>gi|26553454|ref|NP_757388.1| DNA polymerase III subunit beta [Mycoplasma penetrans HF-2] >gi|26453460|dbj|BAC43792.1| DNA polymerase III subunit beta [Mycoplasma penetrans HF-2] (378 aa)
Score = 1572, Expect = 8.0e-173, Identities = 377/378 (99%), Positives = 378/378 (100%)
  Q:     1 LKKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN 378
           +KKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN
  S:     1 MKKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN 378
>gi|13357635|ref|NP_077909.1| DNA pol III beta chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971016|ref|ZP_02553293.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282152|ref|ZP_02689819.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308310|ref|ZP_02690985.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170761919|ref|YP_001752158.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11356839|pir||C82937 DNA pol III beta chain UU079 [imported] - Ureaplasma urealyticum >gi|6899030|gb|AAF30484.1|AE002107_8 DNA pol III beta chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827496|gb|ACA32758.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902942|gb|EDT49231.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676125|gb|EDT88030.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700969|gb|EDU19251.1| DNA polymerase III, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (379 aa)
Score = 413, Expect = 2.0e-38, Identities = 115/372 (30%), Positives = 217/372 (58%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNK--EKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEI---IDFDTN--IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRII-ATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDS-FKPVLLRDEKDPNFLQILVPIRN 378
           M++ +S  KLI A++   +I+    ++ + LG LIEV+ N+I F T+N  +S +  +  +E       G++L+  K    +ISKLK++ + L+++D +++ +KT  F++ IN M+ E +PN+NFS  D+ ++S+   + ++  +KV   V N++  EKI  +SGI  ++ + E  L  I TD  K +    E   + F+ ++  S ++L++EI   +++  N  ++ ++   ++IFK+++ I+ +++I+G YPN+  I   T +EN     ++ L+E +ERG+ I   E+   + +       E+S ++ ++GN KE +S     N+     LN   L  +LK FDN+++T +  D   +P++  D KD  F QIL  I+N
  S:     1 MEVFISIKKLIEAIKFSTTIANTNNANALLLGVLIEVSQNKISFKTTNNQVSGYKEI--TEGFEYFNSGKVLVTAKIILGLISKLKDKSVLLKQIDTNILLIKTENFETQINTMNIEGFPNLNFSLEDYVKISLPHQIMQEINTKVLPNVLNSQGIEKIQPISGILIDTQTLENKLIAIGTDKIKASCLIREYMGEKFKFIVSYSTMKLIIEILKNVEYSNNQTVDFYVRSRSLIFKINDAILQTRMIDGVYPNIYSIFDETNEENTYVFDRRLLIEIIERGMNIVMQEQNPKISIRIDKNEAEISLTTFEIGNMKEKMSIVNLNNKSAEFILNPSLLAHVLKNFDNNDVTFKVKDEILRPIIFIDTKDVGFKQILSRIKN 379
>gi|110003909|emb|CAK98249.1| putative dna polymerase III, beta chain protein [Spiroplasma citri] (372 aa)
Score = 360, Expect = 2.6e-32, Identities = 110/372 (29%), Positives = 205/372 (55%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN 378
           M + + + K+++ L   + I       P  LG LIEV  ++I FTTS+G  S  S +    D NI   G +LIK K    +I K+++E ITLE V+ ++IK+K + FDS +N ++   YP+++F   +  ++  +  V K+ IS+  +A+   KEK  + +G+   +  + K L I ATD ++L+  K + S   +F +++    I  +  +I + D  I++ + + ++   ++NTI+ +KIIEG YP+ S++IAT     + I+ + L++ +ER   +S+    +IV L    + + V+  + ++GN++E +           I+ N+ ++L  LK F    IT++  D  KP+++    D    Q+++PIR+
  S:     1 MIVNIKRDKILDELLKVSRIISQKTLIPSLLGILIEVKKDKITFTTSDGDTSIKSEIM-GNDLNITRIGSVLIKNKFIVEVIRKIEDEFITLEVVEGNLIKIKANNFDSVLNTLNSADYPHLSFE-TEGKEIIFTSTVLKEIISQTSFAIGE-KEKRIVFNGLNIKTDQNNKELIITATDSFRLSCKKIDYSNNYNFDVIIPGKFINEIGRLISENDQEIKMKITDKSVSVIINNTIVQTKIIEGKYPDTSKVIATSFNTSLTINNRELIKIIERASVLSNETMTTIVTLKIKEQKVLVTSFTQEIGNTEEEIREFKVEGTDQIIAFNSKYILDALKAFKTKEITIKMIDETKPLIITANDDQTLQQLVLPIRS 371
>gi|29374663|ref|NP_813815.1| DNA polymerase III, beta subunit [Enterococcus faecalis V583] >gi|29342121|gb|AAO79887.1| DNA polymerase III, beta subunit [Enterococcus faecalis V583] (376 aa)
Score = 346, Expect = 1.0e-30, Identities = 100/371 (26%), Positives = 200/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDA---NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           MK+ V ++  +  L+       +  + P+  G  I ++++ +  T SN  IS  S ++K ++     I   G I+++++ F  II KL  +M T+E +DN+ + + +   D  +N +D + YP++    +  NQ+ +   +  K IS+  +AV+ ++ +  I++G+ F  I   + L  +ATD ++L+      E   +DF IV+   SL EL   + + +  +EI + E+ ++FK       S+++EG+YP+ +R+I T    ++      L+ A+ER   +S   + +IV+L+ S + + +  +S ++G  +E ++ +    E   IS N  ++   L+ F + NITV+F    +P  L   E + +F+Q++ P+R
  S:     1 MKLTVKRSVFLQELQTVQRAISSKTTIPILTGVKIVLSEDGLSLTGSNADISIESFLSKDDEKAQMTIERTGSIVLQSRFFGEIIRKLPEDMFTMEVLDNNQVAITSGKADFTVNGLDADNYPHLPV-IDTQNQMKLPVHLLTKIISETGFAVSMHESR-PILTGVHF--ILENQKLLAVATDSHRLSQRVIPTEQAVEDFNIVIPGKSLTELSRSLTNEEEMVEISIMENQVLFKTETMYFYSRLLEGNYPDTNRLIPTSHNTQIEFYVPELLSAIERASLLSHEGRNNIVRLSISPDSVVLYGNSPEIGKVEEALNYENVSGEALDISFNPDYMKDALRAFGDMNITVKFLSPIRPFTLEPTETELDFIQLITPVR 374
>gi|73661311|ref|YP_300092.1| DNA polymerase III subunit beta [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72493826|dbj|BAE17147.1| DNA polymerase III beta subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (376 aa)
Score = 329, Expect = 1.1e-28, Identities = 99/344 (28%), Positives = 185/344 (53%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDA----NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  IEV +NE+  T S+  IS    + K  D     +I+E G +++  + F  II KL  + + L   +     + +   + N++ +D +QYP +   S +D  QLS+   V K  I++  +AV+ ++ +  +++G+  N +  E  L   ATD ++LA  K   E   ++  +++    +  L +I+ D + +I+IF   + ++FKV N    S+++EG YP+ SR+     E K+ I       A++R   ++     +++KL+  +E++E+S +S ++G  KE V           IS N+ +++  LK  DND + VEF  + KP +L+ + D +  Q+++PIR
  S:    28 PILTGIKIEVKNNEVILTGSDSEISIEITIPKQVDGEDIIDIVETGSVVLPGRFFVDIIKKLPGKEVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVK--VLKNVIAQTNFAVSTSETR-PVLTGV--NWLIQENELICTATDSHRLAVRKVALEDDSENKNVIIPGKALSELNKIMSDSEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTSRLFPENYEIKLGIDNGEFYHAIDRASLLAREGGNNVIKLSTGNELVELSSTSPEIGTVKEDVKASNVDGGNLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKDDDSVTQLILPIR 374
>gi|70725003|ref|YP_251917.1| DNA polymerase III subunit beta [Staphylococcus haemolyticus JCSC1435] >gi|68445727|dbj|BAE03311.1| DNA polymerase III beta chain, sliding clamp subunit [Staphylococcus haemolyticus JCSC1435] (377 aa)
Score = 324, Expect = 4.1e-28, Identities = 96/344 (27%), Positives = 183/344 (53%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDA----NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  I+  DNE+  T S+  IS    + K  D      I E G +++  + F  II KL  + + L   +     + +   + N++ +D +QYP +   S +D  QLS+   V K  I++  +AV+ ++ +  +++G+  N +  +  L   ATD ++LA    K E   ++  +++    +  L +I+ D D  I+IF   + ++FKV N    S+++EG YP+ +R+     E K+ +       A++R   ++     +++KL+  ++V+E+S +S ++G  KE V+          IS N+ +++  LK  DND + VEF  + KP +L+ ++D +  Q+++PIR
  S:    29 PILTGIKIDAKDNEVILTGSDSEISIEITIPKQVDGEDIVTISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVK--VLKNIIAQTNFAVSTSETR-PVLTGV--NWLIQDNELICTATDSHRLAVRKLKLEDDSENKNVIIPGKALSELNKIMSDSDEEIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLGLDNGEFYHAIDRASLLAREGGNNVIKLSTGNDVVELSSTSPEIGTVKEEVTATDVEGGNLKISFNSRYMMDALKAIDNDEVEVEFFGTMKPFILKPKEDDSVTQLILPIR 375
>gi|69246707|ref|ZP_00604075.1| DNA polymerase III, beta chain [Enterococcus faecium DO] >gi|68195121|gb|EAN09580.1| DNA polymerase III, beta chain [Enterococcus faecium DO] (376 aa)
Score = 323, Expect = 5.3e-28, Identities = 97/371 (26%), Positives = 197/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDAN--ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP-NFLQILVPIR 377
           MK+ +++   +  L+       +  + P+  G  I +    +  T SN  IS  + ++ ++E AN  I   G I+++ + F  II +L  E  TLE ++N  + + +   +  +N +D + YP++       NQ+ +   V  K I++  +AV+ ++ +  I++G+ F  I S+ +L  +ATD ++L+      E     F IV+   SLIEL   + + +  +EI + E+ ++FK       S+++EG+YP+ +R+I +    +V  S  + + A+ER   +S   + +IV+L+   + + +  +S ++G  +E++S      +P  IS N  ++ + L+ F + +I V+F  + +P  L   +D   F+Q++ P+R
  S:     1 MKVTLNRASFMQELQTVQRAISSKTTIPILTGVKITLTQEGLTLTGSNADISIETFLSVENEKANMQIESTGSIVLQARFFSEIIRRLPEETFTLEVLENKQVAITSGKANFIVNGLDADNYPHLPV-VESHNQMKLPVHVLTKLINETVFAVSQHESR-PILTGVHF--ILSDNSLLAVATDSHRLSQRVIPVEQAADHFDIVIPGKSLIELSRSLTNEEEIVEISIMENQVLFKTETMYFYSRLLEGNYPDTNRLIPSSFNTEVEFSVPSFLAAIERASLLSHEGRNNIVRLSIRPDAVVLYGNSPEIGKVEESLSYTASSGDPLDISFNPDYMKAALRAFGDMSIKVKFISAIRPFTLEPTEDGVQFIQLITPVR 374
>gi|461954|sp|P34029|DPO3B_SPICI DNA polymerase III subunit beta >gi|49347|emb|CAA79522.1| DnaN protein [Spiroplasma citri] >gi|745457|prf||2016285B DNA polymerase III:SUBUNIT=beta (363 aa)
Score = 322, Expect = 6.2e-28, Identities = 105/372 (28%), Positives = 195/372 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN 378
           M + + + K+++ L   + I       P  LG LIEV  ++I FTTS+G  S  S +    D NI   G +LIK K    +I K+++E ITLE V+ ++IK+K + FDS +N ++   YP+++F   +  ++  +  V K+ IS+  +A+   KEK  + +G+   +  + K L I ATD ++L+  K + S   +F +++    I  +  +I  +  +      S ++  + N     KIIEG YP+ S++I T     + I+ + +++ +ER   +S+    +IV L    + + V+  + ++GN++E +           I+ N+ ++L  LK F    IT++  D  KP+++    D    Q+++PIR+
  S:     1 MIVNIKRDKILDELLKVSRIISQKTLIPSLLGILIEVKKDKITFTTSDGDTSIKSEIM-GNDLNITRIGSVLIKNKFIVEVIRKIEDEFITLEVVEGNLIKIKANNFDSVLNTLNSADYPHLSFE-TEGKEIIFTSTVLKEIISQTSFAI-GEKEKRIVFNGLNIKTDQNNKELIITATDSFRLSCKKIDYSNNYNFDVIIPGKFINEIGRLISENDQV------SELLLIIINC--KQKIIEGKYPDTSKVIRTSFNTSLTINNRAIIKIIERRSVLSNETMTTIVTLKIKEQKVLVTSFTQEIGNTEEEIRDFKVEGTDQIIAFNSKYILDALKAFKTKEITIKMIDERKPLIITANDDQTLQQLVLPIRS 362
>gi|15922992|ref|NP_370526.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus Mu50] >gi|15925707|ref|NP_373240.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus N315] >gi|21281731|ref|NP_644817.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus MW2] >gi|49482255|ref|YP_039479.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus MRSA252] >gi|49484914|ref|YP_042135.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651110|ref|YP_184913.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus COL] >gi|87160973|ref|YP_492724.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus USA300] >gi|88193825|ref|YP_498610.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266449|ref|YP_001245392.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus JH9] >gi|150392482|ref|YP_001315157.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus JH1] >gi|151220214|ref|YP_001331037.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978333|ref|YP_001440592.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus Mu3] >gi|161508268|ref|YP_001573927.1| DNA polymerase III subunit beta [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727089|ref|ZP_02759366.1| DNA-directed DNA polymerase beta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|60389826|sp|Q6GD88|DPO3B_STAAS DNA polymerase III subunit beta >gi|60389828|sp|Q6GKU3|DPO3B_STAAR DNA polymerase III subunit beta >gi|60392198|sp|P0A022|DPO3B_STAAM DNA polymerase III subunit beta >gi|60392199|sp|P0A023|DPO3B_STAAW DNA polymerase III subunit beta >gi|60392200|sp|P0A024|DPO3B_STAAU DNA polymerase III subunit beta >gi|60392205|sp|P99103|DPO3B_STAAN DNA polymerase III subunit beta >gi|81695636|sp|Q5HJZ4|DPO3B_STAAC DNA polymerase III subunit beta >gi|13699919|dbj|BAB41218.1| DNA polymerase III, beta chain [Staphylococcus aureus subsp. aureus N315] >gi|14245769|dbj|BAB56164.1| DNA polymerase III beta chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21203166|dbj|BAB93867.1| DNA polymerase III beta chain [Staphylococcus aureus subsp. aureus MW2] >gi|49240384|emb|CAG39030.1| DNA polymerase III, beta chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243357|emb|CAG41774.1| DNA polymerase III, beta chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285296|gb|AAW37390.1| DNA polymerase III, beta subunit [Staphylococcus aureus subsp. aureus COL] >gi|87126947|gb|ABD21461.1| DNA polymerase III, beta subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201383|gb|ABD29193.1| DNA polymerase III, beta subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147739518|gb|ABQ47816.1| DNA polymerase III, beta subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149944934|gb|ABR50870.1| DNA polymerase III, beta subunit [Staphylococcus aureus subsp. aureus JH1] >gi|150373014|dbj|BAF66274.1| DNA polymerase III beta subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|156720468|dbj|BAF76885.1| DNA polymerase III beta chain [Staphylococcus aureus subsp. aureus Mu3] >gi|160367077|gb|ABX28048.1| DNA-directed DNA polymerase beta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (377 aa)
Score = 321, Expect = 9.4e-28, Identities = 97/344 (28%), Positives = 184/344 (53%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDA----NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  I+  ++E+  T S+  IS    + K+ D     NI E G +++  + F  II KL  + + L   +     + +   + N++ +D +QYP +   S +D  QLS+   V K  I++  +AV+ ++ +  +++G+  N +  E  L   ATD ++LA  K   E   ++  +++   +L EL   + D + +I+IF   + ++FKV N    S+++EG YP+ +R+     E K++I       A++R   ++     +++KL+   +V+E+S +S ++G  KE V           IS N+ +++  LK  DND + VEF  + KP +L+ + D +  Q+++PIR
  S:    29 PILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVK--VLKNVIAQTNFAVSTSETR-PVLTGV--NWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIR 375
>gi|116332683|ref|YP_794210.1| DNA polymerase sliding clamp subunit [Lactobacillus brevis ATCC 367] >gi|116098030|gb|ABJ63179.1| DNA polymerase III, beta subunit [Lactobacillus brevis ATCC 367] (379 aa)
Score = 319, Expect = 1.6e-27, Identities = 110/371 (29%), Positives = 195/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSS---PVFLGTLIEVNDNEIKFTTSNGIISTHSIV-AKSEDA--NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSF--SSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  +++   I  L   N++S  I S    P+  G  I  +D  +  T SN  IS  +++ A + D    I E G I++  + F  I+ +L  + +T+E  D    ++ +     NIN  D   YP++    +  + + +S  VFK+ IS+   AV+N +E   I++GI F  + ++     +ATD ++L+  + E STP +     I+   SL EL   I D D ++++   E+ ++F + +T   S+++EG+YP+ SR+I       V      L+ A+ER   +S   + ++VKL  +    +V+   +S D+GN +E ++ K    EP  IS N  ++   L +F    I V F+ + +P  L+  E   NF+Q++ P+R
  S:     1 MKFTINRAAFIKEL---NNVSRAISSKTTIPILTGLKIVASDAGLLLTGSNADISIETLIRADNPDVGLTIDEPGSIVLTARFFSEIVKRLPEKEMTVEVKDGFQTEITSGAAAFNINGQDANNYPHLP-EIDAADSIVLSGAVFKELISQTVIAVSN-QESRPILTGIHF--VLNDNQFLAVATDSHRLSQRQIELSTPSEASFDVIIPGKSLTELSRMIGDDDADVKMQFSENQVLFLLGDTSFYSRLLEGNYPDTSRLIPKESSTTVEFEAPELLAAVERASLLSHESRNNVVKLTLTPTDHQVTIFSNSPDVGNVEEELAPKEIGGEPLEISFNPDYMKDALHSFGQATIRVAFTSALRPFTLVPTEDTSNFIQLITPVR 377
>gi|82749779|ref|YP_415520.1| DNA polymerase III subunit beta [Staphylococcus aureus RF122] >gi|82655310|emb|CAI79690.1| DNA polymerase III beta chain [Staphylococcus aureus RF122] (377 aa)
Score = 316, Expect = 3.2e-27, Identities = 98/344 (28%), Positives = 185/344 (53%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKS---ED-ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  I+  ++E+  T S+  IS    + K+   ED  NI E G +++  + F  II KL  + + L   +     + +   + N++ +D +QYP +   S +D  QLS+   V K  I++  +AV+ ++ +  +++G+  N +  E  L   ATD ++LA  K   E   ++  +++   +L EL   + D + +I+IF   + ++FKV N    S+++EG YP+ +R+     E K++I       A++R   ++     +++KL+   +V+E+S +S ++G  KE V           IS N+ +++  LK  DND + VEF  + KP +L+ + D +  Q+++PIR
  S:    29 PILTGIKIDAKEHEVILTGSDSEISIEITIPKTVNGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVK--VLKNVIAQTNFAVSTSETR-PVLTGV--NWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIR 375
>gi|16802050|ref|NP_463535.1| DNA polymerase III subunit beta [Listeria monocytogenes EGD-e] >gi|46906226|ref|YP_012615.1| DNA polymerase III subunit beta [Listeria monocytogenes str. 4b F2365] >gi|47093012|ref|ZP_00230791.1| DNA polymerase III, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|153169032|ref|ZP_01928771.1| DNA polymerase III, beta subunit [Listeria monocytogenes FSL N1-017] >gi|153176164|ref|ZP_01931423.1| DNA polymerase III, beta subunit [Listeria monocytogenes FSL N3-165] >gi|153181032|ref|ZP_01933999.1| DNA polymerase III, beta subunit [Listeria monocytogenes F6900] >gi|153184354|ref|ZP_01935113.1| DNA polymerase III, beta subunit [Listeria monocytogenes J0161] >gi|153192644|ref|ZP_01939604.1| DNA polymerase III, beta subunit [Listeria monocytogenes J2818] >gi|153197968|ref|ZP_01942138.1| DNA polymerase III, beta subunit [Listeria monocytogenes 10403S] >gi|153204491|ref|ZP_01945288.1| DNA polymerase III, beta subunit [Listeria monocytogenes HPB2262] >gi|167015924|ref|ZP_02278457.1| DNA polymerase III subunit beta [Listeria monocytogenes FSL J1-194] >gi|167455309|ref|ZP_02321532.1| DNA polymerase III subunit beta [Listeria monocytogenes FSL J2-064] >gi|16409361|emb|CAC98217.1| DNA polymerase III, beta chain [Listeria monocytogenes] >gi|46879490|gb|AAT02792.1| DNA polymerase III, beta subunit [Listeria monocytogenes str. 4b F2365] >gi|47018580|gb|EAL09334.1| DNA polymerase III, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|126942857|gb|EBA20591.1| DNA polymerase III, beta subunit [Listeria monocytogenes J0161] >gi|127632304|gb|EBA21986.1| DNA polymerase III, beta subunit [Listeria monocytogenes 10403S] >gi|127763681|gb|EBA24515.1| DNA polymerase III, beta subunit [Listeria monocytogenes J2818] >gi|133725980|gb|EBA27678.1| DNA polymerase III, beta subunit [Listeria monocytogenes FSL N1-017] >gi|133728877|gb|EBA30575.1| DNA polymerase III, beta subunit [Listeria monocytogenes FSL N3-165] >gi|133731550|gb|EBA33248.1| DNA polymerase III, beta subunit [Listeria monocytogenes F6900] >gi|133734271|gb|EBA35969.1| DNA polymerase III, beta subunit [Listeria monocytogenes HPB2262] (381 aa)
Score = 316, Expect = 3.4e-27, Identities = 100/371 (26%), Positives = 197/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEK----GRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR--DEKDPN-FLQILVPIR 377
           MK ++ + +L+ A+           + P+  G  I VND  +  T S+  IS  + +   E+  ++ +    G I++++K F  I+ +L  E + +E   N    + +      +N +D  +YP +     D   + I   V K  + +  +AV+  + +  +++G+  N I  E  L  +ATD ++LA  +        +++ IV+   SL EL   + D   +IE+ L  + I+FK+ + +  S+++EG YP+ SR+I T  ++++ I+ K  ++A++R   ++   + +++KL    +  +EVS +S ++GN  E V  +    E   IS N  +++  L+ F+ D+I + FS + +P +LR  D  +PN  LQ++ P+R
  S:     1 MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLTGSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQTNISSGQASFTLNGLDPMEYPKLP-EVTDGKTIKIPINVLKNIVRQTVFAVSAIEVR-PVLTGV--NWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKLLDDASESIEMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLLARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALRAFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITPVR 379
>gi|116871424|ref|YP_848205.1| DNA polymerase III subunit beta [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740302|emb|CAK19420.1| dnaN [Listeria welshimeri serovar 6b str. SLCC5334] (381 aa)
Score = 316, Expect = 3.7e-27, Identities = 100/371 (26%), Positives = 197/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEK----GRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR--DEKDPN-FLQILVPIR 377
           MK ++ + +L+ A+           + P+  G  I VND  +  T S+  IS  + +   E+  ++ +    G I++++K F  I+ +L  E + +E   N    + +      +N +D  +YP +     D   + I   V K  I +  +AV+  + +  +++G+  N I  E  L  +ATD ++LA  +        +++ IV+   SL EL   + D   +IE+ L  + I+FK+ + +  S+++EG YP+ SR+I T  ++++ I+ +  ++A++R   ++   + +++KL    +  +EVS +S ++GN  E V  +    E   IS N  +++  L+ F+ D+I + FS + +P +LR  D  +PN  LQ++ P+R
  S:     1 MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLTGSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTTNYQTNISSGQASFTLNGLDPMEYPKLP-EVTDGKNIKIPINVLKNIIRQTVFAVSAIEVR-PVLTGV--NWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLAELNKILDDASESIEMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSRAFLQAIDRASLLARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALRAFEGDDIQISFSGTMRPFVLRPKDATNPNEILQLITPVR 379
>gi|27466920|ref|NP_763557.1| DNA polymerase III subunit beta [Staphylococcus epidermidis ATCC 12228] >gi|57865930|ref|YP_190093.1| DNA polymerase III subunit beta [Staphylococcus epidermidis RP62A] >gi|38604836|sp|Q8CQK6|DPO3B_STAES DNA polymerase III subunit beta >gi|81672839|sp|Q5HK00|DPO3B_STAEQ DNA polymerase III subunit beta >gi|27314462|gb|AAO03599.1|AE016744_2 DNA polymerase III beta subunit [Staphylococcus epidermidis ATCC 12228] >gi|57636588|gb|AAW53376.1| DNA polymerase III, beta subunit [Staphylococcus epidermidis RP62A] (377 aa)
Score = 315, Expect = 4.1e-27, Identities = 96/344 (27%), Positives = 182/344 (52%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  I+  +NE+  T S+  IS    + K  D      I E G +++  + F  II KL  + + L   +     + +   + N++ +D +QYP +   S +D  QLS+   V K  I++  +AV+ ++ +  +++G+  N +  +  L   ATD ++LA  K +    +     I+   +L EL   + D D +I+IF   + ++F+V N    S+++EG YP+ +R+     E K+ I+      A++R   ++     +++KL+  +E++E+S +S ++G  KE V+          IS N+ +++  LK  DND + VEF  + KP +L+ + D +  Q+++PIR
  S:    29 PILTGIKIDAKENEVILTGSDSEISIEITIPKQVDGEEIVEITETGSVVLPGRFFVDIIKKLPGKEVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPEVSRDDAIQLSVK--VLKNIIAQTNFAVSTSETR-PVLTGV--NWLIQDNELICTATDSHRLAVRKLQLEDESENKNVIIPGKALSELNKIMSDSDEDIDIFFASNQVLFRVGNINFISRLLEGHYPDTTRLFPENYEIKLGINNGDFYHAIDRASLLAREGGNNVIKLSTGNELVELSSTSPEIGTVKEEVNANDVEGGNLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKDDDSVTQLILPIR 375
>gi|16799081|ref|NP_469349.1| DNA polymerase III subunit beta [Listeria innocua Clip11262] >gi|16412423|emb|CAC95235.1| DNA polymerase III, beta chain [Listeria innocua] (381 aa)
Score = 313, Expect = 7.7e-27, Identities = 99/371 (26%), Positives = 198/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEK----GRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR--DEKDPN-FLQILVPIR 377
           MK ++ + +L+ A+           + P+  G  I VND  +  T S+  IS  + +   E+  ++ +    G I++++K F  I+ +L  E + +E   N    + +      +N +D  +YP +     D   + I   V K  I +  +AV+  + +  +++G+  N I  +  L  +ATD ++LA  +     +  +++ IV+   SL EL   + D   +IE+ L  + I+FK+ + +  S+++EG YP+ SR+I T  ++++ I+ +  ++A++R   ++   + +++KL    +  +EVS +S ++GN  E V  +    E   IS N  +++  L+ F+ D+I + FS + +P +LR  D  +PN  LQ++ P+R
  S:     1 MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLTGSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTTNYQTNISSGQASFTLNGLDPMEYPKLP-EVTDGKNIKIPINVLKNIIRQTVFAVSAIEVR-PVLTGV--NWIIKDNKLSAVATDSHRLALREIPLETNIDEEYNIVIPGKSLAELNKILDDASESIEMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSRAFLQAIDRASLLARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALRAFEGDDIQISFSGTMRPFVLRPKDATNPNEILQLITPVR 379
>gi|47097284|ref|ZP_00234842.1| DNA polymerase III, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|47014329|gb|EAL05304.1| DNA polymerase III, beta subunit [Listeria monocytogenes str. 1/2a F6854] (378 aa)
Score = 308, Expect = 2.6e-26, Identities = 99/369 (26%), Positives = 195/369 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEK----GRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR--DEKDPN-FLQILVP 375
           MK ++ + +L+ A+           + P+  G  I VND  +  T S+  IS  + +   E+  ++ +    G I++++K F  I+ +L  E + +E   N    + +      +N +D  +YP +     D   + I   V K  + +  +AV+  + +  +++G+  N I  E  L  +ATD ++LA  +        +++ IV+   SL EL   + D   +IE+ L  + I+FK+ + +  S+++EG YP+ SR+I T  ++++ I+ K  ++A++R   ++   + +++KL    +  +EVS +S ++GN  E V  +    E   IS N  +++  L+ F+ D+I + FS + +P +LR  D  +PN  LQ++ P
  S:     1 MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLTGSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQTNISSGQASFTLNGLDPMEYPKLP-EVTDGKTIKIPINVLKNIVRQTVFAVSAIEVR-PVLTGV--NWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKLLDDASESIEMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLLARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALRAFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITP 377
>gi|13507740|ref|NP_109689.1| DNA polymerase III beta subunit [Mycoplasma pneumoniae M129] >gi|2494195|sp|Q50313|DPO3B_MYCPN DNA polymerase III subunit beta >gi|11379480|gb|AAG34739.1|AE000016_1 DNA polymerase III beta subunit [Mycoplasma pneumoniae M129] >gi|1209517|gb|AAC43645.1| DnaN (380 aa)
Score = 308, Expect = 2.9e-26, Identities = 104/369 (28%), Positives = 198/369 (53%)
  Q:     7 MKIIVSKTKLINALR-LCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYN----DWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFL-------FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVP 375
           MK++++K +L   L+ L N I  N    P     LIE  + EI F  +N   S    +A  E+ ++LE+G +++K K F  +I+ +K ++IT+++ D +++ VKT   + N+N +D++++P I F+ N    ++++L I   +  K + K+ +AV+  +E     +G+ FN  S+ K + + A+D YKL+ Y+ +     F  +++ +L+  +        + I IF          + ++ K+ N +I    I   +P V ++     E KV I K  L +AL+R L ++ +E+  +  +  ++  L+++ +  ++G S E V+C         I++N   LL  + +FD D I + F  S K  L+    +P   +ILVP
  S:     1 MKVLINKNELNKILKKLNNVIVSNNKMKPYHSYLLIEATEKEINFYANNEYFSAKCTLA--ENIDVLEEGEVIVKGKIFSELINGIKEDIITIQEKDQTLL-VKTKKTNINLNTIDKKEFPRIRFNQNVDLKEFDELKIQHSLLTKGLKKIAHAVSTFRESTRKFNGVNFNG-SNGKQIFLEASDSYKLSVYEIKQKTDPFNFIVETNLLSFINSFNPEGGDLISIFFRKEHKDDLSTELLIKLDNFLINYTSINESFPRVMQLFDFEPETKVTIQKNELKDALQRILTLAQNERFFLCDMQVTNSHLKINSNVQNIGASLEEVTCLKFEGHKLNIAVNALSLLEHIDSFDTDEIELYFQGSNKYFLISSNNEPELKEILVP 378
>gi|28376976|ref|NP_783868.1| DNA-directed DNA polymerase III, beta chain [Lactobacillus plantarum WCFS1] >gi|28269807|emb|CAD62704.1| DNA-directed DNA polymerase III, beta chain [Lactobacillus plantarum WCFS1] (379 aa)
Score = 307, Expect = 3.6e-26, Identities = 97/371 (26%), Positives = 193/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANIL---EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  ++++  I  L        +  + P+  G  ++VN + I  T S+  IS  + +  S+D N L   + G I++  + F  I+ KL  + +T+  VD    ++ +      IN +D E YP++    +  N ++++  V K+ I +   AV+N +E   I++G+ F  I +      +ATD ++L+  +    E+   ++ +++   SL EL   I D + ++++ L E+ ++F + NT   S+++EG+YP+ SR+I       V IS   L  A+ER   +S   + ++V+  +N + + + +  +S D+G   E +       +   IS N  ++   L++F    I + F+ + +P  L+  E+  NF+Q++ P+R
  S:     1 MKFTINRSAFIKELNNVQRAISSKTTIPILTGLKLDVNTDAITLTGSDADISIETTIPASDDNNTLVVEDAGSIVLPARFFSEIVKKLPEDTMTVNVVDGFQTQITSGAASFTINGLDPENYPHLP-EIDTTNTITLAGDVLKELIGQTVIAVSN-QESRPILTGVHF--ILANGEFLAVATDSHRLSQRRIKLPEANNANYDVIIPGKSLTELSRMIGDNNPDVQMRLSENQVLFVLGNTSFYSRLLEGNYPDTSRLIPKESNTTVEISAPALSAAIERASLLSHESRNNVVRFSVNPTDKTITIFGNSPDVGEVTEQLQPTDLSGDELEISFNPDYMKEALRSFGQAMIKISFTMALRPFTLVPTEEGENFIQLITPVR 377
>gi|89892748|ref|YP_516235.1| DNA polymerase III beta chain [Desulfitobacterium hafniense Y51] >gi|89332196|dbj|BAE81791.1| DNA polymerase III beta chain [Desulfitobacterium hafniense Y51] (385 aa)
Score = 304, Expect = 8.1e-26, Identities = 103/371 (27%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERG-LAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI  SK  LI  +        N  + PV  G +I      + F  ++  I    +V     A + ++G +++ ++ F  ++ KL + +I LE + N VI +  +  D ++   D E++P +   + D    ++   +FK  I +  +A +  +E   + +G C   I  + +L +IATD ++LA+   E S P+  +   I+   +L E+   + D D N+ I   ++ I+F+     + S++IEG +PN  ++I    + KV +S +   +++ER  L        SI+KL+  +E L +   +S+LG   E +  K + N+   I+ N+ FLL +LK  D++ I  E S S+ P ++R   DPN+L + +P+R
  S:    19 MKIYCSKDSLITGVNTVQKAVSNKNTLPVLQGIMIRAEGQSLIFEATDLEIGIRCVVP----AQVEKEGVVVLPSRLFSDLVRKLPDVLIELE-LQNDVINIHYNESDLSLRGYDPEEFPLLPDLF-DAETFNLPVSIFKTMIKQTIFACSA-EESRPVFTG-CLLQIE-DGSLRLIATDTHRLAYRIAEISNPEQIKFQGIIPAKTLGEIYRLLRDEDENLFIRFNQAQIVFQFGAVHLLSRLIEGQFPNYKQVIPQSCQTKVLLSARLFQDSVERASLLARDGSHTSIIKLSVDTERLSID-QTSELGKISEQMEVKKEGND-VKIAFNSKFLLDVLKIIDSEEIVFELSGSYSPGIIRPVDDPNYLYLALPVR 383
>gi|109647879|ref|ZP_01371782.1| DNA polymerase III, beta subunit [Desulfitobacterium hafniense DCB-2] >gi|109640969|gb|EAT50524.1| DNA polymerase III, beta subunit [Desulfitobacterium hafniense DCB-2] (367 aa)
Score = 303, Expect = 9.4e-26, Identities = 103/371 (27%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERG-LAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI  SK  LI  +        N  + PV  G +I      + F  ++  I    +V     A + ++G +++ ++ F  ++ KL + +I LE + N VI +  +  D ++   D E++P +   + D    ++   +FK  I +  +A +  +E   + +G C   I  + +L +IATD ++LA+   E S P+  +   I+   +L E+   + D D N+ I   ++ I+F+     + S++IEG +PN  ++I    + KV +S +   +++ER  L        SI+KL+  +E L +   +S+LG   E +  K + N+   I+ N+ FLL +LK  D++ I  E S S+ P ++R   DPN+L + +P+R
  S:     1 MKIYCSKDSLITGVNTVQKAVSNKNTLPVLQGIMIRAEGQSLIFEATDLEIGIRCVVP----AQVEKEGVVVLPSRLFSDLVRKLPDVLIELE-LQNDVINIHYNESDLSLRGYDPEEFPLLPDLF-DAETFNLPVSIFKTMIKQTIFACSA-EESRPVFTG-CLLQIE-DGSLRLIATDTHRLAYRIAEISNPEQIKFQGIIPAKTLGEIYRLLRDEDENLFIRFNQAQIVFQFGAVHLLSRLIEGQFPNYKQVIPQSCQTKVLLSARLFQDSVERASLLARDGSHTSIIKLSVDTERLSID-QTSELGKISEQMEVKKEGND-VKIAFNSKFLLDVLKIIDSEEIVFELSGSYSPGIIRPVDDPNYLYLALPVR 365
>gi|163938015|ref|YP_001642899.1| DNA polymerase III subunit beta [Bacillus weihenstephanensis KBAB4] >gi|163860212|gb|ABY41271.1| DNA polymerase III, beta subunit [Bacillus weihenstephanensis KBAB4] (381 aa)
Score = 303, Expect = 1.1e-25, Identities = 89/371 (23%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIV----AKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+ +++       +  + P+  G  +   +  +  T S+  IS  S +    A  E   I + G I+++ K F  I+ KL  E + +   ++ + K+K+   + N+N +D  +YP +     + +   I   + K  I +  +AV++++ +  I++G+ +   +SE  L  IATD ++LA        Y      Q   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+    ++LE+S ++ ++G   E V C+    E   IS +  +++  LK  D+  I V F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFTIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEDAGKEIVEIEQSGSIILQAKYFSEIVKKLPKETVEISVENHFMTKIKSGKSEFNLNGLDAAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSSSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGYNIADEFQANVVIPGKSLSELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQQMLEISSNAPEIGKVVEEVQCENVDGEELKISFSAKYMMDALKALDSTEIKVSFTGAMRPFLIRTVNDDSIIQLILPVR 379
>gi|52145207|ref|YP_081621.1| DNA polymerase III subunit beta [Bacillus cereus E33L] >gi|51978676|gb|AAU20226.1| DNA polymerase III, beta subunit [Bacillus cereus E33L] (379 aa)
Score = 303, Expect = 1.2e-25, Identities = 88/371 (23%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+ +++       +  + P+  G  +   +  +  T S+  IS  S +   ED      + + G I+++ K F  I+ KL  E + +   ++ + K+ +   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +   +SE  L  IATD ++LA    K E    +F+   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+     +LE+S +S ++G   E V C+    E   IS +  +++  LK  D+  I + F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFTIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSTSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGIADEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVR 377
>gi|23193192|gb|AAN14421.1|AF319579_2 DNA polymerase III beta chain [Bacillus weihenstephanensis] (381 aa)
Score = 302, Expect = 1.4e-25, Identities = 89/371 (23%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIV----AKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+ +++       +  + P+  G  +   +  +  T S+  IS  S +    A  E   I + G I+++ K F  I+ KL  E + +   ++ + K+K+   + N+N +D  +YP +     + +   I   + K  I +  +AV++++ +  I++G+ +   +SE  L  IATD ++LA        Y      Q   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+    ++LE+S ++ ++G   E V C+    E   IS +  +++  LK  D+  I V F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFTIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEDAGKEIVEIEQTGSIILQAKYFSEIVKKLPKETVEISVENHFMTKIKSGKSEFNLNGLDAAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSSSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGYNIADEFQANVVIPGKSLSELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQQMLEISSNAPEIGKVVEEVQCENVDGEELKISFSAKYMMDALKALDSTEIKVSFTGAMRPFLIRTVNDNSIIQLILPVR 379
>gi|30018280|ref|NP_829911.1| DNA polymerase III subunit beta [Bacillus cereus ATCC 14579] >gi|29893820|gb|AAP07112.1| DNA polymerase III, beta chain [Bacillus cereus ATCC 14579] (381 aa)
Score = 301, Expect = 2.0e-25, Identities = 89/371 (23%), Positives = 196/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE----STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+  ++       +  + P+  G  +   +  +  T S+  IS  S +   E+      I + G I+++ K F  I+ KL  + + +   ++ + K+K+   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +   +SE  L  IATD ++LA  K +    +   +F+   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+    E+LE+S +S ++G   E V C+    E   IS +  +++  LK  D+  I V F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFTIQKDYLVRGVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEENGKEIVEIAQSGSIVLQAKYFSEIVKKLPKDTVEISVENHFMTKIKSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSTSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGHNIADEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQEMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKVSFTGAMRPFLIRTVNDDSIIQLILPVR 379
>gi|81427618|ref|YP_394615.1| DNA-directed DNA polymerase III, beta subunit [Lactobacillus sakei subsp. sakei 23K] >gi|78609257|emb|CAI54304.1| DNA-directed DNA polymerase III, beta subunit [Lactobacillus sakei subsp. sakei 23K] (379 aa)
Score = 300, Expect = 2.1e-25, Identities = 94/371 (25%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANIL---EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLE--VSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  +++   I  L           + P+  G  + ++   +  T S+  IS  + ++ S++ N L   E G I++  + F  I+ KL  + + +   +N    +++   +  IN +D   YP++       N  SIS  V K+ I +   AV+N +E   I++G+  + + +   +  +ATD ++LA  K   + P D     I+   SL+EL   + D   ++EI + E+ ++FK  N    S+++EG+YP+ +R+I T    ++  +   L+ A+ER   +S   + ++V+L   +E     +  +S D+GN +E +  +    E   IS N  ++   L++F    I + F+ + +P  L+  E   +++Q++ P+R
  S:     1 MKFSINRALFIKTLNDVQRAISAKTTIPILTGLKLVLSQEGLTLTGSDADISIEATLSASDEKNQLVVEEVGEIVLPARFFSEIVKKLPEDQMRIAVGNNFQTTIRSGKSEFTINGLDANSYPHLP-EIAGQNTFSISTDVLKQLIHQTVIAVSN-QESRPILTGV--HLVLANGEMLAVATDSHRLAQRKLPVALPSDANYDVIIPGKSLVELSRTLADDAEDVEIRIAENQVLFKAGNLAFYSRLLEGNYPDTARLIPTSSSTQIEFNAPVLLAAIERASLLSHESRNNVVRLTLDTEANTAIIYGNSPDVGNVEEALQFENLTGESLEISFNPDYMKDALRSFGQTTIVINFTAALRPFTLVPSEDQEHYIQLITPVR 377
>gi|77917620|ref|YP_355435.1| DNA polymerase III, beta subunit [Pelobacter carbinolicus DSM 2380] >gi|77543703|gb|ABA87265.1| DNA polymerase III, beta subunit [Pelobacter carbinolicus DSM 2380] (372 aa)
Score = 300, Expect = 2.5e-25, Identities = 99/371 (26%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL-SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDF-------------DTNIEIFL--FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + K   +  L     I E   + P+    LIE  D+ I+ T ++  +   +    S  A++   GRI +  K  F II +L  + I+    +N  I+++      N+  +  +++P   F   D  Q   I   + K+ I K  ++++ ++ K N ++GI   ++  E  + L  +ATDG++LA      TP      LD S +E L + + F             + N E+ L   ++N + K S T+I  ++++GD+P+ +R+I    + K NI ++  + AL R +AI SSEK   VK++F    L +S S+ + G+++E    +    + + I  N  +L+ +L   D++ + +   D   P L+    D ++L +++P+R
  S:     1 MNFSIEKEVFLKGLARVQGIVEKKNTIPILANVLIEAEDDHIRLTATDLEVGMKA----SYPASVTSAGRITVSAKKLFEIIKELPEKEISFTAKENCWIEIRCGKSLFNVVGLSADEFPY--FPQIDKEQFFQIPGDILKRLIEKTAFSMSTDESKYN-LNGIYLRAMEDEGRQILRFVATDGHRLA---LMQTP------LDCSHVEPLAKGVIFPRKGVLELRKIAEEGNGEVLLGFMDNNAVIKKSQTVIVMRLVDGDFPDYNRVIPLNNDLKANIPREEFLHALRR-MAILSSEKSKGVKIDFQENQLTLSSSNPEFGDAREDFEIEYAEGDLS-IGFNARYLIDILANLDSEKVCLSLRDQLSPGLITPLDDNDYLAVIMPMR 371
>gi|52078493|ref|YP_077284.1| DNA polymerase III subunit beta [Bacillus licheniformis ATCC 14580] >gi|52783857|ref|YP_089686.1| DNA polymerase III subunit beta [Bacillus licheniformis ATCC 14580] >gi|52001704|gb|AAU21646.1| DNA polymerase III (beta subunit) [Bacillus licheniformis ATCC 14580] >gi|52346359|gb|AAU38993.1| DnaN [Bacillus licheniformis DSM 13] (378 aa)
Score = 300, Expect = 2.5e-25, Identities = 95/371 (25%), Positives = 201/371 (54%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKS----EDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVN--ISKKTLVEALERGLAISSSEKKSIVKLNFSS-EVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + K +L+ +++       +  + P+  G  I  +D  +  T S+  IS  S + K     E   I + G I+++ + F  I+ KL    + +E  +  +  +++   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +N    E  L   ATD ++LA  K +   +    + +V+   SL EL   + D    ++I + E+ ++FK  N +  S++++G+YP+ +R+I  P+E+K N  ++ K  ++A++R   ++   + ++VKL+ ++ E +E+S +S ++G   ETV+ +    E   IS +  ++L  LK  + ++I V F+ + +P L+R   D + +Q+++P+R
  S:     1 MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDEGVSLTGSDSDISIESFIPKEDGDLEIVTIEQPGSIVLQARFFSEIVKKLPMSTVEIEVQNQYLTIIRSGKAEFNLNGLDASEYPLLP-QIEEHHAFQIPTDLLKNLIRQTVFAVSTSETR-PILTGVNWNVTGGE--LICTATDSHRLALRKAKLDINEDSSYNVVIPGKSLTELSKILDDHQELVDIVITETQVLFKTKNVLFFSRLLDGNYPDTNRLI--PQESKTNLIVNTKEFLQAIDRASLLAREGRNNVVKLSAAANESIEISSNSPEIGKVVETVNAEQIEGEDLKISFSPKYMLDALKVLEGEDIHVSFTGAMRPFLIRTPNDDSIVQLILPVR 376
>gi|49476685|ref|YP_034362.1| DNA polymerase III subunit beta [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118475780|ref|YP_892931.1| DNA polymerase III subunit beta [Bacillus thuringiensis str. Al Hakam] >gi|166997069|ref|ZP_02263528.1| DNA polymerase III subunit beta [Bacillus cereus AH820] >gi|196036084|ref|ZP_03103484.1| DNA polymerase III, beta subunit [Bacillus cereus W] >gi|196041972|ref|ZP_03109259.1| DNA polymerase III, beta subunit [Bacillus cereus NVH0597-99] >gi|196045398|ref|ZP_03112629.1| DNA polymerase III, beta subunit [Bacillus cereus 03BB108] >gi|49328241|gb|AAT58887.1| DNA polymerase III, beta subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118415005|gb|ABK83424.1| DNA polymerase III, beta subunit [Bacillus thuringiensis str. Al Hakam] >gi|195991251|gb|EDX55219.1| DNA polymerase III, beta subunit [Bacillus cereus W] >gi|196023605|gb|EDX62281.1| DNA polymerase III, beta subunit [Bacillus cereus 03BB108] >gi|196027227|gb|EDX65847.1| DNA polymerase III, beta subunit [Bacillus cereus NVH0597-99] (379 aa)
