQQWGKPLAFYSDKHGVFRPVHASEKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANQTLQDRLVKELRLRGIDTIEAANLYAPAFIADFNARFGKPPRNPKD 304
>gi|171319156|ref|ZP_02908276.1| integrase, catalytic region [Burkholderia ambifaria MEX-5] >gi|171095636|gb|EDT40596.1| integrase, catalytic region [Burkholderia ambifaria MEX-5] (496 aa)
Score = 105, Expect = 1.5e-02, Identities = 40/170 (23%), Positives = 67/170 (39%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  +E +G P    +D+   F +       N VT+    + +L I     +    K  VER+    Q    K     G+NT           + AYN R+ K  K   N    +  D+  DL  T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLNFTQTESTFSYFEATRAYIECHGKPGAFYSDKYSVFRNTTPGKTGNRVTHFGRAMYELNIDTFCANSSPAKGRVERAHLTLQDRLVKEMRLRGINTVADANAYAPSFMAAYNTRFAKPPKSDFNAHRSLRADENLDLVMT 320
>gi|162957999|ref|YP_001621431.1| Sea28 [Serratia entomophila] >gi|155382586|gb|ABU23781.1| Sea28 [Serratia entomophila] (354 aa)
Score = 105, Expect = 1.7e-02, Identities = 38/169 (22%), Positives = 72/169 (42%)
  Q:   220 GHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
           G ++++D C   W   +       +Y  +D  T +L+       E+ F Y +  +  LEK+G P  + +D+   F   N         T     +++L IQ    +  + K  VER+    Q    K     G+++           +  YN+R+ K+ +   +    +  DD  + F+T
  S:   144 GELIQIDGCDHHWFENRAPACTVLVY--VDDATSQLMQLRFVKSESTFTYFEATRGYLEKHGKPLALYSDKASVFRINNKNATGGDGYTQFGRAMHELNIQTICANTSSAKGRVERAHLTLQDRLVKELRLRGISSVVAANDYADEFMADYNRRFAKAPRHNFDVHRSLENDDDLEAFFT 321
>gi|190410323|ref|YP_001965826.1| putative transposase [Klebsiella pneumoniae] >gi|146151117|gb|ABQ02883.1| putative transposase [Klebsiella pneumoniae] (467 aa)
Score = 104, Expect = 1.8e-02, Identities = 35/149 (23%), Positives = 66/149 (44%)
  Q:   220 GHIVEVDACVSVWI---GIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSV-------TNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           G ++++D C   W    G K   + + +D  T +L+       E+ F Y +  +  +EK+G P  + +D+   F   N         T     +++L IQ         K  VER+    Q    K     G+++ E      +  ++ YN+R+ K+ +
  S:   144 GELIQIDGCDHHWFENRGPKCTALVY-VDDATSRLMQLLFVKSESTFTYFEATRGYIEKHGKPLALYSDKASVFRINNKNATGGDGDTQFGRAMHELNIQTICAETSAAKGRVERAHLTLQDRLVKELRLQGISSMEAANAFAEEFMNDYNRRFAKAPR 301
>gi|169830531|ref|YP_001716513.1| integrase catalytic subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169637375|gb|ACA58881.1| Integrase, catalytic region [Candidatus Desulforudis audaxviator MP104C] (462 aa)
Score = 104, Expect = 1.9e-02, Identities = 37/144 (25%), Positives = 62/144 (43%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN---------------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY 363
           G +V+ DA    W   +  K  ++  ID  TGK+L  W   EE  +GY  +L   +  +G P  + TD    F+S                 ++T     L +L I       P  K  +ER ++  Q          G++  E       + ++ +N R+
  S:   157 GLLVQSDASPYAWFEDRGPKACLHGNIDDATGKILALWFRPEEDLYGYLMVLNLTVINHGIPVSLYTDGHSIFFSPKKDKLSIDEELAGKTVALTQFGKALEELGINHIQARSPQAKGRIERLWETLQSRLVIEMRLRGISNIEDANAFLPVFIERFNARF 317
