>gi|26553470|ref|NP_757404.1| hypothetical protein MYPE180 [Mycoplasma penetrans HF-2] >gi|26453476|dbj|BAC43808.1| hypothetical protein [Mycoplasma penetrans HF-2] (914 aa)
Score = 3405, Expect = 0.0e+00, Identities = 914/914 (100%), Positives = 914/914 (100%)
  Q:     1 MKSLNKSFISKRKKRKLLVFSSSLFSMFAIGLGLSLTSSLSLNKDSITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKKANEVTNSDIQNILTPSATVSSYNVVILPVTETNINKGYVNFLVYQTYWDGSLMKTEFADASKSMNTANGGTQTNYQSDDTYDNVVLNEYGFTSGEATTNPSTTNIFSTAKINNLANWITAEKYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVDKNGNTANDSNSVGLFKIKIQINQTSKSNWLNDNFPTGSTGGESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNTVSSLRPSQFESPYGGKTALISLFSTGTGLYSTGNTVTPIVQYSFTESTNTKYNFHDPSASNNNGSNGTQGSGLIQEINNQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQPENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPNEEVSGALQSIPVNNVTKEDIIEHYLSNSALFQNGDLGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFKSYHDSVLEKKVKKHTRRTIK 914
           MKSLNKSFISKRKKRKLLVFSSSLFSMFAIGLGLSLTSSLSLNKDSITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKKANEVTNSDIQNILTPSATVSSYNVVILPVTETNINKGYVNFLVYQTYWDGSLMKTEFADASKSMNTANGGTQTNYQSDDTYDNVVLNEYGFTSGEATTNPSTTNIFSTAKINNLANWITAEKYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVDKNGNTANDSNSVGLFKIKIQINQTSKSNWLNDNFPTGSTGGESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNTVSSLRPSQFESPYGGKTALISLFSTGTGLYSTGNTVTPIVQYSFTESTNTKYNFHDPSASNNNGSNGTQGSGLIQEINNQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQPENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPNEEVSGALQSIPVNNVTKEDIIEHYLSNSALFQNGDLGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFKSYHDSVLEKKVKKHTRRTIK
  S:     1 MKSLNKSFISKRKKRKLLVFSSSLFSMFAIGLGLSLTSSLSLNKDSITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKKANEVTNSDIQNILTPSATVSSYNVVILPVTETNINKGYVNFLVYQTYWDGSLMKTEFADASKSMNTANGGTQTNYQSDDTYDNVVLNEYGFTSGEATTNPSTTNIFSTAKINNLANWITAEKYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVDKNGNTANDSNSVGLFKIKIQINQTSKSNWLNDNFPTGSTGGESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNTVSSLRPSQFESPYGGKTALISLFSTGTGLYSTGNTVTPIVQYSFTESTNTKYNFHDPSASNNNGSNGTQGSGLIQEINNQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQPENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPNEEVSGALQSIPVNNVTKEDIIEHYLSNSALFQNGDLGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFKSYHDSVLEKKVKKHTRRTIK 914
>gi|26553812|ref|NP_757746.1| hypothetical protein MYPE3590 [Mycoplasma penetrans HF-2] >gi|26453819|dbj|BAC44150.1| hypothetical protein [Mycoplasma penetrans HF-2] (880 aa)