Score = 298, Expect = 3.5e-25, Identities = 88/371 (23%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+ +++       +  + P+  G  +   +  +  T S+  IS  S +   ED      + + G I+++ K F  I+ KL  E + +   ++ + K+ +   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +   +SE  L  IATD ++LA    K E    +F+   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+     +LE+S +S ++G   E V C+    E   IS +  +++  LK  D+  I + F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFSIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSTSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVR 377
>gi|30260197|ref|NP_842574.1| DNA polymerase III subunit beta [Bacillus anthracis str. Ames] >gi|47525256|ref|YP_016605.1| DNA polymerase III subunit beta [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183041|ref|YP_026293.1| DNA polymerase III subunit beta [Bacillus anthracis str. Sterne] >gi|65317470|ref|ZP_00390429.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Bacillus anthracis str. A2012] >gi|167635102|ref|ZP_02393419.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0442] >gi|167641746|ref|ZP_02399989.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0193] >gi|170689459|ref|ZP_02880649.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0465] >gi|170707580|ref|ZP_02898033.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0389] >gi|177655289|ref|ZP_02936843.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0174] >gi|190569279|ref|ZP_03022173.1| DNA polymerase III, beta subunit [Bacillus anthracis Tsiankovskii-I] >gi|30253518|gb|AAP24060.1| DNA polymerase III, beta subunit [Bacillus anthracis str. Ames] >gi|47500404|gb|AAT29080.1| DNA polymerase III, beta subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49176968|gb|AAT52344.1| DNA polymerase III, beta subunit [Bacillus anthracis str. Sterne] >gi|167510300|gb|EDR85703.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0193] >gi|167529576|gb|EDR92326.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0442] >gi|170127576|gb|EDS96450.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0389] >gi|170666561|gb|EDT17334.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0465] >gi|172080216|gb|EDT65308.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0174] >gi|190559586|gb|EDV13577.1| DNA polymerase III, beta subunit [Bacillus anthracis Tsiankovskii-I] (379 aa)
Score = 296, Expect = 6.2e-25, Identities = 85/344 (24%), Positives = 183/344 (53%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  +   +  +  T S+  IS  S +   ED      + + G I+++ K F  I+ KL  E + +   ++ + K+ +   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +   +SE  L  IATD ++LA    K E    +F+   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+     +LE+S +S ++G   E V C+    E   IS +  +++  LK  D+  I + F+ + +P L+R   D + +Q+++P+R
  S:    28 PILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSTSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVR 377
>gi|152973856|ref|YP_001373373.1| DNA polymerase III subunit beta [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022608|gb|ABS20378.1| DNA polymerase III, beta subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (381 aa)
Score = 296, Expect = 6.9e-25, Identities = 87/371 (23%), Positives = 196/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+ +++       +  + P+  G  +   +  +  T S+  IS  S +   ED      + + G I+++ K F  I+ KL  +++ +   ++ + K+K+   + N+N +D  +YP +     + +   I   + K  I +  +AV++++ +  I++G+ +   +SE  L  IATD ++LA        +      Q   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+ F  ++LE+S +S ++G   E V C+    E   IS +  +++  LK  D+  I + F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFSIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDSDISIESFIPVEEDGKEIVEVSQSGSIVLQAKYFSEIVKKLPKDIVEISVENHFMTKIKSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSSSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRTAKIEGHNISDEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTFEQKMLEISSNSPEIGKVVEEVQCEKIDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDNSIIQLILPVR 379
>gi|16077070|ref|NP_387883.1| DNA polymerase III subunit beta [Bacillus subtilis subsp. subtilis str. 168] >gi|118797|sp|P05649|DPO3B_BACSU DNA polymerase III subunit beta >gi|40015|emb|CAA26218.1| unnamed protein product [Bacillus subtilis] >gi|467392|dbj|BAA05238.1| beta subunit of DNA polymerase III [Bacillus subtilis] >gi|2632269|emb|CAB11778.1| DNA polymerase III (beta subunit) [Bacillus subtilis subsp. subtilis str. 168] (378 aa)
Score = 295, Expect = 9.2e-25, Identities = 89/371 (23%), Positives = 198/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED----ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQD--FRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFS-SEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + K +L+ +++       +  + P+  G  I  +D+ + FT S+  IS  S + K E       I + G I+++ + F  I+ KL    + +E  +  +  +++   + N+N +D ++YP++     + + + I   + K  I +  +AV+ ++ +  I++G+ +    SE  L   ATD ++LA  K +   P+D  + +V+    +  L +I+D +   ++I + E+ ++FK  N +  S++++G+YP+ + +I    + ++ ++ K  ++A++R   ++   + ++VKL+   +E +E+S +S ++G   E +       E   IS +  ++L  LK  +   I V F+ + +P L+R   D   +Q+++P+R
  S:     1 MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLP-QIEEHHAIQIPTDLLKNLIRQTVFAVSTSETR-PILTGVNWKVEQSE--LLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVR 376
>gi|42779083|ref|NP_976330.1| DNA polymerase III subunit beta [Bacillus cereus ATCC 10987] >gi|42734998|gb|AAS38938.1| DNA polymerase III, beta subunit [Bacillus cereus ATCC 10987] (379 aa)
Score = 295, Expect = 9.5e-25, Identities = 87/371 (23%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K  L+ +++       +  + P+  G  +   +  +  T S+  IS  S +   E+      + + G I+++ K F  I+ KL  E + +   ++ + K+ +   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +   +SE  L  IATD ++LA    K E    +F+   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R   ++   + ++VKL+     +LE+S +S ++G   E V C+    E   IS +  +++  LK  D+  I + F+ + +P L+R   D + +Q+++P+R
  S:     1 MRFTIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEENGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSTSETR-PILTGVNWKVYNSE--LTGIATDSHRLALRKAKIEGIADEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVR 377
>gi|55821995|ref|YP_140436.1| DNA polymerase III subunit beta [Streptococcus thermophilus CNRZ1066] >gi|55737980|gb|AAV61621.1| beta subunit of DNA polymerase III [Streptococcus thermophilus CNRZ1066] (378 aa)
Score = 294, Expect = 1.2e-24, Identities = 99/371 (26%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP-NFLQILVPIR 377
           ++  ++K   + AL        +  + P+     IEV  + I  T SNG IS  +SI A  E+A +L  + G IL++   F  ++S L +  +T E+++   + +K++  +  +   D EQYP I    +    L +   + K  I++  +A +  +E   I++G+ F  +S+ K L+ +ATD ++++  +   E +  +F +V+   SL EL     D   N+EIF   + I+F+       ++++EG+YP+ +R+++   E +V     TL  A+ER   IS++ +   VKL   +  +    +S ++G   E +           IS N  +L+  LK   ++++ V F    +P  L    D  NF+Q++ P+R
  S:     2 IQFAINKAYFLQALHTTRRAISSKNAIPILSTIKIEVTSDGIYLTGSNGQISIENSISASEENAGLLITQPGSILLEANFFINVVSSLPDVTLTFEEIEQYQVLLKSAKSEITLKGKDAEQYPRIQ-EVDSLTPLIMDTKMLKSIIAETSFAAST-QESRPILTGVHF-VLSNHKDLKAVATDSHRMSQRQLVLEHSADNFDVVIPSRSLKELSAVFSDGIENLEIFFSANQILFRSETISFYTRLLEGNYPDTNRLLSDSFETEVVFETSTLRSAMERSYLISNASQSGTVKLEIINGNVSAHVNSPEVGKVNEDIDVLDVSGSDLIISFNPTYLIDALKALKSESVRVRFISPVRPFTLTPADDSENFIQLITPVR 376
>gi|172056047|ref|YP_001812507.1| DNA polymerase III, beta subunit [Exiguobacterium sibiricum 255-15] >gi|171988568|gb|ACB59490.1| DNA polymerase III, beta subunit [Exiguobacterium sibiricum 255-15] (377 aa)
Score = 293, Expect = 1.3e-24, Identities = 92/371 (24%), Positives = 197/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQ-DFR--IVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE---VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M I + +  LI A++       +  + P+  G  +E + + +  T S+  IS    +   E+      +   G +++  + F  I+ KL  + + LE   N + ++++ T + ++N +D +++P +    +   Q  +   + +  I +  +AV   +E   +++G+ F++   +  L  ++TD ++LA    +FE+  +  F+  IV   SL EL  LL     D +++I +    I+FK+ + +  S++++G+YP+ SR+I       V ++ K L++A++R   ++  ++ +++K  F++E    +E+S  S ++G   E VS      E   IS N+ +++  LK  D  +I ++F+ S +P +L      N LQ+++P+R
  S:     1 MHITIQRDTLIQAIQDVAKAVSSRTTIPILTGIKLEAHGDGMTLTGSDTEISIERTIYAEENGTSYVTVHRAGSVVLNARFFGDIVKKLPTDEVILEVSPNFMTRIQSGTAEFHLNGLDPDEFPRLP-QVDGGQQFRLPADLLRSMIRQTSFAVAV-QETRPVLTGVNFSA--DKDILTCVSTDSHRLALRRAQFETDNEISFQNVIVPGKSLNELSKLLS----DGHVDITITNQQILFKMKHVLFFSRLLDGNYPDTSRLIPEEYRTAVRMNAKELLQAIDRASLLAREDRNNVIK--FAAEGTTAVEISSHSPEVGKVSEQVSILSLEGEELKISFNSKYMMDALKALDATDIEIQFTGSIRPFILHPVDQDNVLQLILPVR 375
>gi|55820105|ref|YP_138547.1| DNA polymerase III subunit beta [Streptococcus thermophilus LMG 18311] >gi|55736090|gb|AAV59732.1| beta subunit of DNA polymerase III [Streptococcus thermophilus LMG 18311] (378 aa)
Score = 293, Expect = 1.7e-24, Identities = 98/371 (26%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP-NFLQILVPIR 377
           ++  ++K   + AL        +  + P+     IEV  + I  T SNG IS  +SI A  E+A +L  + G IL++   F  ++S L +  +T E+++   + +K++  +  +   D EQYP I    +    L +   + K  I++  +A +  +E   I++G+ F  +S+ K L+ +ATD ++++  +   E +  +F +V+   SL EL     D   N+EIF   + I+F+       ++++EG+YP+ +R+++   E +V     TL  A+ER   IS++ +   VKL   +  +    +S ++G   E +           IS N  +L+  LK   ++++ + F    +P  L    D  NF+Q++ P+R
  S:     2 IQFAINKAYFLQALHTTRRAISSKNAIPILSTIKIEVTSDGIYLTGSNGQISIENSISASEENAGLLITQPGSILLEANFFINVVSSLPDVTLTFEEIEQYQVLLKSAKTEITLKGKDAEQYPRIQ-EVDSLTPLIMDTKMLKSIIAETSFAAST-QESRPILTGVHF-VLSNHKDLKAVATDSHRMSQRQLVLEHSADNFDVVIPSRSLKELSAVFSDGIENLEIFFSANQILFRSETISFYTRLLEGNYPDTNRLLSDSFETEVVFETSTLRSAMERSYLISNASQSGTVKLEIINGNVSAHVNSPEVGKVNEDIDVLDVSGSDLIISFNPTYLIDALKALKSESVRIRFISPVRPFTLTPADDSENFIQLITPVR 376
>gi|116626974|ref|YP_819593.1| DNA polymerase III subunit beta [Streptococcus thermophilus LMD-9] >gi|116100251|gb|ABJ65397.1| DNA polymerase III, beta subunit [Streptococcus thermophilus LMD-9] (378 aa)
Score = 292, Expect = 1.9e-24, Identities = 98/371 (26%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP-NFLQILVPIR 377
           ++  ++K   + AL        +  + P+     IEV  + I  T SNG IS  +SI A  E+A +L  + G IL++   F  ++S L +  +T E+++   + +K++  +  +   D EQYP I    +    L +   + K  I++  +A +  +E   I++G+ F  +S+ K L+ +ATD ++++  +   E +  +F +V+   SL EL     D   N+EIF   + I+F+       ++++EG+YP+ +R+++   E +V     TL  A+ER   IS++ +   VKL   +  +    +S ++G   E +           IS N  +L+  LK   ++++ + F    +P  L    D  NF+Q++ P+R
  S:     2 IQFAINKAYFLQALHTTRRAISSKNAIPILSTIKIEVTSDGIYLTGSNGQISIENSISASEENAGLLITQPGSILLEANFFINVVSSLPDVTLTFEEIEQYQVLLKSAKSEITLKGKDAEQYPRIQ-EVDSLTPLIMDTKMLKSIIAETSFAAST-QESRPILTGVHF-VLSNHKDLKAVATDSHRMSQRQLVLEHSADNFDVVIPSRSLKELSAVFSDGIENLEIFFSANQILFRSETISFYTRLLEGNYPDTNRLLSDSFETEVVFETSTLRSAMERSYLISNASQSGTVKLEIINGNVSAHVNSPEVGKVNEDIDVLDVSGSDLIISFNPTYLIDALKALKSESVRIRFISPVRPFTLTPADDSENFIQLITPVR 376
>gi|42521652|ref|NP_967032.1| DNA polymerase III, beta subunit [Bdellovibrio bacteriovorus HD100] >gi|39574182|emb|CAE77686.1| DNA polymerase III, beta subunit [Bdellovibrio bacteriovorus HD100] (368 aa)
Score = 292, Expect = 2.1e-24, Identities = 99/371 (26%), Positives = 191/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIK-FTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-------IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + K  L++ +    +I E   + P+ +  L+E + N +K F T   +  T  I  +   A     G++ +  K  F I  +L    ITL K +N+ +++K   + S I  +  E+YP I  +YN    + I   V K+ I K  Y+V+ ++ + + ++G+ F  ++ +   +++ATDG++++     S  +D +       I+    L E+   +   D  +EI +  S  + K S+TI+  ++IEG YPN  + I      KV IS+   + +L+R +++ +++K   V LN S+  +E+S ++ +LG++KE +       E   I  N  ++  +L + + D I  E +D   P L+R   D  +  +++P+R
  S:     1 MKLEIDKRDLLSLIGKTQNIVEKRNTMPILINVLLEADQNTLKVFATDLEVSLTDQIKVQVHQA-----GKVAVSAKSLFDIAKELSEGPITLIKKENNWLEIKQGKYTSKIVGISAEEYP-IFPTYNSQAFIKIHAQVLKEMIDKTIYSVSTDETRYH-LNGVFF-ELNPQTGFKMVATDGHRMSLVNKPS--EDIKVNATQGVIIPRKGLHEIKKILESIDGTVEIAVEGSQFVLKHSSTILMIRLIEGKYPNYQQFIPQKLPQKVMISRDAFLTSLKR-VSLLANQKSKAVLLNLSNGRMEISSNNPELGDAKEEIEVDYMGGE-IKIGFNAKYITDILTSMNQDKIDFELNDHLSPGLMRPHNDQTYTCVVMPMR 367
>gi|23097457|ref|NP_690923.1| DNA polymerase III subunit beta [Oceanobacillus iheyensis HTE831] >gi|22775680|dbj|BAC11958.1| DNA-directed DNA polymerase III beta chain [Oceanobacillus iheyensis HTE831] (378 aa)
Score = 292, Expect = 2.1e-24, Identities = 90/371 (24%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANI----LEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRI----VLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF-SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + + KLIN +             P+  G  IEV ++ +  T S+  IS    +   ED  +    +E+G I+++ K F  I+ KL    + +   D   +++ +   + N+N    E+YP +     + N   +   + K  I +  +AV+  + +  I++G+    +  + +L   ATD ++LA  +   +     I    V   SL EL   + D +  +EI +  + I+F+  +    S++++G+YP  SR+I    + K+ +  K L+  ++R   ++  E+ ++VK N   + ++E+S +S ++GN  E ++      E   IS ++ +++  LK  + D + +EF+ + +P ++R   D + LQ+++P+R
  S:     1 MRFTIQRDKLINGVSNVMKAISARTVIPILTGMKIEVKNHGVTLTGSDSDISIEYYIPIEEDGIVHVENIEEGTIILQAKYFPDIVRKLPESTVDIVVDDQLNVRITSGKAEFNLNGQSAEEYPQLPKVQTE-NSFELPIDLLKSMIKQTVFAVSTMETR-PILTGVNLKLV--DNSLSFTATDSHRLARREIPVSNAPIEISQIVVPGKSLNELNKILGDSEETVEISVTNNQILFRTKHLNFLSRLLDGNYPETSRLIPEQSKTKIQLKTKELLGTIDRASLLAKEERNNVVKFNAPGNSMIEISSNSPEVGNVVEEITADQMEGEDVKISFSSKYMIDALKAIEYDEVQIEFTGAMRPFIIRPVGDDSILQLILPVR 376
>gi|116493576|ref|YP_805310.1| DNA polymerase sliding clamp subunit [Lactobacillus casei ATCC 334] >gi|191636826|ref|YP_001985992.1| DNA-directed DNA polymerase III, beta subunit [Lactobacillus casei] >gi|116103726|gb|ABJ68868.1| DNA polymerase III, beta subunit [Lactobacillus casei ATCC 334] >gi|190711128|emb|CAQ65134.1| DNA-directed DNA polymerase III, beta subunit [Lactobacillus casei BL23] (379 aa)
Score = 289, Expect = 5.0e-24, Identities = 98/371 (26%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILE---KGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  ++++  +  L   +       + P+  G  I +ND+ +  T S+  IS  S +  +++ N L+    G I++  + F  I+ +L    +TLE  DN    + +   +  IN +D   YP +     D   LS+S  V ++ I++   AV+N +E   I++G+       +  L  +ATD ++LA        ++  D+ I++   SL EL   + D    IEI + E+ ++F    T   S+++EG+YP+ SR+I T    +       L+ +++R   +S     ++V+  LN + +   +  +S D+GN +E +S      E   IS N  ++   L+ F    I V+F+   +P  L+  E    F+Q++ P+R
  S:     1 MKFTITRSTFLKTLNDVSRAISTKTTIPILTGLKIVLNDSGLILTGSDADISIESRINATDENNDLQIGSTGEIVLPARFFSEIVKRLPESTMTLEVKDNFQTVITSGASEFTINGLDANNYPRLPEITAD-AALSVSADVLRQLINQTVIAVSN-QESRPILTGVHLTITGDQ--LVAVATDSHRLAQRSLTLPTASASDYDIIIPGKSLTELSRMLSDDVEKIEIRIAENQVLFVFGQTAFYSRLLEGNYPDTSRLIPTSSNTQAEFDAPALLASIQRASLLSHESSNNVVRLVLNIADQKATIYGNSPDVGNVEEVLSFNKLSGEDLEISFNPDYMKDALQGFGQTAIEVDFTAPLRPFTLVPTEDKERFIQLITPVR 377
>gi|15902046|ref|NP_357596.1| DNA polymerase III subunit beta [Streptococcus pneumoniae R6] >gi|116516939|ref|YP_815419.1| DNA polymerase III subunit beta [Streptococcus pneumoniae D39] >gi|30315898|sp|P59651|DPO3B_STRR6 DNA polymerase III subunit beta >gi|2109446|gb|AAC45337.1| beta subunit of DNA polymerase III [Streptococcus pneumoniae] >gi|15457530|gb|AAK98806.1| DNA biosynthesis; sliding clamp subunit, required for high processivity; DNA polymerase III beta-subunit [Streptococcus pneumoniae R6] >gi|116077515|gb|ABJ55235.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae D39] (378 aa)
Score = 288, Expect = 5.6e-24, Identities = 95/367 (25%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           ++K   + AL +      +  + P+     I+V +  +    SNG IS  + ++ K+EDA +L    G IL++   F  ++S L +  +  ++++ + I + +   +  +   D EQYP I    +    L +   + KK I++  +A +  +E   I++G+ F  +S  K L+ +ATD ++L+  K   E    DF +V+   SL E      D    +EIF   + I+F+  N    ++++EG+YP+  R+I T     +  +   L +++ER   +SS+ +   VKL     V+     S ++G   E +       E   IS N  +L+  LK  +++ +T+ F  + +P  L+  + D +F+Q++ P+R
  S:     6 INKNLFLQALNITKRAISSKNAIPILSTVKIDVTNEGVTLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQ-EISASTPLILETKLLKKIINETAFAAST-QESRPILTGVHF-VLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVR 376
>gi|89101118|ref|ZP_01173954.1| DNA polymerase III subunit beta [Bacillus sp. NRRL B-14911] >gi|89084173|gb|EAR63338.1| DNA polymerase III subunit beta [Bacillus sp. NRRL B-14911] (378 aa)
Score = 288, Expect = 6.3e-24, Identities = 86/371 (23%), Positives = 195/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLN-FSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ +++       +  + P+  G  I  ++  +  T S+  IS  S + K  D N    I   G I+++ K F  I+ KL  + + ++  ++    +++   + N+N +D E+YP++    ++     I   + K  + +  +AV+ ++ +  I++G+ +    +E  L  IATD ++LA  K +      + + +V+    +  L +I+D + + I+I + E+ ++FK  N +  S+++EG+YP+ +R+I    + ++ +  K  ++A++R   ++   + ++VK +     V+E+S ++ ++G   E V  +    E   IS +  +++  LK  +   I V F+ + +P ++R   D + LQ+++P+R
  S:     1 MKFQIQRDSLVQSVQDVMKAVTSRTTIPILTGIKIVASEEGVTLTGSDSDISIESFIPKESDGNEIVEISRTGSIVLQAKFFSEIVKKLPTDKVEIDVQNHLQTVIRSGKSEFNLNGLDAEEYPHLP-QLSEEKIFRIPTDLLKAMVRQTVFAVSTSETR-PILTGVNWKVEDAE--LTCIATDSHRLALRKAKVETEANESYNVVIPGKSLSELSKILDDNNDLIDIVITENQVLFKAENLLFFSRLLEGNYPDTTRLIPNESKTEIGMQTKEFLQAIDRASLLAREGRNNVVKFSTIEDGVVEISSNTPEIGKVVEEVQSQFIEGEDLKISFSAKYMMDALKALEGTEIKVSFTGAMRPFVIRPMNDESILQLILPVR 376
>gi|108761971|ref|YP_628517.1| DNA polymerase III, beta subunit [Myxococcus xanthus DK 1622] >gi|108465851|gb|ABF91036.1| DNA polymerase III, beta subunit [Myxococcus xanthus DK 1622] (368 aa)
Score = 287, Expect = 7.4e-24, Identities = 97/371 (26%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIV------FKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFL--FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  ++  +L  AL     I E   + P+    L+  N   I  T  +   G++S H        A +++ G + +  K  F I+  L +  +TL+K+ N+ + + + +    I  M  E+YP +    N       +P+V        + I K ++A+++++ +  I++G+ F   S+ K + ++ATDG++LA  + E  P DF+     I+    L+E L  ++D   + E  L   E++ +FK     +  ++I+G +P   R+I    E  V + K  L+E+L+R +A+ S++K + V++      L ++ S+ DLG +K+ +    + N  T I  N  +L+ +L   + D ++ E  D   P +L    D +F  +++P+R
  S:     1 MEFRIAADELKKALYRAQGIVERKTTMPILANVLVTANKGGITVTAFDLDIGVVSEHP-------AEVIKTGAVTLSAKYVFDIVQNLPDAQVTLKKLANNYVDISSGSAHFKIVGMAAEEYPKLPKEEN-------APLVQVGGNTLLEMIKKTQFAISSDETRY-ILNGVFFEPQSTGK-VRMVATDGHRLALVERE-LPGDFKLKSGVIIPRKGLME-LKRLLDEAPDAECHLGFAENSALFKKPGLTMVMRLIDGQFPEYQRVIPKEGEKIVLVPKVRLLESLKR-IALLSADKSNAVRIGLEENQLIITASNPDLGEAKDVLELAYRGNGIT-IGFNARYLMDVLAVTETDEVSFELGDEHSPGVLHAPGDRSFTAVVMPMR 367
>gi|15899951|ref|NP_344555.1| DNA polymerase III subunit beta [Streptococcus pneumoniae TIGR4] >gi|148988887|ref|ZP_01820302.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP6-BS73] >gi|148993606|ref|ZP_01823077.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|148997956|ref|ZP_01825469.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP11-BS70] >gi|149003111|ref|ZP_01828020.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP14-BS69] >gi|149007715|ref|ZP_01831324.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|149020160|ref|ZP_01835134.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP23-BS72] >gi|168487222|ref|ZP_02711730.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|168489314|ref|ZP_02713513.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae SP195] >gi|168493998|ref|ZP_02718141.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|168576112|ref|ZP_02722017.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae MLV-016] >gi|169834446|ref|YP_001693436.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|194397554|ref|YP_002036723.1| DNA polymerase III beta subunit [Streptococcus pneumoniae G54] >gi|18266730|sp|O06672|DPO3B_STRPN DNA polymerase III subunit beta >gi|14971466|gb|AAK74195.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae TIGR4] >gi|147755966|gb|EDK63009.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP11-BS70] >gi|147758852|gb|EDK65848.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP14-BS69] >gi|147760710|gb|EDK67682.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|147925698|gb|EDK76774.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP6-BS73] >gi|147927827|gb|EDK78849.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|147930838|gb|EDK81819.1| DNA polymerase III subunit beta [Streptococcus pneumoniae SP23-BS72] >gi|168996948|gb|ACA37560.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|183569923|gb|EDT90451.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|183572312|gb|EDT92840.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae SP195] >gi|183575839|gb|EDT96367.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|183578124|gb|EDT98652.1| DNA polymerase III, beta subunit [Streptococcus pneumoniae MLV-016] >gi|194357221|gb|ACF55669.1| DNA polymerase III beta subunit [Streptococcus pneumoniae G54] (378 aa)
Score = 287, Expect = 7.8e-24, Identities = 96/367 (26%), Positives = 182/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           ++K   + AL        +  + P+     I+V +  I    SNG IS  + ++ K+EDA +L    G IL++   F  ++S L +  +  ++++ + I + +   +  +   D EQYP I    +    L +   + KK I++  +A +  +E   I++G+ F  +S  K L+ +ATD ++L+  K   E    DF +V+   SL E      D    +EIF   + I+F+  N    ++++EG+YP+  R+I T     +  +   L +++ER   +SS+ +   VKL     V+     S ++G   E +       E   IS N  +L+  LK  +++ +T+ F  + +P  L+  + D +F+Q++ P+R
  S:     6 INKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQ-EISASTPLILETKLLKKIINETAFAAST-QESRPILTGVHF-VLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVR 376
>gi|66880408|ref|ZP_00405389.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Mycoplasma genitalium G-37] >gi|108885075|ref|NP_072661.2| DNA polymerase III, beta subunit [Mycoplasma genitalium G37] >gi|84626162|gb|AAC71217.2| DNA polymerase III, beta subunit [Mycoplasma genitalium G37] >gi|166078983|gb|ABY79601.1| DNA polymerase III, beta subunit [synthetic Mycoplasma genitalium JCVI-1.0] (380 aa)
Score = 285, Expect = 1.2e-23, Identities = 103/371 (27%), Positives = 200/371 (53%)
  Q:     7 MKIIVSKTKLINALR-LCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFS----YNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFL--------FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI+++K++L   L+ + N I  N    P     LIE  + EI F  +N   S    + K+ D  ILE+G +++K K F  +I+ +K E+IT+++ D +++ VKT     N+N ++  ++P I F+     +++NQ  I+  +  K I K+ ++V+NN+E  +  +G+ FN  S+ K + + A+D YKL+ ++ +   + F  +L+ +L+  +      +    +F         F + ++  + N +I+   +   +P V+       E K+ + K  L +AL+R   ++ +E+  +  +  +S  L++    +++GNS E +SC         IS N   LL  +++F+++ I  +F  + K  L+  + +P   QILVP R
  S:     1 MKILINKSELNKILKKMNNVIISNNKIKPHHSYFLIEAKEKEINFYANNEYFSVKCNLNKNID--ILEQGSLIVKGKIFNDLINGIKEEIITIQEKDQTLL-VKTKKTSINLNTINVNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFNGVNFNG-SNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFLITSKSEPELKQILVPSR 380
>gi|90960992|ref|YP_534908.1| DNA polymerase III, beta chain [Lactobacillus salivarius UCC118] >gi|90820186|gb|ABD98825.1| DNA polymerase III, beta chain [Lactobacillus salivarius UCC118] (379 aa)
Score = 283, Expect = 2.0e-23, Identities = 98/371 (26%), Positives = 196/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED---ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL--NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  + +   I  L        +  +  +  G  ++++ + +  T SN  IS  +I++ ++D     I ++G +++  + F  I+ KL  + +T+E  +     + + + +  IN ++ E+YP++    +  +QL++   + K+ IS+   AV+N +E   I++GI  + +     L  +ATD ++L+    + +  D   V DV     SL EL   I D D NIEI + E+  +F + NT   ++++EG YP+  R+I    E  V+ +   L++++ER   +S   + ++VKL  N S++ + +S ++ ++GN +E +  K        IS N  ++   L++F    IT+ F+   +P  ++  E   NF+Q++ P+R
  S:     1 MKFSIQRASFIKYLNDVQRAISSKTTIDILTGLKMDLSKDALTLTGSNSDISIETIISIADDNAALQIEQEGAVVLPARFFSEIVKKLPEQTMTIEINERFQATITSGSAEFTINGLNAEEYPHLP-EIDSKDQLTVPGDILKQVISQTVIAVSN-QESRPILTGI--HLVIKNGELLAVATDSHRLSQRIIKLSGAD-DAVYDVIIPGKSLSELSKMISDSDENIEIQISENQALFILGNTSFYTRLLEGKYPDTERLIPKVSEITVDFNAVELLQSIERASLLSHEGRNNVVKLAINPSAQSVILSGNTPEVGNVEEELHFKNLEGSELEISFNPDYMKDALRSFGQSEITIAFTQPLRPFTIVPTEDKDNFVQLITPVR 377
>gi|148262087|ref|YP_001228793.1| DNA polymerase III, beta subunit [Geobacter uraniireducens Rf4] >gi|146395587|gb|ABQ24220.1| DNA polymerase III, beta subunit [Geobacter uraniireducens Rf4] (372 aa)
Score = 281, Expect = 3.3e-23, Identities = 88/371 (23%), Positives = 197/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDT-NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  V+K     AL+    I E   + P+   TLIE +++ +  T ++  +   S    S   N++++G+I +  K  + II +L +E I     +N  +++       NI  +  +++P      ND + ++++  +  + I K  YA+ N++ K N ++GI   + +  +   L ++ATDG++L+  + E     S   +  ++     I  L ++ + +  +I +   +++ + K  NT+I  ++I+G++P+ +++I T  +  + I +++L+ +L R +AI SSEK   +KL+  +  +E+S S+ +LG+++E +    +  EP  +  N  +L+ +L     D + +   D   P++++     +F+ +++P+R
  S:     1 MEFRVAKDTFTKALQKIQGIVEKRNTMPILSNTLIEAHNDTLYITATDLEVGMKS----SYPVNVIKEGKITVSAKKIYEIIKELSDEEIVFSTKENDWVEIHCGKAHFNIVGLSPDEFPYFP-KINDNSFITLNNQILSEMIEKTSYAICNDETKFN-LNGIFIKATTENERNVLRMVATDGHRLSVTEKELSGNISNELNKGVIFPKKGIFELKKMTEEEIGDIMLGFMDNSAVIKKGNTVIVMRLIDGEFPDYTKVIPTNNDKIIKILRESLLHSLRR-MAILSSEKFKGIKLDVRNGSVEISSSNPELGDAREELEVDYQ-GEPLSVRFNARYLIDVLTILKEDEVELNLRDELSPIIMKPAAKNDFMSVIMPMR 371
>gi|91762458|ref|ZP_01264423.1| DNA polymerase III [Candidatus Pelagibacter ubique HTCC1002] >gi|91718260|gb|EAS84910.1| DNA polymerase III [Candidatus Pelagibacter ubique HTCC1002] (370 aa)
Score = 281, Expect = 3.7e-23, Identities = 100/371 (26%), Positives = 204/371 (54%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT--LEIIATDGYKLAHYKFESTPQ-DFR-IVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V++  L  AL  C  + E   + P+    L+  +++ +  T ++  +I  H I     +  ++E+G     +   + II K  + + I L   D S ++V++     N+N +   ++P  + ++N  N+ SI      K ++K K++V+N++ + + +SGI F+   +E    L   ATD ++++  K     Q DF  I+L    I  L  +++ +D +++I   +S I F+++N+I+ SK+I+G +PN  ++I    + K+ I  K  +++++R +A  S +KK  VK N S +VL +S ++++ G+ KE+++   K +    IS N+ +L+ +    D D I + F+D+  P L++D  D + + +++P++
  S:     1 MKFNVNQQDLQQALNYCQGVIEKRSTLPILSNVLLNASNSNLTITATDLDLIFIHQI----NNVEVVEEGNTTTTSSIMYDIIRKFSSGKKINLSLTDVSKLQVESEKSVFNLNCISASEFPLTDENFNQ-NEFSIKSKQLLKLLNKCKFSVSNDETR-HYLSGIFFHQTQTEDKNFLTAAATDSHRMSISKIRLDQQVDFEPIILPKKTIFQLCSLLESYDGDVKISNIKSKIKFELNNSILISKLIDGKFPNYIQVIPKNNQKKLEIDLKLFLDSVDR-VASVSLDKKDGVKFNLSKDVLNLSVNNTNSGDGKESLTV--KFDHDLEISFNSRYLIDVAAQLDGDKIEIFFNDTGSPALIKDPGDFDSIFVVMPMK 369
>gi|78101467|pdb|2AWA|A Chain A, Crystal Structure Of Dna Polymerase Iii, Beta Chain (Ec 2.7.7.7) (Np_344555.1) From Streptococcus Pneumoniae Tigr4 At 2.50 A Resolution >gi|78101468|pdb|2AWA|B Chain B, Crystal Structure Of Dna Polymerase Iii, Beta Chain (Ec 2.7.7.7) (Np_344555.1) From Streptococcus Pneumoniae Tigr4 At 2.50 A Resolution >gi|78101469|pdb|2AWA|C Chain C, Crystal Structure Of Dna Polymerase Iii, Beta Chain (Ec 2.7.7.7) (Np_344555.1) From Streptococcus Pneumoniae Tigr4 At 2.50 A Resolution >gi|78101470|pdb|2AWA|D Chain D, Crystal Structure Of Dna Polymerase Iii, Beta Chain (Ec 2.7.7.7) (Np_344555.1) From Streptococcus Pneumoniae Tigr4 At 2.50 A Resolution (390 aa)
Score = 281, Expect = 4.0e-23, Identities = 96/367 (26%), Positives = 180/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           ++K   + AL        +  + P+     I+V +  I    SNG IS  + ++ K+EDA +L    G IL++   F  ++S L +  +  ++++ + I + +   +  +   D EQYP I    +    L +   + KK I++  +A +  +E   I++G+ F  +S  K L+ +ATD ++L+  K   E    DF +V+   SL E      D    +EIF   + I+F+  N    ++++EG+YP+  R+I T     +  +   L ++ ER   +SS+ +   VKL     V+     S ++G   E +       E   IS N  +L+  LK  +++ +T+ F  + +P  L+  + D +F Q++ P+R
  S:    18 INKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQ-EISASTPLILETKLLKKIINETAFAAST-QESRPILTGVHF-VLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSXERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFXQLITPVR 388
>gi|111658628|ref|ZP_01409278.1| hypothetical protein SpneT_02000218 [Streptococcus pneumoniae TIGR4] (341 aa)
Score = 278, Expect = 7.8e-23, Identities = 90/330 (27%), Positives = 168/330 (50%)
  Q:    48 IKFTTSNGIISTHSIVA-KSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           I    SNG IS  + ++ K+EDA +L    G IL++   F  ++S L +  +  ++++ + I + +   +  +   D EQYP I    +    L +   + KK I++  +A +  +E   I++G+ F  +S  K L+ +ATD ++L+  K   E    DF +V+   SL E      D    +EIF   + I+F+  N    ++++EG+YP+  R+I T     +  +   L +++ER   +SS+ +   VKL     V+     S ++G   E +       E   IS N  +L+  LK  +++ +T+ F  + +P  L+  + D +F+Q++ P+R
  S:     6 ITLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQ-EISASTPLILETKLLKKIINETAFAAST-QESRPILTGVHF-VLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVR 339
>gi|58336356|ref|YP_192941.1| DNA polymerase III, beta chain [Lactobacillus acidophilus NCFM] >gi|58253673|gb|AAV41910.1| DNA polymerase III, beta chain [Lactobacillus acidophilus NCFM] (376 aa)
Score = 277, Expect = 1.0e-22, Identities = 92/371 (24%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           MK  +++   I  L        +  + P+  G  +E+ + E+  T S+  IS    +  +ED N+   G I++  + F  II KL  +  + E  ++   ++ +   +  IN +D   YP +    +D    +IS   F++ I++ ++A +N++ +  I++G+ F       +++ +ATD ++L+      E+ PQ     I+   SL EL   I + D  +++   +S  +F + N    S++++G+YP+  R+I T K   +      L  ALER   ++ + + ++V L   +E    ++S  S+++GN +E VS +        IS N  ++   L+    D++ + F+   +P ++  D+KD  F+Q++ P+R
  S:     1 MKFTINRNLFIENLNNVMRAISSRTTIPILSGIKLELTNEELILTGSDTDISIEIKIPVNEDLNVESTGSIVLPARFFSEIIKKLPGKDFSFEVKESFQTQIISENSEFTINGLDANNYPRLP-EISDSASFTISGKTFREIINETQFATSNDQTRA-ILTGVRF--FFKPDSIKAVATDSHRLSQRIIALENGPQSETDLIIPGKSLQELARIIGETDPEVKVCPGDSQALFVIGNLAFYSRLLDGNYPDTDRLIPTEKTTSIEFDIPELSSALERASLLTHAGRNNVVTLTLDTEKQTAKLSGKSAEIGNVEEDVSFRNLEGNNLEISFNPDYMRDALRASVTDSVIMSFTKPLRPFIINPDKKDIEFVQLITPVR 374
>gi|150014894|ref|YP_001307148.1| DNA polymerase III subunit beta [Clostridium beijerinckii NCIMB 8052] >gi|149901359|gb|ABR32192.1| DNA polymerase III, beta subunit [Clostridium beijerinckii NCIMB 8052] (366 aa)
Score = 276, Expect = 1.4e-22, Identities = 91/371 (24%), Positives = 191/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M     K K++  + +         + P+  G  I  N++ I    S+  +S  ++V    DA I+E+G I+I  K F  II KL N  I +E ++N +IK+       ++  M+  ++P +    N+  ++S++  + K  I    +A+  ++ +  I+ GI F      K L ++A DGY+LA   +F  T  D  +V+    +  + +I+ D D  ++I    ++I+F +  T I S+++EG + N   ++    +  VN++++ L  A+ER   ++     +++KL+   + L ++ S+S LG  ++ +S K + +E   I+ N+ +LL +LK  +++ + ++ +    P ++ +  + N   +++P+R
  S:     1 MIFTCEKQKILEGISIVQKAITGKSTMPILEGIYINANNSTITLIGSDMDVSIQTLV----DATIMEEGSIVIDAKIFGEIIRKLPNSTIRIETMENQLIKITCEKSIFDVVYMNTNEFPELP-EINENLKISVNQNILKNMIKGTSFAIAQDETR-PILQGILFEV--RNKNLNLVALDGYRLAIKSEFLDTDIDIEVVIPGKTLNEVSKILEDIDEIVDITFTNNHILFNLKRTKIISRLLEGKFINYKSLLPQEHKLFVNVNRQELQNAIERASLMAKDGNTNLIKLDLHQDNLVIT-SNSQLGKVRDEISIKLQGDE-IEIAFNSKYLLDVLKNMEDNEVVMKMTSGISPCVIEEHNNENAKYLVLPVR 363
>gi|115378321|ref|ZP_01465487.1| DNA polymerase III, beta subunit [Stigmatella aurantiaca DW4/3-1] >gi|115364675|gb|EAU63744.1| DNA polymerase III, beta subunit [Stigmatella aurantiaca DW4/3-1] (444 aa)
Score = 276, Expect = 1.5e-22, Identities = 90/371 (24%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFL--FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  ++  +L  AL     I E   + P+    L+    + +  T  +   G++S H        A + + G + +  K  F I+  L +  +TL+K+ N+ + + + +    I  M  E+YP +    N    + +S     + I K ++A+++++ +  I++G+ F   S  K + ++ATDG++LA  + E    DF+     I+    L+EL   ++D   + E  L   E++ +FK     +  ++I+G +P   R+I    E  V +SK   +E L+R +A+ S++K   V++      L ++ ++ DLG +++ +    +  + T I  N  +L+ +L   + D ++ E  D   P +L    D +F  +++P+R
  S:    77 MEFRIAADELKKALYRAQGIVERKTTMPILANVLVNATKSGVTVTAFDLDIGVVSEHP-------AEVSKPGAVTLNAKYIFDIVQNLPDAQVTLKKLANNYVDIASGSAHFKIVGMAAEEYPKLPKEENA-PLVQVSGNTLLEMIKKTQFAISSDETRY-ILNGVYFEPQSGGK-VRMVATDGHRLALIERELN-GDFKLKGGVIIPRKGLMELK-RLLDEAPDAECHLGFAENSALFKKPGLTMVMRLIDGQFPEYQRVIPKEGEKVVLVSKVRFLEGLKR-IALLSADKSYAVRIGLEQNKLLITSNNPDLGEARDALEIAYRGGDIT-IGFNARYLIDVLTVTETDEVSFELGDEHSPGVLHAPGDRSFTAVVMPMR 443
>gi|95929987|ref|ZP_01312727.1| DNA polymerase III, beta subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133956|gb|EAT15615.1| DNA polymerase III, beta subunit [Desulfuromonas acetoxidans DSM 684] (372 aa)
Score = 276, Expect = 1.6e-22, Identities = 97/371 (26%), Positives = 188/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSI---VAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNS--ISSEKTLEIIATDGYKLAHYKFESTP----QDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI   K  L+  L L   + E   + P+    L+E +       TS  I++   +   +     A I+  G+I I  K  + I+ +L +  ITL+  +N+ +++       NI  +  E++P I     D N LSI  I  K  I K  YA++N++ K N ++GI  +S  I ++  ++ ++TDG++L+  + ES      Q   I     L EL   I   + +I+I + ++N +  +  T +  ++I+GD+P+  R+I    +N   I+ + L+  L R +++ ++EK   + + F    + V+ S+ + G++ ET+    + N    I  N+ +L+ ++    + +I +   D+  P L+  E   N+L +++P+R
  S:     1 MKITTKKNDLLKGLTLVQGVVEKKKTLPILSNVLLETDKE-----TSQLILTATDLEIGIKTHIKAEIISDGKITISAKKLYEIVKELADAEITLKVKENNWVEIINGKAKFNIVGLSSEEFPLITDKQTD-NNLSIDGITLKNIIDKTFYAISNDESKFN-LNGIYLHSESIDNKNYIKFVSTDGHRLSLMQIESDTKILDQKGVIFPKKGLAELRKIIDQENQDIKISILDNNAVINIKETTLVMRLIDGDFPDYKRVIPEMSDNYCQINGEILLHTLRR-ISLLANEKSKGINIEFLQNEINVTSSNPEYGDASETIKTIYEGNN-VKIGFNSKYLIDVISNVVDKDIRIYIKDNMSPCLILPEDTNNYLAVIMPMR 371
>gi|6226601|sp|P47247|DPO3B_MYCGE DNA polymerase III subunit beta (364 aa)
Score = 275, Expect = 1.9e-22, Identities = 93/338 (27%), Positives = 183/338 (54%)
  Q:    40 LIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFS----YNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFL--------FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           LIE  + EI F  +N   S    + K+ D  ILE+G +++K K F  +I+ +K E+IT+++ D +++ VKT     N+N ++  ++P I F+     +++NQ  I+  +  K I K+ ++V+NN+E  +  +G+ FN  S+ K + + A+D YKL+ ++ +   + F  +L+ +L+  +      +    +F         F + ++  + N +I+   +   +P V+       E K+ + K  L +AL+R   ++ +E+  +  +  +S  L++    +++GNS E +SC         IS N   LL  +++F+++ I  +F  + K  L+  + +P   QILVP R
  S:    19 LIEAKEKEINFYANNEYFSVKCNLNKNID--ILEQGSLIVKGKIFNDLINGIKEEIITIQEKDQTLL-VKTKKTSINLNTINVNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFNGVNFNG-SNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFLITSKSEPELKQILVPSR 364
>gi|83588877|ref|YP_428886.1| DNA polymerase III, beta subunit [Moorella thermoacetica ATCC 39073] >gi|83571791|gb|ABC18343.1| DNA polymerase III, beta subunit [Moorella thermoacetica ATCC 39073] (374 aa)
Score = 273, Expect = 3.3e-22, Identities = 81/371 (21%), Positives = 189/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-----NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-------IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKS---IVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M I+  + +L+NA++          +     G L++ ++N +    ++   GII T  +        ++E+G +L+  + F  ++ +L    ++L+ + ++ +++        +N +D  Q+P +     NFS+      +++    K +I KV  A  N+  + +I +G+ +     E    ++ATD ++LA Y     P+D         +V   ++ EL   +   D  ++I + ES I  +     + ++++ G +P+  ++I T     + I+ + L++ +ER   ++  E K+   I+ L    + L+++  ++++G+ +E ++ +    +P  ++LN  +LL  L+  D +N+ +E     KPV++R     N+  +++P+R
  S:     1 MHILCPQPQLVNAVQKVYRAVATTTTYHAITGILLQAHENTLTLQGTDLDLGIIYTFPV-------EVIEEGELLLPARIFTEMVRRLPPTSLSLQSLQDNTVEIAYQQSKVQLNSIDASQFPLLPPVEGNFSF------TVAITALKDAIRKVTIAAGNDDLR-SIFNGVLWELEPGENRFNLVATDTHRLAVY--HGQPEDSTSNETATALVPCRAMNELARLLPGEDGLVKITIGESQIYAQHEGLTLYTRLLNGKFPHYQQVIPTDHITTIEIATRDLLDTVERATLLARDENKARAHIIILQVGEKSLKITSEAAEIGHLEEELTAE-IAGQPLELALNGRYLLETLRVIDTENVILELLAPLKPVVVRPAGQENYFCLILPVR 372
>gi|86156432|ref|YP_463217.1| DNA polymerase III, beta subunit [Anaeromyxobacter dehalogenans 2CP-C] >gi|85772943|gb|ABC79780.1| DNA polymerase III, beta subunit [Anaeromyxobacter dehalogenans 2CP-C] (375 aa)
Score = 272, Expect = 4.1e-22, Identities = 87/371 (23%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDA-NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV--------SLIELLLEIIDF---DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR--DEKDPNFLQILVPIR 377
           M++ +   +L  AL     I E   + P+    L+E    +    ++  +     +   SE A  +L++G + +  +  + I+  L  + +TL+K  N+ ++VK+   +  I  +  E +P +   ++      + P +  + I +  +AV+N++ + N ++G+ F    +   L ++ATDG++L+  +  +    F +   V         L +LL E  +        ++   E++ IF+  N ++  ++IEG +P+  ++I    E    + +   +E L R +++ SS+K   VKL+ S ++L V   + DLG +KE V  +    EP  I  N  +++ +L+   ++ +  E +D   P +L+  +E D  F  +++P+R
  S:     1 MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVVSATDL----DLAVSSEHACEVLKEGAVAVSARHLYEIVRALPEQTVTLKKAHNNYLEVKSGPSEFRIVGLPAEDFPALP-RFDKVPFADVDPALLLEMIERTFFAVSNDETRYN-LNGVYFEP--AGDALRLVATDGHRLSLSE-RTVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEKPEAKLGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRARFLETLRR-ISLLSSDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVE-YAGEPLKIGFNARYIMEVLQAVKSNEVVFELADDLSPGVLKGGEEADQGFTAVVMPMR 374