>gi|38348000|ref|NP_941249.1| putative transposase [Serratia marcescens] >gi|38259477|emb|CAE51705.1| putative transposase [Serratia marcescens] (467 aa)
Score = 104, Expect = 2.0e-02, Identities = 35/149 (23%), Positives = 66/149 (44%)
  Q:   220 GHIVEVDACVSVWI---GIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSV-------TNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           G ++++D C   W    G K   + + +D  T +L+       E+ F Y +  +  +EK+G P  + +D+   F   N         T     +++L IQ         K  VER+    Q    K     G+++ E      +  ++ YN+R+ K+ +
  S:   144 GELIQIDGCDHHWFENRGPKCTALVY-VDDATSRLMQLLFVKSESTFTYFEATRGYIEKHGKPLALYSDKASVFRINNKNATGGDGDTQFGRAMHELNIQTICAETSAAKGRVERAHLTLQDRLVKELRLQGISSMEAANAFAEEFMNDYNRRFAKAPR 301
>gi|169832005|ref|YP_001717987.1| integrase catalytic subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169638849|gb|ACA60355.1| Integrase, catalytic region [Candidatus Desulforudis audaxviator MP104C] (442 aa)
Score = 104, Expect = 2.0e-02, Identities = 37/144 (25%), Positives = 62/144 (43%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN---------------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY 363
           G +V+ DA    W   +  K  ++  ID  TGK+L  W   EE  +GY  +L   +  +G P  + TD    F+S                 ++T     L +L I       P  K  +ER ++  Q          G++  E       + ++ +N R+
  S:   137 GLLVQSDASPYAWFEDRGPKACLHGNIDDATGKILALWFRPEEDLYGYLMVLNLTVINHGIPVSLYTDGHSIFFSPKKDKLSIDEELAGKTVALTQFGKALEELGINHIQARSPQAKGRIERLWETLQSRLVIEMRLRGISNIEDANAFLPVFIERFNARF 297
>gi|169831113|ref|YP_001717095.1| integrase catalytic subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169831657|ref|YP_001717639.1| integrase catalytic subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169637957|gb|ACA59463.1| Integrase, catalytic region [Candidatus Desulforudis audaxviator MP104C] >gi|169638501|gb|ACA60007.1| Integrase, catalytic region [Candidatus Desulforudis audaxviator MP104C] (442 aa)
Score = 104, Expect = 2.0e-02, Identities = 37/144 (25%), Positives = 62/144 (43%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN---------------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY 363
           G +V+ DA    W   +  K  ++  ID  TGK+L  W   EE  +GY  +L   +  +G P  + TD    F+S                 ++T     L +L I       P  K  +ER ++  Q          G++  E       + ++ +N R+
  S:   137 GLLVQSDASPYAWFEDRGPKACLHGNIDDATGKILALWFRPEEDLYGYLMVLNLTVINHGIPVSLYTDGHSIFFSPKKDKLSIDEELAGKTVALTQFGKALEELGINHIQARSPQAKGRIERLWETLQSRLVIEMRLRGISNIEDANAFLPVFIERFNARF 297
>gi|84060887|ref|YP_444094.1| putative transposase [Escherichia coli] >gi|60499784|gb|AAX22097.1| putative transposase [Escherichia coli] (479 aa)
Score = 103, Expect = 2.3e-02, Identities = 40/169 (23%), Positives = 69/169 (40%)
  Q:   220 GHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
           G ++++D C   W   +       +Y  +D  T +L+       E+ F Y +  +  +EKYG P I+ +D+   F   N         T     +  L I          K  VER+    Q    K     G++T +      +  +  YNQR+ K+ +   N    ++  D  D  +T