Score = 282, Expect = 9.0e-23, Identities = 195/849 (22%), Positives = 381/849 (44%)
  Q:    46 SITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKK-----------ANEVTNSDIQNILTPSATVS-SYNVVILPVTETNINKGYVNFLVYQTYWDGSLMKTEFADASKSMNTANGGTQTNYQSDDTYDN------VVLNEYGFTSGEATTNPSTTNIFSTAKINNLANWITAEKYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVDKNGNTANDSNSVGLFKIKIQINQTSKSN----WLNDNFPTGSTG-----GESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNTVSSLRPSQFESPYGGKTALISLFSTGTGLYSTGNTVTPIVQYSFTESTN------------TKYNFHDPSASNNNGSNGTQGSGL-----------------IQEINNQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQP---ENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPN----EEVSGALQSIPVNNVTKEDIIEHYLSNSALFQNGD---LGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFK 894
           SI ++NSNL  + ++      A + TVN+    L K            A  VT + ++ ++ PS     +Y + IL   +  +  GYV F VYQ   + S   T   +   S    +G T    + +  YD+      + +  Y   +G+ T N             N+      +K++  W ++E++  ++ N+T +TLT+E +  N  S +     L     TN+N    S +     + + G + ND+   G+  +K+  + +S  N    W++   PT           S N +  K+ + +    G  N+       +     +  I+    ++   F   S  NN  +S+  SQF       T LI+  ++ +G  S    +T    +  T + N            T Y+  +P    N+ +N TQ SG                    + +N   +  I+++   A++  G+L + I Y+ +++Y  T+    +T   ++G  +  S+    ENL+F WK ++ L     +   D++N +  N+ N ++++  +N F   S    +L+RT TI                             +V+   +++ L+F  +    +   F  ++T SG+      S S+ G T      +  T  SN          ++ TPS V+  +  + T      T   T + +S  S     +D +  +++ L+ T+ ST +         YS ++ G  K T T+ + +F++  N    E     L++IP++ +TKED+  +Y+S   ++   +   L   D  +T +  +NS+TI + ++     +   T +T++  L GF      N++S +  +N+T   ++S A  +++ +  +++  ++KR +L   K
  S:    28 SIKNMNSNLTKV-DSDLQASGARDITVNSLTMQLKKDYQQLDWYGKNFAETVTEAQLKQLIVPSVKYDVNYGINILTPVDEPLANGYVLFTVYQIKNNFSGGVTTQPNGGSSTTPVDGRTDIAPEDNIMYDDGTTQSSINMKAYPGETGKVTINDKEVEKNLVWTTKNIQGLFLEKKFSFSWNNNEKIGDFLKNTTKSTLTSEDVYTNLISRSKITDILPEDTETNSN--IISFSQETADLTEYGISTNDAKRYGIGVVKVNFSSSSTGNDANRWVDSKIPTDEKYLVRGLMPSDNSSSSKEEMKLNVSDGSTNS------FLSTPLNVAAIK----AENPNFKLPSGANNNATSVTISQFTP-----TELINALTSSSGQSSIYKLLTKKDYWDKTSNANQLPALYLTYMGKTIYDGQNP----NDATNSTQWSGAGLSKMGQVPTVRNGVVDYTKTSNPANDSTISNVLATADNSTGTLYLNITYNKYNVYQNTMEIGLQTSITISGLQSDDSESIKNENLYFQWKTIDQLI---FSNAQDVLNLYSSNSENADYLKSLSNLFFEGSENTYSLDRTVTI-----------------------------TVTNNVLSINLSFPRFGDLKEGATFGNTYTLSGM------SASSAGITFKSQSEVANTIASNLG-----KDLSTVTPSEVINELAVNNTRGRLNLTDFYTTSGSSTYSALILQSDTNDGIVIQLSVTNGSTTSK--------YSYIYNGMAKGTSTSYIYNFAFDTNDQELENGLKTLKNIPISLITKEDVYNYYVSRLPIYSGSNKLSLTMDDFEITKDTEKNSITISINVAIVANGSENGT-KTYSNTLKGFTNATIVNNNSNSTMQNLTVPLSVSFALAIALIMSGLIVHQVIKRKKLAKSK 868