>gi|22536187|ref|NP_687038.1| DNA polymerase III subunit beta [Streptococcus agalactiae 2603V/R] >gi|25010077|ref|NP_734472.1| DNA polymerase III subunit beta [Streptococcus agalactiae NEM316] >gi|76787013|ref|YP_328729.1| DNA polymerase III subunit beta [Streptococcus agalactiae A909] >gi|76797975|ref|ZP_00780234.1| DNA polymerase III, beta subunit [Streptococcus agalactiae 18RS21] >gi|77405619|ref|ZP_00782708.1| DNA polymerase III, beta subunit [Streptococcus agalactiae H36B] >gi|77407693|ref|ZP_00784448.1| DNA polymerase III, beta subunit [Streptococcus agalactiae COH1] >gi|77411784|ref|ZP_00788120.1| DNA polymerase III, beta subunit [Streptococcus agalactiae CJB111] >gi|77413651|ref|ZP_00789836.1| DNA polymerase III, beta subunit [Streptococcus agalactiae 515] >gi|22533004|gb|AAM98910.1|AE014191_2 DNA polymerase III, beta subunit [Streptococcus agalactiae 2603V/R] >gi|23094428|emb|CAD45647.1| beta subunit of DNA polymerase III [Streptococcus agalactiae NEM316] >gi|76562070|gb|ABA44654.1| DNA polymerase III, beta subunit [Streptococcus agalactiae A909] >gi|76586655|gb|EAO63154.1| DNA polymerase III, beta subunit [Streptococcus agalactiae 18RS21] >gi|77160306|gb|EAO71432.1| DNA polymerase III, beta subunit [Streptococcus agalactiae 515] >gi|77162175|gb|EAO73150.1| DNA polymerase III, beta subunit [Streptococcus agalactiae CJB111] >gi|77173692|gb|EAO76806.1| DNA polymerase III, beta subunit [Streptococcus agalactiae COH1] >gi|77175763|gb|EAO78543.1| DNA polymerase III, beta subunit [Streptococcus agalactiae H36B] (378 aa)
Score = 271, Expect = 5.0e-22, Identities = 96/367 (26%), Positives = 187/367 (50%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKE---TVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP-NFLQILVPIR 377
           ++K   ++AL +      +  + P+     IEV  + I  T SNG IS  ++I A +E+A +L    G IL++   F  IIS L +  +   +++   I + +   +  +   D +QYP +     D   L++   + K  I++  +A +  +E   I++G+    IS  K  + +ATD ++++   ++ E +  +F +V+   SL E      D    +E+F  +S ++F+  N    ++++EG+YP+  R++    E ++  +   L  A+ER   IS++ +   V+L   +E +    +S ++G   E   TVS KG   +   IS N  +L+  LK   ++ +T+ F    +P  L   +D  +F+Q++ P+R
  S:     6 INKNFFLHALTVTKRAISHKNAIPILSTVKIEVTRDAIILTGSNGQISIENTIPASNENAGLLVTNPGSILLEAGFFINIISSLPDVTLEFTEIEQHQIVLTSGKSEITLKGKDVDQYPRLQEMTTD-TPLTLETKLLKSIINETAFAASQ-QESRPILTGVHL-VISQNKYFKAVATDSHRMSQRTFQLEKSANNFDLVVPSKSLREFSAVFTDDIETVEVFFSDSQMLFRSENISFYTRLLEGNYPDTDRLLTNQFETEIIFNTNALRHAMERAYLISNATQNGTVRLEIQNETVSAHVNSPEVGKVNEELDTVSLKG---DSLNISFNPTYLIESLKAVKSETVTIRFISPVRPFTLTPGEDTEDFIQLITPVR 376
>gi|24378534|ref|NP_720489.1| DNA polymerase III subunit beta [Streptococcus mutans UA159] >gi|24376382|gb|AAN57795.1|AE014853_2 putative DNA polymerase III, beta subunit [Streptococcus mutans UA159] (378 aa)
Score = 269, Expect = 8.2e-22, Identities = 94/371 (25%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +K  ++K   + AL        +  + P+     IEVN   I  T SNG IS  ++I A+ E+A +L    G IL++   F  I+S L +  +  E+++   + + +   +  +   D EQYP +       N L +   + K  IS+  +A +  +E   I++G+    +++ K  + +ATD ++++  K   + +  DF +V+   SL E      D   ++E+F   S I+F+       ++++EG+YP+  R++    E +V  +   L  A+ER   IS++ +   VKL   +  +    +S ++G   E +  +        IS N  +L+  LK   ++ +T+ F    +P  L   +   NF+Q++ P+R
  S:     2 IKFSINKVFFLQALNATKRAISSKNAIPILSSLKIEVNSQSITLTGSNGQISIENTISAEEENAGLLVTSSGAILLEANFFINIVSSLPDITLDFEEIEQHQVVLNSGKSEITLKGKDVEQYPRLQ-EVGTNNPLILETKLLKTIISETAFAAST-QESRPILTGVHL-VLTNHKEFKAVATDSHRMSQRKLTLDHSSDDFDVVIPSRSLREFAAVFTDDIESVEVFFSNSQILFRSEYISFYTRLLEGNYPDTDRLLGNNFETEVVFNTNALRYAMERAHLISNATQNGTVKLEIINNQVTAHVNSPEVGKVNEELDIESLSGNDLTISFNPTYLIEALKALKSETVTIRFISPIRPFTLTPSDNSENFIQLITPVR 376
>gi|118578451|ref|YP_899701.1| DNA polymerase III, beta subunit [Pelobacter propionicus DSM 2379] >gi|118501161|gb|ABK97643.1| DNA polymerase III, beta subunit [Pelobacter propionicus DSM 2379] (373 aa)
Score = 267, Expect = 1.4e-21, Identities = 90/371 (24%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKL--AHYKFESTP-QDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESN-IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K   + +L+    I E   S P+    L+E  ++ ++ T ++  +    I      A IL  GRI +  K  + I+ +L N+ I+    DN  ++++      NI  +  E++P     + + N   I   + K  I K  YA+ N+  K N+        I+ +  + L+++ATDG++L  A   F+    Q+    ++L    +  L +I + D    +F F  N  + K  ++ +  ++++G++P+ +R+I T  +  + I+      ++ R +AI SSEK   + L+ S   + +S S+ +LG++ E +       EP  +  N  +LL +L   + +++ ++F D   P ++  +K  +FL +++P+R
  S:     1 MEFRIDKEVFLKSLQKIQGIVEKRTSMPILSNVLLEATESSLRVTATDLEVGMKCIYP----AEILSPGRITVGAKKIYEIVKELPNQQISFSAKDNDWVEIRCGKVHFNIVGLSAEEFPYFPEVHEE-NLFEIESALLKGMIEKTSYAICNDDTKYNLNGLFAKTEINDDDVQLLKMVATDGHRLSIASCPFKGNAGQELSKGVILPKKGVYELKKIAEEDGGTLMFGFMDNSAVIKRGDSYMVMRLVDGEFPDYNRVIPTSNDRSIIINCDDFTHSVRR-MAILSSEKFKGIMLDISESSIRISSSNPELGDAMEEIDVSYG-GEPFSVRFNARYLLDVLAVTETESVEMKFKDELAPSIILPDKSDSFLAVIMPMR 372
>gi|56961784|ref|YP_173506.1| DNA polymerase III subunit beta [Bacillus clausii KSM-K16] >gi|56908018|dbj|BAD62545.1| DNA-directed DNA polymerase III beta subunit DnaN [Bacillus clausii KSM-K16] (380 aa)
Score = 267, Expect = 1.6e-21, Identities = 90/371 (24%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED----ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD----FR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M +I+ + ++++ ++       +  + P+  G  +  + N +  T S+  +S  S + K E+      I + G I++++K F  I+ KL  E I ++  D     +++ +    +N +D E+YP +     D    S+   + +  I +  +AV+  +E   +++G+   + + E  L   ATD ++LA  K +   QD    F+  ++   SL EL   + D     EI + E+ I+FK+ N +  S+++EG YP  S +I T  +    +  K LV  LER + +S   K +++ +       +E++ +S ++G   E ++      +   IS N   +L  LK  D+D + +  + +  P ++R     ++L +  P+R
  S:     1 MHVIIERNRMVHDVQHVAKAVSSRTTIPILTGIKLVADANGLTLTGSDSDLSIESFIPKEENEREIVQIEQAGSIVLQSKYFAEIVKKLPGETIEIQVHDQFAATIRSGSSVFTLNGLDPEEYPRLPQLKEDL-IFSLPQDMLRNIIRQTVFAVST-QETRPVLTGVNIETENGE--LICTATDSHRLAMRKTKIDSQDEGLEFKNVVIPGKSLQELSKILEDTSDLAEIVVTENQILFKLGNLLFFSRLLEGKYPVTSGMIPTQFKTSFVVKTKELVHTLERAMLLSREAKNNVINVKTLGDNQIEITSTSQEIGKVTEKMATDQFEGDEIRISFNGKNILDALKVVDSDEVQIFLTGAMSPFVIRPIDSDHYLHLFSPVR 378
>gi|116513230|ref|YP_812136.1| DNA polymerase sliding clamp subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092545|gb|ABJ57698.1| DNA polymerase III, beta subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (375 aa)
Score = 267, Expect = 1.7e-21, Identities = 91/371 (24%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSS---PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  V +   IN L   NS+ + + S    P+  G  +E+ + E+  T SN  IS       S+D  +   G I++    F  I+ KL     T E  + + I++ +   D  IN +D   YP +          S+     ++ I++  +AV+  +E    ++G+ F+  + +  ++ +ATD ++L+    +      +D  +++    ++ L +II D D +I+++L +S I F+  N    ++++EG YP+V R++ T     V  +   L++ L R   ++ + + + V+  LN + + + VS +S ++G  +E V           IS N  ++ + L+    D++ + F++S +P  ++ +++   F+Q++ PIR
  S:     1 MKFTVQRNLFINDL---NSVLKAVSSRAQIPILSGIKLELTEAELIMTGSNADISIELSQPVSDDLRVESTGSIVVTAHLFSEIVRKLPGREFTFEVKEGNQIQITSDKADYVINGLDASAYPRLPEIAG--TSFSLPSKTLRELITQTVFAVST-EESRPTLTGVNFSFKNGQ--IKAVATDSHRLSQRIVDIAAGPSEDLSLIIPGKNLQELAQIIGDADQDIKVYLGDSQIRFEFENLSFYTRLLEGVYPDVDRLLPTESTTSVQFTVSDLMQTLSRASLLTHANRTNAVQMTLNVADQTVLVSGNSPEVGKIEEEVGFSSLTGRDLTISFNPDYMAAALRASVTDSVIINFTESLRPFTVVPNDQSVEFVQLITPIR 373
>gi|56418537|ref|YP_145855.1| DNA polymerase III subunit beta [Geobacillus kaustophilus HTA426] >gi|56378379|dbj|BAD74287.1| DNA-directed DNA polymerase III beta subunit [Geobacillus kaustophilus HTA426] (378 aa)
Score = 265, Expect = 2.5e-21, Identities = 79/344 (22%), Positives = 179/344 (52%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANIL----EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD---FRIVLDVSLIELLLEIIDFDTN--IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  +    + +  T S+  IS  S +   ++  +L      G I+++ + F  I+ KL  + + +E  DN +  +++   +  +N ++ ++YP +     + N   I   + K  I +  +AV+ ++ +  I++G+ +     E  L   ATD ++LA  K +   ++   + +V+    +  L +I+D D N  ++I +  + ++FK  + +  S++++G+YP  +R+I T  +  + ++ K  ++A++R   ++   + ++VKL      +LE+S  S ++G   E +  +    E   IS +  +++  L+  D  +I + F+ + +P LLR     + LQ+++P+R
  S:    28 PILTGIKLTATASGVTLTGSDSDISIESFIPLEKEGKLLVDVKRPGSIVLQARFFSEIVKKLPQQTVEIETEDNFLTIIRSGHSEFRLNGLNADEYPRLP-QIEEENVFQIPADLLKTVIRQTVFAVSTSETR-PILTGVNWKVEHGE--LVCTATDSHRLAMRKVKIESENEVSYNVVIPGKSLNELSKILD-DGNHPVDIVMTANQVLFKAEHLLFFSRLLDGNYPETARLIPTESKTTMIVNTKEFLQAIDRASLLAREGRNNVVKLTTLPGGMLEISSISPEIGKVTEQLQTESLEGEELNISFSAKYMMDALRALDGTDIQISFTGAMRPFLLRPLHTDSMLQLILPVR 376
>gi|134297883|ref|YP_001111379.1| DNA polymerase III, beta subunit [Desulfotomaculum reducens MI-1] >gi|134050583|gb|ABO48554.1| DNA polymerase III, beta subunit [Desulfotomaculum reducens MI-1] (365 aa)
Score = 265, Expect = 2.6e-21, Identities = 88/371 (23%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKII ++  LI  +             P+  G L+   DN++K   ++  +    +V  +      E+G I++  K    I+ +L +  I +E    + + ++    +  IN  D E++P      +  N L+I     K+ + ++ +A  +++ +  + +G+    ++   TL ++ TD ++LA    K  S   D  I++    +  L  +I   D  + I L E+ IIF + +T++ S++IEG +PN  ++I    + ++ +  K L+EA ER  ++ +     I++LN   E + ++ +++++G   E V    +  E   IS N  +L+  L+   +DNI  + S    P +LR  +  ++L +++P+R
  S:     1 MKIICTRQNLIQGVTTAQRAVSAKNPLPILSGILLTAKDNKLKLQATDLEMGIQCVVPCTTQ----EEGSIVLPAKYLSEIVRRLPDSPIQIESNQGTNVIIRYGQSEITINGFDAEEFPTFPKPQSK-NSLTIPEEELKEYLRQILFATLSDENR-PVFTGVLMEILNG--TLRLVTTDTHRLAMREIKDSSVDNDINIIIPGKTLNELTRVIGAADQQVTISLGENQIIFGMEDTLLISRLIEGQFPNYRQVIPQGHKTRIRLKTKDLLEASERA-SLLARVGTQIIRLNIEEEKIILT-ANTEVGRIHEEVPVYLQ-GESLQISFNAMYLIDALRAIGSDNIYFDLSGPLSPGILRPVEGDDYLSLILPVR 363
>gi|148543245|ref|YP_001270615.1| DNA polymerase III, beta subunit [Lactobacillus reuteri F275] >gi|184152657|ref|YP_001840998.1| DNA polymerase III beta subunit [Lactobacillus reuteri F275] >gi|148530279|gb|ABQ82278.1| DNA polymerase III, beta subunit [Lactobacillus reuteri F275] >gi|183224001|dbj|BAG24518.1| DNA polymerase III beta subunit [Lactobacillus reuteri F275] (380 aa)
Score = 265, Expect = 2.8e-21, Identities = 94/364 (25%), Positives = 182/364 (50%)
  Q:    14 TKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSE---DANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           ++L N LR  +S +    + P+  G  + VN++ I  T SN  I+  S++  ++   D  I E G I++  + F  I+ KL ++ +T+E        + + +    IN  D E +P++     +   +++   + K+ I +   AV+  +E   I++G+  + +  +  L  +ATD ++LA  K      D  I  DV     S+ EL   I D   ++++ + E+ ++F   NT   S+++EG+YP  S++I    +  V +   T + ++ER   +S   +  +VKL+   S  ++ +S  S D+G  +E V           IS N +++   L++F    I + F+   +P  L+  E   NF+ ++ P+R
  S:    12 SQLNNVLRAISSKT----TIPILTGLKMVVNEDNIVLTGSNSDITIESVINANDADNDLTIEETGAIVLPARFFSDIVKKLPDKKVTIEVTSGFQADITSGSAKFQINGQDAENFPHLPEIETN-KSVTLPNDILKEVIRQTVIAVSK-QESRPILAGV--HMMLKDGVLTAVATDSHRLAQRKVVLENIDNGIDFDVIIPGKSMEELSGMISDVHEDVQMQVTENQVLFIFGNTHFYSRLLEGNYPETSQLIPQTADTTVELEAGTFLSSIERASLLSHESRNDVVKLSLKPSENLVRISGDSPDIGTVEEEVVTSALDGNDLEISFNPNYMKDALRSFGQATIKISFTSPLRPFTLVPTEDQENFVHLITPVR 378
>gi|94989511|ref|YP_597611.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS10270] >gi|94543019|gb|ABF33067.1| DNA polymerase III, beta chain [Streptococcus pyogenes MGAS10270] (378 aa)
Score = 264, Expect = 3.5e-21, Identities = 91/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      E+T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNATKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLENTSADFDVVIPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|126697568|ref|YP_001086465.1| DNA polymerase III subunit beta [Clostridium difficile 630] >gi|115249005|emb|CAJ66816.1| DNA polymerase III, beta chain [Clostridium difficile 630] (402 aa)
Score = 264, Expect = 3.8e-21, Identities = 84/371 (22%), Positives = 189/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +KII ++  L N + +         +  +  G LI   + ++K T  +  I   + V     A I+EKG +++  + F  II KL +  + +E    + I +        I     +++P +    N+ +  SI   + K  I +  +A++ ++ K  +M  +       ++ L ++A DGY+LA      +S  ++ ++++    +  +  ++  + N+++   E N IF +++T I ++++EGD+ +  +++     ++V ++ K L+ ++ER   +S SEK +++KL+   +V+ ++ S+++ GN  E V       +   I+ N+ + +  LK  DN+ I +EF+ +  P +++   D N++ +L+P+R
  S:    35 LKIICNQKILANRIGIAQKAINGKTTIELLKGILISTEEGQLKLTGYDAEIGIETYV----QAEIIEKGDVVVDARLFGDIIRKLPDSFVEIETDSENNIYINCVNSRFKIKGYAAKEFPKLP-ELNEEDLYSIPQEILKNMIKQTVFAISQDQTKPVLMGELLE---IVDRNLNLVAIDGYRLAVKSCSVDSLTENIKVIIPGKTLIDVNSLLSGEDNVKVGFNEKNAIFIINDTKIITRLLEGDFIDYKKLLPREHNSRVKLNTKELLNSIERASLLSQSEKNNLIKLSIRDKVMAIT-SNTEKGNVYEEVEIDLD-GDYLDIAFNSRYFIEGLKNIDNEEIFIEFTTNVNPCIIKPTDDVNYIYLLLPVR 397
>gi|88192167|pdb|2AVT|A Chain A, Crystal Structure Of The Beta Subunit From Dna Polymerase Of Streptococcus Pyogenes >gi|88192168|pdb|2AVT|B Chain B, Crystal Structure Of The Beta Subunit From Dna Polymerase Of Streptococcus Pyogenes (378 aa)
Score = 264, Expect = 4.0e-21, Identities = 91/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +VL   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNTTKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFMVVLPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|104773259|ref|YP_618239.1| DNA polymerase III, beta chain [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422340|emb|CAI96848.1| DNA polymerase III, beta chain [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (375 aa)
Score = 263, Expect = 4.3e-21, Identities = 90/371 (24%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSS---PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  V +   IN L   NS+ + + S    P+  G  +E+ + E+  T SN  IS       S+D  +   G I++    F  I+ KL     T E  + + I++ +   D  IN +D   YP +          S+     ++ I++  +AV+  +E    ++G+ F+  + +  ++ +ATD ++L+    +      +D  +++    ++ L +II D D +I+++L +S I F+  N    ++++EG YP+V R++ T     V  +    ++ L R   ++ + + + V+  LN + + + VS +S ++G  +E V           IS N  ++ + L+    D++ + F++S +P  ++ +++   F+Q++ PIR
  S:     1 MKFTVQRNLFINDL---NSVLKAVSSRAQIPILSGIKLELTEAELIMTGSNADISIELSQPVSDDLRVESTGSIVVTAHLFSEIVRKLPGREFTFEVKEGNQIQITSDKADYVINGLDASAYPRLPEIAG--TSFSLPSKTLRELITQTVFAVST-EESRPTLTGVNFSFKNGQ--IKAVATDSHRLSQRIVDIAAGPSEDLSLIIPGKNLQELAQIIGDADQDIKVYLGDSQIRFEFENLSFYTRLLEGVYPDVDRLLPTESTTSVQFTVSDFMQTLSRASLLTHANRTNAVQMTLNVADQTVLVSGNSPEVGKIEEEVGFSSLTGRDLTISFNPDYMAAALRASVTDSVIINFTESLRPFTVVPNDQSVEFVQLITPIR 373
>gi|114762141|ref|ZP_01441609.1| DNA polymerase III subunit beta [Roseovarius sp. HTCC2601] >gi|114545165|gb|EAU48168.1| DNA polymerase III subunit beta [Roseovarius sp. HTCC2601] (372 aa)
Score = 263, Expect = 5.2e-21, Identities = 91/371 (24%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ A+    S+ E   + P+    LIE   + + F  ++  I     V     A +   G   +       I+ KL +  +     D++  ++  +   SN N+  + +E +P +  S    N  S      +K   K K+A++  + +   ++G+  +   SE  + L  +ATDG++LA          E+ P    IV   ++ EL   + D D +I + + E+ + F   +  + SK+I+G +P+ SR+I T    ++ +      +A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +EP  I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKVSIERATLLKAVSQAQSVVERRNTIPILANVLIEAEGDTVTFRATDLDIE----VLDRAPAQVERAGATTVSAVTLHEIVRKLPDGALVQLADDSAAGRLTVTAGRSNFNLATLPKEDFPVMASSEYATN-FSAKAETLRKLFDKSKFAISTEETRY-YLNGVYMHVSDSEEGRVLRCVATDGHRLARIDAPVPEGAEAMPG--VIVPRKTVGELRKLLDDDDMDIAVSVSETKVRFATPDITLTSKVIDGTFPDYSRVIPTGNTRRLEVDATEFAKAVDR-VATVSSERSRAVKLQLDEDRLVLSVNAPDSGAAEEELAV-AYGDEPLEIGFNAKYLLEIASQVDRENAVFMFNSSGDPTLMREGSDTSAVYVVMPMR 371
>gi|28209865|ref|NP_780809.1| DNA polymerase III subunit beta [Clostridium tetani E88] >gi|28202300|gb|AAO34746.1| DNA polymerase III, beta chain [Clostridium tetani E88] (367 aa)
Score = 262, Expect = 6.2e-21, Identities = 94/371 (25%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI  +K+ L  ++ +         + P+  G  I+  +N +    S+  +S  +I+    DA ++E+G I+I +K F  II KL N++I +   DN++I++K      N+  M  +++P +    N+    SI   + K  +    +A  + +E   I++G+ F     +K L ++A DGY+LA      +S      ++   +L E+   + + D  + I    ++I+F +  T I S+++EGD+ N   II      KV   +   +E +ER   +      S++KLN + + + ++ S+S LG  +E +    +  E   I+ N+ +L+ +LK  + D I +E S S  P ++++++  +   +++P+R
  S:     1 MKIFCNKSILQESISIAQKAVTGKSTMPILQGIFIKAENNSLTLIGSDIDLSIETIM----DAEVIEEGSIVIDSKIFGEIIRKLPNDVIEITSKDNNIIEIKCQKSKFNLVHMSADEFPELP-KINENIIFSIPEALLKNMVRGTIFA-TSQEETRPILTGLLFE--IKDKILNLVALDGYRLAVKSEIIDSENSISAVIPGKTLNEVSKILSENDEKVNITFTPNHILFSIGKTKIISRLLEGDFINYKSIIPKEYNLKVIAKRIKFLECIERASLMGKDGNTSLIKLNITDDSIVIT-SNSQLGMVREEMGIILQ-GEDLEIAFNSKYLIDVLKVMEEDEIILELSSSISPCVIKNKEANDCTYLVLPVR 363
>gi|50913348|ref|YP_059320.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS10394] >gi|139472890|ref|YP_001127605.1| DNA polymerase III subunit beta [Streptococcus pyogenes str. Manfredo] >gi|50902422|gb|AAT86137.1| DNA polymerase III beta chain [Streptococcus pyogenes MGAS10394] >gi|134271136|emb|CAM29346.1| DNA polymerase III, beta chain [Streptococcus pyogenes str. Manfredo] (378 aa)
Score = 261, Expect = 7.8e-21, Identities = 90/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNATKRAISTKNAIPILSSIKIEVTPTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|15674252|ref|NP_268425.1| DNA polymerase III subunit beta [Streptococcus pyogenes M1 GAS] >gi|71909816|ref|YP_281366.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS5005] >gi|13621327|gb|AAK33147.1| beta subunit of DNA polymerase III [Streptococcus pyogenes M1 GAS] >gi|71852598|gb|AAZ50621.1| DNA polymerase III beta chain [Streptococcus pyogenes MGAS5005] (378 aa)
Score = 261, Expect = 8.0e-21, Identities = 90/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNTTKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|56808864|ref|ZP_00366575.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Streptococcus pyogenes M49 591] >gi|71902669|ref|YP_279472.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS6180] >gi|94987633|ref|YP_595734.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS9429] >gi|94991499|ref|YP_599598.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS2096] >gi|71801764|gb|AAX71117.1| DNA polymerase III, beta chain [Streptococcus pyogenes MGAS6180] >gi|94541141|gb|ABF31190.1| DNA polymerase III, beta chain [Streptococcus pyogenes MGAS9429] >gi|94545007|gb|ABF35054.1| DNA polymerase III, beta chain [Streptococcus pyogenes MGAS2096] (378 aa)
Score = 261, Expect = 8.2e-21, Identities = 90/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNATKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|21909538|ref|NP_663806.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS315] >gi|28894914|ref|NP_801264.1| DNA polymerase III subunit beta [Streptococcus pyogenes SSI-1] >gi|21903718|gb|AAM78609.1| beta subunit of DNA polymerase III [Streptococcus pyogenes MGAS315] >gi|28810159|dbj|BAC63097.1| putative DNA polymerase III beta subunit [Streptococcus pyogenes SSI-1] (378 aa)
Score = 261, Expect = 8.7e-21, Identities = 90/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNATKRAISTKNAIPILSSIKIEVTPTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDININVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPGKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|94993398|ref|YP_601496.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS10750] >gi|94546906|gb|ABF36952.1| DNA polymerase III, beta chain [Streptococcus pyogenes MGAS10750] (378 aa)
Score = 260, Expect = 1.0e-20, Identities = 90/367 (24%), Positives = 182/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIQALNATKRAISTKNAIPILSSIKIEVTPTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|116628685|ref|YP_813857.1| DNA polymerase sliding clamp subunit [Lactobacillus gasseri ATCC 33323] >gi|116094267|gb|ABJ59419.1| DNA polymerase III, beta subunit [Lactobacillus gasseri ATCC 33323] (376 aa)
Score = 260, Expect = 1.1e-20, Identities = 88/344 (25%), Positives = 174/344 (50%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           P+  G  + + D  +  T S+  IS    +  ++D  +   G I++  + F  I+ KL  +  + E  ++   K+ +   +  IN +D   YP++     D     IS   F++ I++  +AV   +E    ++G+ F  I +  +++ +ATD ++L+  +   E+ PQ     I+   SL+EL   I + D  I +   E+ ++F+V N    S++++G YP+  R+I T     V      L  +LER   ++   + ++VK  L+  ++++++   S ++GN +E +S K    E   IS N  +L   L+    D+I + F+   +P  ++  ++D NF Q++ P+R
  S:    28 PILSGIKLNLTDEMLTLTGSDTDISIEIQIPVNDDLVVQSTGSIVLPARFFSEIVKKLPGKDFSFEVRESFQTKIVSENTEFMINGLDANNYPHLPEISTD-ASFKISGKTFREIINETVFAVAT-QESRPTLTGVNF--IFNNSSIKAVATDSHRLSQRQISLENGPQTSTDLIIPGKSLVELARIIGENDPEITVNPGENQVLFEVGNIAFYSRLLDGQYPDTDRLIPTESTTSVEFELPVLARSLERASLLTHESRNNVVKMTLDVQNQLVKLQGDSPEIGNVEEEISFKKLEGEGLTISFNPDYLREALRASITDSIIMNFTQPLRPFTVVPAKQDVNFTQLITPVR 374
>gi|194467404|ref|ZP_03073391.1| DNA polymerase III, beta subunit [Lactobacillus reuteri 100-23] >gi|194454440|gb|EDX43337.1| DNA polymerase III, beta subunit [Lactobacillus reuteri 100-23] (380 aa)
Score = 259, Expect = 1.5e-20, Identities = 93/364 (25%), Positives = 181/364 (49%)
  Q:    14 TKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSE---DANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           ++L N LR  +S +    + P+  G  + VN++ I  T SN  I+  S++  ++   D  I + G I++  + F  I+ KL ++ +T+E        + + +    IN  D E +P++     +   +++   + K+ I +   AV+  +E   I++G+  +    +  L  +ATD ++LA  K      D  I  DV     S+ EL   I D   ++++ + E+ ++F   NT   S+++EG+YP  S++I    +  V +   T + ++ER   +S   +  +VKL+   S  ++ +S  S D+G  +E V           IS N +++   L++F    I + F+   +P  L+  E   NF+ ++ P+R
  S:    12 SQLNNVLRAISSKT----TIPILTGLKMVVNEDNIVLTGSNSDITIESVINANDADNDLTIEDTGAIVLPARFFSDIVKKLPDKKVTIEVTSGFQADITSGSAKFQINGQDAENFPHLPEIETN-KSVTLPNDILKEVIRQTVIAVSK-QESRPILAGV--HMTLKDGILTAVATDSHRLAQRKVVLENIDNGIDFDVIIPGKSMEELSGMISDVHEDVQMQVTENQVLFIFGNTHFYSRLLEGNYPETSQLIPQTADTTVELEAGTFLSSIERASLLSHESRNDVVKLSLKPSENLVRISGDSPDIGTVEEEVVTSALDGNDLEISFNPNYMKDALRSFGQATIKISFTSPLRPFTLVPTEDQENFVHLITPVR 378
>gi|16885215|gb|AAF98349.2| DNA polymerase III beta subunit [Streptococcus pyogenes] (378 aa)
Score = 258, Expect = 1.6e-20, Identities = 90/367 (24%), Positives = 182/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     IEV    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  D  +VL   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNTTKRAISTKNAIPILSSIKIEVTSTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADLMVVLPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|19745203|ref|NP_606339.1| DNA polymerase III subunit beta [Streptococcus pyogenes MGAS8232] >gi|19747292|gb|AAL96838.1| beta subunit of DNA polymerase III [Streptococcus pyogenes MGAS8232] (378 aa)
Score = 257, Expect = 2.3e-20, Identities = 89/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           +++T  I+AL           + P+     I+V    +  T SNG IS  ++I   +E+A +L    G IL++   F  IIS L +  I +++++   + + +   +  +   D +QYP +    +  N L +   + K  I++  +A +  +E   I++G+    +S+ K  + +ATD ++++      ++T  DF +V+   SL E      D    +E+F   S I+F+  +    ++++EG+YP+  R++ T  E +V  + ++L  A+ER   IS++ +   VKL  +   +    +S ++G   E +    +      IS N  +L+  LK   ++ + + F    +P  L   +++ +F+Q++ P+R
  S:     6 INRTLFIHALNATKRAISTKNAIPILSSIKIKVTPTGVTLTGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQVVLTSGKSEITLKGKDVDQYPRLQ-EVSTENPLILKTKLLKSIIAETAFAASL-QESRPILTGVHI-VLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETVEVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVR 376
>gi|37522801|ref|NP_926178.1| DNA polymerase III subunit beta [Gloeobacter violaceus PCC 7421] >gi|35213803|dbj|BAC91173.1| DNA polymerase III beta subunit [Gloeobacter violaceus PCC 7421] (376 aa)
Score = 257, Expect = 2.6e-20, Identities = 85/370 (22%), Positives = 181/370 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF-----ESTPQDFRIVLDVSLIELLLEIIDFDT--NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MKI+ S+  L   L L      +  + P+    L+E  D      T  G      I  +     +   GR  +  +    IIS+L NE +T+E  +++ I +   +    +     E++P +     +  + L +S   F + + +  +A + ++ K  I++G+   ++  ++ +E +ATD ++L+ Y+      E+  Q    VL V  +  L +I+      ++E+   E  +IF+  N  + ++++ G YP+  +++    +   ++ +K L+  LER +A+ + +K  IVKL+F  S  ++ VS  + D+G  +E+V  +    +   ++ N  +LL  LK  D  +++   + +  P +L+   D N+  +++P+
  S:     1 MKIVCSQAVLNQNLSLVGRAVPSRPTHPILANILLEA-DGRSGTVTLTGFDLDLGIDTRFAAEQVEGSGRTTLPARVLSDIISRLPNESLTMEVSEDNAISLVCGSSQYQVQGASAEEFPKLPELPDSAAHVLPVSE--FLEGVQRSLFAASTDESK-QILNGVSVKAL--KEGMEFVATDAHRLSFYRTDFTLPEAGTQAIAAVLPVRSVRELEKILGAQAGDSVEVRFDEKQMIFQFPNQTLTTRLLGGRYPDYQQLLPKQFQQTADMERKRLIGCLER-IAVLADQKNHIVKLDFAPSEHLMTVSVDAPDVGRGRESVPVQYS-GQDFSVAFNVRYLLEGLKAMDATDVSFCLNGASDPAVLKPVGDGNYQYLIMPV 372
>gi|42560562|ref|NP_975013.1| DNA polymerase III, beta chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492058|emb|CAE76655.1| DNA POLYMERASE III, BETA CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (375 aa)
Score = 256, Expect = 2.8e-20, Identities = 85/369 (23%), Positives = 189/369 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETV-SCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVP 375
           M   +++  L++ L     + +    +P   G  + V  +++    ++GI+S  SI+  ++ D  + ++G++L+K K    ++ +L +E +T   V+++ + +KT   D +I +++ E YP I F      + +++P   KK+I +V  ++N N +K+ I++G+     +++       TD ++++    E   +  +D  I +       L +++D   N++I + E  I F + N I  S +I+G +PNV     T  +  + + +K++++ L R   ++     +IV +  + + +E     S++G  +E       + N+   IS N  FL+  +KT + D I ++  +S KP+++ +  D    Q+++P
  S:     1 MNFSINRIVLLDNLSKAAKVIDYKNVNPSLAGIYLNVLSDQVNIIATSGILSFKSILNNQNSDLEVKQEGKVLLKPKYVLEMLRRLDDEFVTFSMVEDNELIIKTDNSDFSIGVLNSEDYPLIGFREKGI-EFNLNPKEVKKTIYQVSVSMNENNKKL-ILTGLNLKLTNNQAIFS--TTDSFRISQKILEIQSNNNEDIDITIPFKTALELPKVLDNAENLKIIIVEGYITFIIDNVIFQSNLIDGKFPNVQIAFPTKFQTIITVKQKSILKVLSRFDLVADDGLPAIVNIKVNEDKIEFKSFISEVGKYEEDFDDFVIEGNKSLSISFNTRFLIDAIKTLNEDRIELKLINSTKPIVINNVYDEYLKQVILP 370
>gi|92115635|ref|YP_575364.1| DNA polymerase III subunit beta [Nitrobacter hamburgensis X14] >gi|91798529|gb|ABE60904.1| DNA polymerase III, beta subunit [Nitrobacter hamburgensis X14] (372 aa)
Score = 256, Expect = 3.4e-20, Identities = 87/371 (23%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   +  +    ++  +     +A    A     G   +    F+ I+ KL +   I LE   D SV+ ++       +  + E  +P++  +    +   ++    K+ I + ++A++  + +   ++GI  +S  S K  TL  +ATDG++LA          E  P        V  ++ L+E  D +  + I L +  I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   +EP  I  N+ +LL +    + +   ++ +D   P L+ D+     L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLKATDLDLEVTETLA----AETATGGATTVPAHIFYDIVRKLPDGAQIVLEGDGDRSVLAIRAGRSRFTLQTLPENDFPDLA-AGEMTHSFKLAAADIKRLIDRTQFAISTEETRY-YLNGIYLHSAGSAKNATLRGVATDGHRLAQVDLALPNGAEGMPGVIIPRKTVGEVQRLIE--DNEAEVGIELSQGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELIVDKKDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASEPLDIGFNSRYLLDIAAQIEGEGAVLKLADPGSPTLVHDKDSKGALYVLMPMR 371
>gi|42518086|ref|NP_964016.1| DNA polymerase III, beta chain [Lactobacillus johnsonii NCC 533] >gi|41582370|gb|AAS07982.1| DNA polymerase III, beta chain [Lactobacillus johnsonii NCC 533] (376 aa)
Score = 255, Expect = 4.2e-20, Identities = 91/362 (25%), Positives = 182/362 (50%)
  Q:    16 LINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           L NA+R  +S +    + P+  G  + + D  +  T S+  IS    +  ++D  +   G I++  + F  I+ KL  +  + E  ++   K+ +   +  IN +D   YP++     D     IS   F++ I++  +AV   +E    ++G+ F  I +  +++ +ATD ++L+  +   E+ PQ     I+   SL+EL   I + D  I +   E+ ++F+V N    S++++G YP+  R+I T     V      L  +LER   ++   + ++VK  L+  ++++++   S ++GN +E +  K    +   IS N  +L   L+    D+I + F+   +P  ++  ++D NF Q++ P+R
  S:    14 LNNAMRAISSRA----TIPILSGIKLTLTDEMLTLTGSDTDISIEIQIPVNDDLIVQSTGSIVLPARFFSEIVKKLPGKDFSFEVKESFQTKIVSENTEFMINGLDANNYPHLPEISTD-ASFKISGKTFREIINETVFAVAT-QESRPTLTGVNF--IFNNSSIKAVATDSHRLSQRQISLENGPQTSTDLIIPGKSLVELSRIIGESDPEITVNPGENQVLFEVGNIAFYSRLLDGQYPDTDRLIPTESTTSVEFELPVLARSLERASLLTHESRNNVVKMTLDVQNQLVKLQGDSPEIGNVEEEIGFKNLEGDGLTISFNPDYLREALRASITDSIIMNFTQPLRPFTVIPAKQDVNFTQLITPVR 374
>gi|116491820|ref|YP_803555.1| DNA polymerase III, beta subunit [Pediococcus pentosaceus ATCC 25745] >gi|116101970|gb|ABJ67113.1| DNA polymerase III, beta subunit [Pediococcus pentosaceus ATCC 25745] (379 aa)
Score = 254, Expect = 5.5e-20, Identities = 97/371 (26%), Positives = 191/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDA---NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL--NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK  +++   I  L        +  + P+  G  IE  ++ +  T SN  IS  + ++ +++    NI   G +++  + F  I+ KL +  + LE  D     + +   +  IN +D   +P++    +    +++   VF + I++   AV+N +E   I++GI F +I   K L  +ATD ++L+  +  + P+  ++  D+     SL+EL   + D    I + + E+  +F    T+  S+++EG YP+ SR+I      ++      L+ ++ER   +S + + ++VKL  N +++   +S  S ++GN +E V  K  V E   IS N  +L   L++F + +I + F+ + +P  L+  E   NF+Q++ P+R
  S:     1 MKFTIARNTFIKKLNAVQRAISSKTTIPILTGLKIEAEEDRLILTGSNTDISIETTISTNDEEAHLNIESTGAVVLTARFFGDIVKKLPDNTMLLEVKDGFQTTITSGASEFKINGLDANNFPHLP-EVDSQTTITLKADVFSEMINETVIAVSN-QESRPILTGIHF-TIEGNK-LSAVATDSHRLSQ-RVINLPEPIKMPEDIIIPGKSLLELSRMLDDEIDTITLQISENQALFTFDETLFYSRLLEGLYPDTSRLIPKESSTEMEFEAPELLASIERASLLSHAGRNNVVKLTINAANKQAIISGDSPEVGNVEEEVVTKDIVGEDLEISFNPDYLKDALRSFGHTSIKMAFTSALRPFTLVPTEDQENFIQLITPVR 377
>gi|81097168|ref|ZP_00875475.1| DNA polymerase III, beta chain [Streptococcus suis 89/1591] >gi|146317664|ref|YP_001197376.1| DNA polymerase III subunit beta [Streptococcus suis 05ZYH33] >gi|80976791|gb|EAP40367.1| DNA polymerase III, beta chain [Streptococcus suis 89/1591] >gi|145688470|gb|ABP88976.1| DNA polymerase sliding clamp subunit [Streptococcus suis 05ZYH33] (378 aa)
Score = 253, Expect = 7.2e-20, Identities = 87/367 (23%), Positives = 178/367 (48%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           ++K   + AL +         + P+     I V    I  T SNG IS  H I  + E+A +L    G IL++   F  ++S + + ++   +++   I + +   +  +   + EQYP +         L +   V K++I++  +A +  +E   I++G+ F  ++  K L+ +ATD ++++  K   +++  DF +V+   SL E      D    +E+F   + I+F+  +    ++++EG YP+  R+I T  +         L  ++ER   +S++ +   VKL  ++ V+    +S ++G   E +       E   IS N  +L+  LK   ++ + + F  S +P  L+ + +  +F+Q++ P+R
  S:     6 INKNIFLQALSITKRAISTKNAIPILSTVKITVTSEGITLTGSNGQISIEHFISIQDENAGLLISSPGSILLEAGFFINVVSSMPDLVLDFNEIEQKQIVLTSGKSEITLKGKEAEQYPRLQ-EVPTSKPLVLETKVLKQTINETAFAAST-QESRPILTGVHF-VLTENKNLKTVATDSHRMSQRKLVLDTSGDDFNVVIPSRSLREFTAVFTDDIETVEVFFSNNQILFRSEHISFYTRLLEGTYPDTDRLIPTEFKTTAIFDTANLRHSMERARLLSNATQNGTVKLEIANNVVSAHVNSPEVGRVNEELDTVEVSGEDLVISFNPTYLIEALKATTSEQVKISFISSVRPFTLIPNNEGEDFIQLVTPVR 376
>gi|91974484|ref|YP_567143.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris BisB5] >gi|91680940|gb|ABE37242.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris BisB5] (372 aa)
Score = 253, Expect = 7.3e-20, Identities = 87/371 (23%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   + ++    ++  +     V ++  A     G   +    F+ I+ KL +   I LE   D SV+ ++       +  + E  +P++       +  S++    K+ I + ++A++  + +   ++GI  ++  S K  TL  +ATDG++LA         ++     IV   ++ E+   I D D  I I L    I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++   I  N+ +LL +    + +   ++ +D   P L++D    N L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLALKATDLDLE----VIETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGRSRFTLQTLPESDFPDLAAGEMS-HSFSLAASDVKRLIDRTQFAISTEETRY-YLNGIYLHTAGSAKAATLRAVATDGHRLAQVDLAQPAGASGMPGVIVPRKTVGEVQRLIEDNDAEIAIELSAGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKEFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDALDIGFNSRYLLDIAAQIEGEVAVLKLADPGSPTLIQDRDTKNALYVLMPMR 371
>gi|83319869|ref|YP_424002.1| DNA polymerase III, beta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|1169394|sp|P24117|DPO3B_MYCCT DNA polymerase III subunit beta >gi|83283755|gb|ABC01687.1| DNA polymerase III, beta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (375 aa)
Score = 253, Expect = 7.4e-20, Identities = 86/369 (23%), Positives = 190/369 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETV-SCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVP 375
           M   +++  L++ L     + +    +P   G  + V ++++   T++GI+S  SI+  ++ D  + ++G++L+K K    ++ +L +E +    V+++ + +KT+  D +I +++ E YP I F      + +++P   KK+I +V  ++N N +K+ I++G+     +++       TD ++++    E      +D  I +       L +++D   N++I + E  I F + N I  S +I+G +PNV     T  E  + + +K++++ L R   ++     +IV +  + + +E     S++G  +E       + N+   IS N  FL+  +KT   D I ++  +S KP+++ +  D +  Q+++P
  S:     1 MNFSINRIVLLDNLSKAAKVIDYKNVNPSLSGIYLNVLNDQVNVITTSGILSFKSILNNQNSDLEVKQEGKVLLKPKYVLEMLRRLDDEFVVFSMVEDNELIIKTNNSDFSIGVLNSEDYPLIGFREKGI-EFNLNPKEVKKTIYQVFVSMNENNKKL-ILTGLNLKLNNNQAIFS--TTDSFRISQKILEIQSDNNEDIDITIPFKTALELPKLLDNAENLKIIIVEGYITFIIDNVIFQSNLIDGKFPNVQIAFPTKFETIITVKQKSILKVLSRFDLVADDGLPAIVNIKVNEDKIEFKSFISEVGKYEEDFDDFVIEGNKSLSISFNTRFLIDAIKTLSEDRIELKLINSTKPIVINNVYDEHLKQVILP 370
>gi|125974857|ref|YP_001038767.1| DNA polymerase III subunit beta [Clostridium thermocellum ATCC 27405] >gi|125715082|gb|ABN53574.1| DNA polymerase III, beta subunit [Clostridium thermocellum ATCC 27405] (366 aa)
Score = 251, Expect = 1.1e-19, Identities = 88/371 (23%), Positives = 188/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP--QDFRIVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI+ SK +L+  + +         +  +  G L+E  DN  K T ++  +    ++    DA+ILEKG I++ +K F  I+ +L +  + +E  +N+ + ++       +  M  + +P++  S    N + +S    +  I +  +AV+    +  I++G       +E T   ++ DG+++A  K  +     +F +V+    +  + +I+   D +I I+  ++ I+F++ N  + S+++EG+Y N   II    E  V +  + L+ +LER   I+S EKK  VK N   + + ++ S++++G  +E +  + +VN     +  N  + +  L+  D++ + + F+ S  P  +R  +  +F  +++P+R
  S:     1 MKIVCSKEQLMEGINVVQKAVPTKATLTILEGILLEAYDN-FKMTGNDLELGIECLI----DADILEKGSIVLNSKMFGDIVRRLPDSEVLIEVKENNTVIIECDNSHFELRGMPSDSFPSLP-SIEKENMIKVSQKAIRDMIRQTLFAVSTEGTR-PILTGSLIECAGNEITF--VSIDGFRMALRKNFNNEGFSEFSVVVPAKTLSEIGKILQPVDEDIYIYSSQNQILFEIGNCKVVSRLLEGEYLNYKSIIPPEYETSVRLRTEDLLSSLERASLITSDEKKYPVKFNIIDDKIIIT-SNTEIGAVREEI--RVEVNGSNMEVGFNPRYFIEALRVIDDELVDIYFNSSVGPCTIRPLEGDSFAYMILPVR 363
>gi|94495788|ref|ZP_01302367.1| DNA polymerase III, beta subunit [Sphingomonas sp. SKA58] >gi|94424480|gb|EAT09502.1| DNA polymerase III, beta subunit [Sphingomonas sp. SKA58] (370 aa)
Score = 251, Expect = 1.2e-19, Identities = 92/371 (24%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN-DNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDW-NQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFN-SISSEKTLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ +L    S+ E   + P+    LIE + D  IK   ++  +     V +S  A + + G   I     F I  KL +   ++L+  D  ++ ++      N++ +  + +P I  +  D   Q  +     K+ I K ++A++  + +   ++GI F+ S   +  L+  ATDG++LA          +  P    I++    I  L +++D  + +++I L  S I F + + I+ SK+I+G +P+ SR+I T  +  + I  ++  + ++R +A  ++EK   VK+    + + +S +S + G + E V    +  E   I  N  +LL +L   D+D + +  +D+  P L+R+      L +L+P+R
  S:     1 MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIEASADGAIKLMATDLDLQ----VVESISAQVEQPGATTISAHTLFDIARKLPEGSQVSLQAADGKML-IQAGRARFNLSTLPRDDFPVI--AEGDLPTQFELPAETLKQIIDKTRFAISTEETRY-YLNGIYFHVSEEGQPVLKAAATDGHRLARVTVPRPDGADGMPG---IIVPRKCIGELRKLLDEVEGSVQISLSASKIRFGLGSAILTSKLIDGTFPDYSRVIPTGNDKLLKIDPRSFEDGVDR-VATIATEKTRAVKMTLDKDRITLSVTSPENGTAAEEVPGAFQ-GEGFDIGFNARYLLDILGQIDSDLVELHLADAAAPTLIRENDASPALYVLMPMR 369
>gi|15893300|ref|NP_346649.1| DNA polymerase III subunit beta [Clostridium acetobutylicum ATCC 824] >gi|15022819|gb|AAK77989.1|AE007513_2 DNA polymerase III beta subunit [Clostridium acetobutylicum ATCC 824] (366 aa)
Score = 251, Expect = 1.2e-19, Identities = 84/371 (22%), Positives = 196/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNI--SKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I  K  L  A+           + PV  G L+ V +NE+    S+  +S  + +    +  +LE+G++++  +    II KL N  + ++ ++N+ +++  +     +  ++   +P++    ++ +   I+    K  I    +A+  ++ +  I++G+ F    S+  L ++A DGY+LA   ++         V+    +  +++I++ D ++ I    ++I+F + NT I S+++EG++   + II  P+E  +NI   K+ L++ +ER   ++     +++KL+   +V+ ++ S+S LGN +E ++   +  +P  I+ N+ +L+ +LK  + + I + FS S  P +++++++ +   +++P+R
  S:     1 MKFICEKNILQEAIITAQKAVTGKSTMPVLQGILMSVQNNELTLIGSDIDLSIETKI----NVEVLEEGKVVLDARLLSEIIRKLPNSKVEIQTIENNCVEITCNKSKLTLVYLNPNDFPSLP-EIDENSIFKINQKTLKTMIKGTIFAIAQDETR-PILTGVLFEIKDSK--LNLVAIDGYRLALRSQYIDNETSINAVIPGKTLNEVIKILEDDGDVNITFTSNHILFNLGNTKIISRLLEGEFIKYNSII--PEEYNLNIVARKEELLDCIERASLMAKDGNNNLIKLDIEDDVMIIT-SNSQLGNVREEINIILQ-GQPLKIAFNSKYLIDVLKIMNQEEIVMNFSSSISPCIIKNKENDDSTYLILPVR 362
>gi|27375940|ref|NP_767469.1| DNA polymerase III subunit beta [Bradyrhizobium japonicum USDA 110] >gi|27349078|dbj|BAC46094.1| DNA polymerase III beta chain [Bradyrhizobium japonicum USDA 110] (372 aa)
Score = 250, Expect = 1.6e-19, Identities = 85/371 (22%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   + ++    ++  +  T ++ A++  A     G   +    F+ I+ KL +   I LE   D +V+ ++       +  + E  +P++  + +  +  S++    K+ I + ++A++  + +   ++GI  ++  + K  TL  +ATDG++LA          +  P        V  ++ L+E  D +  + I L ++ I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL+ S   L +S ++ D G++ E +  +   ++   I  N+ +LL +    + +  T+  +D   P L++D  D + L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAKLSLKATDLDLEVTETLPAETATA-----GSTTVPAHMFYDIVRKLPDGSQIVLEADGDRAVLAIRAGRSRFTLQTLPENDFPDLA-AGDMSHSFSLAAKDVKRLIDRTQFAISTEETRY-YLNGIYLHAAGTAKAATLRGVATDGHRLAQLDLVQPKGADGMPGVIVPRKTVGEVQRLIE--DTEAEMTIELSQAKIRFTIGNVVLTSKLIDGTFPDYGRVIPQGNDKELVVDKKDFENAVDR-VSTISSERGRAVKLSLSPGKLVLSVTNPDSGSATEELEVE-YASDALDIGFNSRYLLDIAAQIEGEVATLRLADPGSPTLVQDRDDKSALYVLMPMR 371