  S:   158 GELIQIDGCDHHWFENRGRPCTALVY--VDDATSRLMHLLFVKSESTFTYFEATRGYIEKYGKPMILYSDKASVFRVNNKHATTGPGETQFARAMRCLNITPLCAETSQAKGRVERAHLTLQDRLVKELRLKGISTIDAANAFAEEYMADYNQRFAKAPRHDFNAHRPLALTDDLDAEFT 335
>gi|84385447|ref|ZP_00988478.1| probable transposase protein [Vibrio splendidus 12B01] >gi|84379427|gb|EAP96279.1| probable transposase protein [Vibrio splendidus 12B01] (340 aa)
Score = 103, Expect = 2.4e-02, Identities = 42/182 (23%), Positives = 78/182 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQF--IKISKDDLKDLFYTTKICKVLKGFYF 400
            G ++++D     W   +  K  +   ID  TG+L+     + E+ F Y    ++ L ++G P    +D+   F        +   T     L +L I++   +    K  VER+    Q    K     G+NT E+        +  +N R+ K  +  ++    ++ SK +L D+F   +  K+ K   F
  S:    27 LGELIQIDGSHHDWFEGRSDKCCLLVFIDDATGRLMNLRFSETESAFDYMLATREYLNEHGKPIAFYSDKHSIFRVNQEKHKQVGQTQYGRVLKELAIELICANSSQAKGRVERANLTLQDRLVKEMRLQGINTIEQANVWLPYFIADFNHRFAKPAQYPKDMHRPVRESKQELDDIFSWQETRKLSKSLTF 218
>gi|163759869|ref|ZP_02166953.1| putative insertion sequence transposase protein [Hoeflea phototrophica DFL-43] >gi|162282827|gb|EDQ33114.1| putative insertion sequence transposase protein [Hoeflea phototrophica DFL-43] (319 aa)
Score = 103, Expect = 2.5e-02, Identities = 36/126 (28%), Positives = 55/126 (43%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS--------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNT 344
            G +V++D     W   +  K  +   ID  TGKLL       E  F Y    K  LE++G P    +D+   F S ++        +T     L +L I +   + P  K  VER+ +  Q    K     G++T
  S:   135 LGELVQIDGSHHWWFENRGPKCALLVYIDDATGKLLHLRFAPSENTFDYLLATKAYLEEWGKPIAFYSDKHGVFRSTHASEKDRTSGLTQFGRALYELNIDIICANTPQAKGRVERANRTLQDRLVKELRLRGIST 270
>gi|92109288|ref|YP_571576.1| integrase catalytic subunit [Nitrobacter hamburgensis X14] >gi|91802370|gb|ABE64744.1| Integrase, catalytic region [Nitrobacter hamburgensis X14] (431 aa)
Score = 102, Expect = 3.3e-02, Identities = 40/167 (23%), Positives = 69/167 (41%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE-------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISK-DDLKDLF 386
           G ++++D     W   +  K  +   ID  T +L+       E+ F Y    +  LE+YG P    +D+   F          + +T     L+ + I +   +    K  VER+    Q    K     G +T E         + AYN R+ K    +++    +++ DDL D F
  S:   141 GELIQIDGSEHWWFEGRGPKCTLLVYIDDATSRLMHLQFVQSESTFDYFAATRAYLERYGKPVAFYSDKHGVFRVNKKDAVGGDGMTQFGRALHAMNIDIICANSSQAKGRVERANGTLQDRLVKEMRLCGTDTIEAGNAFLPTFMAAYNARFAKPPFNEQDVHRALAEHDDLDDAF 317
>gi|187919873|ref|YP_001888904.1| Integrase catalytic region [Burkholderia phytofirmans PsJN] >gi|187718311|gb|ACD19534.1| Integrase catalytic region [Burkholderia phytofirmans PsJN] (477 aa)
Score = 102, Expect = 3.5e-02, Identities = 37/150 (24%), Positives = 58/150 (38%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
            G +V++D     W   +       +Y  +D  T +L+       E+ F Y +  +  LE+YG P    +DR   F    S      VT     + +L I     +    K  VER+    Q    K     G+ T E         + AYN  + K  +