>gi|26553814|ref|NP_757748.1| hypothetical protein MYPE3610 [Mycoplasma penetrans HF-2] >gi|26453821|dbj|BAC44152.1| hypothetical protein [Mycoplasma penetrans HF-2] (881 aa)
Score = 274, Expect = 8.2e-22, Identities = 194/849 (22%), Positives = 372/849 (43%)
  Q:    46 SITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKK-----------ANEVTNSDIQNILTPSATV-SSYNVVILPVTETNINKGYVNFLVYQT---YWDGSLMKTEFADASKSMNTANGGTQ-----TNYQSDDTYDNVVLNEYGFTSG--EATTNPSTTNIFSTAKINNLANWITAEKYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVDKN----GNTANDSNSVGLFKIKIQINQ----TSKSNWLNDNFPTGST----GGESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNT---VSSLRPSQ----FESPYGGKTALISLFSTGTGLYSTGNTVTPIVQYSFTEST-------NTKYNFHDPSASNNNGSNGTQGSGLIQEIN--NQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQP---ENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPN----EEVSGALQSIPVNNVTKEDIIEHYLSNSALFQNGD---LGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFK 894
           SI S+NSNL+ + +   +T +A N TVN  +  L K            AN  T + ++ ++ P+    ++Y + IL   +  +  GYV F VYQ    + +G   K   + ++ S     G T      TN   DD   + +      T+G  +   N             N+       KYN  W ++E++  ++ +++ +TL  + +  N  S +     L    +T       +  IT +  D      G T  D+   G+  +K+  ++    T+  NW+N   P        G   +NG+  K+ + +       N   G    ++    ++ I+     +  L  GE+ +N T   +S   PS+      +   G   L+ L +    L ++     P +  ++   T       N      + +  N  G   T  +G++  IN  N      IT++   A++ +G L + I Y+ F++Y  TV    +T   ++G     S+    +NLFF WK ++ L+     +  D+++ +  N  N  +++  +N F   S    +L+RT TI                               SG ++TV L F  +        F  ++T SG           T +  G          +N     N+   ++ TPS V+  + ++ TS     +   T + +S  ++  +++  DG +I  ++   +         N + YS ++ G  + T T+ + +F++       E+    L++IP++ +TKED+  +Y+S   ++   D   L   D  +T +++ NS+TI + ++    D      +T++  L GF      NS+S T  +N+T   ++S A  + + +  ++   ++KR +L   K
  S:    28 SINSMNSNLSKVDSDLQAT-AARNITVNTLEMRLKKDYNKLSWYGKNFANTATEAQLKELIVPNKKYDANYGINILTSKDQALANGYVEFTVYQIKNEFNNGVTTKPGGSGSTSSTTPVEGRTDIAPPTTNITFDDGSSSSIDMRAYTTNGTDDVEINGKVVKKSMVWTTKNIGGLFLEYKYNFSWNNNEKIGDFLRDTSKSTLNAQDVYTNLISRSKITDILPADTAT------KTGIITFSQEDAELTSYGITNADAKRYGIGVVKVDFSKSDIATNADNWVNKKVPNDEKYLVRGLMPSNGSSSKEEMKL-------NIDEGTNSFLNTPLSVEAIKKQN-RNFKLPSGETNQNATSVKISQFTPSELINALTTSSNGSLNLLDLLTKKDYLDTSSTNQLPALYLTYMGKTTFGGRNSNNTSTQWNGTGLNKMGEVPTVKNGVVDYINKSNPANTSNITNVLATADNANGQLYLNITYNKFNVYQNTVEMGVQTSIVISGLQPDDSESLNNKNLFFQWKSIDQLA---FGSVQDVMDLYNNNKDNAVYLKSLSNLFFEGSQNTYSLDRTVTI-----------------------------QSSGNNLTVTLNFPKYGDINGGWTFTNTYTLSG----------QTASAAGITFKSQSEVTANIRRAFNDAELSTITPSQVINQLNSNNTSGRLSLSDFYTASGSSTSALILQSDTNDGIVIQVISTQGS---------NTYRYSYIYNGMSQGTSTSHIYNFAFGAQDSGLEQGLLTLRNIPIDLITKEDVYNYYVSKLPIYSGTDKLPLTINDFEITKDLDTNSITISINVAIV-ADGSENGTKTYSNTLKGFTKATIVNSNSNTIMQNLTIPLSVSFALAIVLIMSGLITHQIIKRKKLAKSK 869
>gi|26553813|ref|NP_757747.1| hypothetical protein MYPE3600 [Mycoplasma penetrans HF-2] >gi|26453820|dbj|BAC44151.1| hypothetical protein [Mycoplasma penetrans HF-2] (880 aa)
Score = 250, Expect = 4.4e-19, Identities = 192/849 (22%), Positives = 377/849 (44%)
  Q:    46 SITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKK-----------ANEVTNSDIQNILTPSATVS-SYNVVILPVTETNINKGYVNFLVYQTYWDGSLMKTEFADASKSM-NTANGGTQTN-----YQSDDTYDNVVLNEYGFTSGEATTNPSTTNIFSTAKINNLANWITAEKYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVD--KNGNTANDSNSVGLFKIKIQINQTSK-----SNWLNDNFPTGST--------GGESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNTVSSLRPSQFESPYGGKTALISLFSTGTGLYSTGN-TVTPIVQYSFTESTNTKYNFHDPSASNNNGSNGTQGSGLIQ---------------EINNQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQP---ENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSW-IPNEEVS---GALQSIPVNNVTKEDIIEHYLSNSALFQNGD---LGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFK 894
           SI ++NSNL A  ++     S+ N +VN     LNK            AN VT   ++ ++ P+     +Y   IL  T   ++ GYV F VYQ     S   T   + S +   TA+G T  +      QSD T   + +  Y   +G+   N +T          N+       KY+  W  +E++  +++++  + LT + + +N  S +    +L T   +NA    S  T +    D  + G +  D+ + G+  +K+  + ++      +NW+N   P             G ++   + K  I+    I   NT+     I   +   +     T   TS+   + T    +++L  S         ++L  L +  T L  T N    P +  ++   T+T        A+  + +    G+GL Q               +  N  ++  +T++   A++  G+L + + Y+ +++Y  T+    +T   + G     S     +NL+F WK ++ L     ++  D++N +  N++++ +++  +N F   S     L+R  T+                             SV+G  +T+ L F  +        F  ++T +G S         + +      S VL               ++ TPS V+  ++T+ +      T   + + +S  S     ND +  +++ +  TS  T   I +++++IY+    G  K T T+ + +F++   N E+S     L++IP+N +TKED+  +Y+S   ++   +   L   D  +T +   NS+TI + ++    D     ++T++  L GF      N++S +  +N+T   +IS A  +++ +  +++  ++KR +L   K