>gi|78221230|ref|YP_382977.1| DNA polymerase III, beta subunit [Geobacter metallireducens GS-15] >gi|78192485|gb|ABB30252.1| DNA polymerase III, beta subunit [Geobacter metallireducens GS-15] (373 aa)
Score = 249, Expect = 1.8e-19, Identities = 81/371 (21%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK-TLEIIATDGYKL--AHYKFEST--PQDFR-IVLDVSLIELLLEIIDFDTNIEIFL--FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K     AL+    I E   + P+    LIE + + I+ T ++  +   S    S +  +  +GRI +  K  + I+ +L  E I+    +N  ++++      +I  +  E++P      N+ + + I   +    I K  YA+  ++ K N+       ++  +K  L ++ATDG++L  A  +F     P+  + ++     I  L +I +  T  E+ L   +++ + K  NT++  ++++G++P+ +R++    +  V +++   + +L R ++I SSEK   +++  + E + +S S+ +LG + E +        P  I  N  +LL +L   +   + +   D   P +++      F  +++P+R
  S:     1 MEFKIDKETFSRALQKIQGIVEKRNTMPILSNVLIEAHADRIELTATDLEVGMKS----SYETTVTREGRITVSAKKLYEIVKELPEEAISFATKENDWVEIRCGKAHFSIVGLSPEEFPYFP-KVNEESLIRIEGALLADMIEKTAYAICFDETKYNLNGTFVKATVEDDKPILRMVATDGHRLSIAEKEFHGAVGPEMAKGVIFPKKGIFELKKICEEATTEELALGFMDNSAVIKKGNTVVVMRLVDGEFPDYTRVVPVANDKIVTVARDPFLHSLRR-MSILSSEKFKGIRMEINGEQMIISSSNPELGEASEELDA-AYSGPPLSIRFNAKYLLDVLAVLNESEVALVLRDELSPAIVKPAAVDGFTAVIMPMR 372
>gi|86747129|ref|YP_483625.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris HaA2] >gi|86570157|gb|ABD04714.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris HaA2] (372 aa)
Score = 249, Expect = 1.9e-19, Identities = 87/371 (23%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   + ++    ++  +  T ++ A++  A     G   +    F+ I+ KL +   I LE   D SV+ ++       +  + E  +P++       +  S++    K+ I + ++A++  + +   ++GI  ++  S K   L  +ATDG++LA         +      IV   ++ E+   I D D  I + L    I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++P  I  N+ +LL +    + +   +  +D   P L++D    N L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAQLSLKATDLDLEVTETLPAETATA-----GSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGRSRFTLQTLPESDFPDLAAGEMS-HSFSLTASDVKRLIDRTQFAISTEETRY-YLNGIYLHTAGSAKDAKLRAVATDGHRLAQVDLTQPAGAAGMPGVIVPRKTVGEVQRLIEDNDAEIGLELSVGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDPLDIGFNSRYLLDIAAQIEGEVAVLRLADPGSPTLIQDRDKKNALYVLMPMR 371
>gi|89898369|ref|YP_515479.1| DNA polymerase III subunit beta [Chlamydophila felis Fe/C-56] >gi|89331741|dbj|BAE81334.1| DNA polymerase III beta chain [Chlamydophila felis Fe/C-56] (366 aa)
Score = 249, Expect = 2.0e-19, Identities = 82/371 (22%), Positives = 188/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +VS+ +L N ++   S+       PV    LIE  ++E+ FT ++  +ST  +      A + E G I I +K FF ++ +L    + +      + K+ + +    +  M +E +P +    N   + ++     K+ + +  +AV+  + +  +++G+      ++  + ++ TDG +LA    E S  + F    ++ +  +E ++++   D+   IFL ++ I  +  NT++ +K++ G++P+ S +I+T    ++++ ++ L+  L++ +A+ ++E    VK  F+   L ++ + + +G  K +++      E   I+ N  F L +LK   ++ + +  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETCNDELVFTATDLTVSTRCVA----QAKVYESGAISIPSKRFFQLVKELTEANLEISATTGEMAKITSGSSCFRLLSMGKEDFPMLPDIQNSI-RFTLPAEQLKEMLQRTSFAVSREESRY-VLTGVLLTI--ADGMVTVVGTDGKRLAKTDTEISLDKSFAGDYIVPIKAVEEMIKLCSEDSEATIFLDQAKIAVECGNTLLITKLLSGEFPDFSPVISTESSVQLDLHREELITLLKQ-VALFTNESSHSVKFTFTPGELTLTANCTKVGEGKVSMAVNYS-GELLEIAFNPFFFLDILKHSKDELVRLGISDSYNPGIITDSTRSLF--VIMPMR 362
>gi|84684520|ref|ZP_01012421.1| DNA polymerase III subunit beta [Rhodobacterales bacterium HTCC2654] >gi|84667499|gb|EAQ13968.1| DNA polymerase III subunit beta [Rhodobacterales bacterium HTCC2654] (372 aa)
Score = 249, Expect = 2.0e-19, Identities = 89/371 (23%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE--STPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI V +  L+ A+    S+ E   + P+    LIE   + + F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++      SN ++  + +E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +   +E  K L  +ATDG++LA    +     +D    IV   ++ EL   + D D  I + + E+ + F   +  + SK+I+G +P+ +R+I      K+ +      +A++R +A  SSE+   VKL  + + L +S ++ D G ++E +      +E   I  N  +LL +    D +N    F ++ +PVL+R+  D + + +++P+R
  S:     1 MKISVERAVLLKAVGQAQSVVERRNTIPILANVLIEAEGSTVSFRATDLDIE----VVDKAPAMVERAGATTVSAVTLHEIVRKLPDGAMVQLTDDGAAGRLTVEAGRSNFSLATLPKEDFPVMASSEYSANFSAPAP-VLRRLFDKSKFAISTEETRY-YLNGVYMHVSDAEGGKVLRCVATDGHRLARIDADLPKGAEDMPGVIVPRKTVGELRKLLDDDDMQIAVSVSETKVRFATPDITLTSKVIDGTFPDYTRVIPMGNTKKMEVDAAEFAKAVDR-VATVSSERSRAVKLALAEDKLTLSVNAPDAGAAEEELIV-AYGDEGMEIGFNAKYLLEIASQVDRENAVFMFDNAGQPVLMREGNDTSAVYVVMPMR 371
>gi|58038493|ref|YP_190457.1| DNA polymerase III subunit beta [Gluconobacter oxydans 621H] >gi|58000907|gb|AAW59801.1| DNA polymerase III, beta chain [Gluconobacter oxydans 621H] (374 aa)
Score = 248, Expect = 2.7e-19, Identities = 88/371 (23%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSIS--SEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDT-NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISL--NNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +T L  AL   + ++E   + P+    L+   D+ ++ T ++  I+    V  S +      G   +     F I+ KL + + +  +  D+   + ++   + +++N++  + +P +  + +  ++ SI     +  I + K+A++N + +   ++GI  +     S   L  +ATDG++LA  + E  P+  R    +++    I  L +++D    ++E+ L ++ I F+    ++ SK+I+G +P   R+I    +  + + K+    A+ R  AI S E+   VKL+ +  +L +S +S D G + E +       +  PI +     +L  +    D + +   FSDS  P ++RD   P+ L +L+P+R
  S:     1 MKFKVDRTLLQRALAHIHGVAEKRNTIPILANVLMSYQDDVLRLTATDMEIAVVEDVPASGE----RSGSTTVPAAVLFEIVRKLPDGVALEFDHQDSEAPLALRAGRYATSLNVLPVDDFPAM-VAGDLPHRFSIPAATLRGLIDRTKFAISNEETRY-YLNGIYLHVAENGSIPMLRAVATDGHRLARVETE-LPEGARGMPGVIIPRKTINELRKLLDEGAADLEVSLSDTRIQFQAGPVLLTSKLIDGTFPEYERVIPKGNDRILRVGKRDFAAAVGRVAAI-SQERSRPVKLSVTQNMLNLSATSPDQGVAHEELDENAVSYDAAPIEIGFQARYLTDITDQIDVE-VEFAFSDSSAPTIVRDTASPSALYVLMPMR 373
>gi|85705684|ref|ZP_01036781.1| DNA polymerase III subunit beta [Roseovarius sp. 217] >gi|85669674|gb|EAQ24538.1| DNA polymerase III subunit beta [Roseovarius sp. 217] (372 aa)
Score = 248, Expect = 2.8e-19, Identities = 87/371 (23%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ A+    S+ E   + P+    LIE   N ++F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++      SN N+  + +E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +   ++  K L  +ATDG++LA    +    ++     IV   ++ EL   + D D  I + + E+ I F   +  + SK+I+G +P+ +R+I      ++ +      +A++R +A  SSE+   VKL+   + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D   + +++P+R
  S:     1 MKLSIERGALLKAVSQAQSVVERRNTIPILANVLIEAEGNSVQFRATDLDIE----VVDKAPAQVERAGATTVSAVMLHEIVRKLPDGSLVTLSDDGTSGRLTVQAGRSNFNLATLPKEDFPVMASSEYASNFSAPAP-VLRRLFDKSKFAISTEETRY-YLNGVYLHVSDADGGKVLRCVATDGHRLARIDADLPDGASDMPGVIVPRKTVGELRKLLEDDDMKIAVSVSETKIRFATPDITLTSKVIDGTFPDYTRVIPQGNTRRMEVDAAEFAQAVDR-VATVSSERSRAVKLSLDEDRLILSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDTTAVYVVMPMR 371
>gi|62185060|ref|YP_219845.1| DNA polymerase III subunit beta [Chlamydophila abortus S26/3] >gi|62148127|emb|CAH63884.1| DNA polymerase III, beta chain [Chlamydophila abortus S26/3] (366 aa)
Score = 247, Expect = 3.0e-19, Identities = 83/371 (22%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +VS+ +L N ++   S+       PV    LIE  ++E+ FT ++  +ST  +      A + E G I I +K FF ++ +L    + +      + K+ + +    +  M +E +P +    N   + ++     K+ + +  +AV+  + +  +++G+     +   T  ++ TDG +LA    E S  + F    ++ +  +E ++++   D+   IFL ++ I  +  NT++ +K++ G++P+ S +I+T     +++ ++ L+  L++ +A+ ++E    VK  F+   L ++ + + +G  K +++      E   I+ N  F L +LK   ++ + +  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHMLIETCNDELVFTATDLTVSTRCVA----QAKVYESGAISIPSKRFFQLVKELTEANLEISATTGEMAKITSGSSCFRLLSMGKEDFPMLPDIQNSV-RFTLPAEQLKEMLQRTSFAVSREESRY-VLTGVLLTIANGTAT--VVGTDGKRLAKTDIEVSLDKSFTGDYIIPIKAVEEIIKLCSEDSEASIFLDQAKIAVECGNTLLITKLLSGEFPDFSPVISTESSVLLDLHREELITLLKQ-VALFTNESSHSVKFTFTPGELTLTANCTKVGEGKVSMAVNYS-GELLEIAFNPFFFLDILKHSKDELVRLGISDSYNPGIITDSTRSLF--VIMPMR 362
>gi|163940409|ref|YP_001645293.1| DNA polymerase III subunit beta [Bacillus weihenstephanensis KBAB4] >gi|163862606|gb|ABY43665.1| DNA polymerase III, beta subunit [Bacillus weihenstephanensis KBAB4] (376 aa)
Score = 247, Expect = 3.2e-19, Identities = 92/371 (24%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKS-ED---ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+  +   AL   +         P+  G  I  + + I    SN  I     +  S ED     IL+ G I++  K F  II K+ +E I ++ ++  +I +++     N+N +   ++PN+ F  +   ++ +      +   +  +A   N+ +  +++G+ F  +     L   ATD ++LA  +   S+      ++  S I  LL++++ ++N + I+L ES+IIFK S   + S++IEG YPN+S +I    +  +NI +K +++ ++R   ++S    + V L    E  +++S ++S +G   ET        E    IS +  +++  LK    D +T+ F  S +P+L+   +    + ++ P+R
  S:     1 MEFIVNHKQFTQALSEVSKAISTKTLIPILSGIKITADQSGITLIASNSNIFIEKFIPISIEDEQITTILKAGSIVVPAKYFIEIIKKMPSE-ILIKSMNEQLITIQSDEITLNLNGLSANEFPNVPF-LDAHTEIQVETEQLIEVFKQTVFATAKNESR-PVLTGVHF--VIDHNKLICAATDSHRLALREIPISSHAKLNCIVPNSTISELLKLMNSNSNLVYIYLSESHIIFKFSTITLYSRLIEGKYPNISGLIPNESQTIINIDRKKILQGVDRSSLLASEWANNNVNLEIIDECTIQISSNASQIGKISETQQIDAIHGEKQLNISFDGRYMVDTLKAIKEDRVTLSFGGSMRPILIEAGEQSAAVYLISPVR 374
>gi|67459041|ref|YP_246665.1| DNA polymerase III subunit beta [Rickettsia felis URRWXCal2] >gi|75536523|sp|Q4ULS3|DPO3B_RICFE DNA polymerase III subunit beta >gi|67004574|gb|AAY61500.1| DNA polymerase III beta chain [Rickettsia felis URRWXCal2] (379 aa)
Score = 247, Expect = 3.3e-19, Identities = 95/371 (25%), Positives = 191/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L   +S+ E     P +    +   D  ++ +++N  +     +A      ++ +G + + TK    I+ KL +  +TL  +  + +++K      N+  +    +P ++ S N      IS   F K I   K++++ ++ + N ++G+  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    + + +IEI L  + I F  + NTI+ SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   VKL+ S E LE+S      GN+KE ++             +E   I  N  +L  +LK   +D + + FSD   PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIA----VQVVSEGELTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPPMD-SINPEASFKISCTDFAKIIESTKFSISLDETRYN-LNGVYLHI--KDKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLSSNKIKFICNENTIMLSKLIDGTFPDYSAFIPESSSSKLVINRKIFADSIER-IAIITVEKFRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKAVKSDLVELYFSDVSAPVLIKFPENPKDIFVVMPVK 378
>gi|15604794|ref|NP_219578.1| DNA polymerase III subunit beta [Chlamydia trachomatis D/UW-3/CX] >gi|166154296|ref|YP_001654414.1| DNA polymerase III subunit beta [Chlamydia trachomatis 434/Bu] >gi|166155171|ref|YP_001653426.1| DNA polymerase III subunit beta [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|14194661|sp|O84078|DPO3B_CHLTR DNA polymerase III subunit beta >gi|3328470|gb|AAC67666.1| DNA Pol III (beta chain) [Chlamydia trachomatis D/UW-3/CX] >gi|165930284|emb|CAP03770.1| DNA polymerase III, beta chain [Chlamydia trachomatis 434/Bu] >gi|165931159|emb|CAP06724.1| DNA polymerase III, beta chain [Chlamydia trachomatis L2b/UCH-1/proctitis] (416 aa)
Score = 247, Expect = 3.5e-19, Identities = 82/371 (22%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK ++S+ +L N ++   ++       PV    LIE  ++E+ FT ++  +ST  +V     A + E G + I ++ FF +I +L    I +      +  + + +    +  M +E +P +    N   + ++     K    +  +AV+  + +  +++G+  +   +  T+ ++ TDG +LA    E     S   D+  ++ +  +E ++ +   D    IFL ++ I  +  NT++ +K++ G++P+ S +I+T    ++++ ++ L+  L++ +A+ ++E    VK +FS   L ++ + + +G  K +++      E   I+ N  F L +LK   ++ + +  SDS+ P ++ D     F  +++P+R
  S:    51 MKFVISRNELGNLIKKVQNVVPQSTPIPVLTHVLIESCNDELVFTATDLTVSTRCVV----KAKVYESGSVTIPSRRFFQLIRELTEANIEVAAHSGEMATITSGSSCFRLLSMGKEDFPMLPDMQNAL-RFTLDSERLKDMFQRTSFAVSREESRY-VLTGVLLSI--ANGTMTVVGTDGKRLAKIDTEISLDPSFSGDY--IIPIKAVEEIIRMSSEDVQSTIFLDQTKIAVECGNTLLVTKLLSGEFPDFSPVISTHSSVQLDLHREELISLLKQ-VALFTNESSHSVKFSFSPGELTLTANCTKVGEGKVSMAVN-YTGETLEIAFNPFFFLDILKHSRDELVQLGISDSYNPGIITDSTRSLF--VIMPMR 412
>gi|15612565|ref|NP_240868.1| DNA polymerase III subunit beta [Bacillus halodurans C-125] >gi|13959350|sp|Q9RCA1|DPO3B_BACHD DNA polymerase III subunit beta >gi|5672648|dbj|BAA82686.1| 58%-identity [Bacillus halodurans] >gi|10172614|dbj|BAB03721.1| DNA polymerase III (beta subunit) [Bacillus halodurans C-125] (380 aa)
Score = 247, Expect = 3.5e-19, Identities = 83/344 (24%), Positives = 165/344 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSE----DANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD-----FRIVLDVSLIELLLEIIDFDTNI-EIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL-NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+  G  I  +   +  T S+  IS  + +   E    +  + ++G I+++ K F  I+ KL  + I +   D+ V  +++ +   N+N +D ++YP +     D +   +   + K  I +  +AV+  +E   +++G+ F     +  L   ATD ++LA  K      D       +V+    +  L +I+D +  + +I + E+  +FK+ N +  S+++EG YP    +I    +    +  K  ++ LER L +S   K  ++ L      V+EV+  + ++G   E V+ +G   E   IS N   ++  LK  D+++I + F+ +  P +L        L +  P+R
  S:    28 PILTGIKIVADHEGVTLTGSDSDISIETFIPLEEGDRQNVEVKQEGSIVLQAKVFAEIVKKLPEQEIEIHVQDSFVTTIRSGSSVFNLNGLDPDEYPRLPVLEED-HVFRLPQKILKDIIRQTVFAVST-QETRPVLTGVNFEI--EDGILTCTATDSHRLAMRKVPVEKNDDELQFSNVVIPGKSLNELSKILDENEELLDIVVTENQTLFKLKNMLFFSRLLEGKYPVTKNMIPKEAKTSFAVHTKAFLQTLERALLLSREGKNQVINLKTLGDGVVEVTAITPEIGKVTENVATQGLEGEELRISFNGKNVIDALKVVDSESIHIAFTGAMSPFVLSPTDHDQSLHLFSPVR 378
>gi|150387855|ref|YP_001317904.1| DNA polymerase III subunit beta [Alkaliphilus metalliredigens QYMF] >gi|149947717|gb|ABR46245.1| DNA polymerase III, beta subunit [Alkaliphilus metalliredigens QYMF] (368 aa)
Score = 247, Expect = 3.5e-19, Identities = 79/371 (21%), Positives = 192/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTN--IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M    S+  L++++ +         + P+  G  IE N+  ++   ++  I    ++    +A++L++G +++  + F  II KL +  + +   +N+ +++K ++ + NI +   +++P +     D     I+  +FK  I +  +A + ++ +  I++G+       E TL ++A DGY+LA  K + S   + ++V+    +  +  I++ D    + I L  ++ +F    T + S+++EG++ N  +I+     +KV I  K ++ ++ER   ++   + ++V+   + E + ++ S+S+LG   E ++   +  E   I+ N+ + +  LK  D++ + +EF+ +  P +L+   + N+  +++P+R
  S:     1 MHFSCSQKALMHSISIVQKGVSAKTTLPILKGIYIETNNEGLRLVGTDLEIGIEHVM----EADVLQEGIVVVDARLFSEIIRKLPDAEVDITLKENNQLEIKCASTEFNILVYSPDEFPELPIVEED-QVYEIAQELFKGMIRQTVFATSQDESR-PILTGVLMEI--EENTLNMVALDGYRLALRKGKISGNSNHKVVVPAKTLNEVNRILNPDEEEPLHITLTNNHALFTAGKTKLISRLLEGEFINYKQILPKEHRSKVTIKGKEILNSIERASLLAKEGRNNLVRFVVNDEKMVIT-SNSELGKVHEEINIVLE-GEDIEIAFNSKYFIDALKVIDDEEVCLEFTTNLSPGILKPLANENYTYLVLPVR 364
>gi|76788788|ref|YP_327874.1| DNA polymerase III subunit beta [Chlamydia trachomatis A/HAR-13] >gi|76167318|gb|AAX50326.1| DNA polymerase III, beta chain [Chlamydia trachomatis A/HAR-13] (416 aa)
Score = 247, Expect = 3.6e-19, Identities = 82/371 (22%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK ++S+ +L N ++   ++       PV    LIE  ++E+ FT ++  +ST  +V     A + E G + I ++ FF +I +L    I +      +  + + +    +  M +E +P +    N   + ++     K    +  +AV+  + +  +++G+  +   +  T+ ++ TDG +LA    E     S   D+  ++ +  +E ++ +   D    IFL ++ I  +  NT++ +K++ G++P+ S +I+T    ++++ ++ L+  L++ +A+ ++E    VK +FS   L ++ + + +G  K +++      E   I+ N  F L +LK   ++ + +  SDS+ P ++ D     F  +++P+R
  S:    51 MKFVISRNELGNLIKKVQNVVPQSTPIPVLTHVLIESCNDELVFTATDLTVSTRCVV----KAKVYESGSVTIPSRRFFQLIRELTEANIEVAAHSGEMATITSGSSCFRLLSMGKEDFPMLPDMQNAL-RFTLDSERLKDMFQRTSFAVSREESRY-VLTGVLLSI--ANGTMTVVGTDGKRLAKIDTEISLDPSFSGDY--IIPIKAVEEIIRMSSEDVQSTIFLDQTKIAVECGNTLLVTKLLSGEFPDFSPVISTHSSVQLDLHREELISLLKQ-VALFTNESSHSVKFSFSPGELTLTANCTKVGEGKVSMAVN-YTGETLEIAFNPFFFLDILKHSRDELVQLGISDSYNPGIITDSTRSLF--VIMPMR 412
>gi|157828455|ref|YP_001494697.1| DNA polymerase III subunit beta [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933170|ref|YP_001649959.1| DNA polymerase III subunit beta [Rickettsia rickettsii str. Iowa] >gi|157800936|gb|ABV76189.1| DNA polymerase III subunit beta [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908257|gb|ABY72553.1| DNA polymerase III, beta chain [Rickettsia rickettsii str. Iowa] (379 aa)
Score = 246, Expect = 4.0e-19, Identities = 95/371 (25%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L   +S+ E     P +    +   D  ++ +++N  +     +A      ++ +G   + TK    I+ KL +  +TL  +  + +++K      N+  +    +P ++ S N      IS   F K I   K++++ ++ + N ++G+  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    + + +IEI L  + I F  + NTI+ SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   VKL+ S E LE+S      GN+KE ++             +E   I  N  +L  +LK   +D + + FSD   PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAQDGNLELSSTNMDLYLSQKIA----VQVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMD-SINPEASFKISCTDFAKIIESTKFSISLDETRYN-LNGVYLHI--KDKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLNSNKIKFICNENTIMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIER-IAIITVEKFRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKAVKSDLVELYFSDVSAPVLIKFPENPKDIFVVMPVK 378
>gi|116617176|ref|YP_817547.1| DNA polymerase III, beta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096023|gb|ABJ61174.1| DNA polymerase III, beta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (378 aa)
Score = 246, Expect = 4.3e-19, Identities = 88/371 (23%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSS---PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN---ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL--RDEKDPNFLQILVPIR 377
           M+  ++++  I AL   N +S  I S    P+     + +ND E+  T SN  IS  + V +S+ +    I   G I +    F  I+ +L N+ +TL  ++     + +      IN  D + YP +    +D   LS+S       IS+ K + +  +E   I++GI      +  +++ + TD ++L+    + T  D       +++       L  +++    +EI    +  +F + +T   S+++EG+YP   R+I T    ++ I   +L+ A++R   +S   + ++V+L+  +    ++ +S ++G   E ++      E   IS N  ++   L+ F+   + V+F+ + +P  L    E D   LQ++ P+R
  S:     1 MQFTINRSAFIKAL---NDVSRAISSRTTIPILTNIKLVLNDEELVLTGSNADISIETTVPQSDTSAQLIITTPGGITLPATFFINIVKRLPNDAMTL-NIEGLRATITSGASSFTINGQDVQNYPQLP-EMDDVQSLSVSAAQLVDIISQTKISAST-QESRPILTGIHLQLTGN--SVKAVTTDSHRLSQRIVQLTGTDANNVDANVIIPAKSFNELQALLEGQDRVEIKFSTNQAVFDLGHTTFYSRLLEGNYPETDRLIPTESTTQITIEASSLLGAIDRASLLSHESRNNVVQLSLKAGRAVLTGTSQEVGQVTEELNANSIEGEDLEISFNPDYVRDALRIFNGKRVDVKFTSNLRPFTLTPEGETDNKQLQLITPVR 376
>gi|71083116|ref|YP_265835.1| DNA polymerase III [Candidatus Pelagibacter ubique HTCC1062] >gi|71062229|gb|AAZ21232.1| DNA polymerase III [Candidatus Pelagibacter ubique HTCC1062] (296 aa)
Score = 246, Expect = 4.4e-19, Identities = 84/293 (28%), Positives = 170/293 (58%)
  Q:    85 FAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT--LEIIATDGYKLAHYKFESTPQ-DFR-IVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           + II K  + + I L   D S ++V++     N+N +   ++P  + ++N  N+ SI      K ++K K++V+N++ + + +SGI F+   +E    L   ATD ++++  K     Q DF  I+L    I  L  +++ +D +++I   +S I F+++N+I+ SK+I+G +PN  ++I    + K+ I  K  +++++R +A  S +KK  VK N S +VL +S ++++ G+ KE+++   K +    IS N+ +L+ +    D D I + F+D+  P L++D  D + + +++P++
  S:     2 YDIIRKFSSGKKINLSLTDVSKLQVESEKSVFNLNCISASEFPLTDENFNQ-NEFSIKSKQLLKLLNKCKFSVSNDETR-HYLSGIFFHQTQTEDKNFLTAAATDSHRMSISKIRLDQQVDFEPIILPKKTIFQLCSLLESYDGDVKISNIKSKIKFELNNSILISKLIDGKFPNYIQVIPKNNQKKLEIDLKLFLDSVDR-VASVSLDKKDGVKFNLSKDVLNLSVNNTNSGDGKESLTV--KFDHDLEISFNSRYLIDVASQLDGDKIEIFFNDTGSPALIKDPGDFDSIFVVMPMK 295
>gi|15834966|ref|NP_296725.1| DNA polymerase III subunit beta [Chlamydia muridarum Nigg] >gi|14194691|sp|Q9PKW4|DPO3B_CHLMU DNA polymerase III subunit beta >gi|7190388|gb|AAF39208.1| DNA polymerase III, beta subunit [Chlamydia muridarum Nigg] (366 aa)
Score = 246, Expect = 4.4e-19, Identities = 83/371 (22%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK ++S+ +L N ++   ++       PV    LIE  ++E+ FT ++  +ST  +V     A + E G + I ++ FF +I +L    I +      +  + + +    +  M +E +P +    N   + ++     K    +  +AV+  + +  +++G+  +   S  T+ ++ TDG +LA          S   D+  ++ +  +E ++ +   D    IFL ++ I  +  NT++ +K++ G++P+ S +I+T    ++N+ ++ L+  L++ +A+ ++E    VK +FS   L ++ + + +G  K +++      E   I+ N  F L +LK   ++ + +  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVISRNELGNLIKKVQNVVPQSTPIPVLTHVLIESCNDELVFTATDLTVSTRCVV----KAKVYESGSVTIPSRRFFQLIRELTEANIEVAANSGEMATITSGSSCFRLLSMGKEDFPMLPDMQNAL-RFTLDSEQLKDMFQRTSFAVSREESRY-VLTGVLLSI--SNGTMTVVGTDGKRLAKIDTNISLDPSFSGDY--IIPIKAVEEIIRMASEDVQSTIFLDQTKIAVECGNTLLVTKLLSGEFPDFSPVISTQSSVQLNLHREELISLLKQ-VALFTNESSHSVKFSFSPGELTLTANCTKVGEGKVSMAVN-YTGETLEIAFNPFFFLDILKHSRDELVQLGISDSYNPGIITDSTRSLF--VIMPMR 362
>gi|58617550|ref|YP_196749.1| DNA polymerase III, beta chain [Ehrlichia ruminantium str. Gardel] >gi|58417162|emb|CAI28275.1| DNA polymerase III, beta chain [Ehrlichia ruminantium str. Gardel] (375 aa)
Score = 246, Expect = 4.6e-19, Identities = 101/371 (27%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +   V K KL+ AL   NSI E   S  V     IE  D +I  T+++  IS    +  S  AN+L  G I++  +  + I+ KL N+  I      +  + ++ S  + ++ I+D E++P I N    D   L +S +V      K K+A++  + + N ++G+  ++  S   L   ATDG++L+  K    E    DF I++    +  +L+II    +   I I L    I F+    I+ SK+I+G +P+ + II    +  V I  + L  A++R +++   +K  ++KL F+   L +S +SSD G+++E +           I LN  +L+  L         + F D+   +L++++ + + + I++P+R
  S:     7 LNFCVGKDKLLQALSYINSIVEKRHSIVVLSCVRIEAQDKKISLTSTDLDIS----IVASISANVLVDGVIVVSAQLLYDIVRKLPNDFEIKFTIGKDGRLTIECSRTEFSLPIVDIEKFPVIENNELQDKFTLQVSELV--NLFGKTKFAISAEESRFN-LNGVYVHT--SNGALCCAATDGHRLSLAKLSKVEDIVSDFGIIVPKKTVNEILKIISHGNSSDPISISLSNRKICFEYKEYILISKVIDGIFPDYNSIIPKSHDKNVLIDSEVLSNAIDR-VSVVVFDKVKVIKLKFTDNKLILSAASSDQGDAREELEIDTYSTSEITIGLNARYLMEALYCIKG-KCHLSFYDANTAILIQEQDNDDAMYIIMPMR 374
>gi|154243960|ref|YP_001414918.1| DNA polymerase III subunit beta [Xanthobacter autotrophicus Py2] >gi|154158045|gb|ABS65261.1| DNA polymerase III, beta subunit [Xanthobacter autotrophicus Py2] (373 aa)
Score = 246, Expect = 4.9e-19, Identities = 85/371 (22%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNI---NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFN---SISSEKTLEIIATDGYKLAHYKFEST------PQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    LI+   N ++   ++  +     V +S  A   + G   +     + I+ KL +   + LE   +   + VK S    ++  + E  +P++    FS+       +    F++ + K ++A++  + +   ++GI  +       +  L  +ATDG++LA  + E+       P        V+ I+ LLE  D +    + L  + I  +V + ++ SK+I+G +P+  R+I    +  + + K     A++R ++  SSE+   VKL+ +   + +S ++ D G++ E +       EP  I  N+ +LL +    + D   ++ +D   P L+RD    + L +L+P+R
  S:     1 MKVTVERAELLKSLSHVHRVVERRNTIPILANVLIKAGKNGLELKATDLDLE----VVESVPAETGQAGATTVPAHVLYDIVRKLPEGAQVQLEAGGERGTLTVKASRARFSLQTLPEADFPDLAAGEFSHT----FKVKGADFRRLVDKTQFAISTEETRY-YLNGIYLHVTEGAGGKSMLRAVATDGHRLAQAELEAPAGAAGLPGVIVPRKTVAEIQKLLE--DKEAEATVSLSTTKIRVQVGSIVLTSKLIDGTFPDYGRVIPQGNDKTLIVDKDEFAAAVDR-VSTVSSERGRAVKLSLAEGKMTLSVTNPDSGSATEELEVD-YTAEPLDIGFNSRYLLDITSQLEGDTAELKLADPGSPTLVRDSTKTDALYVLMPMR 372
>gi|15618258|ref|NP_224543.1| DNA polymerase III subunit beta [Chlamydophila pneumoniae CWL029] >gi|4376617|gb|AAD18487.1| DNA Polymerase III (beta chain) [Chlamydophila pneumoniae CWL029] (366 aa)
Score = 245, Expect = 5.3e-19, Identities = 85/371 (22%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDF--RIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +VS+ +L N ++   S+       PV    LIE  ++E+ FT ++  +ST  +      A + EKG I I +K FF ++ +L    + +      + ++ + +    +  M++E +P +    N   + S+     K  + +  +AV+  + +  +++G+     +   T  I+ TDG +LA    E T  + F    ++ +  +E ++++   +    IFL +  I  +  NT++ +K++ G++P+ S +I+T    K+++ ++ L+  L++ +A+ ++E    VK +F    L ++ + + +G  K +++      E   I+ N  F L +LK   ++ +++  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFTATDLTVSTRCVT----KAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITSGSSCFRLLSMEKEDFPMLPDIQNAL-RFSLPAEQLKTMLQRTSFAVSREESRY-VLTGVLLAIANGVAT--IVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEAAIFLDQDKIAVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQ-VALFTNESSHSVKFSFLPGELTLTANCTKVGEGKVSMAVNYS-GELLEIAFNPFFFLDILKHSKDELVSLGISDSYNPGIITDSASGLF--VIMPMR 362
>gi|56551876|ref|YP_162715.1| DNA polymerase III subunit beta [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543450|gb|AAV89604.1| DNA polymerase III beta subunit [Zymomonas mobilis subsp. mobilis ZM4] (369 aa)
Score = 245, Expect = 5.4e-19, Identities = 91/371 (24%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSI-----VAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ +L    S+ E   + P+    LIE          SNG +   +      V ++  A +   G   +     F I+ KL +   I L   D  ++ V   +  S +  +  + +P I+ S       ++     K+ I K ++A++ ++ +   ++GI  + +  E  ++  ATDG++LA     + P     + DV      ++EL   + + +  I+I L  S I F + + I+ SK+I+G +P+ SR+I T  +  + +  K L++ ++R +A  +SEK   VK++  +  + +S +S + G + E V  +    +P  I  N  +LL +L   ++D   +  +++  P L+RD      L +L+P+R
  S:     1 MKATIERATLLKSLSHVQSVVERRNTIPILSNVLIE--------AASNGCVKLMATDLDLQVVETLSAEVDTPGETTVSAHMLFEIVRKLPDGSQIQLSAADGKMLIVAGRSRFS-LATLPRDDFPVISESELP-THFALPTESLKQIIDKTRFAISVDETRY-YLNGIFLHVLKDENVMKAAATDGHRLACVTIPA-PAGAEDMPDVIIPRKCVVELRKLLDECEDEIKISLSASKICFDLGHAILTSKLIDGTFPDYSRVIPTANDKLLKVKPKDLMQGVDR-VATIASEKTRAVKMSIEAGKISLSVTSPENGMATEEVLGEYDA-DPLDIGFNARYLLDILGQIESDQAEIHLAEAAAPTLIRDSDQSAALYVLMPMR 368
>gi|33239453|ref|NP_874395.1| DNA polymerase III subunit beta [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33236978|gb|AAP99047.1| DNA polymerase III beta subunit [Prochlorococcus marinus subsp. marinus str. CCMP1375] (385 aa)
Score = 244, Expect = 6.6e-19, Identities = 100/371 (26%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGI--CFNSISSEKTLEIIATDGYKLAHYKF------ESTPQ--DFRIVLDVSL-------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK++ S+ +L  AL+L +       S PV    L+  +    K + +      +  +  S  A+I   G I + +K F  IISKL +E  ITL   D+S  + +K+ + +  +  M  + +P++    N    L ++   F  S+    +A + ++ K  I++G+  CF       +L+  ATDG++LA          E+ P+  +    L+V+L       +E  L     D+ I  F  +   +F  S  II ++ ++G+YPN +++I     N++ + KK  + ALER +A+ + +  ++VK++ + E  +L +S  + DLG+  E++  K   +E   I+ N+ +LL  LK  + + I ++F+    P +     + NF+ +++P++
  S:     1 MKLVCSQIELNTALQLVSRAVATRPSHPVLANVLLTADAGTGKLSLTG--FDLNLGIQTSLSASIESSGAITVPSKLFGEIISKLSSESSITLSTDDSSEQVNLKSKSGNYQVRAMSADDFPDLPMVENG-AFLKVNANSFAVSLKSTLFASSTDEAK-QILTGVNLCFEG----NSLKSAATDGHRLAVLDLQNVIASETNPEINNLSEKLEVTLPSRSLRELERFLSGCKSDSEISCFYDQGQFVFISSGQIITTRTLDGNYPNYNQLIPDQFSNQLVLDKKYFIAALER-IAVLAEQHNNVVKISTNKELQILNISADAQDLGSGSESIPIKYD-SEDIQIAFNSRYLLEGLKIIETNTILLKFNAPTTPAIFTPNDETNFVYLVMPVQ 382
>gi|15835873|ref|NP_300397.1| DNA polymerase III subunit beta [Chlamydophila pneumoniae J138] >gi|33241682|ref|NP_876623.1| DNA polymerase III subunit beta [Chlamydophila pneumoniae TW-183] >gi|14194707|sp|Q9Z8K0|DPO3B_CHLPN DNA polymerase III subunit beta >gi|8978712|dbj|BAA98548.1| DNA polymerase III (beta chain) [Chlamydophila pneumoniae J138] >gi|33236191|gb|AAP98280.1| DNA-directed DNA polymerase III beta chain [Chlamydophila pneumoniae TW-183] (366 aa)
Score = 244, Expect = 7.1e-19, Identities = 85/371 (22%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDF--RIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +VS+ +L N ++   S+       PV    LIE  ++E+ FT ++  +ST  +      A + EKG I I +K FF ++ +L    + +      + ++ + +    +  M++E +P +    N   + S+     K  + +  +AV+  + +  +++G+     +   T  I+ TDG +LA    E T  + F    ++ +  +E ++++   +    IFL +  I  +  NT++ +K++ G++P+ S +I+T    K+++ ++ L+  L++ +A+ ++E    VK +F    L ++ + + +G  K +++      E   I+ N  F L +LK   ++ +++  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFTATDLTVSTRCVT----KAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITSGSSCFRLLSMEKEDFPMLPDIQNAL-RFSLPAEQLKTMLQRTSFAVSREESRY-VLTGVLLAIANGVAT--IVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEATIFLDQDKIAVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQ-VALFTNESSHSVKFSFLPGELTLTANCTKVGEGKVSMAVNYS-GELLEIAFNPFFFLDILKHSKDELVSLGISDSYNPGIITDSASGLF--VIMPMR 362
>gi|114704370|ref|ZP_01437278.1| DNA polymerase III subunit beta [Fulvimarina pelagi HTCC2506] >gi|114539155|gb|EAU42275.1| DNA polymerase III subunit beta [Fulvimarina pelagi HTCC2506] (374 aa)
Score = 244, Expect = 7.8e-19, Identities = 83/371 (22%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+II+ ++ L+ +L   + + E   + P+    L+      +    ++  I  T  + A+ E     ++G   +     + I+ KL +  E+  +   + + + V     +  +  + E  +P+I       +  ++      + I + ++A++  + +   ++GI  ++I ++ TL +  +ATDG++LA  +       E  P        V  I+ LL   + D  I + L ES I FK+   ++ SK+I+G +P+  R+I    + ++ + + +   A++R ++  SSE+   VKL  +   L ++ +S D G + E ++  G  +E   I  N  +LL +      +      +D   P L++D  D + L +L+P+R
  S:     1 MRIIIERSNLLKSLAHVHRVVERRNTIPILSNVLLRAKAETLGLKATDLDIEITEEVAAQGE-----QEGATTVPAHLLYDIVRKLPDGAEVKLVLNSEGTQMTVSAGRSNFRLQCLPETDFPDITAGELS-HGFTMEAGALARLIERTQFAISTEETRY-YLNGIYLHTIDADGTLMLRAVATDGHRLARAEMTAPSGSEGMPGIIVPRKTVGEIQKLLADCEDDDEIAVDLSESKIRFKIGRVVMTSKLIDGTFPDYQRVIPQNNDKELTLDRASFSSAVDR-VSTISSERGRAVKLTLADSQLTLTVNSPDAGTATEELAV-GYESEDLEIGFNARYLLDVTSQLSGEEAMFVLADPGSPTLIKDGGDTSTLYVLMPMR 373
>gi|16752700|ref|NP_444967.1| DNA polymerase III subunit beta [Chlamydophila pneumoniae AR39] >gi|7189343|gb|AAF38262.1| DNA polymerase III, beta subunit [Chlamydophila pneumoniae AR39] (366 aa)
Score = 244, Expect = 7.9e-19, Identities = 85/371 (22%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDF--RIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +VS+ +L N ++   S+       PV    LIE  ++E+ FT ++  +ST  +      A + EKG I I +K FF ++ +L    + +      + ++ + +    +  M++E +P +    N   + S+     K  + +  +AV+  + +  +++G+     +   T  I+ TDG +LA    E T  + F    ++ +  +E ++++   +    IFL +  I  +  NT++ +K++ G++P+ S +I+T    K+++ ++ L+  L++ +A+ ++E    VK +F    L ++ + + +G  K +++      E   I+ N  F L +LK   ++ +++  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFTATDLTVSTRCVT----KAKVYEKGAISIPSKRFFQLVKELTEANLEISYSAGEMAQITSGSSCFRLLSMEKEDFPMLPDIQNAL-RFSLPAEQLKTMLQRTSFAVSREESRY-VLTGVLLAIANGVAT--IVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEATIFLDQDKIAVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQ-VALFTNESSHSVKFSFLPGELTLTANCTKVGEGKVSMAVNYS-GELLEIAFNPFFFLDILKHSKDELVSLGISDSYNPGIITDSASGLF--VIMPMR 362
>gi|57239515|ref|YP_180651.1| DNA polymerase III, beta chain [Ehrlichia ruminantium str. Welgevonden] >gi|58579497|ref|YP_197709.1| DNA polymerase III, beta chain [Ehrlichia ruminantium str. Welgevonden] >gi|57161594|emb|CAH58522.1| DNA polymerase III, beta subunit [Ehrlichia ruminantium str. Welgevonden] >gi|58418123|emb|CAI27327.1| DNA polymerase III, beta chain [Ehrlichia ruminantium str. Welgevonden] (375 aa)
Score = 244, Expect = 8.3e-19, Identities = 100/371 (26%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFS-YNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +   V K KL+ AL   NSI E   S  V     IE  D +I  T+++  IS    +  S  AN+L  G I++  +  + I+ KL N+  I      +  + ++ S  + ++ I+D E++P I  +   D   L +S +V      K K+A++  + + N ++G+  ++  S   L   ATDG++L+  K    E    DF I++    +  +L+II    +   I I L    I F+    I+ SK+I+G +P+ + II    +  V I  + L  A++R +++   +K  ++KL F+   L +S +SSD G+++E +           I LN  +L+  L         + F D+   +L++++ + + + I++P+R
  S:     7 LNFCVGKDKLLQALSYINSIVEKRHSIVVLSCVRIEAQDKKISLTSTDLDIS----IVASISANVLVDGVIVVSAQLLYDIVRKLPNDFEIKFTIGKDGRLTIECSRTEFSLPIVDIEKFPVIEHNELQDKFTLQVSELV--NLFGKTKFAISAEESRFN-LNGVYVHT--SNGALCCAATDGHRLSLAKLSKVEDIVSDFGIIVPKKTVNEILKIISHGNSSDPISISLSNRKICFEYKEYILISKVIDGIFPDYNSIIPKSHDKNVLIDSEVLSNAIDR-VSVVVFDKVKVIKLKFTDNKLILSAASSDQGDAREELEIDTYSTSEITIGLNARYLMEALYCIKG-KCHLSFYDANTAILIQEQDNDDAMYIIMPMR 374
>gi|49473789|ref|YP_031831.1| DNA polymerase III subunit beta [Bartonella quintana str. Toulouse] >gi|49239292|emb|CAF25618.1| DNA polymerase III, beta chain [Bartonella quintana str. Toulouse] (373 aa)
Score = 243, Expect = 9.4e-19, Identities = 86/371 (23%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVD---NSVIKVKTSTFDSNINIMDEEQYPNI---NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK-TLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEII--DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M + V + +L+ +L   + + E   + P+    LI+ + N ++   ++  +     V +S  AN+ + G I +     + I+ KL +    +  VD    S + V +      +  + +  +P      F Y    + S+S    K  +   ++A++  + +   ++GI F+ +      L ++ATDG++LA    E+ P   +    I++    +  L +++  + + N+ + L E+ I F V + +  SK+I+G +P   R+I    + K+ ++K+    A++R   ISS   ++ VKL      L++   + D G++++ ++     ++P  I  N+ +LL +      D +    +++  P L+RD  D N L +L+PIR
  S:     1 MHVTVDRNQLLKSLGRVHRVVERRNTVPILSNVLIDADKNGVQLKATDLDLE----VTESFMANVKQAGAITVPAHLLYDIVRKLLDGSEIVLSVDMNQASTMSVVSGCAHFQLQCLPKVDFPESLPGQFGY----RFSLSASSLKHLLDCTQFAISTEETRY-YLNGIYFHVVDDGVLKLRLVATDGHRLAQVDMEA-PSGVKDMPGIIIPRKAVGELQKLLSEEINDNVCVELSETKIRFSVGSVVFTSKLIDGTFPEYQRVIPLGNDKKLIVNKQNFSSAVDRVSTISSDRGRA-VKLTIEQGQLKLVVHNPDSGSAEDQLAAT-YTSDPLEIGFNSRYLLDIAGQLSGDEMVFMLAEAGAPALIRDNDDANALYVLMPIR 372
>gi|84501259|ref|ZP_00999464.1| DNA polymerase III subunit beta [Oceanicola batsensis HTCC2597] >gi|84390550|gb|EAQ03038.1| DNA polymerase III subunit beta [Oceanicola batsensis HTCC2597] (372 aa)
Score = 243, Expect = 9.6e-19, Identities = 88/371 (23%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ A+    S+ E   + P+    LIE   NE++F  ++  I     V     A +   G   +       I+ KL +   +TL + D +  ++  +   SN N+  + +E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +    E  + L  +ATDG++LA     + P+        IV   ++ EL   + D +  + + + E+ + F      + SK+I+G +P+ +R+I      K+ +      +A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ +  P L+R+  D + + +++P+R
  S:     1 MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGNEVQFRATDLDIE----VVDKAPAMVERAGATTVSAVTLHEIVRKLPDGAQVTLSE-DGAAGRLTVAAGRSNFNLATLPKEDFPVMASSEYQSNFSAPAP-VLRRLFDKSKFAISTEETRY-YLNGVYMHVAEGEDGRMLRCVATDGHRLARID-ATLPEGAADMPGVIVPRKTVGELRKLLDDDELQVAVSVSETKVRFATPEITLTSKVIDGTFPDYTRVIPQGNTRKMEVDASDFAKAVDR-VATVSSERSRAVKLALDEDRLVLSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFLFNSAGDPTLMREGSDTSAVYVVMPMR 371
>gi|110677617|ref|YP_680624.1| DNA polymerase III subunit beta [Roseobacter denitrificans OCh 114] >gi|109453733|gb|ABG29938.1| DNA polymerase III, beta subunit [Roseobacter denitrificans OCh 114] (372 aa)
Score = 243, Expect = 9.8e-19, Identities = 83/371 (22%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFD-TNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE   +++ F  ++  I     V     A +   G   +       I+ KL +  +     D+++ ++      SN ++  + +E +P +  S    N  S+   V ++   K K+A++  + +   ++G+  +   ++    L  +ATDG++LA       E+      +++    +  L +++D D   I + + E+ + F   +  + SK+I+G +P+ +R+I      K+ +       A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDVTFRATDLDIE----VVDKAPAQVERAGATTVSATTLHEIVRKLPDGALVTLTADSAIGRLTVEAGRSNFSLATLPKEDFPVMATSEYQSN-FSVKAPVLRRLFDKSKFAISTEETRY-YLNGVYMHVADADGGHVLRCVATDGHRLARIDADLPEAANDMPGVIVPRKTVGELRKLLDNDEMTIAVSVSETKVRFATPDITLTSKVIDGTFPDYTRVIPQGNTRKLEVDAADFARAVDR-VATVSSERSRAVKLQLDEDRLVLSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDLSAVYVVMPMR 371
>gi|83855143|ref|ZP_00948673.1| DNA polymerase III subunit beta [Sulfitobacter sp. NAS-14.1] >gi|83941666|ref|ZP_00954128.1| DNA polymerase III subunit beta [Sulfitobacter sp. EE-36] >gi|83842986|gb|EAP82153.1| DNA polymerase III subunit beta [Sulfitobacter sp. NAS-14.1] >gi|83847486|gb|EAP85361.1| DNA polymerase III subunit beta [Sulfitobacter sp. EE-36] (372 aa)
Score = 242, Expect = 1.2e-18, Identities = 89/371 (23%), Positives = 171/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ A+    S+ E   + P+    LIE   ++  F  ++  I     V     A +   G   +       I+ KL +  +     D++  ++      SN ++  +  E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +   SE  K L  +ATDG++LA       P+        IV   ++ EL   + D D  I + + E+ I F   +  + SK+I+G +P+ +R+I      K+ +       A++R +A  SSE+   VKL    + L +S ++ D G ++E +      +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKFSIERAALLKAVSQAQSVVERRNTIPILANVLIEAEGSDASFRATDLDIE----VVDKAAAQVERAGATTVSATTLHEIVRKLPDGALISLTADSAAGRLTVEAGRSNFSLATLPREDFPVMATSEYQSNFKAPAP-VLRRLFDKSKFAISTEETRY-YLNGVYMHISDSEGSKVLRCVATDGHRLARID-APMPEGAAEMPGVIVPRKTVGELRKLLDDDDMEIAVSVSETKIRFATPDITLTSKVIDGTFPDYTRVIPQGNTRKMEVDASDFARAVDR-VATVSSERSRAVKLQLDEDRLVLSVNAPDSGAAEEELVV-AYADERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDMSAVYVVMPMR 371
>gi|118445177|ref|YP_879297.1| DNA polymerase III subunit beta [Clostridium novyi NT] >gi|118135633|gb|ABK62677.1| DNA polymerase III, beta subunit [Clostridium novyi NT] (367 aa)
Score = 242, Expect = 1.3e-18, Identities = 89/371 (23%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF--RIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK   +K KL  A+ +           P+  G  +   DNE+    S+  +S  + +    +A + E+G I++ +K F  II KL N  + +   DN+ I++       ++  MD +++P +    N+    SI   V K  I    +A+  ++ +  I++GI F  +  EK L ++A DGY+LA    E   ++    ++   +  E+   + + + N+ I    ++I+F +  T + S+++EG++   + II    + KV   +  L+  +ER   +      ++VK +   + L ++ S+S LG  +E ++   + +E   I+ N+ +L+ +LK  ++D I +EF  S  P +++ +++  +  +++P+R
  S:     1 MKFTCAKNKLQEAISIAQKAVTGKSPMPILQGIHLSAKDNELTLIGSDIDLSIETKI----EAEVEEEGTIVVDSKIFGEIIRKLPNSSVKINTTDNNSIEIFCEKSKFDLIHMDADEFPGLP-RINENMIFSIPEKVLKNMIKGTIFAIAQDETR-PILTGILF-EVRDEK-LNLVALDGYRLALRSNEINNENTISAVIPGKTFSEVSKILSEDEKNVNITFTPNHILFNLGETKVISRLLEGEFIKYNSIIPEEYKLKVTAKRSELLNCIERASLMGKDGNTNLVKFDIKDDNLIIT-SNSQLGKVREELNIILQGDE-LQIAFNSKYLIDVLKILEDDEIIMEFDSSVSPCVIKSKEEKAYTYLVLPVR 363
>gi|89069838|ref|ZP_01157173.1| DNA polymerase III subunit beta [Oceanicola granulosus HTCC2516] >gi|89044639|gb|EAR50755.1| DNA polymerase III subunit beta [Oceanicola granulosus HTCC2516] (372 aa)
Score = 242, Expect = 1.4e-18, Identities = 87/371 (23%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ A+    S+ E   + P+    LIE   + ++F  ++  I     V     A +   G   +       I+ KL +  +     D    +++     SN ++  +  E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +    E  + L  +ATDG++LA     + P+        IV   ++ EL   + D +  I + + E+ I F   +  + SK+I+G +P+ SR+I      ++ +      +A++R +A  SSE+   VKL+   + L +S ++ D GN++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKFSIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGDGVQFRATDLDIE----VVDRAPAQVERAGATTVAAVTLNEIVRKLPDGALVTLAEDGGSGRLQIMAGRSNFSLATLPREDFPVMASSEYATNFTADAP-VLRRLFDKSKFAISTEETRY-YLNGVYMHVAEGEDGRALRCVATDGHRLARID-AALPEGAEEMPGVIVPRKTVGELRKLLDDDEMQIAVSVSETKIRFATPDITLTSKVIDGTFPDYSRVIPANNAKRLEVDASEFAKAVDR-VATVSSERSRAVKLSLDEDRLILSVNAPDSGNAEEELAV-AYGDEKLDIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGDDTSAVYVVMPMR 371
>gi|167036433|ref|YP_001664011.1| DNA polymerase III subunit beta [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038677|ref|YP_001661662.1| DNA polymerase III subunit beta [Thermoanaerobacter sp. X514] >gi|166852917|gb|ABY91326.1| DNA polymerase III, beta subunit [Thermoanaerobacter sp. X514] >gi|166855267|gb|ABY93675.1| DNA polymerase III, beta subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] (370 aa)
Score = 241, Expect = 1.8e-18, Identities = 87/371 (23%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP-------QDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN--SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +  K  L   + +      +  + P+  G  I     ++KF+ ++  I     +     A I E+G I++  K F  ++ KL    + +E    + + V   + +  I   D  ++P I     + N   ++  + K  I K  + +   + +  I++G+ F    +E  ++ +A DG+++A Y ++S         + + IV+    +E +  I+ D +T IEI+   + ++F++ NT + S+++EG + N + ++    + +V + ++ L E++ER   I+ S K +++K     + + VS S+S+ G    K  V  KG   E   I+ N+ +LL  L+  D + IT+ F +S  P++++     ++L +++P++
  S:     1 MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKISALKGQVKFSGTDLDIGIECQIP----AVIEEEGEIVVPAKIFSELVRKLPEGDVKIESDSQNTVNVVCDSINFTIAGSDAVEFPEIPLVSKE-NSFKLTQNILKDLIRKTVFCIAQEQTR-PILTGVLFEVFQTE--VKAVALDGFRMAIYSYQSEEKFFDEDIEKYSIVIPGKTLEEIYRILKDEETEIEIYHTANQVLFQIENTKVISRLLEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIAES-KNNLIKFEIGDKFITVS-SNSEKGKMIEKIEVDVKGMFLE---IAFNSRYLLDSLRAIDEEEITLYFINSINPLIIKPIGSKDYLYMILPVK 368
>gi|56695075|ref|YP_165422.1| DNA polymerase III subunit beta [Silicibacter pomeroyi DSS-3] >gi|56676812|gb|AAV93478.1| DNA polymerase III, beta subunit [Silicibacter pomeroyi DSS-3] (372 aa)
Score = 240, Expect = 1.9e-18, Identities = 85/371 (22%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE      +F  ++  I     V     A I   G   +       I+ KL +  +     D +  ++      SN ++  +  E +P +  S    N  + +  V ++   K K+A++  + +   ++G+  +    +  K L  +ATDG++LA    +    +T     IV   ++ EL   + D + +I + + E+ + F   +  + SK+I+G +P+ +R+I      ++ +      +A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGEGAQFRATDLDIE----VVDKAPAMIERAGATTVSATTLHEIVRKLPDGALVTLTADAAAGRLTVEAGRSNFSLATLPREDFPVMASSEYQSN-FTANAAVLRRLFDKSKFAISTEETRY-YLNGVYMHVADGDGGKVLRCVATDGHRLARIDADLPAGATDMPGVIVPRKTVGELRKLLDDDEMDIAVSVSETKVRFATPDITLTSKVIDGTFPDYTRVIPQANTRRLEVDASEFAKAVDR-VATVSSERSRAVKLQLDEDKLVLSVNAPDSGAAEEELAV-AYSDERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDQSAVYVVMPMR 371
>gi|15892506|ref|NP_360220.1| DNA polymerase III subunit beta [Rickettsia conorii str. Malish 7] >gi|20137866|sp|Q92I37|DPO3B_RICCN DNA polymerase III subunit beta >gi|15619665|gb|AAL03121.1| DNA polymerase III beta chain [EC:2.7.7.7] [Rickettsia conorii str. Malish 7] (379 aa)
Score = 240, Expect = 1.9e-18, Identities = 94/371 (25%), Positives = 189/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L   +S+ E     P +    +   D  ++ +++N  +     +A      ++ +G   + TK    I+ KL +  +TL  +  + +++K      N+  +    +P ++ S N      IS   F K I   K++++ ++ + N ++G+  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    + + +IEI L  + I F  + NT + SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   VKL+ S E LE+S      GN+KE ++             +E   I  N  +L  +LK   +D + + FSD   PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIA----VQVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMD-SINPEASFKISCTDFAKIIESTKFSISLDETRYN-LNGVYLHI--KDKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEILLSSNKIKFICNENTSMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIER-IAIITVEKFRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKAVKSDVVELYFSDVSAPVLIKFPENPKDIFVVMPVK 378
>gi|114568556|ref|YP_755236.1| DNA polymerase III subunit beta [Maricaulis maris MCS10] >gi|114339018|gb|ABI64298.1| DNA polymerase III, beta subunit [Maricaulis maris MCS10] (372 aa)
Score = 240, Expect = 2.1e-18, Identities = 87/371 (23%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS---VIKVKTSTFD-SNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE------STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ AL    ++ E   + P+    LI    +   F  ++  I     + ++ DA+   +G +       + I  KL +   +TLE   +     +K   S+F   ++   D    P  +  +    +  +      + I K ++A++  + +   ++GI  ++   +  KTL  +ATDG +LA  + +        P        V  ++ LLE  D D ++E+ + E  I F++   ++ SK+I+G +P+  R+I       +++  K   EA++R +A  S EK   VKL+  ++ L ++ ++ + G ++E ++     +E   I  N  ++L +    + D     F+D+  P L+ D  DP+ L +L+P+R
  S:     1 MKLTIERATLLKALGHVQAVVEKRNTIPILSNVLISAGPDGASFAATDLDIE----ILETTDASCDGEGLVTAPAHTLYDITRKLPDGADVTLEMNGSDPRLTLKAGRSSFSLPSLPPGDFPVMPTEDLEH----RFQVPARELARLIDKTRFAISTEETRY-YLNGIHLHAADQDGRKTLRAVATDGVRLALAEVDLPDGADGMPGVIVPRKTVQEVKRLLE--DADDDVEVSVSEGKIRFRLGRAVLTSKLIDGAFPDYERVIPRGNTRLMSVENKRFAEAVDR-VATISVEKSRSVKLSLGADALTLAVNNPESGQAEEELAVSYS-DEGFAIGFNARYMLDVASQIEGDEARFHFADAASPALVTDSGDPDALYVLMPLR 371
>gi|158319061|ref|YP_001511568.1| DNA polymerase III subunit beta [Alkaliphilus oremlandii OhILAs] >gi|158139260|gb|ABW17572.1| DNA polymerase III, beta subunit [Alkaliphilus oremlandii OhILAs] (368 aa)
Score = 240, Expect = 2.2e-18, Identities = 79/371 (21%), Positives = 199/371 (53%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ-DFRIVLDVSLIELLLEII--DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK   ++  L++++ +      +  + P+  G  +E  ++ ++   ++  I    ++    +ANI+E+G I++  + F  II +L +  + +   +N+ + +K +  + NI   +  ++P +     D     IS  +FK  I +  +A   ++ +  I++G+       +  L ++A DGY++A  K +     + R+V+    +  +  I+  + D NI+I L  ++ +F V NT + S+++EG++ N ++II    +++V ++ ++L++++ER   +    + ++VK + +   + ++ S+S+LGN  E +  + + ++   I+ N+ + +  LK  D++++ +EF+ +  P +++   + N + +++P+R
  S:     1 MKFFCNQKALMHSISIVQKAVSSKSTLPIIKGIYLEAYEDHLRLVGTDMEIGIDHVM----EANIIEEGSIVVDARLFSEIIRRLPDYEVEVSLQENNQLLIKCAATEFNILSYNASEFPELPEIEEDQIH-EISQDLFKNMIRQTVFATAQDETR-PILTGVLMEI--EDDILSMVALDGYRVALRKGKLNAHLNNRVVIPGKTLNEVNRIMTGEEDENIKISLTNNHALFTVGNTKLISRLLEGEFMNYNQIIPKEFKSRVKVNTRSLLDSIERASLLGKEGRNNLVKFSITDYKMVIN-SNSELGNVHEEILIELEGDD-LQIAFNSKYFIDALKVIDDESVYLEFTTNLSPGIIKPITNDNTIYLVLPVR 364
>gi|114778881|ref|ZP_01453678.1| DNA polymerase III subunit beta [Mariprofundus ferrooxydans PV-1] >gi|114550850|gb|EAU53416.1| DNA polymerase III subunit beta [Mariprofundus ferrooxydans PV-1] (366 aa)
Score = 240, Expect = 2.3e-18, Identities = 84/371 (22%), Positives = 167/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI +S+T L+  ++ C SI E   + P+    LIE N + I  T ++  +   S +    D ++ E G   +  K  F II +L  EM       N  I + + +    +N    ++YP +        ++ +        I+   +A++ ++ +   ++G  F  +   + L ++ TDG++LA  +    ++      IV   ++IE+     +    +E+ + E  I     +  + SK+I+  +P    +I     N   I +    + L R + I ++E    ++L FS + L++S  +S+   S+E ++ +   +E   I  N  +L   L      ++ +E  D   PVL+R E D     +++P+R
  S:     1 MKITLSRTPLLQLVQRCQSIVEKRHTIPILANVLIEANQDGITMTATDLEVGIRSHI----DGSVEEDGTATVSAKKLFEIIRELDAEMDVSLTTGNGFISIVSGSSRFRVNTRPADEYPAMA-EQEGTIKIVLPGNALADMIAATSFAMSTDETR-KYLTGTLF-ELDDSQNLRLVTTDGHRLALSEIRLQQAAGTASCIVPKKAVIEIRKLCEENQGQVELLISERQIRLVAGSNTLTSKLIDARFPVYQDVIPVNNPNIARIERTAFDQILRRNM-IVANEFTHDIRLIFSDQGLDISAHNSEQEESEEHLAAEYPGHE-VAIGFNGRYLRDALGAIRAPSVCMELKDELSPVLIRGEDDEQSRYVIMPMR 365
>gi|34580501|ref|ZP_00141981.1| DNA polymerase III beta chain [Rickettsia sibirica 246] >gi|28261886|gb|EAA25390.1| DNA polymerase III beta chain [Rickettsia sibirica 246] (379 aa)
Score = 240, Expect = 2.3e-18, Identities = 93/371 (25%), Positives = 189/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L   +S+ E     P +    +   D  ++ +++N  +     +A      ++ +G   + TK    I+ KL +  +TL  +  + +++K      N+  +    +P ++ S N      IS   F K I   K++++ ++ + N ++G+  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    + + +IE+ L  + I F  + NT + SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   VKL+ S E LE+S      GN+KE ++             +E   I  N  +L  +LK   +D + + FSD   PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIA----VQVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKGKNCKFNLFTLPVSSFPAMD-SINPEASFKISCTDFAKIIESTKFSISLDETRYN-LNGVYLHI--KDKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEVLLSSNKIKFICNENTSMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIER-IAIITVEKFRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKAVKSDVVELYFSDVSAPVLIKFPENPKDIFVVMPVK 378
>gi|39933082|ref|NP_945358.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris CGA009] >gi|39652707|emb|CAE25446.1| DNA polymerase III beta subunit [Rhodopseudomonas palustris CGA009] (372 aa)
Score = 240, Expect = 2.4e-18, Identities = 85/371 (22%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   + ++    ++  +  T ++ A++  A     G   +    F+ I+ KL +   I LE   D SV+ ++       +  + E  +P++       +   +     K+ I + ++A++  + +   ++GI  ++  S K  +L  +ATDG++LA          +  P        V  ++ L+E  D +  I I L    I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++P  I  N+ +LL +    + +   ++ +D   P L++D    + L +L+P+R
  S:     1 MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALKATDLDLEVTETLPAETATA-----GSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGRSRFTLQTLPESDFPDLAAGEMS-HAFRLPASDVKRLIDRTQFAISTEETRY-YLNGIYLHTAGSPKASSLRAVATDGHRLAQLDLTLPSGADGMPGVIVPRKTVGEVQRLIE--DTEAEIGIELSTGKIRFTLGNVVLTSKLIDGTFPDYGRVIPQNNDKELLVDKKDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDPLDIGFNSRYLLDIAAQIEGEVAVLKLADPGSPTLIQDRDSKSALYVLMPMR 371
>gi|157825704|ref|YP_001493424.1| DNA polymerase III subunit beta [Rickettsia akari str. Hartford] >gi|157799662|gb|ABV74916.1| DNA polymerase III subunit beta [Rickettsia akari str. Hartford] (379 aa)
Score = 239, Expect = 2.7e-18, Identities = 93/371 (25%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L   +S+ E     P +    +   D  ++ +++N  +     +A      ++ +G + + TK    I+ KL +  + L  +  + +++K      N+  +    +P ++ S N      IS   F K I   K++++ ++ + N ++G+  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    + + +IE+ L  + I F  + NTI+ SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   VKL+ S E LE+S      GN+KE ++             +E   I  N  +L  +LK   +D + + FSD   PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLVQSLGFASSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIA----VQVVSEGELTVSTKTLNDIVRKLPDSELILTDLGTTGLEIKGKNCKFNLFTLPVSSFPTMD-SINPEASFKISCTDFAKIIESTKFSISLDETRYN-LNGVYLHI--KDKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINEDIEMLLSSNKIKFICNENTIMLSKLIDGTFPDYSAFIPESSSSKLVINRKIFADSIER-IAIITVEKFRAVKLSLSRETLEISAVGEARGNAKEVINSSQDKESFYEYNSDESLVIGFNPQYLEDVLKAVKSDLVELYFSDVSAPVLIKFPENPKDIFVVMPVK 378
>gi|47458837|ref|YP_015699.1| DNA polymerase III beta chain [Mycoplasma mobile 163K] >gi|47458165|gb|AAT27488.1| DNA polymerase III beta chain [Mycoplasma mobile 163K] (369 aa)
Score = 239, Expect = 3.0e-18, Identities = 98/371 (26%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES-TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPIS--LNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI  ++  L   L + N   ++    P  LG   +VN++     +SNG +S    +  +E+  I+E G +LI +  F  II K+  E+    + +  ++ ++       IN ++ E YP I+F+  D  ++ I+    +  I  V +A ++++    ++SG+ FN   +   +   ATD ++LA     + T  DF I +    +  L   ++ +  +E+ + E  I     NTI  +K+I   Y +V++II    E K+ I K+ L   L + + +  +E+ S + ++ S+E +  +    ++G +K  +       E TPI   LN+ F+   +  F+N NI +  + S KPVL++D+   N LQ++ P+R
  S:     1 MKIKSNRRTLEKILDIFNPTIDSTNPFPALLGLYFDVNESTTTIISSNGDVSIKHKIVSNENFKIIEPGILLIPSSLFRNIIKKIDGEVFI--RNEGLILYLENEGNIYTINCLESENYPKIDFNLIDHKKVVINSSFIRDVIKNVSFASSSSETNNLVLSGVNFN--LNLNKIIATATDSFRLAQESSSTLTNGDFNITITAKNLRDLFSNLNSE-KVELLIDEYKINIIDENTIFQAKLINMPYIDVTKIIPKNFEKKLYIEKRVLNNYLNKAMVV-LNERYSAIDVSISNEEIIFTSQRKEVGATKLVLKNDSFTFEGTPIKIRLNSRFIKEAINVFEN-NIEILMNSSEKPVLIKDKDSFNNLQLISPLR 367
>gi|50364817|ref|YP_053242.1| DNA polymerase III, beta chain [Mesoplasma florum L1] >gi|50363373|gb|AAT75358.1| DNA polymerase III, beta chain [Mesoplasma florum L1] (373 aa)
Score = 239, Expect = 3.0e-18, Identities = 88/369 (23%), Positives = 190/369 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEK-GRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVS-CKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVP 375
           M++ ++K+ L+N L   + + E    +P   G  +EV+ +++   +SN   S  + +       I+E+ GRIL+K K    ++ KL +E +TL     + +++ T   +  ++I++ E++P I F  N   +LSI    FK ++++   ++N   +K+ +++G+  N    +  +  + TD ++++  +    E+T Q+  I++    +  L  +I+     +I + ++N  FK+ N ++ S +I+G YPNV     T  E K+ +  KTL++ L R    +     S+V L      + +  + ++    +E  +  K + +    I+ N  +L+  +++FD+  I + F+   KPVL+   +  +  Q+++P
  S:     1 MRLSINKSVLLNELTKASKLIELKNVNPALQGVYMEVSFDKLVIVSSNTSTSFKAELNNENSDLIIEQPGRILVKPKFILELLRKLDSEFVTLSTFAENELEIITEKSNLKVSILNVEEFPLIGFVENGL-ELSIDSQEFKSTLTQTISSINEWNQKV-VLAGM--NLKIKDNKISFVTTDLFRVSLKEIILNEATNQEVDIIIPYKTLIELRNLIENVKEFKIIIHDTNATFKLDNDLLQSTLIDGRYPNVHSAFPTTHEIKLELKAKTLLKVLSRFELTNDQNITSVVNLEIQQSGIILKTTIAETVKYEEKFTEYKYEGSSNLNINFNTKYLIEAIRSFDDQLIHLTFNSQNKPVLITGAQKRDLKQVVLP 370
>gi|42525749|ref|NP_970847.1| DNA polymerase III, beta subunit [Treponema denticola ATCC 35405] >gi|41815760|gb|AAS10728.1| DNA polymerase III, beta subunit [Treponema denticola ATCC 35405] (367 aa)
Score = 239, Expect = 3.2e-18, Identities = 90/371 (24%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI   +  L+  + +   I     +  +    L+ V D  +    ++  +S  + +      NI+E+G   +    F  I+S L    + +E+ D  + IK         +  + E  +P      N  N  +I    FK+ I +  ++V++++ +   M+G+   +   E TL  IATDG +LAH K       P+   +++   ++ ++ +    + NIE+ + E NI F  ++   +S +I+G +PN  R+I   +     +S+   +EAL+R +++    K   + LN     L +S   +++G+++E + CK    E   ++LN  ++   LKT  +D I VEF+++ K + L+ E + +F  I++P++
  S:     1 MKISFDRDTLLKEISIAQEIIATKTALTILSNVLLSVKDGSLTIKATDIKVSFETKIP----VNIIEEGSTTVFCDKFAGILSSLPAGEVEIEQKDQKLTIKSVVKKAKFQLKTIPENDFPAFTEPTN-VNFFNIPTKEFKEMIHQTIFSVSDDETRY-FMNGVYIEN--KEDTLYFIATDGRRLAHIKKNFGIPIPEFKGVIVPPKILNIINKRASDEGNIEVGIGEKNIFFNFNSYKFSSVLIDGQFPNYERVIPENQNLSFEVSRTEFIEALKR-VSLLVELKTRRIFLNILPGSLIISSQENEIGSAREEIPCKYDGQE-VMLALNYVYIEDPLKTITSDRIKVEFTEAMKAITLKPEPEEDFFHIIMPMQ 365
>gi|78778386|ref|YP_396498.1| DNA polymerase III subunit beta [Prochlorococcus marinus str. MIT 9312] >gi|78711885|gb|ABB49062.1| DNA polymerase III, beta subunit [Prochlorococcus marinus str. MIT 9312] (385 aa)
Score = 238, Expect = 3.3e-18, Identities = 99/371 (26%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE----MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA------HYKFESTPQDFRIVLDVSL---------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF-SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN-FLQILVPIR 377
           M+II ++ +L NA++L +    +  + P+    L+  +    K + +      +  +  S D  +   G I I +K    I++KL NE    +   E +DN +IK    +F  N+  +  + YPN+ F       L+I P  F K++    +A +N+  K  +++G+ F     +  LE  +TDG++LA          E+  +   I  D+S+         IE L+ +   + +I++F  +  ++F  SN II ++ +EG YPN S++I        N + K L++ALER +A+ + ++ S+VK+   ++++  +S  + D+GN+ E++       E   I+ N  +LL  LK   + N+ ++ + +  P +   E + N F  +++P++
  S:     1 MEIICNQNELNNAIQLVSKAVASRPTHPILANILLTADQGTNKISLTG--FDLNLGIQTSFDGTVKNSGAITIPSKLLSEIVNKLPNESPVSLEVDENLDNILIKSDRGSF--NLKGIPSDDYPNLPF-VESGTSLNIDPSSFLKALKATIFATSNDDSK-QLLTGVNFTF--KQNYLESASTDGHRLAVALIGNEEHIENKDKSPSIEDDLSVTIPTRSLREIEKLVSLRSSENSIKLFYDKGQVVFISSNQIITTRTLEGAYPNYSQLIPDTFSKIFNFNTKKLIDALER-IAVLADQQSSVVKIKLDNTDLASISADAQDIGNANESIPVSYS-GEDFDIAFNVRYLLEGLKVIASKNVLLKCNLATTPAVFVPEDNLNSFTYLVMPVQ 382
>gi|84514653|ref|ZP_01002017.1| DNA polymerase III subunit beta [Loktanella vestfoldensis SKA53] >gi|84511704|gb|EAQ08157.1| DNA polymerase III subunit beta [Loktanella vestfoldensis SKA53] (372 aa)
Score = 238, Expect = 3.3e-18, Identities = 91/371 (24%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITL-EKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ A+    S+ E   + P+    LIE   +E+ F  ++  I    IV K+  A +   G   +       I+ KL +  ++TL E+     + ++    + ++  + +E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +    E  K L  +ATDG++LA    E    +      IV   ++ EL   + D D  I + + E+ I F   +  + SK+I+G +P+ +R+I      ++ +       A++R +A  SSE+   VKL+   + L +S +S D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKFSIERAVLLKAVAQAQSVVERRNTIPILANVLIEAQGDEVHFRATDLDIE---IVDKAP-AKVDRAGATTVSAVTLNEIVRKLPDGALVTLTEESATGRLTIEAGRSNFSLATLPKEDFPVMASSDYAANFSAKAP-VLRRLFDKSKFAISTEETRY-YLNGVYMHVADGENGKVLRCVATDGHRLARIDAELPMGAENMAGVIVPRKTVGELRKLLDDDDMKIAVSVSETKIRFATPDITLTSKVIDGTFPDYTRVIPQGNTRRLEVDASEFARAVDR-VATVSSERSRAVKLSLDEDRLILSVNSPDSGAAEEELAV-AYSDERLEIGFNAKYLLEIASQVDRENAVFMFNSSGDPTLMREGNDMSAIYVVMPMR 371
>gi|29840207|ref|NP_829313.1| DNA polymerase III subunit beta [Chlamydophila caviae GPIC] >gi|29834555|gb|AAP05191.1| DNA polymerase III, beta chain [Chlamydophila caviae GPIC] (366 aa)
Score = 238, Expect = 4.0e-18, Identities = 80/371 (21%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDF--RIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +VS+ ++ N ++   S+       PV    LIE  ++E+ FT ++  +ST  +      A + E G I I +K FF ++ +L    + +      + K+ + +    +  M +E +P +    N   + ++     ++ + +  +AV+  + +  +++G+      +   + ++ TDG +LA    E S  + F    ++ +  +E ++++   D+   IFL ++ I  +  NT++ +K++ G++P+ S +I+T    ++++ ++ L+  L++ +A+ ++E    VK  F+   L ++ + + +G  K +++      E   I+ N  F L +LK   ++ + +  SDS+ P ++ D     F  +++P+R
  S:     1 MKFVVSRNEVGNLIKKIQSVVPQNTPIPVLTHVLIETCNDELVFTATDLTVSTRCVA----QAKVYESGAISIPSKRFFQLVKELTEANLEISATTGEMAKITSGSSCFRLLSMGKEDFPMLPDIQNAI-RFTLPAEQLREMLQRTSFAVSREESRY-VLTGVLLTI--ANGIVTVVGTDGKRLAKTDTEISLDKSFIGDYIVPIKAVEEIIKLCSEDSEATIFLDQAKIAVECGNTLLITKLLSGEFPDFSPVISTESSVQLDLHREELITLLKQ-VALFTNESSHSVKFTFTPGELTLTANCTKVGEGKVSMAVNYS-GELLEIAFNPFFFLDILKHSKDELVRLGISDSYNPGIITDSTRSLF--VIMPMR 362
>gi|85374293|ref|YP_458355.1| DNA polymerase III subunit beta [Erythrobacter litoralis HTCC2594] >gi|84787376|gb|ABC63558.1| DNA polymerase III beta subunit [Erythrobacter litoralis HTCC2594] (375 aa)
Score = 237, Expect = 4.7e-18, Identities = 97/371 (26%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVND-NEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT--LEIIATDGYKLAHYKFESTPQDFRIVLDV--------SLIELLLEIIDFDTNIEIFLFESNIIFKVSN---TIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L    S+ E   + P+    LIE  D + +K   ++  +    +V     A++   G   +     F I  KL +   ++LE  DN + IK   S F   +  + ++ +P I    +      I      + I + ++A++  + +   ++GI F  +S E T  L+  ATDG++LA +   + P     + DV         L +LL E    D N+ + L  S I F +     T++ SK+I+G +P+ SR+I T  +  + +  K+  E ++R +A  ++EK   VK+   ++ + +S +S D G + E ++ + K +E   I  N ++L  +L   D+D + +  +D+  P L+R +++   L +L+P+R
  S:     1 MKATIERATLLRCLSHVQSVVERRNTIPILSNILIEAGDGSAVKVMATDLDLQ---VVETMNAASVESSGSTTVSAHLLFDIARKLPDGSQVSLEVADNRMTIKAGRSRF--QLPTLPKDDFPVI-VEGDLPTSFEIPAKTLAELIDRTRFAISTEETRY-YLNGI-FLHVSDEDTPVLKAAATDGHRLARFTL-ARPDGADGMPDVIVPRKAVGELRKLLEE--RMDGNVVVDLSASKIRFTLGGEGGTVLTSKLIDGTFPDYSRVIPTGNDKLLKVDPKSFFEGVDR-VATIATEKTRAVKMGLDADKVTLSVTSPDNGTASEELAAEYK-SEGFEIGFNANYLKDILSQIDSDMVELHLADAGAPTLIRKDENSPALYVLMPMR 374
>gi|49479172|ref|YP_036786.1| DNA polymerase III subunit beta [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49330728|gb|AAT61374.1| DNA polymerase III, beta subunit [Bacillus thuringiensis serovar konkukian str. 97-27] (376 aa)
Score = 236, Expect = 6.4e-18, Identities = 88/371 (23%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTH----SIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+      AL   +         P+  G  I  + + I    SN  I       S++   +   IL+ G I++  K F  II K+ ++++   K +   I +++     N+N     ++PN+    +   ++ I       +  +  +AV  N+ +  +++G+          L   ATD ++LA      ST      ++  + I  LL++++ +   + I+L ES+IIF    T + S++IEG YPN+S +I    +  +NI ++ +++ ++R   ++S    + V L   +E  +++S ++S +G   ET    G   E    IS +  F++ +LK    + IT+ F  S +P+L+   +    + ++ P+R
  S:     1 MEFIVNHKHFTQALSEVSKAISTKAVIPILSGIKITADQSGITLIASNSNIFIEKFIPSVIDDEQITTILQAGTIVVPAKYFIEIIKKMPSDIVIKSK-NEQTITIQSGEITLNLNGFPANEFPNVP-QIDGHTEIQIETKQLIDAFKQTVFAVAKNESR-PVLTGVHIEL--DHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISETQQIDGLQGEKQLNISFDGRFMVEVLKAIKEETITLSFGGSMRPILIEAGEQSAVVHLISPVR 374
>gi|85713965|ref|ZP_01044954.1| DNA polymerase III subunit beta [Nitrobacter sp. Nb-311A] >gi|85699091|gb|EAQ36959.1| DNA polymerase III subunit beta [Nitrobacter sp. Nb-311A] (372 aa)
Score = 236, Expect = 6.5e-18, Identities = 84/371 (22%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   + ++    ++  +     V ++  A     G   +    F+ I+ KL +   I LE   D SV+ ++       +  + E  +P++  +    +  +++    K+ I + ++A++  + +   ++GI  +   + K  TL  +ATDG++LA          E  P        V  ++ L+E  D +  I I L +  I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++   I  N+ +LL +    + +   ++ +D   P L+ D      L +L+P+R
  S:     1 MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAKLSLKATDLDLE----VTETLSAETGTIGSTSVPAHMFYDIVRKLPEGAQILLEGDGDRSVLAIRAGRSRFTLQTLPENDFPDLA-AGEMTHAFTLAAADLKRLIDRTQFAISTEETRY-YLNGIYLHGAGNAKSATLRGVATDGHRLAQLDLALPKGAEGMPGVIIPRKTVGEVQRLIE--DSEAEIGIELSQGKIRFTIGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDALDIGFNSRYLLDIAAQIEGEAAVLKLADPGSPTLVHDRDSRGALYVLMPMR 371
>gi|42781777|ref|NP_979024.1| DNA polymerase III subunit beta [Bacillus cereus ATCC 10987] >gi|42737700|gb|AAS41632.1| DNA polymerase III, beta subunit [Bacillus cereus ATCC 10987] (376 aa)
Score = 236, Expect = 7.0e-18, Identities = 92/371 (24%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINAL-RLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED----ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+      AL  +  +IS   F  P+  G  I  N + I    SN  I     +  S D       L+ G I++  K F  II K+ ++++   K +   I +++     N+N     ++PN+     D  ++ I       +  +  +AV  N+ +  +++G+          L   ATD ++LA  + + ST      ++  + I  LL++++ +   + I+L ES+IIF    T + S++IEG YPN+S +I    +  +N+ ++ +++ ++R   ++S    + V L   +E  ++VS ++S +G   ET        E    IS +  F+L  L+    + +T+ FS S +P+L+        + ++ P+R
  S:     1 MEFIVNHKHFTQALSEVSKAISTKAFI-PILSGIKITANQSGITLIASNSNIFIEKFIPSSMDDEQITTTLQAGTIVVPAKYFIEIIKKMPSDIVIKSK-NEQTITIQSEEITLNLNGFPASEFPNVP-QIEDHAEIQIETKQLIDAFKQTVFAVAKNESR-PVLTGVHIEL--DYNKLICAATDSHRLAIRETQISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISSLIPNEFQTVINVDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIKVSSNASQIGKIYETQQVDAIHGEKQLHISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVR 374
>gi|75674201|ref|YP_316622.1| DNA polymerase III subunit beta [Nitrobacter winogradskyi Nb-255] >gi|74419071|gb|ABA03270.1| DNA polymerase III, beta subunit [Nitrobacter winogradskyi Nb-255] (372 aa)
Score = 235, Expect = 7.4e-18, Identities = 84/371 (22%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNS--ISSEKTLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   + ++    ++  +     +A +E   +   G   +    F+ II KL +   I LE   D SV+ ++       +  + E  +P++  +    +  +++    K+ I + ++A++  + +   ++GI  +    ++  TL  +ATDG++LA          E  P        V  ++ L+E  D +  I I L +  I F + N ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++   I  N+ +LL +    + +   ++ +D   P L+ D      L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENAKLSLKATDLDLEVTETLA-AETGTV---GSTTVPAHMFYDIIRKLPDGAQIVLEGDGDRSVLTIRAGRSRFTLQTLPENDFPDLA-AGEMTHSFTLAAADLKRLIDRTQFAISTEETRY-YLNGIYLHGAGTANNATLRGVATDGHRLAQLDLALPKGAEGMPGVIIPRKTVGEVQRLIE--DSEAEIGIELSQGKIRFTLGNVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDALDIGFNSRYLLDIAAQIEGEAAVLKLADPGSPTLVHDRDSRGALYVLMPMR 371
>gi|18308984|ref|NP_560918.1| DNA polymerase III subunit beta [Clostridium perfringens str. 13] >gi|110798947|ref|YP_694477.1| DNA polymerase III subunit beta [Clostridium perfringens ATCC 13124] >gi|110803106|ref|YP_697353.1| DNA polymerase III subunit beta [Clostridium perfringens SM101] >gi|168207735|ref|ZP_02633740.1| DNA polymerase III, beta subunit [Clostridium perfringens E str. JGS1987] >gi|168212005|ref|ZP_02637630.1| DNA polymerase III, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|168215268|ref|ZP_02640893.1| DNA polymerase III, beta subunit [Clostridium perfringens CPE str. F4969] >gi|168218305|ref|ZP_02643930.1| DNA polymerase III, beta subunit [Clostridium perfringens NCTC 8239] >gi|169343474|ref|ZP_02864474.1| DNA polymerase III, beta subunit [Clostridium perfringens C str. JGS1495] >gi|182627053|ref|ZP_02954778.1| DNA polymerase III, beta subunit [Clostridium perfringens D str. JGS1721] >gi|18143659|dbj|BAB79708.1| DNA-directed DNA polymerase III beta chain [Clostridium perfringens str. 13] >gi|110673594|gb|ABG82581.1| DNA polymerase III, beta subunit [Clostridium perfringens ATCC 13124] >gi|110683607|gb|ABG86977.1| DNA polymerase III, beta subunit [Clostridium perfringens SM101] >gi|169298426|gb|EDS80515.1| DNA polymerase III, beta subunit [Clostridium perfringens C str. JGS1495] >gi|170660920|gb|EDT13603.1| DNA polymerase III, beta subunit [Clostridium perfringens E str. JGS1987] >gi|170710065|gb|EDT22247.1| DNA polymerase III, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|170713330|gb|EDT25512.1| DNA polymerase III, beta subunit [Clostridium perfringens CPE str. F4969] >gi|177907579|gb|EDT70218.1| DNA polymerase III, beta subunit [Clostridium perfringens D str. JGS1721] >gi|182379690|gb|EDT77169.1| DNA polymerase III, beta subunit [Clostridium perfringens NCTC 8239] (366 aa)
Score = 235, Expect = 8.8e-18, Identities = 85/371 (22%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M     K KL  ++ +         + P+  G  IE ++N +    S+  +S    +    +A++ E G++++  K F  II KL N+ I +E V    I++       ++  M+ E +P++    N+    SI+  + K  I    +A+  ++ +  I+ GI F    S+  L ++A DGY+LA      ++      ++   +L E+   + D +  + I    ++I+F + +T + S+++EG++     ++    + ++ + K+TL   +ER   ++     ++VK + + E + ++ S+S LG  +E V+ K + +E   I+ N+ +LL +LK  + D I +  + S  P ++R++ +     +++P+R
  S:     1 MIFTCDKNKLQESIAIAQKAITGKSTMPILEGLYIEASENIVTIIGSDKDVS----IETKFEADVTEPGKLVVDAKIFGEIIRKLPNDKIKIETVSEEAIRITCQKSVFDLLHMNAEDFPSLP-KINENMIFSINQGILKNMIKGTSFAIAQDETR-PILQGILFEIKDSK--LNLVALDGYRLAIRTENIDTNNTINAVIPGKTLNEVAKILEDSEEIVNITFTPNHILFNMGDTKVISRLLEGEFIKYDALLPKEHKLQIEVDKQTLQNGIERASLMAKEGNSNLVKFDITDENIVIT-SNSQLGKVREEVTIKLQGDE-IQIAFNSKYLLDVLKNMEEDKIELRMTSSISPCIIRNKNNDLCEYLVLPVR 363
>gi|146276061|ref|YP_001166220.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides ATCC 17025] >gi|145554302|gb|ABP68915.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides ATCC 17025] (372 aa)
Score = 235, Expect = 9.1e-18, Identities = 84/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDS--NINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFD-TNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE   + + F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++  +   S  ++  +  E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +  + E+   L  +ATDG++LA       E       +++    +  L +++D D   I++ + E+ + F      + SK+I+G +P+ SR+I T    ++ +  +   +A++R +A  SSE+   VKL+   + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIE----VVDRTPAVVERPGATTVSAVMLHEIVRKLPDGALVGLSEDAASGRLTVTAGRSVFSLATLPREDFPVMASSEYSSNFTAPAP-VLRRLFDKAKFAISTEETRY-YLNGVFMHVATGEEGPVLRCVATDGHRLARIDAPLPEGAEGMAGVIVPRKTVNELRKLLDDDEAQIKVSVSETKVRFATPQITMTSKVIDGTFPDYSRVIPTGNARRLEVDAQEFAKAVDR-VATVSSERSRAVKLSLDEDRLVLSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDMSAVYVVMPMR 371
>gi|17988225|ref|NP_540859.1| DNA polymerase III subunit beta [Brucella melitensis 16M] >gi|23500918|ref|NP_697045.1| DNA polymerase III subunit beta [Brucella suis 1330] >gi|163842279|ref|YP_001626683.1| DNA polymerase III subunit beta [Brucella suis ATCC 23445] >gi|17983990|gb|AAL53123.1| DNA POLYMERASE III, BETA CHAIN [Brucella melitensis 16M] >gi|23346771|gb|AAN28960.1| DNA polymerase III, beta subunit [Brucella suis 1330] >gi|163673002|gb|ABY37113.1| DNA polymerase III, beta subunit [Brucella suis ATCC 23445] (397 aa)
Score = 234, Expect = 1.0e-17, Identities = 78/373 (20%), Positives = 184/373 (49%)
  Q:     5 LKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
            KM++ + ++ L+ +L   + + E   + P+    L++     +    ++  +  +   A    A + + G   +     + I+ KL +  E++     D   + V +      +  + +  +P +    F+++      I     K+ I + ++A++  + +   ++GI F++I S+  L++  +ATDG++LA  + E+ P         I+   ++ EL   +   D  + + L ++ I F V + ++ SK+I+G +P+  R+I +  + K+ I ++    +++R ++  SSE+   VKL+ +   L ++ ++ D G++ + ++      +P  I  N+ +LL +       +     +D+  P L+RD  D + L +L+P+R
  S:    24 FKMRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATA----AMVEQAGATTVPAHLLYDIVRKLPDGAEVMLSTNPDGGSMSVISGKSSFRLQCLPQSDFPELTAGAFTHS----FRIEAQALKRLIDRTQFAISTEETRY-YLNGIFFHAIESDGALKLRAVATDGHRLARAELEA-PSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDAKIRFTVGSVVLTSKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDR-VSTISSERGRAVKLSIADGQLTLTVNNPDSGSATDELAADYD-GDPLDIGFNSKYLLDITGQLSGTDAVFMLADAGSPTLVRDTGDEDVLYVLMPMR 396
>gi|84701585|ref|ZP_01016160.1| DNA polymerase III subunit beta [Parvularcula bermudensis HTCC2503] >gi|84690831|gb|EAQ16671.1| DNA polymerase III subunit beta [Parvularcula bermudensis HTCC2503] (373 aa)
Score = 234, Expect = 1.0e-17, Identities = 75/371 (20%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE-MITLEKVD-NSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK---TLEIIATDGYKLAHYKFESTPQDFRI----VLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++ + +  L+ AL    S+ E   + P+    L+      +  T ++  I     +A++  A I E+G +       + I+ +L +   I+L K   +S + +K+   +  ++I+ ++ +P ++         +IS     + + + ++A++  + +   ++G+  ++++  +   +L  +ATDG++LA       P    I    +   +++EL   + D D ++ + +  + I F   + ++ SK+I+G +P+  R+I +  +  + +       A++R   +S+ + +S VKL+ + + L +  ++ + G++ + +S   K  +   +  N  +LL +      +     F+D+  P L+ DE+D   L +L+P+R
  S:     1 MQVTIERATLLKALHHTQSVVERRNTIPILSNVLMRAQGGSLALTATDLDIE----IAETVPAEIAEEGGVTASAVTLYDIVKRLPDGGQISLNKSSGSSRLMLKSGRSEFQLSILPDDDFPTLS-DEAAGATFTISADALGRLLDRTRFAMSQEETRY-YLNGVYLHALTEGEGAPSLRAVATDGHRLARLDSPLPPGAEAIPGVIIPRKAVLELRRLLDDADGDVAVTVTPAKIRFAFGDIVLVSKLIDGTFPDYQRVIPSGNDRVMKVDNDAFRRAVDRVSTVSADKTRS-VKLSLTEDQLTLLVNNPETGSATDELSVDFKSTD-LEVGFNARYLLDIADQISGETAVFHFADAASPTLVTDEEDEGALYVLMPLR 372
>gi|103486201|ref|YP_615762.1| DNA polymerase III subunit beta [Sphingopyxis alaskensis RB2256] >gi|98976278|gb|ABF52429.1| DNA polymerase III, beta subunit [Sphingopyxis alaskensis RB2256] (371 aa)
Score = 234, Expect = 1.0e-17, Identities = 90/371 (24%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDN-EIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT---LEIIATDGYKLAHYKFESTPQDFRIVLDVSL-------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ +L    S+ E   + P+    LIE +   +++   ++  +     +A    A +   G   +     F I  KL +   ++L   +  V +VK    + N+  +  + +P I       N +L ++ ++  + I K ++A++  + +   ++GI F  ++ + T   L+  ATDG++LA Y   + P     + DV +       I  LL+  + + N+EI L  S I F++ N ++ SK+I+G +P+ SR+I T  +  + +  K+L + ++R ++  +SEK   VK+    + + +S +S + G + E ++     ++   I  N  +L  +L   D D++ +  +D+  P L+R+ +    L +L+P+R
  S:     1 MKATIERAVLLKSLGHVQSVVERRNTIPILSNVLIEADGTGQLRLMATDLDLQVVETIA----AKVETPGTTTVSAHTLFEIARKLPEGSEVSLAAAEGKV-QVKAGRSNFNLPTLPRDDFPVIAEGDLPTNFELPVAELI--QIIDKTRFAISTEETRY-YLNGI-FLHVAEDATGPVLKAAATDGHRLARYTV-TRPDGAAGMPDVIVPRKCVGEIRKLLD--EAEGNVEISLSASKIRFQLGNAVLTSKLIDGTFPDYSRVIPTANDKLLKVDPKSLFQGVDR-VSTIASEKTRAVKVGLDKDRITLSVTSPENGTAAEELAAAYD-SDAMEIGFNARYLSDILGQVDGDSVELHLADANAPTLIRESEKSPALYVLMPMR 370
>gi|114565578|ref|YP_752732.1| DNA-directed DNA polymerase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336513|gb|ABI67361.1| DNA polymerase III, beta subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (409 aa)
Score = 234, Expect = 1.1e-17, Identities = 92/377 (24%), Positives = 174/377 (46%)
  Q:     1 LKKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN-DNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFD-TNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSI--VKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTP--ISLNNHFLLSLLKTFDND--NITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           + +   MK ++ K  L+    +    + +  + PV  G L+E + D  +  T ++  I   +  AK E   ++EKG +L+    FF  I  L    I +E   + + + +K       IN   + +YP +          +I   V K+++ K  +A      +  + +G+ F+ +     L ++A+D ++LA Y        P+    ++       +L ++D     I I L  +N+ F  +N ++ S++IEG YPN  ++I      KV +  + L + LER   I S +K  I   +  F    +EV+  S  +G   E +  K  V       IS N ++ L ++K  + +   + +  S    PV++ + +  N+L +LVP+R
  S:    24 MTEGFSMKFMIEKKDLLAITSMVYRAASSKNAIPVLSGLLLESDPDTGLTMTATDMEIGIRASTAKIE---VIEKGSVLVNAHYFFDFIKLLPEVPIFIELNQETAQLDIKYGRSSGFINTYRDYEYPALPLKKIK-PCFTIKQEVLKEALKKTVFAAATTHFR-QVFTGVLFD-LGEGGNLNVVASDTHRLARYSCTIKLDAPEPLSFIIPTRTANEILRLLDDSPEEINIGLSNNNVSFYRNNFLLLSRLIEGQYPNYEQVIPRSFSYKVKLDTQVLADTLERARVIPSDDKLKIQYTRFKFEENEVEVNSYSEIMGEITEVIEIKDPVEGEGELNISFNTNYFLDVVKILEGEAKELLINLSSILGPVMIVNPQKDNYLYVLVPLR 406
>gi|49474937|ref|YP_032978.1| DNA polymerase III subunit beta [Bartonella henselae str. Houston-1] >gi|49237742|emb|CAF26934.1| DNA polymerase III, beta chain [Bartonella henselae str. Houston-1] (373 aa)
Score = 234, Expect = 1.1e-17, Identities = 89/371 (23%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVD---NSVIKVKTSTFDSNINIMDEEQYPNI---NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK-TLEIIATDGYKLAHYKFESTPQDFRIVLDV--------SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I V + +L+ +L   + + E   + P+    LI+ + N ++   ++  +     V +S  ANI ++G I +     + I+ KL +    +  VD    S + V +   +  +  + +  +P      F Y    + S+S    K  +   ++A++  + +   ++GI F+ I      L ++ATDG++LA    E+ P     +  V         L +LL E +D D  +E  L E+ I F + + +  SK+I+G +P   R+I    + K+ ++++    A++R   ISS   ++ VKL      L++   + D G++++ ++     ++P  I  N+ +LL +     +D +    +++  P L+R+    + L +L+PIR
  S:     1 MRITVDRNQLLKSLGRVHRVVERRNTVPILSNVLIDADKNGVQLKATDLDLE----VTESFVANIKQEGAITVPAHLLYDIVRKLPDGSEIVLSVDMNQASTMSVVSGCANFQLQCLPKVDFPESLPGQFGY----RFSLSTSGLKHLLDCTQFAISTEETRY-YLNGIYFHVIDDGVLKLRLVATDGHRLAQVDMEA-PSGVEGMPGVIVPRKTVGELQKLLSEEVDEDVCVE--LSETKIRFSIGSVVFTSKLIDGTFPEYQRVIPLGNDKKLIVNRQDFSSAVDRVSTISSDRGRA-VKLTIEQGQLKLIVHNPDSGSAEDQLAVT-YTSDPLEIGFNSRYLLDIAGQLSSDEMVFMLAEAGAPALIRNNGVADALYVLMPIR 372
>gi|62288993|ref|YP_220786.1| DNA polymerase III subunit beta [Brucella abortus bv. 1 str. 9-941] >gi|82698934|ref|YP_413508.1| DNA polymerase III subunit beta [Brucella melitensis biovar Abortus 2308] >gi|62195125|gb|AAX73425.1| DnaN, DNA polymerase III, beta subunit [Brucella abortus biovar 1 str. 9-941] >gi|82615035|emb|CAJ09958.1| DNA polymerase III, beta chain:Inorganic pyrophosphatase [Brucella melitensis biovar Abortus 2308] (397 aa)
Score = 234, Expect = 1.1e-17, Identities = 78/373 (20%), Positives = 184/373 (49%)
  Q:     5 LKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
            KM++ + ++ L+ +L   + + E   + P+    L++     +    ++  +  +   A    A + + G   +     + I+ KL +  E++     D   + V +      +  + +  +P +    F+++      I     K+ I + ++A++  + +   ++GI F++I S+  L++  +ATDG++LA  + E+ P         I+   ++ EL   +   D  + + L ++ I F V + ++ SK+I+G +P+  R+I +  + K+ I ++    +++R ++  SSE+   VKL+ +   L ++ ++ D G++ + ++      +P  I  N+ +LL +       +     +D+  P L+RD  D + L +L+P+R
  S:    24 FKMRVTLERSNLLKSLNHVHRVVERRNTIPILSNVLLQAEGASLAMKATDLDLEVNEATA----AMVEQAGATTVPAHLLYDIVRKLPDGAEVMLSTNPDGGSMSVISGKSSFRLQCLPQSDFPELTAGAFTHS----FRIEAQALKRLIDRTQFAISTEETRY-YLNGIFFHAIESDGALKLRAVATDGHRLARAELEA-PSGTEGMPGIIIPRKTVAELQKLVDVPDVVVTVELSDTKIRFTVGSVVLTSKLIDGTFPDYQRVIPSGNDKKLTIDRQDFAASVDR-VSTISSERGRAVKLSIADGQLTLTVNNPDSGSATDELAADYD-GDPLDIGFNSKYLLDITGQLSGTDAVFMLADAGSPTLVRDTGDEDVLYVLMPMR 396
>gi|78211559|ref|YP_380338.1| DNA polymerase III subunit beta [Synechococcus sp. CC9605] >gi|78196018|gb|ABB33783.1| DNA polymerase III, beta subunit [Synechococcus sp. CC9605] (385 aa)
Score = 232, Expect = 1.7e-17, Identities = 84/371 (22%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLI--EVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD-----------FRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           MK++ S+++L  AL+L +       + PV    L+  +   N +  T  +  +   + +A S + +    G I +  +    I+S+L ++      VD+S  +V+ ++   +  +  M  + YP++    +    L + P    +++    +A + ++ K  +++G+      +++ LE  ATDG++LA    E   QD           F + L    +  +E L+     D  + +F     ++F  ++ ++ S+ +EG YPN  ++I         + ++ L+ ALER +A+ + +  ++VK +   E  V+++S  + D+G+  E++    +  +   I+ N  +LL  LK   +D I +  +    P +LR D+    F  +++P++
  S:     1 MKVVCSQSELNGALQLVSRAVATRPTHPVLANVLLTADAGSNRLSLTGFDLSLGIQTSLAASVEIS----GAITLPARLLGEIVSRLSSDSPVTLAVDDSGEQVQLTSLSGSYQMRGMSADDYPDLPMVESGMT-LKLQPERLVQALKGTLFASSADEAK-QLLTGVHLKF--NQRALEAAATDGHRLAVLNVEDALQDEAVTDAVDDDGFAVTLPSRSLREVERLMASWRSDEPVSLFCDRGQVVFLAADQMVTSRTLEGTYPNYGQLIPDGFARTFGMDRRALIAALER-IAVLADQHNNVVKFSSQPEDGVVQISADAQDVGSGSESLPANLE-GDAMQIAFNVRYLLDGLKAMGSDRIVLHCNAPTTPAVLRSDDASEAFTYLVMPVQ 382
>gi|56417078|ref|YP_154152.1| DNA polymerase III beta chain [Anaplasma marginale str. St. Maries] >gi|56388310|gb|AAV86897.1| DNA polymerase III beta chain [Anaplasma marginale str. St. Maries] (379 aa)
Score = 232, Expect = 1.8e-17, Identities = 86/367 (23%), Positives = 187/367 (50%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +S+  L+ +L   +S+ E   S  V     +E  D  ++ ++++  IS  + V    +A+++ KG ++   +  + I+ KL  +     K+ +  + V+       ++++  E++P I     D    + +S I   + ++K K++++  + + N + G+  +   +E  L  +ATDG++L+  K    E    D  +++    +  LL+II    D    + + + +  I F+     + SK+++G +P+   II   +   V++   +L+ A++R +++   +K   +KL+F+S  L +S +SSD G+++E +    K +E T I LN  +L+ +L         V F D    VL++D++    + I++P+R