  S:   143 LGELVQIDGSDHRWFEDRAPACTLLVY--VDDATSRLMALHFTATESTFSYFEATRAYLERYGKPVAFYSDRASVFRPTYSRTGARGVTQFGRAMYQLNIDTFCANSSPAKGRVERAHLTLQDRLVKELRLRGIQTMEAANAWAPAFMAAYNAHFAKPPR 300
>gi|10957337|ref|NP_058361.1| putative transposase [Salmonella typhi] >gi|7800390|gb|AAF69986.1|AF250878_147 putative transposase [Salmonella typhi] (468 aa)
Score = 102, Expect = 3.7e-02, Identities = 35/149 (23%), Positives = 65/149 (43%)
  Q:   220 GHIVEVDACVSVWI---GIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           G ++++D C   W    G K   + + +D  T +L+       E+ F Y +  +  +E +G P  + +D+   F   N         T     +++L IQ         K  VER+    Q    K     G++T E      +  ++ YN+R+ K+ +
  S:   144 GELIQIDGCDHHWFENRGPKCTALVY-VDDATSRLMQLRFVKSESTFTYFEATRGYIEMHGKPLALYSDKASVFRINNKNATGGEGETQFGRAMHELNIQTICAETSAAKGRVERAHLTLQDRLVKELRLQGISTMESANAFAEEFMNDYNRRFSKAPR 301
>gi|145849056|emb|CAM91619.1| putative transposase [Salmonella enterica] (468 aa)
Score = 101, Expect = 4.1e-02, Identities = 35/149 (23%), Positives = 65/149 (43%)
  Q:   220 GHIVEVDACVSVWI---GIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEK 368
           G ++++D C   W    G K   + + +D  T +L+       E+ F Y +  +  +E +G P  + +D+   F   N         T     +++L IQ         K  VER+    Q    K     G++T E      +  ++ YN+R+ K+ +
  S:   144 GELIQIDGCDHHWFENRGPKCTALVY-VDDATSRLMQLRFVKSESTFTYFEATRGYIEMHGKPLALYSDKASVFRINNKNATGGEGETQFGRAMHELNIQTICAETSAAKGRVERAHLTLQDRLVKELRLQGISTMESANAFAEEFMNDYNRRFSKAPR 301
>gi|152973466|ref|YP_001338517.1| putative transposase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150958258|gb|ABR80287.1| putative transposase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (467 aa)
Score = 99, Expect = 7.1e-02, Identities = 39/171 (22%), Positives = 76/171 (44%)
  Q:   220 GHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQ-VKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTK 390
           G ++++D C   W   +       +Y  +D  T KL+       E+ F Y +  ++ ++K+G P  + +D+   F   N         T     +++L IQ + +E+ P  K  VER+    Q    K     G+ + E      +  +  YN+R+ K  +   +    +  D+   L +T +
  S:   144 GELIQIDGCDHDWFEGRGPACTALVY--VDDATSKLMELLFVKSESTFSYFEATRRYIDKHGKPLALYSDKAGVFRVNNKHATGGDGHTQFGRAMHELNIQTICAETSPA-KGRVERAHLTLQDRLVKELRLQGICSMEAANDFAEAYMADYNRRFGKVPRHDFDVHRAVEHDEDLGLIFTVR 323
>gi|150377007|ref|YP_001313603.1| integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150396504|ref|YP_001326971.1| integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150028019|gb|ABR60136.1| Integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150031554|gb|ABR63670.1| Integrase catalytic region [Sinorhizobium medicae WSM419] (457 aa)
Score = 98, Expect = 8.5e-02, Identities = 63/332 (18%), Positives = 126/332 (37%)
  Q:    55 GKLNPKTLSNKTGYSIKQSRRFIKSFK-DNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW-------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY--KKSEKGKRNQFIKISKDDLKDLF 386