  S:    28 SIKNMNSNL-AKVDSDLQASSSRNISVNNLTMQLNKDYQSLDWYGKNFANTVTEEQLKQLIVPNLKFDVNYGFNILNPTGDALSNGYVEFTVYQIKNSFSGGVTTNPNGSGATGQTADGRTLISPVDNITQSDGTASTIDMRAYPNDNGDTVINDTTVKKNMVWTTKNITGLFLPLKYSFSWNDNEKIGDFLSSTNKSILTAQDVFDNMISRSKITDSLPTDTVSNA----SIITFSQNDADLSQYGISGTDAQNYGIGVVKVDFSTSANEGGQANNWVNSTVPKDQKYLVRGLLPTGSNSTKEEMKLNISDDSAISFLNTSLSVSAIQAENKNFKLPSGATSGATSVTISQFTPTELINALPSSTSSV-----SSLYKLLTQDTYLNKTNNANQLPALHLTYMGKTSTS------RATTGSTTAAWGGTGLYQMGKVPTVKNGVIDYNDTRNPADSSGVTNVLATADNASGTLYLNVTYNKYNVYQNTMEIGLQTSITITGLQTDDSASINNQNLYFQWKSIDQLI---FSSAQDVLNLYNSNSNDSAYLKSLSNLFFEGSDNTYQLDREVTM-----------------------------SVNGNVLTINLNFSRFGDLKDGATFGNTYTLNGTSARSAGITFKSQSDVASRISSVL-----------GKDLSTVTPSEVINELVTNNSRGLLNLTDFYSTSGSSTYSALILQNDTNDGIVIEVLVTSGDT---ITSKHSYIYN----GMAKGTSTSHIYNFAFGADNSELSSGLATLRNIPINLITKEDVYNYYVSRLPIYSGENRLSLTMDDFEITKDTGNNSITISINVAIV-ADGSENGSKTYSNTLKGFTNATIVNNNSNSTMQNLTVPLSISFALAIALIMSGLIVHQVIKRKKLAKSK 868
>gi|26553811|ref|NP_757745.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453818|dbj|BAC44149.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (878 aa)
Score = 221, Expect = 9.3e-16, Identities = 195/884 (22%), Positives = 389/884 (44%)
  Q:    11 KRKKRKLLVFSSSLFSMFAIGLGLSLTSSLSLNKDSITSVNSNLNALKNTTTSTQSAANFTVNAAQTPLNKK-ANEVTNSDIQNILTPSATVS-SYNVVILPVTETNINKGYVNFLVYQTYWDGSLMKTEFADAS-KSMNTANGGTQTNYQSDDTY-DNVVLNEYGFTSGEATTNPSTTNIFSTAKINNLANWITAE--------KYNIEWKSDEELKTYITNSTATTLTTEMLVNNFFSNTTNLPNLATSGSTNANNQPSSTTITVTSVDKNGNTAN----DSNSVGLFKIKIQINQTSK----SNWLNDNFPT------GSTGGESANGNDDKKTITITKYIGGFNTASGQRYIVDIDSELQTIRNWTISDTSLFDGESTENNTVSSLRPSQFESPYGGKTALISLFSTGTGLYSTGNTVTPIVQYSFTESTNTKYNFHDPSASNNN---------GSNGTQGSGLI--QEINNQRENIKITDITTIANDVDGSLRIIIKYDGFSIYSGTVVSQTKTYDYVAGTFATSSQP---ENLFFSWKDVNTLSAYGLNTPSDIVNQFMRNNSNTEFVRVFTNQFINASSEIQALNRTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTGNTTGYDDSLVLTWRSNDAVLTNNPS------FASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDVDGSLIVFLTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPNEEVSGA----LQSIPVNNVTKEDIIEHYLSNSALFQNGD---LGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTGFATYQYTNSSSFTPPKNMTAVFAISAATVLSITLGVVLLAMLLKRARLRNFK 894
           K+K  +LL+ +S+LFS+  I +  ++T+  S+N   I+  +S+L A ++ TT+  +              +  +N VT   ++ ++ P+     +Y + IL  T T + +GYV F VYQ   + S   T   + S +S +T +G       S+  Y D    +  G +    TTN + T   +  ++     W T          K++  W  +E++  ++ ++  + LT   +  N  S +  +  L +   TN      S+ I+ +  D    T N    D+   G+  + +  + ++     SNW +   P       G  G   +   ++    T        NT      I   ++  +  +    + T++   + T    +++L  +       GK+ L+ L +  T L  + N  +    Y  T    TK++                   G+  T   G++    + N      IT IT  A++  G++ + + Y+ +++Y  T+    +    ++G     S     +NL+F WK V+ L        +++++ +  N S+T+F++  +N F   S     L+R  TI             TN+S                            N  T    F Q    +G++ T TYS ++   +     S  +T+RS D V ++  S       +  TPS V+  +     + S  + F ST ++ +  ++  +++  DG ++  +   +T         N + YS +++G  K T T+ + +F++  ++    +    L++IP+  +TKED+  +Y+S   ++   +   L   D  +T +   NS+TI + +      +V  T +T++  L GF      N++S T  +N+T   ++S A  + + +  ++   ++KR +L   K