  S:    16 ISREDLLQSLAYVSSVIERRNSIAVLSCVRVEAKDGVVELSSTDLDISIEACV----NASVVHKGVVVASAQLLYDIVRKLSGDCAVGFKMSDGRLLVECGNAKFFLHVVAPEKFPAIEGGEVDCGFDMQVSHIA--ELLNKTKFSMSVEESRYN-LRGVYMHV--AEDMLCCVATDGHRLSLAKVNRPEGLQPDIGVIVPRKTVNELLKIIGGGGDASQVVSVSISQRKICFRYKGYFMVSKVVDGVFPDYLSIIPQERGASVSMDACSLLSAVDR-VSVVVFDKVKAIKLSFASGRLTLSSASSDQGDAREELEVDYKGDEVT-IGLNARYLIEVLGCMKG-ACEVVFQDGNTAVLIQDKEPGGSMHIIMPMR 378
>gi|44004430|ref|NP_982098.1| DNA polymerase III, beta subunit [Bacillus cereus ATCC 10987] >gi|42741496|gb|AAS44941.1| DNA polymerase III, beta subunit [Bacillus cereus ATCC 10987] (370 aa)
Score = 232, Expect = 1.9e-17, Identities = 87/371 (23%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAK--SEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINF-SYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST----PQDFRIVLDVSLIELLLEIIDFDTNIEIFLF-ESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNF--LQILVPIR 377
           MK  +++T  I  L   ++  +     P   G L++ N   +    S+G   T ++V +      +  E G++L    P    I K K+E I LE  +N +  V++     +   MD E+YP I   +  DW  +S+S   F    +   +A+     +  I++G+   S+  +     IATD ++LA   F+ T     +D  +VL +  ++  L++ + +TN+++ L  ++ ++ +  + I  S+++ G YP+ +R++    ++++ +S++     LE+  A SS     IV  +   E + +   +S +G +   + C     E   ++ N  +LL  L+T  ++ I ++   + +P+++   +D     LQ+++P+R
  S:     1 MKFTINRTLFIEKLEKASATVDVKNPMPALQGVLLDCNSKGMILMGSDGT-ETVTLVTRFNVNSGDCTEPGKVLFAAAPVLKTIKKFKSEFIGLEHKNNELKIVESKKKQFSFCTMDHEEYPEIKIEAGEDW--ISLSQEQFVSMANGTLHAIPAMDTR-KILTGVNLKSVDDK--FFSIATDAHRLARLHFDCTKITIAKDGEVVLPIKSLKTALKLFNRETNLQLKLISDTQLLIRGESIIYQSRLLAGTYPDTARMVPDEFKSEIQLSREEFKNTLEQLSAFSS----LIVLTSEGKESIHLKPQNSQVGTASVEIPCNQV--EAFTLACNVEYLLQALQTITSETIAIKMISNQRPIVVVGAEDTTHSNLQLILPVR 369
>gi|99079843|ref|YP_611997.1| DNA polymerase III subunit beta [Silicibacter sp. TM1040] >gi|99036123|gb|ABF62735.1| DNA polymerase III, beta subunit [Silicibacter sp. TM1040] (373 aa)
Score = 232, Expect = 1.9e-17, Identities = 84/371 (22%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE---KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE   +++ F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++      SN ++  +  E +P +  S    N  + +  + ++   K K+A++  + +   ++G+  +  + E   K L  +ATDG++LA    +    +      IV   ++ EL   + + D +I + + E+ + F   N  + SK+I+G +P+ +R+I      ++ +      +A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERATLLKAVAQAQSVVERRNTIPILANVLIEAEGSDVMFRATDLDIE----VVDKAPAQVERAGATTVAATTLHEIVRKLPDGALVTLDADAASGRLTVEAGRSNFSLATLPREDFPVMATSEYHSN-FTANAAMLRRLFDKSKFAISTEETRY-YLNGVYMHVATGESGGKALRCVATDGHRLARIDADLPMGAEDMPGVIVPRKTVGELRKLLDEDDMDIAVSVSETKVRFATPNITLTSKVIDGTFPDYTRVIPVGNTRRLEVDASEFAKAVDR-VATVSSERSRAVKLQLDEDRLVLSVNAPDSGAAEEELAV-AYSDERLEIGFNAKYLLEIANQVDRENAVFMFNSSGDPTLMREGSDESAVYVVMPMR 372
>gi|110632364|ref|YP_672572.1| DNA polymerase III subunit beta [Mesorhizobium sp. BNC1] >gi|110283348|gb|ABG61407.1| DNA polymerase III, beta subunit [Mesorhizobium sp. BNC1] (372 aa)
Score = 231, Expect = 2.4e-17, Identities = 79/371 (21%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLS----ISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++++ ++ L+ +L   + + E   + P+    L+  +   ++   ++  +     + ++  A++ + G   +     + I+ KL +    + KVD +    +T +  S  +    +  P  +F      Q S    +   V +  + K ++A++  + +   ++GI  +++ S+  L++  +ATDG++LA  + E    S      IV   ++ EL   + D D  + + L ++ I F + + ++ SK+I+G +P+  R+I    + ++ I +++   A++R ++  SSE+   VKL+ S   +  + ++ D G++ E +   G   +P  I  N  +LL +             +D+  P L++D  D   L +L+P+R
  S:     1 MRVVLERSNLLKSLGHVHRVVERRNTIPILSNVLLSADGASLEMKATDLDLE----MTEAAPASVEQGGATTVPAHLLYDIVRKLPDGAEVMLKVDENG---QTMSVISGRSTFRLQCLPKADFPALTAGQFSHIFRMESAVLRSLVEKTQFAISTEETRY-YLNGIFLHTLESDGALKLRAVATDGHRLARAEIEAPAGSEGMPGIIVPRKTVGELQKLVDDPDVAVTVELSDTKIRFTIGSVVLTSKLIDGTFPDYQRVIPVGNDKELLIDRQSFSAAVDR-VSTVSSERGRAVKLSISDGQVTFTVNNPDSGSATEEIPA-GYNADPIEIGFNARYLLDVAAQLSGSEAKFLLADAGSPTLIQDTSDERVLYVLMPMR 371
>gi|15604284|ref|NP_220800.1| DNA polymerase III subunit beta [Rickettsia prowazekii str. Madrid E] >gi|6225282|sp|Q9ZDB3|DPO3B_RICPR DNA polymerase III subunit beta >gi|3860976|emb|CAA14876.1| DNA POLYMERASE III, BETA CHAIN (dnaN) [Rickettsia prowazekii] (381 aa)
Score = 231, Expect = 2.4e-17, Identities = 95/371 (25%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKV--------NEPTPISLNNHFLLSLLKTFDNDNITVEFSD--SFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L    SI E     P +    +   D  ++ +++N  +     +A      +L +G I + T+    I+ K  +  +TL +++ + +++K      N+  +    +P ++ S        IS   F K I   K++++ ++ + N ++GI  +    +K     +TDGY+L+      E   ++F ++L     E +L+I+    +   +IEI L  + I F  + NTI+ SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   VKL+ S ++LE+S      G +KE ++             +E   I  N  +L  +LK   +D + + FSD  +  PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLMQSLGFARSIIEKRNVIPEYANIKLSAQDGNLELSSTNMDLYLSQKIA----VQVLNEGEITVATQTLSDIVRKFPDSELTLTEIEITQLEIKGQNCKFNLFTLPVSSFPAMD-SIKPEVSFKISCADFAKIIESTKFSISLDETRYN-LNGIYLHI--KDKEFFAASTDGYRLSISWITLEEKIKNFGVILPQKSAEEILKIVKDPKNIHEDIEILLSSNKIKFICNENTILLSKLIDGTFPDYSAFIPKSSVSKLVINRKIFADSIER-IAIITVEKFRAVKLSLSRKILEISAVGEARGTAKEIITASQDKESFYEYNHDESLVIGFNPQYLEDVLKAIKSDIVELYFSDISASAPVLIKFPRNPKDIFVIMPVK 380
>gi|157803823|ref|YP_001492372.1| DNA polymerase III subunit beta [Rickettsia canadensis str. McKiel] >gi|157785086|gb|ABV73587.1| DNA polymerase III subunit beta [Rickettsia canadensis str. McKiel] (379 aa)
Score = 231, Expect = 2.5e-17, Identities = 90/371 (24%), Positives = 189/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L   +S+ E     P +    +   D  ++ +++N  +     +A      ++ +G + + TK    ++ KL +  +TL  +  + +++K      N+  +    +P ++ S N      IS   F K I   K++++ ++ + N ++G+  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    + + +IE+ L  + I F  + NTI+ SK+I+G +P+ S  I     +K+ I++K   ++++R +AI + EK   VKL  S E LE+S      GN++E ++             +E   I  N  +L  +LK   +D + + FS    PVL++  ++P  + +++P++
  S:     2 LKLIVETKMLVQSLGFASSVIEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIA----VQVVSEGELTVSTKTLNDVVRKLSDSELTLTDLGTTGLEIKGKNCTFNLFTLPVSSFPAMD-SINPEASFKISCTDFAKIIESTKFSISLDETRYN-LNGVYLHI--KDKEFYSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINQDIEVLLSSNKIKFICNENTIMLSKLIDGTFPDYSAFIPESSSSKLVINRKIFADSIDR-IAIITVEKFRAVKLLLSRETLEISAVGEARGNAQEVINSSQAKESFYEYNSDESLAIGFNPQYLDDVLKAVKSDLVELYFSGVSAPVLIKFPENPEDIFVVMPVK 378
>gi|30262664|ref|NP_845041.1| DNA polymerase III subunit beta [Bacillus anthracis str. Ames] >gi|47527976|ref|YP_019325.1| DNA polymerase III subunit beta [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185507|ref|YP_028759.1| DNA polymerase III subunit beta [Bacillus anthracis str. Sterne] >gi|165869103|ref|ZP_02213763.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0488] >gi|167632459|ref|ZP_02390786.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0442] >gi|167637875|ref|ZP_02396154.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0193] >gi|170685339|ref|ZP_02876563.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0465] >gi|170704813|ref|ZP_02895279.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0389] >gi|177649679|ref|ZP_02932681.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0174] >gi|190565349|ref|ZP_03018269.1| DNA polymerase III, beta subunit [Bacillus anthracis Tsiankovskii-I] >gi|30257296|gb|AAP26527.1| DNA polymerase III, beta subunit [Bacillus anthracis str. Ames] >gi|47503124|gb|AAT31800.1| DNA polymerase III, beta subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49179434|gb|AAT54810.1| DNA polymerase III, beta subunit [Bacillus anthracis str. Sterne] >gi|164715829|gb|EDR21346.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0488] >gi|167514424|gb|EDR89791.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0193] >gi|167532757|gb|EDR95393.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0442] >gi|170130614|gb|EDS99475.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0389] >gi|170670699|gb|EDT21438.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0465] >gi|172084753|gb|EDT69811.1| DNA polymerase III, beta subunit [Bacillus anthracis str. A0174] >gi|190563376|gb|EDV17341.1| DNA polymerase III, beta subunit [Bacillus anthracis Tsiankovskii-I] (376 aa)
Score = 230, Expect = 2.9e-17, Identities = 88/371 (23%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED----ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKE-----TVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+      AL   +         P+  G  I  + + I    SN  I     +  + D      IL+ G I++  K F  II K+ ++++   K +   I +++     N+N     ++PN+    +D  ++ I       +  +  +AV  N+ + ++++G+          L   ATD ++LA      ST      ++  + I  LL++++ +   + I+L ES+IIF    T + S++IEG YPN+S +I    +  +NI ++ +++ ++R   ++S    + V L   +E  +++S ++S +G   E      +  K ++N    IS +  F+L  L+    + +T+ FS S +P+L+        + ++ P+R
  S:     1 MEFIVNHKHFTQALSDVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDEQITTILQAGTIVVPAKYFIEIIKKMPSDIVIKSK-NEQTITIQSGEITLNLNGFPANEFPNVP-QIDDHTEIQIETKQLIDAFKQTVFAVAKNESR-HVLTGVHIEL--DHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISEKQQIDVIQGKKQLN----ISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVR 374
>gi|83944867|ref|ZP_00957233.1| DNA polymerase III subunit beta [Oceanicaulis alexandrii HTCC2633] >gi|83851649|gb|EAP89504.1| DNA polymerase III subunit beta [Oceanicaulis alexandrii HTCC2633] (372 aa)
Score = 230, Expect = 3.5e-17, Identities = 89/371 (23%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ AL    ++ E   + P+    LI  +D   +FT ++       IV ++E A++  +G I       + I  KL +   +TLE   D+  I +       N+ I+    +P +  S +     +       + I K K+A++  + +   ++GI  ++   +  KTL  +ATDG++LA  + +    +      IV    + EL   + D D ++++ + E  I F++   ++ SK+I+G +P+  R+I    +  + I +    +A++R +A  S EK   VKL+ +   + ++ ++ + G + E +      +E T I  N  +LL +    + D    E +DS  P  + D  D +   +L+P+R
  S:     1 MKLTIERAILLKALGHVQAVVERRNTIPILSNVLINASDGFARFTATD---LDMEIVEEAE-ASVEREGLITAPAHTLYEIARKLPEGSQVTLELGGDDPRILLSAGRSRFNLPILPPGDFP-VMPSEDLAVSFTAPASEIARLIDKTKFAISTEETRY-YLNGIHLHAAERDGRKTLRAVATDGHRLALAETDLPDGAMGMPAVIVPRKPIQELRRLLEDLDGDVDVSVSEGKIRFQLGAAVLTSKLIDGTFPDYERVIPRGNDKVMRIDRAPFAQAVDR-VATISQEKSRSVKLSLAPGQVTLTVNNPESGAASEELVADYSADEMT-IGFNARYLLDVASQIEGDEAIFELADSGSPTRVTDSGDKDAEYVLMPLR 371
>gi|126460790|ref|YP_001041904.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides ATCC 17029] >gi|126102454|gb|ABN75132.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides ATCC 17029] (372 aa)
Score = 230, Expect = 3.5e-17, Identities = 85/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDS--NINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE   + + F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++  +   S  ++  +  E +P +  S       + +P V ++   K K+A++  + +   ++G+  +  + E+   L  +ATDG++LA     + P+  +     IV   ++ EL   + D +  I + + E+ + F      + SK+I+G +P+ SR+I T    ++ +  +   +A++R +A  SSE+   VKL+   + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIE----VVDRTPAVVERAGATTVSAVMLHEIVRKLPDGALVGLSEDPASGRLTVTAGRSVFSLATLPREDFPVMASSEYSSTFKAPAP-VLRRLFDKAKFAISTEETRY-YLNGVYMHVATGEEGPVLRCVATDGHRLARID-AALPEGAQGMPGVIVPRKTVNELRKLLDDDEVEIAVSVSETKVRFATPQITMTSKVIDGTFPDYSRVIPTANARRLEVDAQEFAKAVDR-VATVSSERSRAVKLSLDEDRLVLSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDMSAVYVVMPMR 371
>gi|114769643|ref|ZP_01447253.1| DNA polymerase III subunit beta [alpha proteobacterium HTCC2255] >gi|114549348|gb|EAU52230.1| DNA polymerase III subunit beta [alpha proteobacterium HTCC2255] (372 aa)
Score = 229, Expect = 3.6e-17, Identities = 87/371 (23%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + ++ L+ A+    S+ E   + P+    LIE    EI F  ++  I   + +V   E A     G   +       I+ KL +  +     D +  ++      S+ ++  +  E +P +  S    N  S      ++   K K+A++  + +   ++G+  +S   E  + L  +ATDG++LA    +  P+        IV   ++ EL   + D +  I + + E+ I F     I+ SK+I+G +P+ +R+I      ++ +      +A++R ++  SSE+   VKL    + L +S ++ D G ++E +      +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKVSIERSALLKAMSQAQSVVERRNTIPILANVLIEAEGGEISFRATDLDIEVVYKVVGMVERA-----GATTVGAHTLHEIVRKLPDGAMVELTDDATANRLDVVAGRSSFSLATLPREDFPIMANSEYACN-FSAQSETLRRLFDKSKFAISTEETRY-YLNGVYMHSSDGENGRVLRCVATDGHRLARIDTQ-LPEGADTLPGVIVPRKTVGELRKLLDDDEMKIAVSVSETKIRFSTPEIILTSKVIDGSFPDYTRVIPQGNTRRLEVDAAEFAQAVDR-VSTVSSERSRAVKLTLEDDRLVLSVNAPDSGAAEEELVV-AYADERLEIGFNAKYLLEIAGQVDRENAVFMFNSSGDPTLMREGNDESAVYVVMPMR 371
>gi|73667428|ref|YP_303444.1| DNA polymerase III, beta subunit [Ehrlichia canis str. Jake] >gi|72394569|gb|AAZ68846.1| DNA polymerase III, beta subunit [Ehrlichia canis str. Jake] (375 aa)
Score = 228, Expect = 4.6e-17, Identities = 101/373 (27%), Positives = 193/373 (51%)
  Q:     5 LKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM---ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD-PNFLQILVPIR 377
           +K+   VSK KL+ AL   NS+ E   S  V     IE  D++I  T+++  IS    +  S  A+I E G +++  +  + I+ KL N++     + K    VI+   + F   + ++D E++P I N    +   L +S +V      K K+A++  + + N ++G+  ++  ++  L   ATDG++L+  K   +     +F I++    +  +L+I+   +N   I + L +  I F+    I+ SK+I+G +P+ + II       V I  + L  A++R +++   +K  ++KL F    L +S +SSD G+++E +       E   I LN  +L+  L       I + F D+   VL++++++  +F  I++P+R
  S:     5 IKLNFFVSKDKLLQALSYINSVVEKRHSIVVLSCVRIEAKDHQINLTSTDLDIS----IIASISAHINENGVVVVSAQLLYDIVKKLPNDIEIKFVIGKDGRLVIECGRTEF--FLPVVDIEKFPIIENNELQNKFTLQVSELV--NLFGKTKFAISVEESRFN-LNGVYVHT--ADNILCCAATDGHRLSLAKLSKSQNMLSNFGIIVPKKTVNEILKIVSHGSNNDLISVSLSDRKICFEYQEYILISKVIDGTFPDYNAIIPKSHNKSVLIESEVLSNAIDR-VSVVVFDKVKVIKLRFVDNKLILSAASSDQGDAREELEVDYS-GEDMTIGLNARYLMEALYCVKGKCI-LSFYDAGTSVLMQEQENIDDFTYIIMPMR 374
>gi|77464921|ref|YP_354425.1| DNA polymerase III subunit beta [Rhodobacter sphaeroides 2.4.1] >gi|77389339|gb|ABA80524.1| DNA polymerase III, beta subunit [Rhodobacter sphaeroides 2.4.1] (372 aa)
Score = 228, Expect = 4.7e-17, Identities = 85/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDS--NINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK--TLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE   + + F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++  +   S  ++  +  E +P +  S       + +P V ++   K K+A++  + +   ++G+  +  + E+   L  +ATDG++LA     + P+  +     IV   ++ EL   + D +  I + + E+ + F      + SK+I+G +P+ SR+I T    ++ +  +   +A++R +A  SSE+   VKL+   + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERGALLKAVGQAQSVVERRNTIPILANVLIEAEGDTVSFRATDLDIE----VVDRTPAVVERAGATTVSAVMLHEIVRKLPDGALVGLSEDPASGRLTVTAGRSVFSLATLPREDFPVMASSEYSSTFKAPAP-VLRRLFDKAKFAISTEETRY-YLNGVYMHVATGEEGSVLRCVATDGHRLARID-AALPEGAQGMPGVIVPRKTVNELRKLLDDDEVEIAVSVSETKVRFATPQITMTSKVIDGTFPDYSRVIPTANARRLEVDAQEFAKAVDR-VATVSSERSRAVKLSLDEDRLVLSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFLFNSSGDPTLMREGNDMSAVYVVMPMR 371
>gi|39995112|ref|NP_951063.1| DNA polymerase III, beta subunit [Geobacter sulfurreducens PCA] >gi|39981874|gb|AAR33336.1| DNA polymerase III, beta subunit [Geobacter sulfurreducens PCA] (372 aa)
Score = 228, Expect = 5.0e-17, Identities = 74/371 (19%), Positives = 171/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT-LEIIATDGYKLA----HYKFESTPQDFRIVL--DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +     AL+    I E   + P+    LIE  ++ I+ T ++  +   S    S    +  +G+I +  K  + I+ +L +E I+     N  ++++       I  +  E++P      N+ + + I   +    I K  YA+  ++ K N+       S    ++ L ++ATDG++L+     +    +P+  + V+     + EL     +  T + +   +++ +    NT++  ++++G++P+ +R++    +  V +++     +L R ++I SSEK   +K++     + +S S+ +LG + E +       +   I  N  +L+ +L   D  ++ +   D   P ++R      F  +++P+R
  S:     1 MEFTIDRDTFSRALQKIQGIVEKRNTMPILSNVLIEALEDRIELTATDLEVGMKS----SYPTTVASQGKITVSAKKLYEIVKELPDETISFLTKANDYVEIRCGKAKFTIVGLSSEEFPYFP-KVNEESFIRIESGLLADMIEKTSYAICFDETKYNLNGTFVKASEEDGRSILRMVATDGHRLSITQREFNGAVSPEMAKGVIFPKKGIFELKKMCEEESTQLSLGFLDNSAVIVKGNTVVVMRLVDGEFPDYTRVVPVANDRIVTVARDPFFHSLRR-MSILSSEKFKGIKMDIQESGMVISSSNPELGEASEELDAV-FAGDAISIRFNAKYLIDVLAVLDESSVALHLKDELSPAIVRPADGDGFTAVIMPMR 371
>gi|83950589|ref|ZP_00959322.1| DNA polymerase III subunit beta [Roseovarius nubinhibens ISM] >gi|83838488|gb|EAP77784.1| DNA polymerase III subunit beta [Roseovarius nubinhibens ISM] (372 aa)
Score = 228, Expect = 5.6e-17, Identities = 84/371 (22%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ A+    S+ E   + P+    LIE   + ++F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++      S+ N+  + +E +P +  S    N  + +P V ++   K K+A++  + +   ++G+  +    +  K L  +ATDG++LA    +    +      IV   ++ EL   + D D  I + + E+ + F      + SK+I+G +P+ +R+I      ++ +      +A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKFSIERGILLKAVSQAQSVVERRNTIPILANVLIEAEGDTVQFRATDLDIE----VVDKAPAKVERAGSTTVSAVTLHEIVRKLPDGALVTLTDDGAAGRLAVEAGRSSFNLATLPKEDFPVMASSEYASNFSAKAP-VLRRLFDKSKFAISTEETRY-YLNGVYMHVSDGDGGKVLRCVATDGHRLARIDADLPDGAGDMPGVIVPRKTVGELRKLLDDDDAVIAVSVSETKVRFATPEITLTSKVIDGTFPDYTRVIPQGNTRRLEVDAAEFAKAVDR-VATVSSERSRAVKLALDEDRLILSVNAPDSGAAEEELAV-AYGDERLEIGFNAKYLLEIASQVDRENAVFMFNSSGDPTLMREGNDTSAVYVVMPMR 371
>gi|30020817|ref|NP_832448.1| DNA polymerase III subunit beta [Bacillus cereus ATCC 14579] >gi|29896369|gb|AAP09649.1| DNA polymerase III, beta chain [Bacillus cereus ATCC 14579] (376 aa)
Score = 228, Expect = 6.0e-17, Identities = 87/371 (23%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHS----IVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+  +   AL   N      F  P+  G  I  + + I    SN  I        ++   + A IL+ G I++  K F  II K+ ++ I ++  +  +IK+++     ++N    +++PN+    N   ++ +      +   +  +AV  N+ +  +++G+      S   L   ATD ++LA      S+      ++  + I  LL++++ ++  + I+  ES+IIF    T + S++IEG YPN+S +I    +  +N+ +K +++ ++R   ++S    + V L   +E  +++S ++S +G   ET        E    IS +  F++  L+    + IT+ F  S +P+L+   +    + ++ P+R
  S:     1 MEFIVNHKQFTQALSEVNKAISTKFLIPILSGIKITADQSGITLIASNSNIFIEKFIPVLIEDEKIATILKAGTIVVPAKYFIEIIKKMPSD-IAIKSKNEQIIKIQSEEITLSLNGFPADEFPNVPLIDNH-AEIKVETEQLIEVFKQTVFAVAKNESR-PVLTGVHIEL--SNNKLICAATDSHRLAIRETLLSSDVKANCIVPSATINELLKLMNSNSEFVYIYFSESHIIFTFGTTTLYSRLIEGKYPNISNLIPNDFKTIINVDRKKILQGVDRSSLLASEWANNNVNLEIINESTIKISSNASQIGKISETQQIDAIQGEKQLNISFDGRFMVDALRAIKEETITLSFGGSMRPILIEAGEQSAAVHLISPVR 374
>gi|69936425|ref|ZP_00631251.1| DNA polymerase III, beta chain [Paracoccus denitrificans PD1222] >gi|119385559|ref|YP_916614.1| DNA polymerase III subunit beta [Paracoccus denitrificans PD1222] >gi|119376154|gb|ABL70918.1| DNA polymerase III, beta subunit [Paracoccus denitrificans PD1222] (372 aa)
Score = 228, Expect = 6.0e-17, Identities = 83/371 (22%), Positives = 169/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT--LEIIATDGYKLAHYK--FESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+ A+    S+ E   + P+    LIE     + F  ++      + +     A +   G   +       I  KL +  +    +D +  ++      SN ++  +  E +P ++ S    N  S    V ++   K K+A++N + +   ++G+  +   +E    L  +ATDG++LA       +  +D    IV   ++ EL   + D +  I + + E+ + F      + SK+I+G +P+ SR+I +    K+ +      +A++R +A  SSE+   VKL+   + L +S ++ D G + E +      +EP  I  N  +L  +    + +N    F+ S    L+R+  D + + +++P+R
  S:     1 MKFSIERADLVKAVSQAQSVVERRNTIPILANVLIEAAPEGVSFRATD----LDTEIVDRAPAQVERPGATTVSAGMLNDIARKLPDGALVQLSLDAASGRLSVQAGRSNFSLATLPREDFPVMSSSEYGAN-FSAPAAVLRRLFDKSKFAISNEETRY-YLNGVYMHVAQTEDGPGLRCVATDGHRLARIDAPLPAGAEDMPGVIVPRKTVAELRKLLDDDEAEIAVSVSETKVRFATPTITLTSKVIDGTFPDYSRVIPSGNARKLEVDAGDFAKAVDR-VATVSSERSRAVKLSLDEDRLVLSVNAPDAGAADEELPV-AYADEPLEIGFNAKYLHEIASQIERENAVFLFNGSGDAALIREGGDTSAVYVVMPMR 371
>gi|47570668|ref|ZP_00241271.1| DNA polymerase III, beta subunit [Bacillus cereus G9241] >gi|47552665|gb|EAL11113.1| DNA polymerase III, beta subunit [Bacillus cereus G9241] (376 aa)
Score = 227, Expect = 6.5e-17, Identities = 89/371 (23%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED----ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+      AL   +         P+  G  I  + + I    SN  I     +  S D       L+ G I++  K F  II K+ ++++   K +   I +++     N+N     ++PN+    +D  ++ I       +  +  +AV  N+ +  +++G+          L   ATD ++LA      ST      ++  + I  LL++++ +   + I+L ES+IIF    T + S++IEG YPN+S +I    +  +NI ++ +++ ++R   ++S    + V L   +E  ++VS ++S +G   ET        E    IS +  F+L  L+    + +T+ FS S +P+L+        + ++ P+R
  S:     1 MEFIVNHKHFTQALSEVSKAISTKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSSMDDEQITTTLKAGTIVVPAKYFIEIIKKMPSDIVIKSK-NEQTITIQSEEITLNLNGFPANEFPNVP-QIDDHAEIQIETKQLIDAFKQTVFAVAKNESR-PVLTGVHIEL--DHNKLICAATDSHRLAIRETLISTNVKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISSLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIKVSSNASQIGKISETQQIDAIQGEKQFNISFDGRFMLDALRAIKEETVTLSFSGSMRPILVEAGTHSAAIHLISPVR 374
>gi|52142810|ref|YP_084019.1| DNA polymerase III subunit beta [Bacillus cereus E33L] >gi|51976279|gb|AAU17829.1| DNA polymerase III, beta subunit [Bacillus cereus E33L] (376 aa)
Score = 227, Expect = 7.0e-17, Identities = 88/371 (23%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSED----ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKET-----VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IV+      AL   +         P+  G  I  + + I    SN  I     +  + D      IL+ G I++  K F  II K+ ++++   K +   I +++     N+N     ++PN+    +   ++ I       +  +  +AV  N+ +  +++G+          L   ATD ++LA      ST      ++  + I  LL++++ +   + I+L ES+IIF    T + S++IEG YPN+S +I    +  +NI ++ +++ ++R   ++S    + V L   +E  +++S ++S +G   ET     +  K ++N    IS +  F+L  L+    + +T+ FS S +P+L+        + ++ P+R
  S:     1 MEFIVNHKHFTQALSDVSKAISAKAIIPILSGIKITADQSGITLIASNSNIFIEKFIPSAIDDKQITTILQAGTIVVPAKYFIEIIKKMPSDIVIKSK-NEQTITIQSGEITLNLNGFPANEFPNVP-QIDGHTEIQIETKQLIDAFKQTVFAVAKNESR-PVLTGVHIEL--DHNKLICAATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASERANNNVNLEIVNESTIQISSNASQIGKISETQQIDVIQGKKQLN----ISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVR 374
>gi|51473607|ref|YP_067364.1| DNA polymerase III subunit beta [Rickettsia typhi str. Wilmington] >gi|81610796|sp|Q68WW0|DPO3B_RICTY DNA polymerase III subunit beta >gi|51459919|gb|AAU03882.1| DNA-directed DNA polymerase III beta subunit; DNA nucleotidyltransferase (DNA-directed). [Rickettsia typhi str. Wilmington] (381 aa)
Score = 226, Expect = 8.2e-17, Identities = 94/371 (25%), Positives = 190/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKG--------KVNEPTPISLNNHFLLSLLKTFDNDNITVEFSD--SFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ +L    S+ E     P +    +   D  ++ +++N  +     +A      +L +G I + T+    I+ KL +  +TL ++D   +++K      N+  +    +P ++ S        IS   F K I   K++++ ++ + N ++GI  +    +K     +TDG++L+      E   ++F ++L     E +L+I+    +   +IEI L  + I F  + NTI+ SK+I+G +P+ S  I     +K+ I++K   +++ER +AI + EK   +KL+ S + LE+S      GN+KE ++             +E   I  N  +L  +LK   ++ + + FSD  +  PVL++  ++P  + +++P++
  S:     2 LKLIVETKTLVQSLGFARSVVEKRNVIPEYANIKLSAKDGNLELSSTNMDLYLSQKIA----VQVLSEGEITVSTQTLSDIVRKLPDSELTLTELDIMKLEIKGQNCQFNLFTLPVSSFPAMD-SIKPEVSFKISCADFAKIIESTKFSISLDETRYN-LNGIYLHI--KDKEFFAASTDGHRLSISWITLEEKIKNFGVILPQKSAEEILKIVKDLKNIHEDIEILLSSNKIKFICNENTILLSKLIDGTFPDYSAFIPKSSISKLVINRKIFADSIER-IAIITVEKFRAIKLSLSRKTLEISAVGEARGNAKEIITASQDKESFYEYNCDESLVIGFNPQYLEDVLKAVKSNLVELYFSDISASAPVLIKFPQNPKDIFVIMPVK 380
>gi|125622884|ref|YP_001031367.1| DNA polymerase III subunit beta [Lactococcus lactis subsp. cremoris MG1363] >gi|3913511|sp|O54376|DPO3B_LACLM DNA polymerase III subunit beta >gi|2909714|gb|AAC12964.1| polymerase III subunit DnaN [Lactococcus lactis] >gi|124491692|emb|CAL96610.1| beta subunit of DNA polymerase III [Lactococcus lactis subsp. cremoris MG1363] (380 aa)
Score = 226, Expect = 8.2e-17, Identities = 91/371 (24%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIV-AKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNI--SKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE-KDPNFLQILVPIR 377
           +K  ++KT   NAL++      +  + P      IEV +  I    SNG IS  + + A ++DA++L    G +L++   F  ++S+L    +TLE ++    +V  ++  S I +  +D E YP++    ++ + L +   V K+  ++  +AV+  +E   I +G+   ++S+ + L+ +ATD ++++      E T   F ++L    I     +   D   IEIF+  S ++F+       S++IEG YP+ +R+I    +  +++      L   ++R   ++       VKL  S + +  + +S ++G+  E ++   K      IS N  +L+  LK      + + F  + +P  L+   ++  F+Q++ P+R
  S:     2 IKFSINKTAFQNALKITKQAIGSKVTIPALTKLKIEVEEKGITLIGSNGQISIKNFLPADNKDASMLISGTGSVLLEAAFFENVVSQLPE--VTLEFIEKEQKQVLLTSGKSEITLKGLDSEIYPHLQ-EISEGSSLKMKVKVLKEIFTETVFAVST-QENRPIFTGVHLETLSTGE-LKAVATDSHRMSQRLLPLEDTDLKFDVILPSKSINSFKNVFTNDEEEIEIFISGSQMLFQNETISYYSRLIEGSYPDTNRLIPNEADYTLDLVFDAAQLRHTMDRARLLTVMTTNGTVKLTVSGDSVVTTANSPEVGSVHEELTALSKEGNDLSISFNPEYLIDALKVIKAPEVRIRFISNVRPFTLQPRNEESGFVQLITPVR 378
>gi|159184247|ref|NP_353331.2| DNA polymerase III subunit beta [Agrobacterium tumefaciens str. C58] >gi|159139574|gb|AAK86116.2| DNA polymerase III, beta chain [Agrobacterium tumefaciens str. C58] (372 aa)
Score = 226, Expect = 8.4e-17, Identities = 79/371 (21%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISS--EKTLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + ++ L+ +L   + + E   + P+    L+  +   +    ++  +     + ++  A + + G   +     + I+ KL +  E++     D S + V +     ++  + E  +P++    FS+       +     K  I + ++A++  + +   ++GI F++I S  E  L  +ATDG++LA          E  P        V  ++ L++  + +  +E+   ++ I   + + ++ SK+I+G +P+  R+I T  + ++ +  +T   A++R ++  SSE+   VKL  +   L ++ ++ D G++ E V+  G  N+   I  N  +LL +      ++     +D+  P L+RD    + L +L+P+R
  S:     1 MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRASGANLDMKATDLDLE----ITEATPAMVEQAGATTVPAHLLYEIVRKLPDGSEVLLATNPDGSSMTVASGRSKFSLQCLPEADFPDLTAGTFSHT----FKLKAADLKMLIDRTQFAISTEETRY-YLNGIFFHTIESNGELKLRAVATDGHRLARADVDAPSGSEGMPGIIIPRKTVGELQKLMDNPELEVTVEVS--DAKIRLAIGSVVLTSKLIDGTFPDYQRVIPTGNDKEMRVDCQTFARAVDR-VSTISSERGRAVKLALTDGQLTLTVNNPDSGSATEEVAV-GYDNDSMEIGFNAKYLLDITSQLSGEDAIFLLADAGSPTLVRDTAGDDALYVLMPMR 371
>gi|83591342|ref|YP_425094.1| DNA polymerase III subunit beta [Rhodospirillum rubrum ATCC 11170] >gi|83574256|gb|ABC20807.1| DNA polymerase III, beta subunit [Rhodospirillum rubrum ATCC 11170] (372 aa)
Score = 225, Expect = 1.2e-16, Identities = 86/371 (23%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNS---VIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +T L+ +L    S+ E   + P+     +E  ++      ++  +     + ++  A  L  G         + I+ KL +   + L    N    V+K   S F  +++ +  E +P ++   FS++     S+     +  I + ++A++  + +   ++GI  ++  S     L  +ATDG++LA  +      +      IV   ++ EL   I +   +I + L E  I F    T + SK+I+G +P+  R+I T  +  + +  K   +A +R  AI S+EK   +K+  +   + +S SS D G++ E +    + +    I  N+ +LL +L   +  ++ + F+D+  P ++RD  D + + +L+P+R
  S:     1 MKLTIERTALLKSLGHVQSVVERRNTIPILSNVRMETGESGFSLNATDMDLE----IVETVTATTLAPGATTAPAHTLYDIVRKLPDGSQVELSYDGNDGQLVLKAGRSRF--SLSCLPVEDFPALSAGEFSHS----FSLPATDLRGLIDRTRFAISTEETRY-YLNGIYLHATESAGVPVLRAVATDGHRLARAEIPLPAGAAGMPGVIVPRKTVGELRKLIEETGMDITVGLSEQKIRFDFDETRLTSKLIDGTFPDYERVIPTENDKVLEVDCKLFAQAADRVSAI-STEKSRAIKVAVAKGTMTLSASSPDAGSAVEEIEAAYQ-STSLEIGFNSRYLLDILGQVEGGSVRLTFADAASPTVIRDVADASAVYVLMPMR 371
>gi|86139416|ref|ZP_01057985.1| DNA polymerase III subunit beta [Roseobacter sp. MED193] >gi|85823919|gb|EAQ44125.1| DNA polymerase III subunit beta [Roseobacter sp. MED193] (373 aa)
Score = 224, Expect = 1.3e-16, Identities = 86/371 (23%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTP---QDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI + +  L+ A+    S+ E   + P+    LIE   +  +F  ++  I     V     A +   G   +       I+ KL +  +     D +  ++      SN ++  +  E +P +  S    N  + +  + ++   K K+A++  + +  +       S ++E  K L  +ATDG++LA     S P   +D    IV   ++ E+   + D + +I + + E+ + F   N  + SK+I+G +P+ +R+I      ++ +       A++R +A  SSE+   VKL    + L +S ++ D G ++E ++     +E   I  N  +LL +    D +N    F+ S  P L+R+  D + + +++P+R
  S:     1 MKISIERGTLLKAVAQAQSVVERRNTIPILANVLIEAEGDVAQFRATDLDIE----VVDKAPAQVERAGATTVAATTLHEIVRKLPDGALVTLTADAATGRLTVEAGRSNFSLATLPREDFPVMASSEYHSN-FTANAAMLRRLFDKSKFAISTEETRYYLNGVYMHVSDAAEGGKVLRCVATDGHRLARID-ASLPVGAEDMPGVIVPRKTVGEMRKLLDDDEMDIAVSVSETKVRFATPNITLTSKVIDGTFPDYTRVIPAGNTRRLEVDADEFARAVDR-VATVSSERSRAVKLQLEEDRLILSVNAPDSGAAEEELAV-AYADERLEIGFNAKYLLEIANQVDRENAVFMFNSSGDPTLMREGSDESAVYVVMPMR 372
>gi|67772421|gb|AAY79411.1| DNA polymerase beta subunit [Ehrlichia chaffeensis] (375 aa)
Score = 224, Expect = 1.7e-16, Identities = 103/373 (27%), Positives = 193/373 (51%)
  Q:     5 LKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD-PNFLQILVPIR 377
           +K+   VSK KL+ AL   NSI E   S  V     IE  D EIK T+++  IS    +  S  A++   G +++  +  + I+ KL N++ I     ++  + +K    +  + ++D E++P I N    +   L +S +V      K K+A++  + + N ++G+  ++  S   L   ATDG++L+  K   +     +F I++    +  +L+I+   +    I I L +  I F+    I+ SK+I+G +P+ + II    +  V I  +TL  A++R +++   +K  ++KL F S  L +S +SSD G+++E +       E   I LN  +L+  L       + + F D+   VL+++E++  +F  I++P+R
  S:     5 IKLNFFVSKDKLLQALSYINSIVEKRHSIVVLSCVRIEARDQEIKLTSTDLDIS----IIASITAHVNVNGVVVVSAQLLYDIVKKLPNDIEIKFFIGEDGRLTIKCGRTEFFLPVVDIEKFPIIENNELQNKFTLQVSELV--SLFGKTKFAISIEESRFN-LNGLYVHT--SNNILCCAATDGHRLSLTKLSQSQNVLSNFGIIVPKKTVNEILKIVSHGSGNDLISISLSDRKICFEYKEYILISKVIDGTFPDYNSIIPRSHDKNVLIESETLSNAIDR-VSVVVFDKVKVIKLRFVSNKLILSAASSDQGDAREELEVDYS-GEDMTIGLNARYLMEALYCIKGKCL-LSFYDAGTSVLIQEEENIDDFTYIIMPMR 374
>gi|68171925|ref|ZP_00545242.1| DNA polymerase III, beta chain [Ehrlichia chaffeensis str. Sapulpa] >gi|67998647|gb|EAM85383.1| DNA polymerase III, beta chain [Ehrlichia chaffeensis str. Sapulpa] (375 aa)
Score = 223, Expect = 1.8e-16, Identities = 103/373 (27%), Positives = 193/373 (51%)
  Q:     5 LKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD-PNFLQILVPIR 377
           +K+   VSK KL+ AL   NSI E   S  V     IE  D EIK T+++  IS    +  S  A++   G +++  +  + I+ KL N++ I     ++  + +K    +  + ++D E++P I N    +   L +S +V      K K+A++  + + N ++G+  ++  S   L   ATDG++L+  K   +     +F I++    +  +L+I+   +    I I L +  I F+    I+ SK+I+G +P+ + II    +  V I  +TL  A++R +++   +K  ++KL F S  L +S +SSD G+++E +       E   I LN  +L+  L       + + F D+   VL+++E++  +F  I++P+R
  S:     5 IKLNFFVSKDKLLQALSYINSIVEKRHSIVVLSCVRIEARDQEIKLTSTDLDIS----IIASITAHVNVNGVVVVSAQLLYDIVKKLPNDIEIKFFIGEDGRLTIKCGRTEFFLPVVDIEKFPIIENNELQNKFTLQVSELV--SLFGKTKFAISIEESRFN-LNGLYVHT--SNNILCCAATDGHRLSLTKLSQSQNILSNFGIIVPKKTVNEILKIVSHGSGNDLISISLSDRKICFEYKEYILISKVIDGTFPDYNSIIPRSHDKNVLIESETLSNAIDR-VSVVVFDKVKVIKLRFVSNKLILSAASSDQGDAREELEVDYS-GEDMTIGLNARYLMEALYCIKGKCL-LSFYDAGTSVLIQEEENIDDFTYIIMPMR 374
>gi|116510845|ref|YP_808061.1| DNA polymerase III subunit beta [Lactococcus lactis subsp. cremoris SK11] >gi|116106499|gb|ABJ71639.1| DNA polymerase III, beta subunit [Lactococcus lactis subsp. cremoris SK11] (380 aa)
Score = 223, Expect = 2.1e-16, Identities = 90/371 (24%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIV-AKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNI--SKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE-KDPNFLQILVPIR 377
           +K  ++KT   NAL++      +  + P      IEV +  I    SNG IS  + + A ++DA++L    G +L++   F  ++S+L    +TL+ ++    +V  ++  S I +  +D E YP++    ++ + L +   V K+  ++  +AV+  +E   I +G+   ++S+ + L+ +ATD ++++      E T   F ++L    I     +   D   IEIF+  S ++F+       S++IEG YP+ +R+I    +  +++      L   ++R   ++       VKL  S + +  + +S ++G+  E ++   K      IS N  +L+  LK      + + F  + +P  L+   ++  F+Q++ P+R
  S:     2 IKFSINKTAFQNALKITKQAIGSKVTIPALTKLKIEVEEKGITLIGSNGQISIKNFLPADNKDASMLISGTGSVLLEAAFFENVVSQLPE--VTLDFIEKEQKQVLLTSGKSEITLKGLDSEIYPHLQ-EISEGSSLKMKVKVLKEIFTETVFAVST-QENRPIFTGVHLETLSTGE-LKAVATDSHRMSQRLLPLEDTDLKFDVILPSKSINSFKNVFTNDEEEIEIFISGSQMLFQNETISYYSRLIEGSYPDTNRLIPNEADYTLDLVFDAAQLRHTMDRARLLTIMTTNGTVKLTVSGDSVVTTANSPEVGSVHEELTALSKEGNDLSISFNPEYLIDALKVIKAPEVRIRFISNIRPFTLQPRNEESGFVQLITPVR 378
>gi|89052493|ref|YP_507944.1| DNA polymerase III subunit beta [Jannaschia sp. CCS1] >gi|88862042|gb|ABD52919.1| DNA polymerase III, beta subunit [Jannaschia sp. CCS1] (372 aa)
Score = 223, Expect = 2.2e-16, Identities = 84/371 (22%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITL-EKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR------IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ A+    S+ E   + P+    LIE     + F  ++  I     V     A +   G   +       I+ KL +  +++L E    S + ++       +  +  E +P +  S +     S      ++   K K+A++  + +   ++G+ F+    +  K L  +ATDG++LA  + +S   D        IV   ++ EL   + D D  I + + E+ I F   +  + SK+I+G +P+ +R+I      ++ +      +A++  +A  SSE+   VK+    + L +S ++ D GN++  +      +E   I  N  +LL +    D +N    FS   +P L+R+  D + + +++P+R
  S:     1 MKLSIERATLLRAVSQAQSVVERRNTIPILANVLIEAEGETVSFRATDLDIE----VVDKAPAQVERAGATTVSAVTLHEIVRKLPDGSLVSLTEDTTTSRLTIEAGRSSFQLATLPREDFP-VMASTDYAANFSAKAPELRRLFDKSKFAISTEETRY-YLNGVYFHIAEGDNGKALRAVATDGHRLA--RIDSALPDGAQEMPGVIVPRKTVGELRKLLDDDDAQIAVSVSETKIRFATPDITLTSKVIDGTFPDYTRVIPAGNTRRMEVDAGDFAKAVDL-VATVSSERSRAVKMALDEDRLMLSVNAPDSGNAEAELVV-AYADEKLEIGFNAKYLLEIASQVDRENAVFMFSSPAEPTLMREGNDDSAIYVVMPMR 371
>gi|85708877|ref|ZP_01039943.1| DNA polymerase III beta subunit [Erythrobacter sp. NAP1] >gi|85690411|gb|EAQ30414.1| DNA polymerase III beta subunit [Erythrobacter sp. NAP1] (375 aa)
Score = 223, Expect = 2.2e-16, Identities = 86/371 (23%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDN-EIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSN---TIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L    S+ E   + P+    LI+ +D   +K   ++  +    +V     +++   G I +     F I  KL +   ++LE  +N  ++VK       +  +  + +P I    +      I      + I   ++A++  + +  +       +   E  L+  ATDG++LA +        E  P        V+ +  LLE    D  +++ L  S I F +      ++ SK+I+G +P+ SR+I T  +  + +  K   E ++R +A  ++EK   VK+   ++ + +S +S D GN+ E +    K ++   I  N ++L  +L  FD + I +  +D+  P L+R+      L +L+P+R
  S:     1 MKATIERATLLRCLSHVQSVVERRNTIPILSNVLIDASDGGSVKVMATDLDLQ---VVETMNASSVESPGAITVSAHLLFDIARKLPDGAQVSLETAENR-MEVKAGRARFKLPTLPRDDFPVI-VEGDLPTSFEIPARTLAQMIDATRFAISTEETRYYLNGIFLHVTDEDEPVLKAAATDGHRLARFTLARPDGAEGMPDVIVPRKAVAELRKLLEEA-LDGAVQVDLSASKIRFTLGGEGGVVLTSKLIDGTFPDYSRVIPTGNDKLLKVDPKLFFEGVDR-VATIATEKTRAVKMGLDADKVTLSVTSPDNGNAAEELMADYK-SDGFEIGFNANYLKDILGQFDAEEIELHLADAGAPTLIRESDTSPALYVLMPMR 374
>gi|15671984|ref|NP_266158.1| DNA polymerase III subunit beta [Lactococcus lactis subsp. lactis Il1403] >gi|18202807|sp|Q9CJJ1|DPO3B_LACLA DNA polymerase III subunit beta >gi|12722837|gb|AAK04100.1|AE006239_2 DNA polymerase III, beta chain (EC 2.7.7.7) [Lactococcus lactis subsp. lactis Il1403] (380 aa)
Score = 222, Expect = 2.3e-16, Identities = 90/371 (24%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIV-AKSEDANIL--EKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNI--SKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE-KDPNFLQILVPIR 377
           +K  ++K    NALR+      +  + P      IEV +N I    SNG IS  + +   ++DA++L    G +L++   F  ++S+L    +TLE  +    +V  ++  S I +  +D E YP++    ++ + L +   V K+  ++  +AV+  +E   I +G+   ++S+ + L+ +ATD ++++      E +   F ++L    I     +   D   IEIF+  S ++F+       S++IEG YP+ +R+I    +  +++      L   ++R   ++       VKL  S + +  + +S ++G+  E ++   K      IS N  +L+  LK      + + F  + +P  L+   ++  F+Q++ P+R
  S:     2 IKFSINKNAFQNALRITKQAIGSKVTIPALTKLKIEVEENGITLIGSNGQISIKNFLPVDNKDASMLISGTGSVLLEAAFFENVVSQLPE--VTLEFTEKEQKQVLLTSGKSEITLKGLDSEIYPHLQ-EISEGSSLKMKVKVLKEIFTETVFAVST-QENRPIFTGVHLETLSTGE-LKAVATDSHRMSQRLLPLEDSELKFDVILPSKSINSFKNVFTNDEEEIEIFISGSQMLFRNETISYYSRLIEGSYPDTNRLIPNEADYTLDLVFDAAQLRHTMDRARLLTVMTTNGTVKLTVSGDSVVTTANSPEVGSVHEELTALSKEGNDLAISFNPEYLIDALKVIKAPEVRIRFISNVRPFTLQPRNEESGFVQLITPVR 378
>gi|126172259|ref|YP_001048408.1| DNA polymerase III, beta subunit [Shewanella baltica OS155] >gi|149116671|ref|ZP_01843391.1| DNA polymerase III, beta subunit [Shewanella baltica OS223] >gi|152998557|ref|YP_001364238.1| DNA polymerase III, beta subunit [Shewanella baltica OS185] >gi|160873128|ref|YP_001552444.1| DNA polymerase III, beta subunit [Shewanella baltica OS195] >gi|125995464|gb|ABN59539.1| DNA polymerase III, beta subunit [Shewanella baltica OS155] >gi|146863396|gb|EDK48934.1| DNA polymerase III, beta subunit [Shewanella baltica OS223] >gi|151363175|gb|ABS06175.1| DNA polymerase III, beta subunit [Shewanella baltica OS185] >gi|160858650|gb|ABX47184.1| DNA polymerase III, beta subunit [Shewanella baltica OS195] (366 aa)
Score = 221, Expect = 3.1e-16, Identities = 85/371 (22%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFEST-PQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L+EV+ + +K T ++  +     V    D   +E+GR  +  K    I+  L  +  + +E+ DN  +++   S F  ++  +  E+YPN+  ++    + S+   V K  I   ++++ N   +   ++G+ F +      L  IATDG++LA  H   E+  P+   IV    ++E+   +   D +I I + ++ I    +NT+  SK+++G +P+  R++    +  V  S+  L +AL R  +I S+EK   V++   + +L+++ ++ +   ++E +  +   N+   I  N  +LL +L    +D++ +   D     L+ +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKLTGTDLEVELVGQVVVHGD---IEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRF--SLATLPAEEYPNVE-AFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRY-YLNGLLFET--EGNVLRAIATDGHRLALSHRTIEAQLPEKQVIVPRKGVMEMARLLESDDLDIAIAIGDNAIRATTANTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRA-SILSNEKFRGVRIQLENGLLKITANNPEQEEAEEIIDVEYN-NQALEIGFNVSYLLDVLNNLKSDDVRITLIDGNSSALIENHLEEDSMYVVMPMR 365
>gi|86355975|ref|YP_467867.1| DNA polymerase III subunit beta [Rhizobium etli CFN 42] >gi|86280077|gb|ABC89140.1| DNA polymerase III, beta chain protein [Rhizobium etli CFN 42] (372 aa)
Score = 221, Expect = 3.1e-16, Identities = 76/371 (20%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISS--EKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + ++ L+ +L   + + E   + P+    L++ +   +    ++  +     + ++  AN+ + G   +     + I+ KL +  E++     +   + V++     ++  + E  +P++    F+++      +     K  I + ++A++  + +   ++GI F++I S  E  L  +ATDG++LA    ++ P        I++    +  L +++D  +  + + + ++ I   + + ++ SK+I+G +P+  R+I T  + ++ +   T  +A++R ++  SSE+   VKL  S   L ++ ++ D G++ E V+  G   +   I  N  +LL +      +      +D+  P L+RD    + L +L+P+R