           G++   T ++  G S +Q RR ++  + D    I HK   + + N+I D V+                           D+ +  ++++    Y      L    L      +++R+T++K + E  L   + Q +     R  +  Y                  G +V++D     W   +     +   ID  TGKL+       E+ F Y + L+  L+ +GAP    +D+   F            +T     L++L I++   +    K  VER  +  Q    K     G+   +         ++ YN+++    +     ++ + ++ D LK++ 
  S:    23 GRMTLVTAAHVLGLSTRQVRRLLERIRTDGAASIRHKAIGRPSNNRISDGVR---------------------------DYAVTLVRER----YADFGPTLAAEKLAERDGLRVSRETLRKWMSEAGLWLSRKQRRTFHQPRLRREAY------------------GELVQIDGSEHRWFEDRGDPCSLLVFIDDATGKLMQLRFVRSESAFSYFEALELYLKNHGAPVAFYSDKHSVFRVAKKDAKGGQGMTQFGRALSELNIEILCANSSQAKGRVERMNRTLQDRLIKDLRLEGICGMDDGNAFLPRFMEGYNRQFAITPARPDDLHRSLNLAPDRLKEIL 317
>gi|194559374|ref|YP_002094399.1| Transposase [Burkholderia cenocepacia PC184] >gi|124874890|gb|EAY64880.1| Transposase [Burkholderia cenocepacia PC184] (473 aa)
Score = 97, Expect = 1.3e-01, Identities = 37/170 (21%), Positives = 68/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  LE++G P    +D+   F S       +SVT     + +L I     +  + K  VER+    Q    K     G++T           +  +N+R+ K  +   N    +  D+  D   T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYLERHGKPVAFYSDKYSVFRSPTAGKTGSSVTQFGRAMYELNIDTFCANSSSAKGRVERANLTLQDQLVKEMRLRGISTVADANAYAPSFIADFNRRFAKPPRSDFNAHRPLRDDENLDRLLT 320
>gi|194556395|ref|YP_002091421.1| Transposase [Burkholderia cenocepacia PC184] >gi|194556988|ref|YP_002092014.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870186|gb|EAY61902.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870779|gb|EAY62495.1| Transposase [Burkholderia cenocepacia PC184] (473 aa)
Score = 97, Expect = 1.4e-01, Identities = 37/170 (21%), Positives = 68/170 (40%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYT 388
            G ++++D     W   +       +Y  +D  T +L+       E+ F Y +  +  LE++G P    +D+   F S       +SVT     + +L I     +  + K  VER+    Q    K     G++T           +  +N+R+ K  +   N    +  D+  D   T
  S:   143 LGELIQIDGSDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYLERHGKPVAFYSDKYSVFRSPTAGKTGSSVTQFGRAMYELNIDTFCANSSSAKGRVERANLTLQDRLVKEMRLRGISTVADANAYAPSFIADFNRRFAKPPRSDFNAHRPLRDDENLDRLLT 320
>gi|149910664|ref|ZP_01899301.1| putative transposase [Moritella sp. PE36] >gi|149806291|gb|EDM66267.1| putative transposase [Moritella sp. PE36] (448 aa)
Score = 96, Expect = 1.5e-01, Identities = 43/196 (21%), Positives = 85/196 (43%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN-------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYK--KSEKGKRNQFIKISKDDLKDLFYTTKICKVLKGFYFFLNGKAMGLFTKEDK 415
           G ++++D     W   +  K  +   ID  T KL+  +  + ET + Y  + +Q + ++G P  + +D+   F   N        +T  +  L +L I++   +    K  VER+    Q    K     G+NT E+        +  +N R+         +++ ++ S  +L D+F   ++ + L         K + + T  DK
  S:   140 GELIQIDGSHHDWFEGRSPKCCLLVFIDDATSKLMSLYFCEAETTYDYMNVTRQYISEHGKPIALYSDKHSVFKINNPSRKTSKQMTQYSRALYELNIELICANSSQAKGRVERANFTLQDRLIKEMRLAGINTIEEANAWVPHYMSLHNARFACLPHSTDDKHRLLQESNVELDDIF-ARQVSRSLTSSLTLQYDKVIYMLTPTDK 345