  S:     2 KKKNNRLLLVASTLFSLSTIPVA-AITTIDSINTTQISKDSSDLQAARDITTNNLTMQLHKGYEQLDWYGQNFSNAVTEQQLKQLIVPNVKFDVNYGINILTPTGTALTEGYVEFTVYQIKTNISGGVTGNPNGSGQSGSTVDGREDIEAPSNINYKDGNNTSPSGISMQAYTTNTTETVEINGKQVQKKYVWTTKNINGLFLKYKFSFSWNDNEKIGDFLRSTNKSALTANDVYGNMISTSRKIDILPSDIETN-----PSSIISFSQEDSELTTYNISSADAKQYGIGVVTVDFSSSTDGKVDSNWADGKVPNVKYLVRGLVGNNGSGSKEEMHLSTDQGITSFLNTTFSVSAIRAQNTNFKLPKTVQSTATTVKVSDFTPTELINALTTTS-----SGKSNLLDLLTKDTYLDKSSNANSLPALY-LTYMGKTKFSKDTTGGKTTEWYGTGLFEMGNVPTVKKGVVDYNTLTNPANGSSITAITANADNASGTIYLNVTYNKYNVYQNTLEMGNEVSIIISGLQVDESANNGNKNLYFQWKSVDQLI---FTNAANVMDLYNNNQSDTDFLKSLSNSFFEGSENTYNLDRNVTI-------------TNSS----------------------------NQITITMEFPQFGEINGITFTNTYSLNSPDAS-----SAGITFRSKDQVASSIRSALGISNLSEATPSQVIDAVADPDRNLSLSD-FYSTGSSYTYSALILQSDTNDGVVVEVIAANNT---------NTYKYSYIYSGMAKGTSTSHIYNFAFDTSDTQLQSGLTTLRNIPIGLITKEDVYNYYVSKLPIYSGTNGLPLTINDFEITKDTINNSITITINIPIVANGSVDGT-KTYSNTLKGFTNATIINNNSNTAMQNLTVPLSVSFALAIVLIMSGLITHQIIKRKKLAKSK 866
>gi|157133855|ref|XP_001663042.1| hypothetical protein AaeL_AAEL012910 [Aedes aegypti] >gi|108870666|gb|EAT34891.1| hypothetical protein AaeL_AAEL012910 [Aedes aegypti] (5644 aa)
Score = 92, Expect = 9.1e-01, Identities = 74/295 (25%), Positives = 123/295 (41%)
  Q:   548 TNQFINASSEIQALN-----RTATILFGTATGEDALPETNNSLNDQTGLYSPGNSVSGRSITVRLTFDNWNGTTQQKVFQQSFTFSGVSDTGTYSYSTTG-NTTGYDDSLVLTWRSNDAVLTNNPSFASTTPSTVVYNIMTSGTSTSYYETFASTNNNASEISVSFEANDV------DGSLIVF-LTKTSTSTDANIKTQNAHIYSQLFTGFRKTTETTGVVSFSWIPNEEVSGALQSIPVNNVTKEDIIEHYLSNSALFQNGDLGTADITLTPNINENSLTIEVTMSFFNQDNVTTTNRTFATKLTG 842
           T+Q I +SSE   +        +T++F + T E +  E   + + +T      NS      + R+T   ++ TT   V         VSD  T   S  G  TT   ++    + S+   +T  P FA+TT STVV +  T+  S++  ET AS      +I  S E   V        S +VF  T T  S      T +  IYS        ++E+  V  F    +  V     +  V+++ +E       ++  ++ + +     +T+TP           T S  + D+ TT   +   + TG
  S:   121 TSQNIYSSSERVTVTPFEATTQSTLVFDSMTTEISGVERETTASQETASQDIYNS------SERVTVTPFDATTHSAV---------VSDNATTEISGVGRETTASQETTSQDFYSSSERVTTTP-FAATTNSTVVSDGTTTDISSTERETTASQETTLQDIYSSSERVTVTPFEATTHSTVVFDSTTTEVSGVERETTASQDIYS--------SSESVSVTPFEATTHSAVVSDDTTTEVSSIERETTASQETTSQDIYSSSE----RVTMTP-------FEATTHSTVDSDDTTTEISSIERETTG 393