  S:     1 MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQNLDMKATDLDLE----ITEATPANVEQAGATTVPAHLLYDIVRKLSDGAEVLLATSTEGGSMTVQSGRSKFSLQCLPESDFPDLTAGTFTHS----FKLKATDLKMLIDRTQFAISTEETRY-YLNGIFFHTIESNGELKLRAVATDGHRLARADVDA-PSGSEGMPGIIIPRKTVGELQKLVDNPEAIVTVEVSDAKIRMTIGSIVLTSKLIDGTFPDYQRVIPTGNDKEMRVDCTTFAQAVDR-VSTISSERGRAVKLALSEGQLMLTVNNPDSGSATEEVAV-GYDTDSMEIGFNAKYLLDITAQLSGEEAIFLLADAGSPTLIRDTAGDDALYVLMPMR 371
>gi|88658616|ref|YP_507795.1| DNA polymerase III, beta subunit [Ehrlichia chaffeensis str. Arkansas] >gi|88600073|gb|ABD45542.1| DNA polymerase III, beta subunit [Ehrlichia chaffeensis str. Arkansas] (369 aa)
Score = 221, Expect = 3.2e-16, Identities = 103/371 (27%), Positives = 191/371 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD-PNFLQILVPIR 377
           M   VSK KL+ AL   NSI E   S  V     IE  D EIK T+++  IS    +  S  A++   G +++  +  + I+ KL N++ I     ++  + +K    +  + ++D E++P I N    +   L +S +V      K K+A++  + + N ++G+  ++  S   L   ATDG++L+  K   +     +F I++    +  +L+I+   +    I I L +  I F+    I+ SK+I+G +P+ + II    +  V I  +TL  A++R +++   +K  ++KL F S  L +S +SSD G+++E +       E   I LN  +L+  L       + + F D+   VL+++E++  +F  I++P+R
  S:     1 MNFFVSKDKLLQALSYINSIVEKRHSIVVLSCVRIEARDQEIKLTSTDLDIS----IIASITAHVNVNGVVVVSAQLLYDIVKKLPNDIEIKFFIGEDGRLTIKCGRTEFFLPVVDIEKFPIIENNELQNKFTLQVSELV--SLFGKTKFAISIEESRFN-LNGLYVHT--SNNILCCAATDGHRLSLTKLSQSQNVLSNFGIIVPKKTVNEILKIVSHGSGNDLISISLSDRKICFEYKEYILISKVIDGTFPDYNSIIPRSHDKNVLIESETLSNAIDR-VSVVVFDKVKVIKLRFVSNKLILSAASSDQGDAREELEVDYS-GEDMTIGLNARYLMEALYCIKGKCL-LSFYDAGTSVLIQEEENIDDFTYIIMPMR 368
>gi|88607712|ref|YP_505645.1| DNA polymerase III, beta subunit [Anaplasma phagocytophilum HZ] >gi|88598775|gb|ABD44245.1| DNA polymerase III, beta subunit [Anaplasma phagocytophilum HZ] (375 aa)
Score = 221, Expect = 3.7e-16, Identities = 91/367 (24%), Positives = 183/367 (49%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEII-----DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +S+  L+ AL   +S+ E   S  V     IE   + I+FT+++  IS  + V     AN+   G  +   +  + I+ KL  E     K+++  + V        ++++  E++P+I  S  D     I      + ++K K++++  + + N + G+ F+    ++ L  +ATDG++L+  K  S P+       +++    +  +L+II     D    + + +    I F+     + SK+++G +P+ + II T   N V+I    L  A++R +++   +K   +KL+F+   L +S +SSD G++ E +S   + +E   I LN  +L+ +L +       + FSD    VL++D +    + I++P+R
  S:    13 ISREDLLQALNYVSSVIERRNSIAVLSCVRIEAKGSVIEFTSTDLDISIEACV----QANVATGGVAVASAQLLYDIVRKLSGEADVRFKLNDGKLLVACGNARFYLHVISPEKFPDIEGSSLDCG-FDIPATSLAELLNKTKFSMSVEESRYN-LRGVYFHV--DDEMLCCVATDGHRLSLAKI-SKPEGLHSGIAVIIPRKTVNEVLKIIGHGGGDAAQMVSVGISNRKICFRYKGYFMVSKVLDGTFPDYAAIIPTECGNSVSIDASVLQSAVDR-VSVVVFDKVKAIKLSFTEGKLVLSSASSDQGDASEELSVDYEGDE-VVIGLNARYLMEVLGSIKG-VCEIVFSDGSAAVLVKDGE--YGMHIVMPMR 374
>gi|83309736|ref|YP_420000.1| DNA polymerase III subunit beta [Magnetospirillum magneticum AMB-1] >gi|82944577|dbj|BAE49441.1| DNA polymerase sliding clamp subunit [Magnetospirillum magneticum AMB-1] (379 aa)
Score = 220, Expect = 4.8e-16, Identities = 79/371 (21%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSI-----VAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEK-VDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ +L    S+ E   + P+          + +K     G++S ++      + ++  A+++  G        F+ I+ KL +   + +E   ++  + +++     ++  +  E +P ++     +   S+S    K  I + ++A++  + +   ++GI  ++ +S+    L  +ATDG++LA  +  + P         IV   ++ E+   I + D  I + L E+ + F   + ++ SK+I+G +P+  R+I    +  + +  K+  +A++R  AI S+EK   +KL        +S SS++ G++ E +      + P  I  N+ +L+ +L   + D      +D+  P ++R+  D   + +L+P+R
  S:     8 MKLTIERAALLKSLAHVQSVVERRTTIPIL---------SNVKLEGRGGLLSLNATDMDLDIIEAVPADVVRPGATTAPAHTFYEIVRKLPDGSQVEIEHDAESGQLTLRSGRSKFSLACLPVEDFPVLSGGELPFT-FSLSAAELKTLIDRTRFAISTEETRY-YLNGIYLHAAASDGVDVLRAVATDGHRLARVEI-TLPSGAAGMPGIIVPRKTVAEIRKLIDETDGEITVSLSETKLKFAFGDAVLTSKLIDGTFPDYERVIPADNDKVLVVDCKSFAQAVDRVSAI-STEKSRAIKLALEKGSATLSASSAENGSAVEEIEAD-YTSTPLEIGFNSRYLMDILAQVEGDTARFAMADAASPTVVREMTDGGAIYVLMPMR 378
>gi|114045515|ref|YP_736065.1| DNA polymerase III, beta subunit [Shewanella sp. MR-7] >gi|113886957|gb|ABI41008.1| DNA polymerase III, beta subunit [Shewanella sp. MR-7] (366 aa)
Score = 219, Expect = 5.3e-16, Identities = 86/371 (23%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFEST-PQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L+EV+ + +K T ++  +    +V ++     +E+GR  +  K    I+  L  +  + +E+ DN  +++   S F  ++  +  E+YPN+  ++    + ++   V K  I   ++++ N   +   ++G+   +      L  IATDG++LA  H   ++  P+   IV    ++E+  LLE  D D  I I + ++ I    S T+  SK+++G +P+  R++    +  V  S+    +AL R  +I S+EK   V++   + +L+++ ++ +   ++E +      N+P  I  N  +LL +L    +D++ +   D     LL +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVE---LVGQAVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRF--SLATLPAEEYPNVE-AFQAEIEFTLKQGVLKSLIDATQFSMANQDVRY-YLNGLLLET--EGNVLRAIATDGHRLALSHRTIDAQLPEKQVIVPRKGVMEMARLLEADDLD--IAIAIGDNAIRATTSTTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRA-SILSNEKFRGVRIQLEAGLLKITANNPEQEEAEEIIDVDYN-NQPLEIGFNVSYLLDVLNNLKSDDVRITLIDGNSSALLENHLEEDSMYVVMPMR 365
>gi|113968348|ref|YP_732141.1| DNA polymerase III, beta subunit [Shewanella sp. MR-4] >gi|117918469|ref|YP_867661.1| DNA polymerase III, beta subunit [Shewanella sp. ANA-3] >gi|113883032|gb|ABI37084.1| DNA polymerase III, beta subunit [Shewanella sp. MR-4] >gi|117610801|gb|ABK46255.1| DNA polymerase III, beta subunit [Shewanella sp. ANA-3] (366 aa)
Score = 219, Expect = 5.7e-16, Identities = 86/371 (23%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFEST-PQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L+EV+ + +K T ++  +    +V ++     +E+GR  +  K    I+  L  +  + +E+ DN  +++   S F  ++  +  E+YPN+  ++    + ++   V K  I   ++++ N   +   ++G+   +      L  IATDG++LA  H   ++  P+   IV    ++E+  LLE  D D  I I + ++ I    S T+  SK+++G +P+  R++    +  V  S+    +AL R  +I S+EK   V++   + +L+++ ++ +   ++E +      N+P  I  N  +LL +L    +D++ +   D     LL +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVE---LVGQAVIHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRF--SLATLPAEEYPNVE-AFQAEIEFTLKQGVLKSLIDATQFSMANQDVRY-YLNGLLLET--EGNVLRAIATDGHRLALSHRTIDAQLPEKQVIVPRKGVMEMARLLEADDLD--IAIAIGDNAIRATTSTTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRA-SILSNEKFRGVRIQLEAGLLKITANNPEQEEAEEIIDVDYN-NQPLEIGFNVSYLLDVLNNLKSDDVRITLIDGNSSALLENHLEEDSMYVVMPMR 365
>gi|116750114|ref|YP_846801.1| DNA polymerase III, beta subunit [Syntrophobacter fumaroxidans MPOB] >gi|116699178|gb|ABK18366.1| DNA polymerase III, beta subunit [Syntrophobacter fumaroxidans MPOB] (369 aa)
Score = 219, Expect = 5.8e-16, Identities = 70/370 (18%), Positives = 187/370 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNE-IKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSL--------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MK+ + K  LI  L+   +I++   S PV    LI  ++ + ++F+ ++  +S  +         +   G   +  +  F I+ +L    + LE + N+ +++ +      ++ +  E +P +NF Y +   + +     K++++K  ++V  +++  +I +G   ++++ E +   +++DG++L++ +    P++    LD+          ++ +L +++ +  + + + E  ++ +  +T ++ ++++ ++P    II   +   + +  +    AL+R   +S++  +  V+   +  VLE+   + +LGN+ ET+  + +  E   ++ N  +LL  ++  D+  +  E+ D F   +    +DP FL +++P+
  S:     1 MKVRLEKGNLIQILQKVQNITDKKSSMPVLSNVLISSSEQQTVEFSATDLELSLWT----QTGGQVETPGSSTVSARKLFEIVRELPQPEVLLEGLPNNKMQILSGRARFELSTIPGEDFPQLNF-YRETELVKVDAAALKRALTKTLHSVPADEDSFSI-AGTFLHAVN-EDSYRFVSSDGHRLSYCE---VPKEAFGTLDIREGLIIPRKGVQEILRMLEKEEEVVLGVHEKYVVLRTPSTFLSVQLLDAEFPEYKTIIPEERPFFIMLDLEQFFSALKRSSILSNNVWRH-VRFILTKGVLELEAGNPELGNANETLDVEYE-GEDFSVAFNIRYLLETIQALDSPRVRFEWVDQFHGGVFVGSEDPGFLSLVMPM 367
>gi|15640045|ref|NP_062597.1| DNA polymerase III subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121727891|ref|ZP_01680950.1| DNA polymerase III, beta chain [Vibrio cholerae V52] >gi|147674757|ref|YP_001218399.1| DNA polymerase III subunit beta [Vibrio cholerae O395] >gi|153819849|ref|ZP_01972516.1| DNA polymerase III, beta chain [Vibrio cholerae NCTC 8457] >gi|153821934|ref|ZP_01974601.1| DNA polymerase III, beta chain [Vibrio cholerae B33] >gi|194532270|ref|YP_002067700.1| DNA polymerase III, beta chain [Vibrio cholerae MO10] >gi|14547987|sp|Q9KVX5|DPO3B_VIBCH DNA polymerase III subunit beta >gi|9654404|gb|AAF93191.1| DNA polymerase III, beta chain [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121629835|gb|EAX62250.1| DNA polymerase III, beta chain [Vibrio cholerae V52] >gi|125618271|gb|EAZ46813.1| DNA polymerase III, beta chain [Vibrio cholerae MO10] >gi|126509610|gb|EAZ72204.1| DNA polymerase III, beta chain [Vibrio cholerae NCTC 8457] >gi|126520554|gb|EAZ77777.1| DNA polymerase III, beta chain [Vibrio cholerae B33] >gi|146316640|gb|ABQ21179.1| DNA polymerase III, beta chain [Vibrio cholerae O395] (366 aa)
Score = 219, Expect = 6.5e-16, Identities = 84/371 (22%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKE--TVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + ++ LI  L+  +       S P+    L++V +N++  T ++  +   S V    +    E G I +  + F  I   L +  +    ++   I+V++     ++  +    +PNI     DW    Q+S++    +  I K ++++ N   +   ++G+ F    +  TL  +ATDG+++A  + +      Q   IV    ++EL+  +   +  + + +  SN+  +V++ +  SK+++G +P+  R++       +    + L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E   VS +G   EP  I  N  ++L +L T   DN+ V  SD+    L+ +  D + + +++PIR
  S:     1 MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLEGE---FEAGSITVPARKFLDICRGLPDSAVITVLLEGDRIQVRSGRSRFSLATLPASDFPNIE----DWQSEVQVSLTQAELRGLIEKTQFSMANQDVRY-YLNGMLFEIDGT--TLRSVATDGHRMAVAQAQLGADFAQKQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRA-AILSNEKFRGVRVNLADNGMRITANNPEQEEAEELLDVSFEG---EPIEIGFNVSYILDVLNTLRCDNVRVSMSDANASALVENVDDDSAMYVVMPIR 365
>gi|157827170|ref|YP_001496234.1| DNA polymerase III subunit beta [Rickettsia bellii OSU 85-389] >gi|157802474|gb|ABV79197.1| DNA polymerase III subunit beta [Rickettsia bellii OSU 85-389] (379 aa)
Score = 219, Expect = 6.6e-16, Identities = 93/371 (25%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNE--------PTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ AL   +S+ E            +   D  ++ +++N        +++     ++ +G + + TK    I+ KL +  +TL  +  + +++       N+  +  E +P ++ + N      IS   F K I   K++V+ ++ + N ++GI  +   SE      +TDG++L+          +DF ++L     E +L+I+    + + +IEI L  + I F  + N I+ SK+I+G +P+ S  I     +K+ I++K   + +ER +AI + EK   VKL+ S E LE+S      GN+KE ++   +              I  N  +L  +LK   +D + + FS    PVL++  + P  + +++P++
  S:     2 LKVIVETKTLVQALGFASSVVEKRNVISELANIKLSAKDGLLELSSTN----MDLYLSQKIGVQVVSEGELTVSTKTLNDIVKKLPDSELTLTDLGTTGLEITGKNCRFNLFTLPVESFPVMD-NINPEASFKISCAEFAKIIESTKFSVSLDETRYN-LNGIYLHVKDSE--FYAASTDGHRLSVSSVVLAEKIEDFGVILPQKSAEEILKIVKDSKNANADIEILLSSNKIKFICNENVIMLSKLIDGTFPDYSSFIPENSSSKLVINRKIFADTIER-IAIITVEKFRAVKLSLSGEALEISAIGEARGNAKEVINSSKETENFYEYSGETNLDIGFNPQYLEDVLKAIKSDLVELYFSSVSAPVLIKFPESPKDIFVVMPVK 378
>gi|116250102|ref|YP_765940.1| DNA polymerase III subunit beta [Rhizobium leguminosarum bv. viciae 3841] >gi|115254750|emb|CAK05824.1| putative DNA polymerase III, beta chain [Rhizobium leguminosarum bv. viciae 3841] (372 aa)
Score = 218, Expect = 7.2e-16, Identities = 74/371 (19%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + ++ L+ +L   + + E   + P+    L++ +  ++    ++  +     + ++  A++ + G   +     + I+ KL +  E++     D   + V++     ++  + E  +P++    F+++      +     K  I + ++A++  + +   ++GI F++I S   L++  +ATDG++LA    ++ P        I++    +  L +++D  +  + + + ++ I   + + ++ SK+I+G +P+  R+I T  + ++ +   +  +A++R ++  SSE+   VKL  S   L ++ ++ D G++ E V+  G   +   I  N  +LL +      +      +D+  P L+RD    + L +L+P+R
  S:     1 MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQKLDMKATDLDLE----ITEATPASVEQPGATTVPAHLLYDIVRKLSDGSEVLLATSSDGGSMTVQSGRSKFSLQCLPESDFPDLTAGTFTHS----FKLKATDLKMLIDRTQFAISTEETRY-YLNGIFFHTIESNGQLKLRAVATDGHRLARADVDA-PSGSEGMPGIIIPRKTVGELQKLVDNPEVMVTVEVSDAKIRLTIGSIVMTSKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDR-VSTISSERGRAVKLALSEGQLMLTVNNPDSGSATEEVAV-GYDTDAMEIGFNAKYLLDITAQLSGEEAIFLLADAGSPTLIRDTAGDDALYVLMPMR 371
>gi|13474647|ref|NP_106216.1| DNA polymerase III subunit beta [Mesorhizobium loti MAFF303099] >gi|14025402|dbj|BAB52002.1| DNA polymerase III beta subunit [Mesorhizobium loti MAFF303099] (372 aa)
Score = 218, Expect = 7.3e-16, Identities = 76/371 (20%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNS--ISSEKTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++I+ ++ L+ +L   + + E   + P+    L+      ++   ++  +     V ++  A +   G   +     + I+ KL +  E++     D + + V +      +  + +  +P ++   FS+       +  +  K  I K ++A++  + +   ++GI  ++  +  +  L  +ATDG++LA  + +    S      I+   ++ EL   + D D  +   L ++ I F + + ++ SK+I+G +P+  R+I T  + K+ + +++   A++R ++  SSE+   VKL+ S   + ++ ++ D G++ E ++     ++P  I  N  +LL +             +D+  P L+ D  D   L +L+P+R
  S:     1 MRVILERSNLLKSLNHVHRVVERRNTIPILSNVLLSAEGASLEMKATDLDLE----VTEATPAKVERGGATTVPAHLLYDIVRKLSDGAEVMLKTDEDGNAMTVTSGRSSFRLQCLPQSDFPELSAGSFSH----IFRLDSVALKGLIEKTQFAISTEETRY-YLNGIYLHTHEVGGKLKLRSVATDGHRLARAEIDAPAGSEGMPGIIIPRKTVSELQKLVDDPDVAVTTELSDTKIRFTIGSVVLTSKLIDGTFPDYQRVIPTGNDKKLILDRQSFAAAVDR-VSTISSERGRAVKLSISEGQVTLAVNNPDSGSATEELAADYS-SDPIEIGFNAKYLLDVAAQLTGTEAKFMLADAGSPTLIHDMADETALYVLMPMR 371
>gi|127510937|ref|YP_001092134.1| DNA polymerase III, beta subunit [Shewanella loihica PV-4] >gi|126636232|gb|ABO21875.1| DNA polymerase III, beta subunit [Shewanella loihica PV-4] (366 aa)
Score = 218, Expect = 8.3e-16, Identities = 82/371 (22%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA---HYKFESTPQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L +   E   + P+    L+EV+ + +K T ++  +    +V ++E    +++GR  +  K F  I+  L +++ + +E+ DN ++ +++      +  +  E+YPN++    D  + ++     K  I   ++++ N   +   ++G+   +      L  IATDG++LA       +S P+   IV    ++EL  L E  D D  + I   E+ I     + +  SK+++G +P+  R++    +  V  S+  L +AL R  +I S+EK   V++     +++++ ++ +   ++E +  +   N P  I  N  +LL +L    +D++ +   D     L+ +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKLTGTDLEVE---LVGQAELQGEVQEGRTTVPAKKFLDIVKSLPDQVELKIEQQDNRLL-LRSGRSRFTLATLPAEEYPNVDAFQADI-EFTLKQGTLKSLIDATQFSMANQDVRY-YLNGLLLET--EGNVLRAIATDGHRLALSHRMVQDSLPEKQVIVPRKGVLELQRLFEGEDLDVTLSIG--ENAIRATTQSAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRA-SILSNEKFRGVRVQLEQNLIKITANNPEQEEAEEILDIEYD-NAPLEIGFNVSYLLDVLNNLPSDDVRITLIDGNSSALIENHVEEDSMYVVMPMR 365
>gi|91205471|ref|YP_537826.1| DNA polymerase III subunit beta [Rickettsia bellii RML369-C] >gi|122990918|sp|Q1RIS7|DPO3B_RICBR DNA polymerase III subunit beta >gi|91069015|gb|ABE04737.1| DNA polymerase III beta chain [Rickettsia bellii RML369-C] (379 aa)
Score = 217, Expect = 9.3e-16, Identities = 97/371 (26%), Positives = 187/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISE--NIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNE--------PTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K+IV    L+ AL   +S+ E  NI S    +  L    D  ++ +++N        +++     ++ +G + + TK    I+ KL +  +TL  +  + +++       N+  +  E +P ++ + N      IS   F K I   K++V+ ++ + N ++GI  +   SE      +TDG++L+          +DF ++L     E +L+I+    + + +IEI L  + I F  + N I+ SK+I+G +P+ S  I     +K+ I++K   + +ER +AI + EK   VKL+ S E LE+S      GN+KE ++   +              I  N  +L  +LK   +D + + FS    PVL++  + P  + +++P++
  S:     2 LKVIVETKTLVQALGFASSVVEKRNIISELANIKLL--AKDGLLELSSTN----MDLYLSQKIGVQVVSEGELTVSTKTLNDIVKKLPDSELTLTDLGTTGLEITGKNCRFNLFTLPVESFPVMD-NINPEASFKISCAEFAKIIESTKFSVSLDETRYN-LNGIYLHVKDSE--FYAASTDGHRLSVSSVVLAEKIEDFGVILPQKSAEEILKIVKDSKNANADIEILLSSNKIKFICNENVIMLSKLIDGTFPDYSSFIPENSSSKLVINRKIFADTIER-IAIITVEKFRAVKLSLSGEALEISAIGEARGNAKEVINSSKETENFYEYSGETNLDIGFNPQYLEDVLKAIKSDLVELYFSSVSAPVLIKFPESPKDIFVVMPVK 378
>gi|22299892|ref|NP_683139.1| DNA polymerase III subunit beta [Thermosynechococcus elongatus BP-1] >gi|22296077|dbj|BAC09901.1| DNA polymerase III beta subunit [Thermosynechococcus elongatus BP-1] (370 aa)
Score = 217, Expect = 9.7e-16, Identities = 85/371 (22%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT-LEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTI-IASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSS--DLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK++ S++ L + L   + ++ +  S P+    L++     +  +  +  +     +    DA +   G I +  K F  ++S++ N  I +   D  VI    S F   I  M  E++P +  +  D   ++++    ++ +    +A + ++ K  I+SG+    ++ E+  LE  ATDG++LA    E    + P     +   SL +L   +   D  + +    + ++F + N   I S+++EG YPN  ++I      +V + +  L +ALER +AI +++K ++VK+N  +E  E+  S+    LG+ +E +  +    E   ++ N  +LL  LK  ++ ++ ++ +   +P +L    +     +++PI+
  S:     1 MKVVCSQSVLSSKLAPLSRVAPSNPSHPILANILLQAEGGRLGLSVFDLSLGMQIWL----DAAVKVPGAITVSAKLFSEMVSRMPNRDIEITAEDTRVILDYGSGF-FEIQGMSAEEFPALP-TLEDVTPITLTAEALRRGLQGSLFAASTDENK-QILSGL---HVTFERDRLEFAATDGHRLAVTVTEQPVPAEPLSPITIPAKSLKDLERLMAKQDGMVALRCDPTQVVFDIGNDARITSRLLEGQYPNYRQLIPKTFARQVTVERSALADALER-VAILAAQKNNVVKINIDTEAQELKLSAEAPQLGSGEENLPAQIS-GESMVVAFNVKYLLEGLKVMNSADVQLQLNGETQPAILLPLGEAQMKYLVMPIQ 367
>gi|115522032|ref|YP_778943.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris BisA53] >gi|115515979|gb|ABJ03963.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris BisA53] (372 aa)
Score = 217, Expect = 1.1e-15, Identities = 80/371 (21%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+      +    ++  +     V +S  A     G   +    F+ I+ KL +   I LE   + +V+ ++       +  + E  +P++  +    +  ++     K+ I + ++A++  + +   ++GI  +S  S    TL  +ATDG++LA         +      IV   ++ E+   I D + ++ I L  + I F + + ++ SK+I+G +P+  R+I    + ++ + K     A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++   I  N+ +LL +    + +   +  +D   P L++D      L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAEKGRLSLKATDLDLE----VTESLPAETATPGATTVPAHMFYDIVRKLPDGSQIVLESDGERAVLAIRAGRSRFTLQTLPETDFPDLA-AGEMTHSFALPASDVKRLIDRTQFAISTEETRY-YLNGIYLHSAGSAVAATLRAVATDGHRLAQLDLPLPSGAAGMPGVIVPRKTVGEVQRLIEDSEVSVGIELSTNKIRFTIGDVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKTDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDALDIGFNSRYLLDIAAQIEGEAAVLRLADPGSPTLIQDRDAKGALYVLMPMR 371
>gi|90420503|ref|ZP_01228410.1| DNA polymerase III, beta subunit [Aurantimonas sp. SI85-9A1] >gi|90335231|gb|EAS48984.1| DNA polymerase III, beta subunit [Aurantimonas sp. SI85-9A1] (374 aa)
Score = 217, Expect = 1.1e-15, Identities = 76/371 (20%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYK------FESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+II+ ++ L+ +L   + + E   + P+    L++     ++   ++  +     + +S  A   ++G   +     + I+ KL +  E+      + + + V +   +  +  + E  +P+I       +   +      + I + ++A++  + +   ++GI  ++I ++  L++  +ATDG++LA          E  P        V  ++ LL   + +  I + L ++ I F +   ++ SK+I+G +P+  R+I    +  + + ++T   A++R ++  SSE+   VKL  +   L ++ +S D G + E ++  G  ++   I  N  +LL +      D      +D   P L++D  D   L +L+P+R
  S:     1 MRIIIERSNLLKSLAHVHRVVERRNTIPILSNVLLKTEGEGLRLKATDLDLE----ITESAPATGEQEGATTVPAHLLYDIVRKLPDGAEVSLATNAEGTQMTVSSGRSNFRLQCLPESDFPDITAGTLS-HAFKLKAAELGRLIERTQFAISTEETRY-YLNGIYLHTIEADGDLQLRAVATDGHRLARADQKAPAGSEGMPGIIIPRKTVGELQKLLGDSNDEAEISVELSDAKIRFTIGAVVMTSKLIDGTFPDYQRVIPQNNDKALTLDRQTFSAAVDR-VSTISSERGRAVKLAVADSQLVLTVNSPDSGTATEELAV-GYDSDEIEIGFNAKYLLDITNQLSGDETVFMLADPGSPTLIKDGGDDATLYVLMPMR 373
>gi|114326983|ref|YP_744140.1| DNA polymerase III subunit beta [Granulibacter bethesdensis CGDNIH1] >gi|114315157|gb|ABI61217.1| DNA polymerase III, beta chain [Granulibacter bethesdensis CGDNIH1] (387 aa)
Score = 216, Expect = 1.3e-15, Identities = 83/371 (22%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSIS---SEKTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDN---DNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK    +  L+ AL    S+ E   + P+    L+EV D  ++FT ++  I+    + +   A  L  G +       + I+ KL +  ++    +  +  + +K+  + + + ++  + +P++       +Q  ++  V +  I + ++A++  + +   ++GI F++         L  +ATDG++LA  + E  P+        IV   ++ EL   + +    +++ L ++ I F      + SK+I+G +P   R+I    +  + + K     A+ R  AI SSE+   VK+     +L +S SS D G + E +   G   +    +L   F    L    +   + +   F+D   P +++D  D + L +L+P+R
  S:    13 MKFKAERAVLLKALAHVQSVVEKRNTIPILANVLLEVKDGSLRFTATDMEIA----IVEDVPAEGLRDGAVTAPAGTLYEIVRKLPDGADVELDHQAGDQQLMLKSGRYATKLVVLPTDDFPSMTTGALP-HQFRLAGNVLRGLIDRTRFAISTEETRY-YLNGIYFHAAQGGPDGAALRAVATDGHRLARVE-EPLPEGALGMPGVIVPRKTVAELRKLLDEVTDTVDVALSDTRIQFVAGPVTLTSKLIDGTFPEYERVIPKDNDKVLRVGKNDFSAAVARVAAI-SSERSRPVKMALDRNLLVLSASSPDQGTATEELD--GDRIQYEAGALEIGFQARYLNDITDQIAEEVEFRFADGSAPTVVQDAADSSALYVLMPMR 386
>gi|120596835|ref|YP_961409.1| DNA polymerase III, beta subunit [Shewanella sp. W3-18-1] >gi|146291113|ref|YP_001181537.1| DNA polymerase III, beta subunit [Shewanella putrefaciens CN-32] >gi|120556928|gb|ABM22855.1| DNA polymerase III, beta subunit [Shewanella sp. W3-18-1] >gi|145562803|gb|ABP73738.1| DNA polymerase III, beta subunit [Shewanella putrefaciens CN-32] (366 aa)
Score = 215, Expect = 1.5e-15, Identities = 83/371 (22%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFEST-PQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L+EV+ + +K T ++  +    +V ++     +E+GR  +  K    I+  L  +  + +E+ DN  +++   S F  ++  +  E+YPN+  ++    + S+   V K  I   ++++ N   +   ++G+ F +      L  IATDG++LA  H   ++  P+   IV    ++E+   +   D +I I + ++ I    +NT+  SK+++G +P+  R++    +  V  S+  L +AL R  +I S+EK   V++   + +L+++ ++ +   ++E +      N+   I  N  +LL +L    +D++ +   D     L+ +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKLTGTDLEVE---LVGQAVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRF--SLATLPAEEYPNVE-AFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRY-YLNGLLFET--EGNMLRAIATDGHRLALSHRVIDAQLPEKQVIVPRKGVMEMARLLESDDLDIAIAIGDNAIRATTANTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRA-SILSNEKFRGVRIQLENGLLKITANNPEQEEAEEIIDVDYN-NQSLEIGFNVSYLLDVLNNLKSDDVRITLIDGNSSALIENHLEEDSMYVVMPMR 365
>gi|118046041|ref|ZP_01514695.1| DNA polymerase III, beta subunit [Chloroflexus aggregans DSM 9485] >gi|117997397|gb|EAV11584.1| DNA polymerase III, beta subunit [Chloroflexus aggregans DSM 9485] (378 aa)
Score = 215, Expect = 1.5e-15, Identities = 77/343 (22%), Positives = 173/343 (50%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFE--SNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEV----LEVSFSSSDLG-NSKE---TVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           PV    L+  ++  +K T +N  +  +  +     ANI + G + +  K    ++  L N+ +TL        ++V+   F SNI  +D +++P++         +S+  ++++++I +V +A   ++ +  I++G+   +   ++ L ++A DG++LA       E+       ++   ++  L  II D + ++ +      S+++F   NT + S++IEG +P+  RII      +  +    L +A++   +  +S  +++VKL    + E+    + +S +S++LG N+ E   +V+  G V     I+LN  FL   +    ++ I  E   +  P + +      ++ I++P+
  S:    29 PVLANVLLATDNGRLKLTATNLEVGINRWIG----ANIAQAGAVAVPAKLLADVVGGLPNDTVTLTLDPKTQTLRVECGRFVSNIKGVDADEFPSLPAVNTRAPLVSLPAVLWREAIEQVAFAAATDESR-PILTGVLVRT--RDRQLTLVAADGFRLAMRTIPLAETVAHAVDCLIPARMLAELARIIGDIEGDVAMVYTPGGSHVLFHTENTEVVSRLIEGRFPDFERIIPQQYLTRTVLDSTELAKAVKLA-SFFASASQNVVKLKIEPAGEMGPGRIVLSANSAELGDNTSELDGSVTGDGGV-----IALNVKFLADAIAAVGSNQIAFEMQSAQSPAVFKPVGHDGYIHIVMPM 375
>gi|87199450|ref|YP_496707.1| DNA polymerase III subunit beta [Novosphingobium aromaticivorans DSM 12444] >gi|87135131|gb|ABD25873.1| DNA polymerase III, beta subunit [Novosphingobium aromaticivorans DSM 12444] (375 aa)
Score = 215, Expect = 1.9e-15, Identities = 90/371 (24%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN-DNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV--------SLIELLLEIIDFDTNIEIFLFESNIIFKV---SNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L    S+ E   + P+    LIE   D+ ++   ++    II T S V+      +   G I +     F I  KL +   ++LE  DN +I VK       +  +  + +P I    +      I      + I + ++A++  + +  +       S   +  L+  ATDG++LA +   + P     + DV         L +LL E++D  + + I L  S I F +   +  ++ SK+I+G +P+ SR+I T  +  + +  ++  E ++R +A  ++EK   VK+   ++ + +S +S D G + E +      +    I  N ++L  +L   D D + +  +D+  P L+R +     L +L+P+R
  S:     1 MKATIERATLLRCLSHVQSVVERRNTIPILSNVLIEAAPDSTVRLMATDLDLQIIETMSAVS------VEAPGAITVSAHLLFDIARKLPDGSQVSLETSDNRMI-VKAGRSRFQLPTLPRDDFPVI-VEGDLPTSFEIPARTLAELIDRTRFAISTEETRYYLNGIFLHVSDDPQPVLKAAATDGHRLARFTI-TRPDGAEGMPDVIVPRKCVGELRKLLEEVLD--SAVLIDLSASKIRFTLGGENGVVLTSKLIDGTFPDYSRVIPTGNDKLLKLDPRSFFEGVDR-VATIATEKTRAVKMALENDRVTLSVTSPDNGTAAEELPADYS-STGFEIGFNANYLKDILSQIDGDTVELHLADAGAPTLIRKDDKSAALYVLMPMR 374
>gi|23014790|ref|ZP_00054590.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Magnetospirillum magnetotacticum MS-1] (372 aa)
Score = 214, Expect = 2.0e-15, Identities = 78/371 (21%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSI-----VAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYP-----NINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ +L    S+ E   + P+          + +K     G++S ++      + ++  A+++  G        F+ I+ KL +   + +E   ++  + +++     ++  +  E +P     ++ FS+      ++S    K  I + ++A++  + +   ++GI  ++ +S+    L  +ATDG++LA  +      +      IV   ++ E+   I + D  I + L E+ + F   + ++ SK+I+G +P+  R+I    +  + +  K+  +A++R  AI S+EK   +KL        +S SS++ G++ E +      + P  I  N+ +L+ +L   + +      +D+  P ++R+  D   + +L+P+R
  S:     1 MKLTIERAALLKSLAHVQSVVERRTTIPIL---------SNVKLEGRGGLLSLNATDMDLDIIEAVPADVVRPGATTAPAHTFYEIVRKLPDGSQVEIEFDAESGQLTLRSGRSKFSLACLPVEDFPVLSGGDLPFSF------TLSAAELKTLIDRTRFAISTEETRY-YLNGIYLHAAASDGIDVLRAVATDGHRLARVEITLPSGAAGMPGVIVPRKTVAEIRKLIDETDGEITVSLSETKLKFAFGDAVLTSKLIDGTFPDYERVIPADNDKVLVVDCKSFAQAVDRVSAI-STEKSRAIKLALEKGSATLSASSAENGSAVEEIEAD-YTSTPLEIGFNSRYLMDILAQVEGETARFAMADAASPTVVREMTDGGAIYVLMPMR 371
>gi|160878164|ref|YP_001557132.1| DNA polymerase III, beta subunit [Clostridium phytofermentans ISDg] >gi|160426830|gb|ABX40393.1| DNA polymerase III, beta subunit [Clostridium phytofermentans ISDg] (370 aa)
Score = 214, Expect = 2.5e-15, Identities = 84/370 (22%), Positives = 191/370 (51%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLF--ESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERG-LAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MKI   K +L+N++ +      +  + P+    +IEV ++ IK  +++  I   +IV  S    I+  G + I  K F  II KL +  + +E  +  +  +        I     E++P +  +      + +S    K+ I +  +++++N E   IM+G  F    +E  L +++ DG++++  K E  ++    +I++    ++ + +I+  + + E+F++  + +++F   +T++ S++IEG+Y  + ++++   E KV I+KK  +  ++R  L I  +EKK I+ +    + LE+  ++S +G   E +  + K  +   I  N  FL+  L+  D++ + +   +   P  ++D K+ +++ +++P+
  S:     1 MKIACQKNELLNSVNIALKAVSSKSTMPILECIVIEVQNDTIKLISNDMEIGIETIVKGS----IISNGSVAINAKVFSEIIRKLPDNEVNVETDEKFMTTITCEKAKFTIAGKSAEEFPMLP-TIEKKEAIELSQFTLKEVIRQTVFSISDN-ESNKIMTGELFEINGNE--LRVVSLDGHRISIRKVELKNSYAPKKILVPGKTLQEVSKILSGEISDEVFIYYTDRHVLFVFDDTLVLSRLIEGEYYKIDQMLSGDYETKVKINKKEFLSCIDRATLLIKETEKKPII-VGIEDKKLELKINTS-IGTMDEDIDIE-KEGKDILIGFNPKFLIDALRVIDDEEVEIYLINPKAPCFIKD-KEESYIYLILPV 363
>gi|24371609|ref|NP_715651.1| DNA polymerase III, beta subunit [Shewanella oneidensis MR-1] >gi|24345359|gb|AAN53096.1|AE015452_9 DNA polymerase III, beta subunit [Shewanella oneidensis MR-1] (366 aa)
Score = 214, Expect = 2.5e-15, Identities = 87/371 (23%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFEST-PQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L+EV+ + +K T ++  +    +V ++     +E+GR  +  K    I+  L  +  + +E+ DN  +++   S F  ++  +  E+YPN+  ++    + ++   V K  I   ++++ N   +   ++G+   +      L  IATDG++LA  H   E+  P+   IV    ++E+  LLE  D D  I I + ++ I    S T+  SK+++G +P+  R++    +  V  S+    +AL R  +I S+EK   V++   + +L+++ ++ +   ++E +      N P  I  N  +LL +L    +D++ +   D     LL +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSGHSLKLTGTDLEVE---LVGQAVIHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRF--SLATLPAEEYPNVE-AFQAEIEFTLKQGVLKSLIDATQFSMANQDVRY-YLNGLLIET--EGNMLRAIATDGHRLALSHRVIEAQLPEKQVIVPRKGVMEMARLLETDDLD--IAISIGDNAIRATTSTTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHFKQALTRA-SILSNEKFRGVRIQLEAGLLKITANNPEQEEAEEIIDVDYN-NLPLEIGFNVSYLLDVLNNLKSDDVRITLIDGNSSALLENHLEEDSMYVVMPMR 365
>gi|194537252|ref|YP_002072396.1| DNA polymerase III, beta chain [Vibrio cholerae V51] >gi|125621865|gb|EAZ50190.1| DNA polymerase III, beta chain [Vibrio cholerae V51] (366 aa)
Score = 213, Expect = 2.6e-15, Identities = 83/371 (22%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKE--TVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + ++ LI  L+  +       S P+    L++V +N++  T ++  +   S V    +    E G I +  + F  I   L +  +    ++   I+V++     ++  +    +PNI     DW    Q+S++    +  I K ++++ N   +   ++G+ F    +  TL  +ATDG+++A  + +      Q   IV    ++EL+  +   +  + + +  SN+  +V++ +  SK+++G +P+  R++       +    + L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E   VS +G   EP  I  N  ++L +L T   +N+ V  SD+    L+ +  D + + +++PIR
  S:     1 MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLEGE---FEAGSITVPARKFLDICRGLPDSAVITVLLEGDRIQVRSGRSRFSLATLPASDFPNIE----DWQSEVQVSLTQAELRGLIEKTQFSMANQDVRY-YLNGMLFEIDGT--TLRSVATDGHRMAVAQAQLGADFAQKQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTNKTLQAGCEELRQAFSRA-AILSNEKFRGVRVNLADNEMRITANNPEQEEAEELLDVSFEG---EPIEIGFNVSYILDVLNTLRCENVRVSMSDANASALVENVDDDSAMYVVMPIR 365
>gi|89891238|ref|ZP_01202745.1| DNA-directed DNA polymerase III beta chain dnaN [Flavobacteria bacterium BBFL7] >gi|89516550|gb|EAS19210.1| DNA-directed DNA polymerase III beta chain dnaN [Flavobacteria bacterium BBFL7] (371 aa)
Score = 213, Expect = 3.0e-15, Identities = 86/347 (24%), Positives = 165/347 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS + L   L++   +  +  + P+    L+E+N  E+K + S+  + T  + A   ++   + G I I  K     +     + +T    DN ++ V      S I   + E++P    S  D +  SI       +I+K  +A  N+  +  +MSG+ F    S  +L  +ATD +KL  Y+ E  +  +    ++    + LL  ++   +T + I   ESN  F   +T I  ++I+G YPN   +I     NK+ I++   + ++ R ++I S++    ++L  +   L +S    D  N + E ++C  + ++   I  N+ FL+ +L   + D++++E S
  S:     1 MKFIVSSSYLQKHLQMLGGVINSNNTLPILDNFLLELNGKELKVSASD--METTMLTALEVESE--DDGSIAIPAKLLLDTLKTFPEQPLTFS-ADNGIMTVSHDKGSSEIACANGEEFPKA-VSLTDPSSTSILGDTLATAINKTIFAAGNDDLR-PVMSGVFFQF--STDSLTFVATDAHKLVRYRREDLAASETAEFIMPKKPLNLLKSMLQGSETEVLIEYNESNAQFTFDSTSIICRLIDGKYPNYEAVIPKENPNKLVIARNQFLNSVRR-VSIFSNKTTHQIRLKMAGAELNISAEDIDYSNKADERLTCDYQGDD-MQIGFNSRFLIEMLNNLNCDDVSLEMS 340
>gi|81251093|gb|ABB69891.1| DNA polymerase III beta chain [Nitrosovibrio sp. RY3C] (370 aa)
Score = 212, Expect = 4.0e-15, Identities = 85/369 (23%), Positives = 179/369 (48%)
  Q:     9 IIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF-ESTPQDFRIVL--DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           I  +K  L+  L+    I E   + P+    LIE    EI FT ++  I   +    S+D +  +   I +  K    I+  L  N  +TLE  +N  ++VK      N+  +  E +P +  S     ++++     K  +  V+YA+     +   ++G+    +     L+++ATDG++L       S PQ+ + V+    +++EL  ++ D +  + + L ++ + F  SN ++ SK+++G +P+ +R+I    + +  +++ T ++ L+R  +I S+EK   V+L  ++  L++  S+++   ++E +      NE   I  N  +LL +L     + +   F D+    L+    + +F  +++P+R
  S:     4 IQTNKDALLKPLQAVTGIVERRHTLPILSNVLIERKREEISFTATDLEIQIATTAPDSKDES-KQTSAITVAAKKLQDILRALPDNVQVTLEAQENR-LQVKAGKSRFNLQTLPAEDFPRLPESSTPQAKITLPQKELKNLLFLVQYAMAQQDIRY-YLNGLLL--LVEADHLKVVATDGHRLGFASIVMSQPQEKKEVILPRKAVLELAKQLHDSEEPVTVELLQNQVRFTFSNIVLVSKVVDGKFPDYNRVIPVGYQKQFTLNRVTFLQTLQRA-SILSNEKFRGVRLILTAGNLQIVCSNNEQEEAQEELEIDYD-NEALDIGFNISYLLDVLNNLTCETVQCSFGDANSSALITIPGNDDFKYVVMPMR 369
>gi|87121028|ref|ZP_01076920.1| DNA polymerase III, beta chain [Marinomonas sp. MED121] >gi|86163866|gb|EAQ65139.1| DNA polymerase III, beta chain [Marinomonas sp. MED121] (365 aa)
Score = 212, Expect = 4.1e-15, Identities = 80/371 (21%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVS--------LIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKEN-KVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+L   + E   + PV    L+EV DNE+  T S+  +     +   E     ++GRI +  +    I   L +  +    VD++   +++      ++ +  +++PNI     D + + ++    ++ I +  +A+ N   +   ++G+ F    ++  L +++TDG++LA     +  +D ++  D++        ++EL   + D D  +E+ +  ++I  KV++ I  SK++EG +P+  R+I  P+ N K+ I+ +  +  +    +I S+EK   V+L  ++ +L+V  ++ +   ++E+V  + + ++   +  N  +LL +L   ++  + +  +D+    L+ +        +++P+R
  S:     1 MKFSVVRETLLKPLQLVAGVVERKQTMPVLANVLLEVKDNELTLTGSDLEVELVGHIQLDE----CQEGRITVPARKLMDICKSLPDSAVIELSVDDTRAIIRSGRSRFTLSTLPADEFPNIQDMQGDLS-VVVAQNSVRRLIERTGFAMANQDVRY-YLNGMLFEV--ADGQLRVVSTDGHRLA-----TAIEDAQVSGDLTQVIVPRKGVLELNRLLSDTDETVELQIGANHIRAKVADYIFTSKLVEGKFPDYHRVI--PRNNDKIVIADRLELRQVFLRASILSNEKYRGVRLILTNGMLQVFANNPEQEEAEESVLVQYQGDD-LEVGFNVSYLLDVLGVVNSQEVRISLNDATASALVEEADSHAAQYVVMPMR 364
>gi|28896786|ref|NP_796391.1| DNA polymerase III subunit beta [Vibrio parahaemolyticus RIMD 2210633] >gi|28804994|dbj|BAC58275.1| DNA polymerase III, beta chain [Vibrio parahaemolyticus RIMD 2210633] (366 aa)
Score = 211, Expect = 4.7e-15, Identities = 82/371 (22%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + ++ LI  L+  +       + P+    LI+V +N +  T ++  +   S V    D    E G I + ++ F  I   L ++ I    ++   ++V++     ++  +    +PNI     DW    ++S+S    +  I K ++++ N   +   ++G+ F    +  TL  +ATDG+++A  + +    DF   +I++    ++ L++++D  +  + + +  SN+  +V+N I  SK+++G +P+  R++       +  S   L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E +    +  +P  I  N  ++L +L T   + + V  SD+    L+ +  D + + +++PIR
  S:     1 MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLIKVEENVLSMTATDLEVELVSKVTLEGD---FEAGSITVPSRKFLDICRGLPDDAIITFVLEGDRVQVRSGRSRFSLATLPANDFPNIE----DWQSEVEVSLSQADLRTLIDKTQFSMANQDVRY-YLNGMLFEIDGT--TLRSVATDGHRMAVSQTQ-LGADFAQKQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFIFTSKLVDGRFPDYRRVLPQHTNKTLIASCDELRQAFSRA-AILSNEKFRGVRVNLAGSEMRITANNPEQEEAEEMLDVTFE-GDPIEIGFNVSYVLDVLNTLRCEKVQVSMSDANASALIENADDDSAMYVVMPIR 365
>gi|108802858|ref|YP_642795.1| DNA polymerase III, beta subunit [Rubrobacter xylanophilus DSM 9941] >gi|108764101|gb|ABG02983.1| DNA polymerase III, beta subunit [Rubrobacter xylanophilus DSM 9941] (375 aa)
Score = 211, Expect = 5.1e-15, Identities = 75/344 (21%), Positives = 175/344 (50%)
  Q:    35 VFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEK-VDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT-LEIIATDGYKLA--HYKFESTPQDFR-IVLDVSLIELLLEIIDF--DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSI-VKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL--RDEKDPNFLQILVPIRN 378
           V  G L+E  +  ++ + ++  +S    +     A + E GR++I  + F  I+  L   MI++E  V++    +++   +  I     E +P +   +++     +S     +++ KV  + + ++ +  +++GI    IS E + L ++ TD Y+L+    +  +T +  R  ++    ++ +  I     +  IE+ L E+  +F+V + ++ +K+I G++P   R++    E ++++++  +V +L R    +  +   + V L FS   +EV   S ++G + E +    +  +   IS N  +LL  +   D + +  +F++  KP L+    E++P+F  +++P+R+
  S:    29 VLSGVLLEAREGRLELSATDMELS----IRTRSPAEVEEAGRLVIPARIFSDIVRSLPEGMISIEHDVESGAAVLRSRENEYRIRAYAAEDFPALP-EFSEEGSFRVSGEALVETVQKVSSSYSRDETR-PVLTGIL---ISFEDSRLRMVTTDSYRLSIKETELATTFEGKREAIIPARAMQEVGRIFSGSDEEQIEVQLSENQALFRVGDVLLGTKLIAGNFPEYRRLLPAAFEREISVNRDEIVGSLRRVNLFAQRQTPPVPVSLVFSEGSVEVVVRSGEVGEAHERIPASSE--DDFTISFNPGYLLDGISAVDTEKVVFKFNEPLKPGLIVPNGEEEPDFRYLIMPMRD 371
>gi|34495457|ref|NP_899672.1| DNA polymerase III subunit beta [Chromobacterium violaceum ATCC 12472] >gi|34101313|gb|AAQ57682.1| DNA-directed DNA polymerase, beta subunit [Chromobacterium violaceum ATCC 12472] (369 aa)
Score = 211, Expect = 5.2e-15, Identities = 86/365 (23%), Positives = 170/365 (46%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLK-NEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEV--SFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L     I E   + P+    LIE    ++ F  ++  I    I   S D    E  R+    K    I+  +  N  +TLE++D   + +K      N+  +  E +P ++      +  ++S    K+ IS+V+YA+     +   ++G+   +  ++  + ++ATDG++LA    +   + P+   I+   ++IEL   + D D  I+I +  + + F    T+I SK+++G +P+ +R+I    +    I +   + AL+R  AI ++EK   V+L  +   + +  + S  +    +  ++ +G   E   I  N ++LL +L     D + + F DS +  L       NF  I++P+R
  S:     8 RDALLKPLLAVTGIVERRHTLPILSNVLIEKKGGQVGFLATDLEIQ---ITTASSDELPGEDFRLTTSAKKLQDILRAIPGNATVTLEQLDGGRLVLKAGKSRFNLQTLPAEDFPLLSVGSAGESSFTLSQRELKRLISQVQYAMAVQDIRY-YLNGLLMQTDGNQ--VRLVATDGHRLAFASADVAATLPKAEVILPRKTIIELYKLLQDSDDEIKIEVLANQVRFSFGATVIISKVVDGKFPDYNRVIPLDNDKIFLIERLEFLHALQRA-AILANEKFRGVRLVLAPGKMSILCTNSEQEEAEEELEIAFQGGTLE---IGFNINYLLDVLTNLPADTLQLAFGDSSRSALFTIPDVSNFKYIVMPMR 368
>gi|146300470|ref|YP_001195061.1| DNA polymerase III, beta subunit [Flavobacterium johnsoniae UW101] >gi|14531036|gb|AAK63183.1| DNA polymerase III beta subunit DnaN [Flavobacterium johnsoniae] >gi|146154888|gb|ABQ05742.1| DNA polymerase III, beta subunit [Flavobacterium johnsoniae UW101] (372 aa)
Score = 210, Expect = 6.8e-15, Identities = 81/347 (23%), Positives = 165/347 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS + L+  L++  S+  +  + P+    L E+++NE+  + S+      + ++ +   +   KG + +  K    I+     + +T    DN+ +++ +++    +     E++P  + +  D +   +   V   ++SK  +A  N+  +  +MSG+ F    S + L  +ATD +KL  Y        Q    ++    + +L  I+   D  ++I   +SN  F   N I+  ++I+G YPN   +I     NK+ I +   + ++ R +AI S++    ++L  +   L VS    D  N ++E ++C  + ++   I  N+ FL+ +L    +D I +E S
  S:     1 MKFIVSSSYLLKQLQVLGSVINSNNTLPILDNFLFELDNNELTVSASD----LETTMSATLSIDSTSKGSVAVPAKLLLEILKTFPEQPLTFTVEDNNTVEISSNSGKYALAYAAGEEFPK-SVNLEDPSVTLVPADVLATAVSKTIFAAGNDDLR-PVMSGVFFQF--SPEGLTFVATDAHKLVKYARADVKASQVADFIMPKKPLNILKSILGSSDAEVKIEYNDSNATFSFDNYILMCRLIDGKYPNYEAVIPKENPNKLLIDRSLFLSSVRR-VAIFSNKTTHQIRLKIAGAELNVSAEDIDYSNKAEERLTCDYQGDD-LQIGFNSRFLIEMLTNLQSDVIMLEMS 341
>gi|121601944|ref|YP_989527.1| DNA polymerase III subunit beta [Bartonella bacilliformis KC583] >gi|120614121|gb|ABM44722.1| DNA polymerase III, beta subunit [Bartonella bacilliformis KC583] (373 aa)