>gi|78062426|ref|YP_372334.1| transposase [Burkholderia sp. 383] >gi|77970311|gb|ABB11690.1| Transposase and inactivated derivatives [Burkholderia sp. 383] (311 aa)
Score = 96, Expect = 1.6e-01, Identities = 33/145 (22%), Positives = 62/145 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK----KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN------SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY 363
            G ++++D C   W   +       +Y  +D  T +L+       E+ F Y +  +  LE+YG P    +D+   F + +      SVT+    + +L I     +  + K  VER+                L  ++++ K  +L+V     RY
  S:   143 LGELIQIDGCDHRWFEERAPACTLLVY--VDDATSRLMMLHFTQTESTFSYFEATRTYLERYGKPVAFYSDKYSVFRNTSAGKTGQSVTHFGRAMYELNIDTFCANSSSAKGRVERAH---------------LTLQDRLVKEMRLVVACRPARY 280
>gi|150378340|ref|YP_001314934.1| integrase catalytic region [Sinorhizobium medicae WSM419] >gi|150032887|gb|ABR65001.1| Integrase catalytic region [Sinorhizobium medicae WSM419] (469 aa)
Score = 95, Expect = 2.3e-01, Identities = 62/332 (18%), Positives = 126/332 (37%)
  Q:    55 GKLNPKTLSNKTGYSIKQSRRFIKSFK-DNTFLISHKNKNKENVNKIKDEVKRAIIEKYIEVTTPCKEMSDGHYEMTHLDFYLDEIKDKFNVKYGFVNKLLNENFLLTSYSKKITRKTMKKKLKEGNLAELKIQEKILEFLRKYKPTYTEYLKTKNPPYVKHNYDFGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFW-------SENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY--KKSEKGKRNQFIKISKDDLKDLF 386
           G++     ++  G S +Q RR ++  + D    I HK   + + N+I D V+                           D+ +  ++++    Y      L    L      +++R+T++K + E  L   + Q++     R  +  Y                  G +V++D     W   +     +   ID  TGKL+       E+ F Y + L+  L+ +GAP    +D+   F            +T     L++L I++   +    K  VER  +  Q    K     G+   +         ++ YN+++    +     ++ + ++ D LK++ 
  S:    23 GRMTLVKAAHVLGLSTRQVRRLLERIRTDGAASIRHKAIGRPSNNRISDGVR---------------------------DYAVTLVRER----YADFGPTLAAEKLAERDGLRVSRETLRKWMAEAGLWLSRKQQRTFHQPRLRREAY------------------GELVQIDGSEHRWFEDRGDPCSLLVFIDDATGKLMQLRFVRSESAFSYFEALELYLKNHGAPVAFYSDKHSVFRVAKKDAKGGQGMTQFGRALSELNIEILCANSSQAKGRVERMNRTLQDRLIKDLRLEGICGMDDGNAFLPRFMEGYNRQFAITPARPDDLHRSLNLAPDRLKEIL 317
>gi|167621887|ref|YP_001676672.1| integrase catalytic region [Caulobacter sp. K31] >gi|167351628|gb|ABZ74358.1| Integrase catalytic region [Caulobacter sp. K31] (432 aa)
Score = 93, Expect = 3.9e-01, Identities = 38/176 (21%), Positives = 70/176 (39%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSE-------NSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVL 395
           G +++VD     W   +     +   ID  T +L+       E+ F Y    ++ LE +G P    TD+   F          + +T     L  L I++   +    K  VER+ K  Q    K     G+++ +         +  YN R+ K+    ++    ++  D  D  +T +  + L
  S:   141 GELIQVDGSDHFWFEDRADSCTLLVFIDDATSRLMHLQFVQSESTFAYFNATQRYLEAHGKPIAFYTDKHAVFRVNKAGGLHGDGMTQFGRALKALSIEIICANSSQAKGRVERANKTLQDRLVKELRLAGVSSMDDGNAFLPSFIADYNARFAKAPFNDKDLHRPMAPRDRLDEAFTWRAERTL 325
>gi|167646616|ref|YP_001684279.1| integrase catalytic region [Caulobacter sp. K31] >gi|167349046|gb|ABZ71781.1| Integrase catalytic region [Caulobacter sp. K31] (432 aa)
Score = 92, Expect = 4.5e-01, Identities = 39/176 (22%), Positives = 70/176 (39%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF-------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRNQFIKISKDDLKDLFYTTKICKVL 395
           G +V+VD     W   +     +   ID  T +L+       E+ F Y    ++ LE +G P    TD+   F          + +T     L  L I++   +    K  VER+ K  Q    K     G+++ +         +  YN R+ K+    ++    ++  D  D  +T +  + L
  S:   141 GELVQVDGSDHFWFEDRADSCTLLVFIDDATSRLMHLQFVQSESTFAYFNATQRYLEAHGKPIAFYTDKHAVFRVNKAGGLHGDGMTQFGRALKALSIEIICANSSQAKGRVERANKTLQDRLVKELRLAGVSSMDDGNAFLPSFMADYNTRFAKAPFNDKDLHRPMAPRDRLDEAFTWRAERTL 325
>gi|10954695|ref|NP_066630.1| hypothetical protein pRi1724_p050 [Agrobacterium rhizogenes] >gi|8918695|dbj|BAA97760.1| riorf49 [Agrobacterium rhizogenes] >gi|10567359|dbj|BAB16168.1| riorf49 [Agrobacterium rhizogenes] (459 aa)
Score = 92, Expect = 4.6e-01, Identities = 35/145 (24%), Positives = 61/145 (42%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDR-------RKTFWSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY 363
           +G +V++D     W   +     +   +D  TGKL+       E+ F Y + L   LE++GAP    +D+       RK       +T     L++L I++   +    K  VER  +  Q    K      ++  E         ++ YN R+
  S:   141 YGELVQIDGSEHRWFEDRGPACSLLVFVDDATGKLMQLRFVRSESAFTYFEALSLYLEEHGAPIAFYSDKHSVFRVARKDAKGGQGMTQFGRALSELHIEILCANSSQAKGRVERMNRTLQDRLVKELRLANISDMETGNAFLPAFIERYNDRF 294
>gi|196156740|ref|YP_002126229.1| probable transposase protein, Y4bF [Alteromonas macleodii 'Deep ecotype'] >gi|196112519|gb|ACG66235.1| probable transposase protein, Y4bF [Alteromonas macleodii 'Deep ecotype'] (494 aa)
Score = 92, Expect = 4.9e-01, Identities = 29/111 (26%), Positives = 49/111 (44%)
  Q:   220 GHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN--SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQ 330
           G ++++D     W G KK  +   ID     +   +   E T  G  K+++ V+EKYG    +  DR   F      + + +     +L I++   S P  K  +ER+F   Q
  S:   130 GLMLQMDGSTHRWFGDKKSCLIAMIDDANSDIHAEFFPSETTE-GCMKVMRSVVEKYGVFKTLYVDRAGIFGGPKRCNFSQMQRACEELGIEIIFASSPQGKGRIERAFDTLQ 241
>gi|88773821|gb|EAR05082.1| probable transposase protein, Y4bF [Alteromonas macleodii 'Deep ecotype'] (503 aa)
Score = 92, Expect = 5.2e-01, Identities = 29/111 (26%), Positives = 49/111 (44%)
  Q:   220 GHIVEVDACVSVWIGIKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSEN--SVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQ 330
           G ++++D     W G KK  +   ID     +   +   E T  G  K+++ V+EKYG    +  DR   F      + + +     +L I++   S P  K  +ER+F   Q
  S:   139 GLMLQMDGSTHRWFGDKKSCLIAMIDDANSDIHAEFFPSETTE-GCMKVMRSVVEKYGVFKTLYVDRAGIFGGPKRCNFSQMQRACEELGIEIIFASSPQGKGRIERAFDTLQ 250
>gi|49206959|ref|YP_026156.1| Sea24 [Serratia entomophila] >gi|48995206|gb|AAT48357.1| Sea24 [Serratia entomophila] (340 aa)
Score = 92, Expect = 5.4e-01, Identities = 35/154 (22%), Positives = 65/154 (42%)
  Q:   219 FGHIVEVDACVSVWIG--IKKYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENSVTNLT------YCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN 372
            G ++++D     W      K  +   ID  TG+L+     + E+ F Y    ++ ++K+G P    +D+   F    + T  T        L+ L I++        K  VER+    Q    K      +N+ E+        +  +N+R+ K+ K  +N
  S:    27 LGELIQIDGSHHDWFEGRASKCCLLVYIDDATGRLMHLRFCETESAFDYMLATREYIDKHGKPVAFYSDKHAVFRVSQAETRRTGTTQFGRVLHDLNIELICADSSQAKGRVERANLTLQDRLIKEMRLENINSIEEANAWLDSFILDFNRRFAKAPKYPKN 188
>gi|165924264|ref|ZP_02220096.1| transposase for insertion sequence [Coxiella burnetii RSA 334] >gi|165916291|gb|EDR34895.1| transposase for insertion sequence [Coxiella burnetii RSA 334] (264 aa)
Score = 91, Expect = 6.2e-01, Identities = 22/71 (30%), Positives = 38/71 (53%)
  Q:   220 GHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF 290
           G +++VD     W+  +  +  +  AID  TGK       ++E + GY +LL++++ +YG P  I  DR   F
  S:   142 GMLLQVDGSPHDWLEGRGPRMTLVGAIDDATGKAPYALFREQEDSQGYFRLLREIVRRYGVPLAIYHDRHSIF 214
>gi|118589865|ref|ZP_01547269.1| putative insertion sequence transposase protein [Stappia aggregata IAM 12614] >gi|118592703|ref|ZP_01550093.1| putative insertion sequence transposase protein [Stappia aggregata IAM 12614] >gi|118434754|gb|EAV41405.1| putative insertion sequence transposase protein [Stappia aggregata IAM 12614] >gi|118437362|gb|EAV43999.1| putative insertion sequence transposase protein [Stappia aggregata IAM 12614] (453 aa)
Score = 89, Expect = 9.5e-01, Identities = 38/168 (22%), Positives = 67/168 (39%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGFWIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTFWSENS-------VTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRYKKSEKGKRN--QFIKISKDDLKDLF 386
           FG +V++D     W   +     +   ID  T  L+       E+ F Y + L   L  +G P    +D+   F    S       +T     L++L I++   +    K  VER+ +  Q    K      + T E         ++ YN ++ K      N  + + +  D L+D+ 
  S:   129 FGELVQIDGSEHRWFEDRGDPCTLLVFIDDATSTLMELRFVRSESAFSYFEALDSYLTHHGRPVAFYSDKHSVFRVNKSEVKGGQGMTQFGRALSELNIEILCANSSQAKGRVERANRTLQDRLVKALRLADIGTIEDANAFLPTFIERYNAQFSKVPARSDNLHRALNVEPDRLQDIL 307
>gi|12831447|gb|AAK08602.1| unknown [Agrobacterium tumefaciens] (464 aa)
Score = 89, Expect = 9.7e-01, Identities = 32/145 (22%), Positives = 65/145 (44%)
  Q:   219 FGHIVEVDACVSVWIGIK--KYYIYHAIDAGTGKLLGF-WIDDEETNFGYCKLLKQVLEKYGAPNIIKTDRRKTF-------WSENSVTNLTYCLNKLEIQVKSESQPTFKANVERSFKNAQQIYYKLFLKHGLNTKEKIQKNYQLIVDAYNQRY 363
           +G +V++D     W   +     +   +D  TG+L+   ++  E++ F Y + L+  L+++GAP    +D+   F            +T     L +L I++   +    K  VER  +  Q    K     G+++ +         ++ YN R+
  S:   145 YGELVQIDGSEHRWFEDRGPSCSLLVFVDDATGRLMQLRFVRSEKSAFSYFEALELYLKRHGAPVAFYSDKHSVFRVAKKDARGGQGMTQFGRALCELNIEILCANSSQAKGRVERMNRTLQDRLVKELRLSGIDSMQAGNAFLPGFIEDYNARF 299