Score = 210, Expect = 6.8e-15, Identities = 85/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLK--NEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL----SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK-TLEIIATDGYKLAHYKFESTPQDFRIVLDV--------SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++ + + + + +L   + + E   + P+    LI+ + + ++   ++  +     + +    +I + G I +     + I+ KL   NE+I     D        S F +N  +   + +P ++F  +   Q     S+     K  +   ++A++  + +   ++GI F+ ++     L ++ATDG++LA    E+ P     +  V         L  LL E  + D  + I L E+ I F V + ++ SK+I+G +P   R+I    + K+ ++++     ++R   ISS   ++ VKL   +  L    ++ D G++++ +      ++P  I  N+ +LL +      D I     ++  P L+RD  D N L +L+PIR
  S:     1 MRVTIDRNQFLKSLGCVHRVVERRNTVPILSNVLIDADSDGMRLKATDLDLE----ITEFSVPHIEQTGGITVPAHLLYDIVRKLPDGNEIILAVDADRPNTMSVISGF-ANFRL---QGFPKMDFPESLPGQFNFRFSLLASDLKHLLDCTQFAISTEETRY-YLNGIYFHIVNDGALKLRLVATDGHRLAQVDMEA-PSGSEGMPGVIIPRKTVGELQRLLSE--EADNYVCIELSETKIRFSVGSVVLTSKLIDGTFPEYQRVIPLGNDKKLTVNRRDFSSTVDRVSTISSDRGRA-VKLTIENGQLRFVVNNPDSGSAEDQLVAD-YASDPLEIGFNSRYLLDIAAQLSGDEIVFMLDEAGAPALIRDSHDTNALYVLMPIR 372
>gi|78043484|ref|YP_361491.1| DNA polymerase III, beta subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77995599|gb|ABB14498.1| DNA polymerase III, beta subunit [Carboxydothermus hydrogenoformans Z-2901] (371 aa)
Score = 209, Expect = 8.7e-15, Identities = 84/344 (24%), Positives = 164/344 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNS---VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF----ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALER-GLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           PV  G L E N+     T +   +     V  S  A I+E G +++ +K    II KL    +  E + N    VIK   S  + ++     E++P  N    D     IS   F   I +V +A   ++ +  + +G+ F  +  E  L ++A+D ++LA  K     E T ++  +++    +   + I      + I + E  + F  +   + S++IEG +PN  ++I T  ++ + I+KK  +++LER  L     +K  + K     E + ++ S S+ G+ +E +    +  E T ++ N  +L+ +LK  + + I +  +    P +++   D N+L +++P+R
  S:    28 PVLTGILFEANEQNSTITLTATDLQMS--VETSFPAKIIEGGSVVLASKFLGDIIKKLPETELMFEYLPNEGKCVIKYGAS--EVSVATYRPEEFPK-NEEVIDGESFYISGEEFSTFIKQVLFATGTDESR-PVFTGVLFEIVGQE--LRLVASDTHRLAFRKTFIKREDTGKNINVIIPSRTLHEAVRIFGTVDELLIKISEGQVEFSGNGIKLTSRLIEGQFPNYQQVIPTAFKSNILINKKYFLDSLERAALLPRDKDKTPVAKFYLERENMIIT-SQSESGSIREELPISLEGEEFT-VAFNTRYLIDVLKVLETEEIYLSLTGPLNPGVVKPVNDENYLCLVLPVR 369
>gi|33860561|ref|NP_892122.1| DNA polymerase III subunit beta [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33633503|emb|CAE18460.1| DNA polymerase III, beta chain [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (385 aa)
Score = 209, Expect = 9.3e-15, Identities = 95/371 (25%), Positives = 189/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV--IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA------------HYKFESTPQDFRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLE-VSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN-FLQILVPIR 377
           M+I+ ++ +   A++L +    +  + P+    L+  +    K + +      +  +  S DA + + G I I +K    I++KL +E      VD S   I +K+     NI  +  + YP++ F       L+I P  F K++    +A +++  K  +++G+ F    + K LE  ATDG++LA               F S  ++  + +    +  IE L+ +   + +I++F  +  ++F  SN II ++ +EG YPN S++I          + K ++E+LER +A+ + ++ S+VK+  + + L  VS  + D+GN+ E V      ++   I+ N  +LL  LK   ++N+  + +    P +L  E + N F  +++P++
  S:     1 MEIVCNQNEFNYAIQLVSKAVASRPTHPILANLLLTADQGTNKISLTG--FDLNLGIQTSFDATVNKSGAITIPSKLLSEIVNKLPSETPVSLDVDESSDNILIKSDRGSFNIKGIPSDDYPSLPF-VESGTSLNIDPSSFLKALKLTIFASSSDDSK-QLLTGVNFTF--NLKYLESAATDGHRLAVVLVDNKENFDEKEDFASNEENLSVTIPTRSLREIEKLVSLRSSENSIKLFYDKGQVVFISSNQIITTRTLEGSYPNYSQLIPDNFTKIFTFNTKKIIESLER-IAVLADQQSSVVKIKLNEKDLALVSADAQDIGNASELVPVSFYFDQ-FDIAFNVRYLLEGLKVISSENVIFKCNLPTTPAVLVPEDNINSFTYLVMPVQ 382
>gi|159902541|ref|YP_001549885.1| DNA polymerase III subunit beta [Prochlorococcus marinus str. MIT 9211] >gi|159887717|gb|ABX07931.1| DNA polymerase III, beta chain [Prochlorococcus marinus str. MIT 9211] (397 aa)
Score = 208, Expect = 9.8e-15, Identities = 89/371 (23%), Positives = 193/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE----MITLEKVDNSVIKVKTSTFD-SNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-------STPQDFRIVLDVSL-------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN-FLQILVPIR 377
           MK++ S+++L +AL+L +    +  + PV    L+  +    + + +      +  +  S  A++   G   +  K F  I+SKL ++    +++ E  +   +  K+ T+    +N  D  + P +    +    L I+P++F  ++    +A ++++ K  I++G+  + I     L+  ATDG++LA    E       ST  +    ++V+L       IE  +     +  I +F     ++F   N ++ ++I+EGDYPN +++I     N +   +K  + ALER +A+ + +  +++K++   SS++++++  + D+G+  E++  K    +   I+ N  +LL  L+ F+ D I +  +    P +L    D N F+ +++PI+
  S:    13 MKLVCSQSELNSALQLVSRAVASRPTHPVLANILLTADAGTGRLSLTG--FDLNLGIQTSLTASVEVSGATTLPAKLFGEIVSKLSSDSPINLVSDELGEKVNLTSKSGTYQMRGLNADDFPELPLVQTGAS----LQINPLIFANALKSTLFASSSDESK-QILTGV--HLIFDGNILQAAATDGHRLAVLNLEDAINLNSSTNLNTNDKIEVTLPAKSLREIERFIGNYKNEEKISLFYDSGQVVFTALNQVVTTRILEGDYPNYNQLIPESFSNILEFDRKPFISALER-IAVLADQHNNVIKISKEPSSDLVKITADAQDVGSGVESIPVKFN-GDNFQIAFNVRYLLEGLRVFEEDKICLRCNLPTTPAILSSIDDQNTFIYLVMPIQ 394
>gi|87301552|ref|ZP_01084392.1| DNA polymerase III subunit beta [Synechococcus sp. WH 5701] >gi|87283769|gb|EAQ75723.1| DNA polymerase III subunit beta [Synechococcus sp. WH 5701] (380 aa)
Score = 208, Expect = 1.1e-14, Identities = 77/371 (20%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-------PQDFRIVLDV-SLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK++ S+ +L  +L+L +    +  + PV    L+  +    + + +   +S    +  S  A++   G I + ++ F  I+++L ++  I+L  +     +++ + +    +  +  E +P++         L + P    K +    +A + ++ K  +++G+      +++ LE  ATDG++L+  + E          + F + +   SL EL  LL     D  + ++     ++F  ++ ++ S+ ++G YPN  ++I       + + ++  V+ALER +A+ + +  ++VKL+   +S  L +S  + D+G+  E +       +P  I+ N  ++L  LK    + + +  +    P +L   +DP F  +++P++
  S:     1 MKLVCSQAELSASLQLVSRAVASRPTHPVLANVLLTADAGTGRLSLTGFDLSLG--IQTSLPASVESSGTITLPSRLFGEIVARLSSDSPISLSCEEGQEQVEITSRSGSYQMRGLSAEDFPDLPLVQTG-TPLRLQPDALVKGLRATLFASSGDEAK-QLLTGVHLGL--ADQDLECAATDGHRLSVLRLEKAFSGAEDGSEPFAVTVPARSLRELERLLSACSSDDPVSLYCDRGQVVFLWADQVLTSRSLDGTYPNYRQLIPDRFSRTLELDRRGFVQALER-VAVLADQHNNVVKLSSDPASGQLHISADAQDVGSGSEDLPAVIS-GDPIEIAFNVRYMLDGLKAMTPERVELRCNAPTTPAVLTSAQDPTFTYLVMPVQ 377
>gi|81251089|gb|ABB69888.1| DNA polymerase III beta chain [Nitrosovibrio sp. FJI82] (370 aa)
Score = 207, Expect = 1.3e-14, Identities = 84/369 (22%), Positives = 179/369 (48%)
  Q:     9 IIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF-ESTPQDFRIVL--DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           I  +K  L+  L+    I E   + P+    LIE    EI FT ++  I   +    S+D +  +   I +  K    I+  L  N  +TLE  +N  ++VK      N+  +  E +P +  S     ++++     K  +  V+YA+     +   ++G+    +     L+++ATDG++L       S P++ + V+    +++EL  ++ D +  + + L ++ + F  SN ++ SK+++G +P+ +R+I    + +  +++ T ++ L+R  +I S+EK   V+L  ++  L++  S+++   ++E +      NE   I  N  +LL +L     + +   F D+    L+    + +F  +++P+R
  S:     4 IQTNKDALLKPLQAVTGIVERRHTLPILSNVLIERKREEISFTATDLEIQIATTAPDSKDES-KQTSAITVAAKKLQDILRALPDNVQVTLEAQENR-LQVKAGKSRFNLQTLPAEDFPRLPESSTPQAKITLPQKELKNLLFLVQYAMAQQDIRY-YLNGLLL--LVEADHLKVVATDGHRLGFASIVMSQPREKKEVILPRKAVLELAKQLHDSEEPVTVELLQNQVRFTFSNIVLVSKVVDGKFPDYNRVIPVGYQKQFTLNRVTFLQTLQRA-SILSNEKFRGVRLILTAGNLQIVCSNNEQEEAQEELEIDYD-NEALDIGFNISYLLDVLNNLTCETVQCSFGDANSSALITIPGNDDFKYVVMPMR 369
>gi|114798873|ref|YP_759292.1| DNA polymerase III subunit beta [Hyphomonas neptunium ATCC 15444] >gi|114739047|gb|ABI77172.1| DNA polymerase III, beta subunit [Hyphomonas neptunium ATCC 15444] (373 aa)
Score = 207, Expect = 1.5e-14, Identities = 81/371 (21%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIV----FKKSISKVKYAVNNNKEKINIMSGICFNSISSEK---TLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L++AL    +I E   + P+    L+E     +K T ++  I        S  AN+   G +       F ++ KL +   + LE    S    +  T  +  ++ +    P  +F     ++ ++S  +    F + I K ++A++  + +   ++GI  ++  ++     L  +ATDG++LA  + ++     +    IV   ++ E    +   D ++EI + ++ II +    ++ SK+I+G +P+ +R+I    + K+ +  K    A++R ++  S+E+   VKL+ S+  L ++ + ++ G +          +EP  I  N  +LL +    ++  +   F+D   P L+ D  D +   +++P+R
  S:     1 MKLTIERGDLLDALSHVQNIVERRTTIPILSNVLLEATQGALKLTATDLDIEA----VDSALANVSRPGSVTAPAGTLFDVVRKLPSGAEVELELNPES----QRLTIAAGRSLFELPTLPAADFQTMTPDEGAVSFKIAAKDFARLIDKTRFAISTEETRY-YLNGIYLHAAKADDGSAVLRTVATDGHRLALAELKAPKGAEKLTGVIVPRKTVGEARRLLDGLDEDVEIEVSDTKIILRAGRAVLTSKLIDGSFPDYARVIPKGNDKKMTVDNKAFEAAVDR-VSTVSAERSRSVKLSVSNGRLTLAVNHAETG-AGNEEIEAEYESEPMEIGFNAKYLLDIAGQIESSEVEFMFNDPASPALVLDPSDDSARFVVMPLR 372
>gi|119947309|ref|YP_944989.1| DNA polymerase III, beta subunit [Psychromonas ingrahamii 37] >gi|119865913|gb|ABM05390.1| DNA polymerase III, beta subunit [Psychromonas ingrahamii 37] (367 aa)
Score = 207, Expect = 1.5e-14, Identities = 84/371 (22%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLC-NSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   +S+   +  L+L  +S++    + P+    LIEV DN++  T ++  +   +++A     N  E G I +  +    I   L        +V    + +++      ++ +    +PNI  S+    +L++    FKK I   ++A+ +   +   ++G+ F +  SE+TL  +ATDG++LA       +   Q   IV    +IEL+  + +   N+ I + ++N+   +   I  +K+++G +P+  R+I    + ++  ++++L +A  R  AI S+EK   V+L  S  +L+++ ++ +   ++E +      +    I  N  ++L +L T  ++ + + FS+S    L+      + L +L+P+R
  S:     1 MHFSISREAFLRPLQLVVSSVAGGRPALPIMANILIEVKDNQLSLTGTDLEVELIAVIALE---NPSENGVITVPARKLLDICRGLSEPCEIKFQVKEEKVTIRSGRSRYLLSSLPAVDFPNIE-SWQSLVELTVPQAEFKKLIEFTQFAMASQDVRY-YLNGMYFEA--SEQTLRSVATDGHRLASCSIKLNQVIEQQSVIVPRKGVIELVKLLDNDQANVTIQIGQNNLRAVIDGFIFTTKLVDGRFPDYRRVIPKNGDKELISNRESLKQAFSRA-AILSNEKFRGVRLILSENLLQITANNPEREEAEEYIDVDYH-SANLEIGFNVSYVLDVLNTLKSEQVKITFSNSDHSALIESIDSDDSLYVLMPMR 366
>gi|120436260|ref|YP_861946.1| DNA polymerase III subunit beta [Gramella forsetii KT0803] >gi|117578410|emb|CAL66879.1| DNA polymerase III subunit beta [Gramella forsetii KT0803] (372 aa)
Score = 207, Expect = 1.6e-14, Identities = 83/347 (23%), Positives = 156/347 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP--QDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS   L+  L++   +  N  + P+    L ++N++E+  + S+ + +T S   K E  +   +G+I +  K     +     + +T    DN+ I++ ++     +   D E++PN      D +   +   +   +ISK  +A  N+  +  +MSG+ F    +E  L  +ATD +KL  Y  E     Q    ++    + LL  I+   ++ + I   +SN  F    T +  ++I+G YPN   +I     NK+ I +   + ++ R ++I S++    V+L  +   L +S    D  N  E         +   I  N+ FL+ +L     D + +E S
  S:     1 MKFIVSSNYLLKQLQILGGVINNSNTLPILDNFLFDLNNDELTVSASD-LETTMSAKLKVESDS---EGKIAVPAKLLLDTLKTFPEQPLTFVVEDNNTIELSSNHGKYALAYADGEEFPN-PVELEDPSSTVVEADILASAISKTIFASGNDDLR-PVMSGVFFQF--TEDGLTFVATDAHKLVKYSREDIKANQAAEFIMPKKPLNLLKGILAGSESEVLIEYNDSNAKFTFDETQLICRLIDGKYPNYEAVIPKENPNKLTIERNQFLSSVRR-VSIFSNKTTHQVRLKIAGAELNISAEDVDYSNKAEERLTCSYQGDDMQIGFNSRFLVEMLNNLTADEVMLEMS 341
>gi|94264232|ref|ZP_01288027.1| DNA-directed DNA polymerase [delta proteobacterium MLMS-1] >gi|94266206|ref|ZP_01289915.1| DNA-directed DNA polymerase [delta proteobacterium MLMS-1] >gi|93453213|gb|EAT03671.1| DNA-directed DNA polymerase [delta proteobacterium MLMS-1] >gi|93455343|gb|EAT05547.1| DNA-directed DNA polymerase [delta proteobacterium MLMS-1] (376 aa)
Score = 207, Expect = 1.6e-14, Identities = 71/367 (19%), Positives = 175/367 (47%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNS--ISSEKTLEIIATDGYKLA--HYKFEST----PQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENK-VNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           V + + + AL    +I+    +  V    L+E  ++ +  TT++  +     V     A +   G I +  +  F ++ + + + I + + DN+ +K+     D  +  M  +++P     + D N +++   V ++ I K  YAV +  E    ++G+      +     L ++++DG++LA    K E+       D  I++    ++ + ++ +    I + + E  ++ K     + ++++ GD+P+   II    +N  + I++++L+ +L R + I + ++ + V     +  + +S  + D G++KE +    +  +   +  N  +    L+  D++ +    +    P LL+ +KDP +L +++P++
  S:     7 VPRPEFLAALASLQNIAGKKGTLAVLANILLEAKEDGLTLTTTDLEVGLRCRVP----AEVTSPGEITLPARKLFELVREAQADQIEIAEQDNTRVKINAGNSDCRLAGMAADEFPAFP-PHQDDNLVAVEAEVIRELIDKTIYAVAHEGEGNFNLAGLLLEKEILEDGHFLRMVSSDGHRLAMMESKVEADLGPLAMDRVILVPRKGMQEVRKLCESGGQIALAIEEKQLVVKAGEYTMVARLMSGDFPDYKSIIQVIDKNTFIGINRESLMHSLRR-VNIFTEDRYNAVHFIIENSRMTLSSQNMDYGSAKEDIPITYE-GDTMRLGFNGKYFYEALQVMDSEMVKAYINAEDSPCLLQGDKDPGYLSVIMPMK 375
>gi|15793547|ref|NP_283369.1| DNA polymerase III subunit beta [Neisseria meningitidis Z2491] >gi|121634190|ref|YP_974435.1| DNA polymerase III subunit beta [Neisseria meningitidis FAM18] >gi|120865896|emb|CAM09632.1| putative DNA polymerase III, beta subunit [Neisseria meningitidis FAM18] >gi|121051532|emb|CAM07829.1| putative DNA polymerase III, beta subunit [Neisseria meningitidis Z2491] (367 aa)
Score = 206, Expect = 1.6e-14, Identities = 88/365 (24%), Positives = 172/365 (47%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKY--AVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+    I E   + P+    LIE    + K   ++  I   +  A  E     +  RI    K F  I+  L    +     D+S + +K       +  +    +P +N   +     S+    FK  +S+V+Y  AV + +  +N   G+      S+  L ++ATDG++LA+         P+   I+   +++EL   + + D  I+I L +  + F+ + T I SK+I+G +P+ +R+I    +    +S+  L+ ALER ++I ++EK    +L   S +L V  S+++   ++E +    +  E   +  N  +L+ +L+   +D++ + F D+ +  L     +PNF  I++P+R
  S:     8 RDSLLKPLQAVTGIVERRHTLPILSNVLIEGKGGQTKLLATDLEIQIDT--AGPEGG--ADDFRITTNAKKFQDILRALPAGALVSLDWDDSRLTLKAGKSRFALQTLPAADFPMMNVGEDISATFSLEQERFKTMLSQVQYSMAVQDIRYYLN---GLLMQVEGSQ--LRLVATDGHRLAYAACAIDADLPRAEVILPRKTVLELFKLLNNPDDPIQIELLDKQVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALER-VSILANEKFRGARLFLQSGLLSVVCSNNEQEEAREEIEIAYQGGE-LEVGFNIGYLMDVLRNIHSDDMQLAFGDANRSTLFTVPNNPNFKYIVMPMR 366
>gi|116490128|ref|YP_809649.1| DNA polymerase III, beta subunit [Oenococcus oeni PSU-1] >gi|116090853|gb|ABJ56007.1| DNA polymerase III, beta subunit [Oenococcus oeni PSU-1] (374 aa)
Score = 206, Expect = 1.8e-14, Identities = 89/371 (23%), Positives = 167/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN---ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE--KDPNFLQILVPIR 377
           MK  V + +L N L + +         P+  G  I V++NE+    SN  IS  +++   +D     I E G I+     F  II  L ++ + +   + S I +   + D  +     + YP +    +D N ++I        I +   AV+    +  +++GI F     +  ++ ++TD ++L+    K  +  Q   +V   +LIEL  LLE ID   N+ +    S ++  +  T   S+++EG YP   R+I +       I    L  +L+R   ++      + + + S + L +S + S++G   E +S      E   IS N  F+   L +     +   F+ + +P ++R     D N +Q++ P+R
  S:     1 MKFSVKRNELTNKLNIVSRAISGKVIIPILTGIKISVSNNEMTLIGSNSEISIKTVLTADKDKKNLVIEEPGEIIANANFFSNIIKHLSSDKVEIS-TEGSQIAIVGGSSDFTVAGQSADNYPQLP-RLDDANTINIPSSELIDIIGETIRAVSIQDSR-PLLTGIHFTI--GDNQIKAVSTDSHRLSQRITKIGNDSQADVVVPSKALIELRALLENID---NLNLQFDRSQLLVDLGETTFYSRLLEGQYPATDRLIPSDSTTSFTIDAAQLAPSLDRASLVAHQSGNIVAEFSISQDKLVLSTAQSEVGKVLEELSIDNFKGEDLKISFNPDFVRDALSSIGESKLDFSFTTNLRPFVIRPNGASDNNKVQLITPVR 372
>gi|75906227|ref|YP_320523.1| DNA polymerase III subunit beta [Anabaena variabilis ATCC 29413] >gi|75699952|gb|ABA19628.1| DNA polymerase III, beta subunit [Anabaena variabilis ATCC 29413] (387 aa)
Score = 206, Expect = 2.0e-14, Identities = 79/355 (22%), Positives = 169/355 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN--DNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNS---------VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN----IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFS--SSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           MK++ +++ L   L L N    +  + PV    L++ +   N++  T  +  +   +    S +A++ + G I +  K    I S+L    ITL+    +         ++ +   T    +  M  E++P +    N    + ++     + +    +A + ++ K  +++G+  +    + TLE  ATDG++LA          E   Q   + +    +  L  ++  +      I ++L +  +IF   N  + S+ +EG YP   ++I    E +V I ++  +  LER +A+ + +K +IVKL   S   E++ S  + ++G+ +E+++ +    E   I+ N  +L+  LK   +  I +  + +  PV+ 
  S:     1 MKLVCAQSDLSTNLSLVNRAVPSRPTHPVLANVLLQADAETNQVSLTAFDLSLGIRT----SFNADVWQSGAIALPAKLLVDITSRLPEGEITLDDESATDGTATGEGLIVSLTPKTGKYQLRAMGAEEFPELPLIENT-TAIYLTATSLIEGLRGSLFATSGDETK-QVLTGV--HLTVKQDTLEFAATDGHRLAVVETTNERPLEDNDQQLEVTVPARALRELERMLAHNAASEEPIALYLDQGQVIFAWQNQRLTSRTLEGQYPAYRQLIPRQFERQVTIERRQFLSTLER-IAVLADQKNNIVKLTIDSTAQELTLSCEAQEMGSGRESMNAE-IAGEDIEIAFNVKYLMEGLKALPSPEIQMHINQNLTPVIF 368
>gi|59800475|ref|YP_207187.1| DNA polymerase III subunit beta [Neisseria gonorrhoeae FA 1090] >gi|59717370|gb|AAW88775.1| putative DNA polymerase III, beta subunit [Neisseria gonorrhoeae FA 1090] (367 aa)
Score = 206, Expect = 2.0e-14, Identities = 88/365 (24%), Positives = 176/365 (48%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKY--AVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+    I E + + P+    LIE    + K   ++  I   +   +    +     RI    K F  I+  L    +++L+  DN + +K   S F   +  +    +P +N   +     S+    FK  +S+V+Y  AV + +  +N   G+      S+  L ++ATDG++LA+         P+   I+   +++EL   + + D  I+I L +  + F+ + T I SK+I+G +P+ +R+I    +    +S+  L+ ALER ++I ++EK    +L     +L V  S+++   ++E +    +  E   +  N  +L+ +L+   +D++ + F D+ +  L     +PNF  I++P+R
  S:     8 RDSLLKPLQAFTGIVERLHTLPILSNVLIEGRGGQTKLLATDLEIQIDTAGPEGGAGDF----RITTNAKKFQDILRALPAGALVSLDWDDNRLTLKAGKSRF--ALQTLPAADFPMMNVGEDISATFSLGQERFKTMLSQVQYSMAVQDIRYYLN---GLLMQVEGSQ--LRLVATDGHRLAYAACAIDADLPRAEVILPRKTVLELFKLLNNPDDPIQIELLDKQVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALER-VSILANEKFRGARLFLQPGLLSVVCSNNEQEEAREEIEIAYQGGE-LEVGFNIGYLMDVLRNIHSDDMQLAFGDANRSTLFTVPNNPNFKYIVMPMR 366
>gi|88802627|ref|ZP_01118154.1| DNA polymerase III, beta chain [Polaribacter irgensii 23-P] >gi|88781485|gb|EAR12663.1| DNA polymerase III, beta chain [Polaribacter irgensii 23-P] (372 aa)
Score = 206, Expect = 2.1e-14, Identities = 76/347 (21%), Positives = 163/347 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS ++L+  L++   +  +  + P+    L E+++N +K + S+   +  S+V    D+     G I +  +     +    ++ +T +    + I++ +     ++     +++P    S    ++  I   +   +ISK  +A  N+  +  +MSG+ F    S ++L  +ATD +KL  Y     +  Q    ++    + LL  I+   D+++ I   ++N  F   N ++  ++I+G YPN   +I     NK+ + + + + ++ R ++I SS+    ++L  +   L +S    D  N + E +SC  + ++   I  N+ FL  +L    +  + +E S
  S:     1 MKFIVSSSQLLKQLQVLGGVINSNNTLPILDNFLFELSENNLKISASDLETTMSSVVTVESDST----GSIAVSARLLLDTLKTFPDQPLTFKTEGANTIEISSDQGKYDMAYFGGDEFPKA-LSLPSPSKTVIPANILGTAISKTIFAAGNDDLR-PVMSGVFFQF--SSQSLTFVATDAHKLVKYSRTDVTADQTAEFIMPKKPLNLLKGILGGSDSDVTIEYNDANAKFTFDNIVLVCRLIDGKYPNYEAVIPKENPNKLTVDRASFLNSVRR-VSIFSSKTTHQIRLKMAGTELNISAEDLDFANKADERLSCDYQGDD-MQIGFNSRFLSEMLSNLSSTEVLIEMS 341
>gi|186680583|ref|YP_001863779.1| DNA polymerase III, beta subunit [Nostoc punctiforme PCC 73102] >gi|186463035|gb|ACC78836.1| DNA polymerase III, beta subunit [Nostoc punctiforme PCC 73102] (387 aa)
Score = 206, Expect = 2.1e-14, Identities = 85/355 (23%), Positives = 172/355 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN--DNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDS------------NINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFRIVLDVS--------LIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFS--SSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           MK++ S++ L   L L +    +  + PV    L++ +   N++  T  +  +     +  S +A + + G I +  K    I S+L    ITL+  D S +   TS+ +              +  M  E++P +    N    + ++     + +    +A + ++ K  +++G+  +    + TLE  ATDG++LA  +  +  P      L+V+        L  +L      D  + ++  +  ++F   N  + S+ +EG YP   ++I    E +V I ++  V  LER +A+ + +K +IVKL+  S+  E++ S  + D+G+ +E++  +    E   I+ N  +L+  LK   +  I +  + S  PV+ 
  S:     1 MKLVCSQSDLSTNLSLVSRAVPSRPTHPVLANVLLQADAETNQVSLTAFDLSLG----IRTSFNAEVWQGGAIALPAKLLVDITSRLPEGEITLD--DESALTGATSSGEGLIVTLTPKSGHYQVRAMGPEEFPELPVIENT-EVIYLTTAALVEGLRGSLFATSGDETK-QVLTGV--HLTVKQDTLEFAATDGHRLAVVETSNERPLGGTSQLEVTVPARALRELQRMLAHSASSDEPVALYFDQGQVVFAWQNQRLTSRTLEGQYPAYRQLIPRQFERQVTIERRQFVSTLER-IAVLADQKNNIVKLSIDSKAQEITLSCEAQDVGSGRESMPAQIS-GENIEIAFNIKYLMEGLKELPSSEIQMHLNQSLTPVIF 368
>gi|88809363|ref|ZP_01124871.1| DNA polymerase III subunit beta [Synechococcus sp. WH 7805] >gi|88786582|gb|EAR17741.1| DNA polymerase III subunit beta [Synechococcus sp. WH 7805] (389 aa)
Score = 205, Expect = 2.2e-14, Identities = 77/368 (20%), Positives = 181/368 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----------STPQDFRIVLDVSL-------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILV 374
           MK++ S+T+L  AL+L +    +  + PV    L+  +    + + +   +S    +  S  A++   G + +  + F  I+S+L ++       D++  +V+ ++   +  +  M  + +P++    N    + + P    +++    +A ++++ K  +++G+       +  LE  +TDG++LA    +           S   D    L V+L       +E L+     +  + +F     ++   ++ ++ S+ +EG YPN  ++I       + + ++  V +LER +A+ + +  ++V+++   S  ++++S  + D+G+  E++  + + +E   I+ N  ++L  LK  D D I +  +    P +L  E D + L  LV
  S:     1 MKLVCSQTELNTALQLVSRAVASRPTHPVLANVLLTADAGTDRLSLTGFDLSLG--IQTSLPASVDTSGAVTLPARLFGEIVSRLSSDSPITLATDDTSEQVELTSLSGSYQMRGMPADDFPDLPLVENG-TAIKLDPAALVRALRSTLFASSSDEAK-QLLTGVHLRF--DQTRLEAASTDGHRLAVLSVDDALKDAIAADDSAEADESAALAVTLPARSLREVERLMAGWKGNDPVSLFFERGQVVVLAADQMVTSRTLEGTYPNYRQLIPESFSRTIGLDRRAFVASLER-IAVLADQHNNVVRISSDPSKGLIQISADAQDVGSGSESLPAQIEGDE-VQIAFNVRYVLDGLKAMDGDRIVLSCNAPTTPAILSPEDDGSGLTYLV 382
>gi|34556460|ref|NP_906275.1| DNA polymerase III subunit beta [Wolinella succinogenes DSM 1740] >gi|34482174|emb|CAE09175.1| DNA POLYMERASE III, BETA CHAIN [Wolinella succinogenes] (355 aa)
Score = 205, Expect = 2.3e-14, Identities = 86/370 (23%), Positives = 177/370 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           M I++ K+ L N L       E   +S +      +   +E+ F  ++  I    ++AK+E   I ++G   +  K    I+ +LK   ITL+  +  + IK + S+F   + + + E++P+   SY +  ++ I+ +   +S+ K+  A++NN  K  +   +       E +   +ATD  +LA  K+E+ P   ++ L V    ++     F   +E+   E+++I K  N +  +K+I G YP+  RII     + + + K+ ++EA++   ++S+      +K+ F+ E +     S +   +K  V  +  + +   + +N+ +LL  L   D     +  ++S  P +L+ E   NF  +++PI
  S:     1 MNIVIPKSSLENILTNLQPFLEKKDASQITSHVYFKAQGSELTFQATDYEIG---LLAKTESVQIQKEGIATVNGKKILDIVRRLKEGEITLQSQEEYLHIKQEKSSF--KLPMFNAEEFPSFP-SYEELPKIEINSMHLVQSMKKILPAIDNNNPKFELNGALL---DIKEYSFNFVATDTRRLAVIKYEN-PSINKLALIVPKKAIVEIQKLFFEEVELHYSETHLILKSKNYLFFTKLISGKYPDYERIIPKETTHNMTLPKEKIIEAIKLINSLSND-----IKVTFTKEEILFESLSEENSEAKTQVEVETGITKELTLGINSKYLLDYLGQIDTSEFKIGINESNTPFILKSE---NFSTVIMPI 353
>gi|114561190|ref|YP_748703.1| DNA polymerase III, beta subunit [Shewanella frigidimarina NCIMB 400] >gi|114332483|gb|ABI69865.1| DNA polymerase III, beta subunit [Shewanella frigidimarina NCIMB 400] (366 aa)
Score = 205, Expect = 2.4e-14, Identities = 85/371 (22%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L+EV+++ +K T ++  +      A   D +I   GR  +  K    I+  L  +  + +E+ DN  +++   S F  ++  +  E YPN+     D  + S+   V K  I   ++++ N   +   ++G+ F +      L  IATDG++LA  H   + S P+   IV    ++E+   +   D +I I + ++ I    S+ +  SK+++G +P+  R++       V  S+  L +AL R  +I S+EK   V++   + +L+++ ++ +   ++E +  +   ++   I  N  +LL +L    +D + +   D     L+ + K+ + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVCGAVERRHNLPILANLLVEVSESSLKLTGTDLEVELVGQAAIHGDIDI---GRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRSRF--SLATLPAEDYPNVEEFQADI-EFSLKQGVLKSIIDSTQFSMANQDVRY-YLNGLLFET--EGNVLRAIATDGHRLALSHRTLDVSLPEKQVIVPRKGVVEMARLLDSDDQDITIAIGDNAIRAITSSAVFTSKLVDGRFPDYRRVLPKGGNKVVIASRNQLKQALTRA-SILSNEKFRGVRIQLETGLLKITANNPEQEEAEEIIDVEYD-SDNLEIGFNVSYLLDVLNNLASDEVRITLIDGNSSALIENHKEEDSMYVVMPMR 365
>gi|15677733|ref|NP_274896.1| DNA polymerase III subunit beta [Neisseria meningitidis MC58] >gi|7227158|gb|AAF42232.1| DNA polymerase III, beta subunit [Neisseria meningitidis MC58] (367 aa)
Score = 204, Expect = 2.8e-14, Identities = 85/365 (23%), Positives = 169/365 (46%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKY--AVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+    I E   + P+    LIE    + K   ++  I   +   +    +     RI    K F  I+  L    +     D+S + +K       +  +    +P +N   +     S+    FK  +S+V+Y  AV + +  +N   G+      S+  L ++ATDG++LA+         P+   I+   +++EL   + + D  I+I L +  + F+ + T I SK+I+G +P+ +R+I    +    +S+  L+ ALER  +I ++EK    +L     +L V  S+++   ++E +    +  E   +  N  +L+ +L+   +D++ + F D+ +  L     +PNF  I++P+R
  S:     8 RDSLLKPLQAVTGIVERRHTLPILSNVLIEGKGGQTKLLATDLEIQIDTAGPEGGAGDF----RITTNAKKFQDILRALPAGALVSLDWDDSRLTLKAGKSRFALQTLPAADFPMMNVGEDISATFSLEQERFKTMLSQVQYSMAVQDIRYYLN---GLLMQVEGSQ--LRLVATDGHRLAYAACAIDADLPRAEVILPRKTVLELFKLLNNPDDPIQIELLDKQVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFVLSRAELLGALERA-SILANEKFRGARLFLQPGLLSVVCSNNEQEEAREEIEIAYQGGE-LEVGFNIGYLMDVLRNIHSDDMQLAFGDANRSTLFTVPNNPNFKYIVMPMR 366
>gi|86133972|ref|ZP_01052554.1| DNA polymerase III, beta chain [Tenacibaculum sp. MED152] >gi|85820835|gb|EAQ41982.1| DNA polymerase III, beta chain [Polaribacter dokdonensis MED152] (372 aa)
Score = 204, Expect = 3.0e-14, Identities = 74/347 (21%), Positives = 168/347 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS ++L+  L++   +  +  + P+    L E+++N++K + S+   +  S+V    D++    G I +  +     +    ++ +T +   ++ I++ +     ++     +++P    S    ++  +   +   +ISK  +A  N+  +  +MSG+ F    S ++L  +ATD +KL  Y     +  Q    ++    + LL  I+   ++++ I   ++N  F   N ++  ++I+G YPN   +I     NK+ + + + + ++ R ++I SS+    ++L  +   L +S    D  N + E +SC  + ++   I  N+ FL  +L   ++ ++ +E S
  S:     1 MKFIVSSSQLLKQLQVLGGVINSNNTLPILDNFLFELSENQLKVSASDLETTMSSVVDVESDSS----GSIAVSARLLLDTLKTFPDQPLTFKTEGDNTIEISSDQGKYDMAYFGGDEFPKA-VSLPSPSKTVVPANILGTAISKTIFAAGNDDLR-PVMSGVFFQF--SSQSLTFVATDAHKLVKYSRTDVTADQTAEFIMPKKPLNLLKGILGGSESDVTIEYNDANAKFTFDNIVLVCRLIDGKYPNYEAVIPKENPNKLTVDRASFLNSVRR-VSIFSSKTTHQIRLKMAGTELNISAEDLDFSNKADERLSCDYQGDD-MQIGFNSRFLSEMLNNLNSSDVLIEMS 341
>gi|148251628|ref|YP_001236213.1| DNA polymerase III subunit beta [Bradyrhizobium sp. BTAi1] >gi|146403801|gb|ABQ32307.1| DNA polymerase III, beta subunit [Bradyrhizobium sp. BTAi1] (372 aa)
Score = 204, Expect = 3.0e-14, Identities = 79/371 (21%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNS--ISSEKTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+   +  +    ++  +     V ++  A     G   +    F+ I+ KL +   I LE   + +V+ ++       +  + E  +P++  + +  +   +     K  I + ++A++  + +   ++GI  ++   + + +L  +ATDG++LA         +      IV   ++ E+   I D D+ I I L +  I F +   ++ SK+I+G +P+  R+I    + ++ + K     A++R ++  SSE+   VKL  S   L +S ++ D G++ E +  +    +   I  N+ +LL +    + +   +  +D   P L++D  + N L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLRATDLDLE----VTETLAAETATAGATTVPAHMFYDIVRKLPDGSQIVLESDGERAVLAIRAGRSKFTLQTLPESDFPDLA-AGDMTHAFGVPAKDIKSLIDRTQFAISTEETRY-YLNGIYLHAGGTAKQPSLRAVATDGHRLAQVDLPQPAGAAEMPGVIVPRKTVGEVQRLIEDNDSEIRIELSQGKIRFTLGQVVLTSKLIDGTFPDYGRVIPQNNDKELIVDKADFAAAVDR-VSTISSERGRAVKLALSPGRLVLSVTNPDSGSATEELEVE-YAADALDIGFNSRYLLDIAAQIEGEVAVLRLADPGSPTLIQDRDNRNALYVLMPMR 371
>gi|51244500|ref|YP_064384.1| DNA polymerase III, beta chain [Desulfotalea psychrophila LSv54] >gi|50875537|emb|CAG35377.1| probable DNA polymerase III, beta chain [Desulfotalea psychrophila LSv54] (376 aa)
Score = 204, Expect = 3.1e-14, Identities = 82/373 (21%), Positives = 178/373 (47%)
  Q:     5 LKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISS--EKTLEIIATDGYKLAHYKFESTPQDFR--IVLDVSLI-----ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRII-ATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           + ++  V K  L+  L    +I+    +  +    LIE ++  +  T ++  I     +     A I  +G + + +K  F I+ +  +E I++E+ +NS + +K      N+  M  ++YP     Y++ +       +F++ I KV ++V N +E I  ++ I F       +  L++I++DG++L+  + E  P D     V  V+LI     +   +  D   +IE+      +I + +  ++   +  G++P    I+ A   EN + I +   +++L+R + + + +    ++L    + + +S  ++DLGN+K+         EP  +  N  + +  L+  + + I    + S  P L+  + DP F  I++P++
  S:     1 MSLQCTVLKQDLLEGLGSIQNITNKNGTMAILFNVLIETSNGGLTLTATDLEIGLKIFI----KAEIHGEGSLTLPSKKIFEIVRESGSEKISIEEKENSWVVIKAGQSTYNLAGMASDEYPEFP-EYDEDSFTVFESYLFQELIEKVIFSVANEQENIYTLTSILFEKEKEGDKNYLKMISSDGHRLSIMRRE-VPVDLTNFKVNPVTLIPKKGVQEWKKFCDNKDSIEVSFEHDKLILRNNQDVMVVSLKTGEFPQYKAIVDAVQLENCLEIPRIPFLDSLKR-INLFTEDVFHTIQLAIDKDFMVLSSQNADLGNAKDE-QVIAYSGEPLTLGFNCRYFIDTLQAMECEKIKAYINSSNSPCLINSDDDPGFTSIIMPMQ 375
>gi|88805371|ref|ZP_01120890.1| DNA polymerase III, beta chain [Robiginitalea biformata HTCC2501] >gi|88784189|gb|EAR15359.1| DNA polymerase III, beta chain [Robiginitalea biformata HTCC2501] (372 aa)
Score = 204, Expect = 3.4e-14, Identities = 77/347 (22%), Positives = 163/347 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS T L+  L++   +  N  + P+    L ++N  ++  + S+      + ++   + +  +KG I +  +     +     + +T    DN+ +++ +S     +   D  ++P       D ++  I   +   +I K  +A  N+  +  +MSG+ F    S + L  +ATD +KL  Y+       +    ++    + LL  I+    + + +   +SN  F  +NT++  ++I+G YPN   +I     NK+ I +  L+ ++ R ++I S++    ++L  +   L +S    D  N ++E ++C  + ++   I  N+ FL+ +L    +D I++E S
  S:     1 MKFIVSSTYLLKQLQVLGGVISNSNTLPILDNFLFDLNGTKLTVSASD----LETTMSSELEVDSGDKGTIAVPARLLLDTLKTFPEQPLTFVVEDNNTVEISSSHGKYALAYADGAEFPKA-VELPDPSKTEIMGDILATAIDKTLFAAGNDDLR-PVMSGVFFQF--SPEGLTFVATDAHKLVKYRRTDVQASEVAEFIMPKKPLNLLKGILAGSEDPVTVAYNDSNAKFLFANTVLVCRLIDGKYPNYEAVIPKENPNKLVIQRSQLLSSVRR-VSIFSNKTTHQIRLKIAGAELNISAEDVDYSNKAEERLTCSYQGDD-LQIGFNSRFLVEMLGNLGSDEISLEMS 341
>gi|163848190|ref|YP_001636234.1| DNA polymerase III, beta subunit [Chloroflexus aurantiacus J-10-fl] >gi|187602869|ref|ZP_02989091.1| DNA polymerase III, beta subunit [Chloroflexus sp. Y-400-fl] >gi|163669479|gb|ABY35845.1| DNA polymerase III, beta subunit [Chloroflexus aurantiacus J-10-fl] >gi|187485056|gb|EDU23035.1| DNA polymerase III, beta subunit [Chloroflexus sp. Y-400-fl] (377 aa)
Score = 204, Expect = 3.5e-14, Identities = 77/343 (22%), Positives = 169/343 (49%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRI--VLDVSLIELLLEIIDFDTNIEIFLFE----SNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSI-VKLNFSSEV----LEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           PV    L+  ++  +K T +N  +  +  ++    A I   G + +  K    ++  L N+ +TL        ++V+   F SNI  +D +++P++         +S+   V++++I +V +A   ++ +  I++G+   +   + TL  +A DG++LA    + S P    +  ++    +  L  II  DT+ E+ +      S+++F   N  + S++IEG +P+  RII      ++ +    L +A++     + S +  + +K+  +SE+    + +S ++++LG++  T    G V  E   I+LN  FL   +    ++ I  E   +  P + +      ++ I++P+
  S:    28 PVLANILLATDEGRLKLTATNLEVGINRWIS----ATITRDGAVAVPAKLLTDVVGGLPNDKVTLSLDQKTQTLRVECGRFVSNIKGVDADEFPSLPTVSAQTPLVSLPAEVWQEAIDQVAFAAATDESR-PILTGVLVRTRDQQVTL--VAADGFRLAMRTIQLSAPVAHAVDCLIPARTLSELARIIG-DTDAEVAMVYTPGGSHVLFHTENIEVVSRLIEGRFPDFERIIPQQYLTRMVLDNSELAKAVKLASFFAGSSQNVVKLKIEPASELAPGRVVISANAAELGDN--TSELDGSVTGEGGVIALNVRFLADAIAAVHSNQIAFEMQSAQSPAVFKPVGQDGYIHIVMPM 374
>gi|56751505|ref|YP_172206.1| DNA polymerase III subunit beta [Synechococcus elongatus PCC 6301] >gi|81298812|ref|YP_399020.1| DNA polymerase III subunit beta [Synechococcus elongatus PCC 7942] >gi|56686464|dbj|BAD79686.1| DNA polymerase III beta subunit [Synechococcus elongatus PCC 6301] >gi|81167693|gb|ABB56033.1| DNA polymerase III, beta subunit [Synechococcus elongatus PCC 7942] (390 aa)
Score = 204, Expect = 3.6e-14, Identities = 83/371 (22%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINF-SYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STP-QDFRIVLD---VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK++  + +L  +L L +    +  + PV    L+  +    + + +   +S    +  S  A +   G I +  K    I+S+L N+  +TLE  D +   +   +    +  +  +++P +      +  QLS S ++  + +    +A + ++ K  I++G+          LE  ATDG++LA  K E   +TP  +F + +    +  +E ++ I   D  I ++  +   +F+  +  + S+ ++G YPN  ++I       V + +K L+ ALER +A+ + ++ + ++L+   E   L ++  + D+G+ +E V  +  + EP  I+ N  +L   LK  +  +I ++ + +  PV+L          +++PI+
  S:    16 MKLVCRQNELNTSLSLVSRAVPSRPNHPVLANVLLAADAGTQRLSLTAFDLSLG--IQTSFAAQVERSGAITLPAKLLNDIVSRLPNDSDVTLEDND-AAATLSVGSGQYQMRGISADEFPELPLVQSQEALQLSASALI--EGLRGTLFATSGDETK-QILTGVHLKV--QPDGLEFAATDGHRLAVVKTENAAATPATEFAVTVPSRALRDLERMIAIRGSDEAIALYHDQGQTVFQWGDQYLTSRTLDGQYPNYGQLIPREFNRNVAVDRKRLLAALER-IAVLADQQNNAIRLSLDPENNRLALAVDAQDVGSGQEAVPAE-IIGEPLEIAFNVRYLAEGLKALNTTDIQIQLNSNTSPVVLSPLGPVKITYLVMPIQ 387
>gi|150398727|ref|YP_001329194.1| DNA polymerase III subunit beta [Sinorhizobium medicae WSM419] >gi|150030242|gb|ABR62359.1| DNA polymerase III, beta subunit [Sinorhizobium medicae WSM419] (372 aa)
Score = 203, Expect = 3.7e-14, Identities = 74/371 (19%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISS--EKTLEIIATDGYKLAHYKFES------TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + ++ L+ +L   + + E   + P+    L+  +   ++   ++  +     + ++  A + + G   +     + I+ KL +  E++     + + + V +     ++  + +  +P++    FS++      +     K  I + ++A++  + +   ++GI  +++ S  E  L  +ATDG++LA    E+       P        VS ++ LL+  D    +E+   ++ I   + + ++ SK+I+G +P+  R+I    + ++ +  ++  +A++R ++  SSE+   VKL  +   + ++ ++ D G++ E V   G  ++P  I  N  +LL +             +D   P L+RD    + L +L+P+R
  S:     1 MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRSDGASLEMKATDLDLE----ITEATQAQVEQAGATTVPAHLLYDIVRKLPDGSEVLLATNAEGTAMTVASGRSKFSLQCLPQSDFPDLTAGTFSHS----FRLKATDLKMLIDRTQFAISTEETRY-YLNGIFVHTVESNGELKLRAVATDGHRLARADVEAPSGSEGMPGIIIPRKTVSELQKLLDNPDVVVTVEVS--DAKIRLTIGSIVMTSKLIDGTFPDYQRVIPASNDKELRVDCQSFSQAVDR-VSTISSERGRAVKLALTDGQMTLTVNNPDSGSATEEVPV-GYESDPLEIGFNAKYLLDITAQLTGSEAVFLLADPGSPTLVRDLAADDALYVLMPMR 371
>gi|89098180|ref|ZP_01171065.1| DNA polymerase III subunit beta [Bacillus sp. NRRL B-14911] >gi|89087037|gb|EAR66153.1| DNA polymerase III subunit beta [Bacillus sp. NRRL B-14911] (368 aa)
Score = 203, Expect = 3.9e-14, Identities = 86/371 (23%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDS-NINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD-EKDPNFLQILVPIR 377
           MK  + K +L + ++    +     S P+  G L++   + + FT S+G  S    V   E A  +E     + TK  F +  KLK   I+ E +D  VI  +  T       +MD E YP +       N +  S   F   ++K  +A ++++ +  I+ GI  +   S+     +ATD ++L       + +   + +    +E +L+  DF T + +F  E NI F   +TI  +++++G +P+ SR+I    + K+ I+++   ++++   AIS   ++ IV L+ +   +E++ +  D       ++ +    E   +  +  ++L  LK+ D+ +I++ F+    P +++   ++   LQ+++P+R
  S:     1 MKFKMEKDRLQDTVKKIEKVLNIKSSIPILAGVLVQAKADCLLFTASDGTESIIHRVPLDEGAVNIESEGSAVFTKDCFDVTKKLKGS-ISFELIDQKVIVSQDKTKTRLEFGVMDAEDYPKVAIESTS-NPIIFSGKEFFNIVNKTSFAASSSELR-PILQGIHMSF--SKDGNNFVATDSHRLGKVTTGQSEETMSVTVHAKKLEQVLKSFDFSTEVLVFPTELNIAFANGHTIYYTRLLDGTFPDTSRLIPKEFKQKLVINREEFFDSIDMLSAIS---REGIVMLSINGLFVELA-ALGDTAKGSREIAYESFEGESLEVGFSAKYVLDALKSIDSSSISIGFNGGMSPFVIQPLSEEITELQLILPVR 364
>gi|78183585|ref|YP_376019.1| DNA polymerase III subunit beta [Synechococcus sp. CC9902] >gi|78167879|gb|ABB24976.1| DNA polymerase III, beta subunit [Synechococcus sp. CC9902] (385 aa)
Score = 203, Expect = 4.2e-14, Identities = 82/371 (22%), Positives = 185/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLI--EVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGIC--FNSISSEKTLEIIATDGYKLAHYKFEST-----------PQDFRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE----VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN-FLQILVPIR 377
           MK++ S+++L  AL+L +       + PV    L+  +   N +  T  +  +   + +A    A++   G I +  +    I+S+L ++       + S  +V+ ++   +  +  +  + YP +    +    L + P    +++    +A + ++ K  +++G+   FN+    K LE  ATDG++LA  + E              + F + L    +  +E L+     D  + +F     ++F  ++ ++ S+ +EG YPN  ++I       + + ++ L+ ALER +A+ + +  ++VK  F+S+    V+++S  + D+G+  E+++      +   I+ N  +LL  LK   +D + +  +    P +L+ E D   F  +++P++
  S:     1 MKVVCSQSELNAALQLVSRAVATRPTHPVLANVLLTADAGTNRLSLTGFDLNLGIQTSLA----ASVETSGAITLPARLLGEIVSRLASDSPITLATEESGEQVQLTSLSGSYQMRGLPADDYPELPMVESGMT-LKLQPAGLVQALKGTLFASSADEAK-QLLTGVHLRFNA----KALEAAATDGHRLAVLQVEDALEDAAANSDDAAEGFAVTLPARSLREVERLMAGWRSDDPVSLFCDRGQVVFLAADQMVTSRTLEGTYPNYGQLIPDGFNRTLALDRRGLIAALER-IAVLADQHNNVVK--FTSQPDEGVVQISADAQDVGSGSESLAAN-LTGDAIQIAFNVRYLLDGLKAMGSDRVVLHCNAPTTPAVLKPEGDAEAFTYLVMPVQ 382
>gi|117619320|ref|YP_854529.1| DNA polymerase III, beta subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560727|gb|ABK37675.1| DNA polymerase III, beta subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (367 aa)
Score = 203, Expect = 4.2e-14, Identities = 79/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK----FESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++ +S+  L+  L+L +       + P+    L++V++  +  T ++  +     V  + D+   + GR  +  +    I   L          +   + +++     N++ +   +YPNI     DW    +  I  +  KK I   ++++ +   +   ++G+ F S      L  +ATDG++LA  +     ES P    I+    ++EL+  +   D  + + +  SN+   +   I  SK+++G +P+  R+I    +  +   ++ L +A  R  AI S+EK   V+LN    +L ++ ++ +   ++E +  + +  E   I  N  ++L +L T   D I +  SDS    ++ D    +   +++P+R
  S:     1 MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLTGTDLEVEMIGQVYLNSDS---QDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSGRSRFNLSTLPATEYPNIE----DWESVLEFDIGQLELKKLIDATQFSMASQDVRY-YLNGMLFES--EGHGLRTVATDGHRLATCRREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRSNLRAALDGFIFTSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARA-AILSNEKFRGVRLNLQENLLRITANNPEQEEAEELLDVQYEAGE-MEIGFNVSYVLDVLNTLKCDQIRISLSDSISSAIIEDFDSQDAQYVVMPMR 366
>gi|109896334|ref|YP_659589.1| DNA polymerase III, beta subunit [Pseudoalteromonas atlantica T6c] >gi|109698615|gb|ABG38535.1| DNA polymerase III, beta subunit [Pseudoalteromonas atlantica T6c] (367 aa)
Score = 203, Expect = 4.2e-14, Identities = 83/371 (22%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  +S+   +  L+L +   E   + P+    LI+V+D+ +  T ++  +   S V  + D    E+G I +  K    II  L         VD +   ++      +++ +    YPN+     DW    +  IS    K+ I  V +++     +   ++G+   +   +  +  +ATDG++LA    +Y   + P    I+    ++E+   I D D ++++ +  ++I    ++ I  SK+++G +P+  R++    +  +  SK  L  A  R  +I S+EK   V+LN SS  ++++ ++ +   + E V    +  +   I  N  +L+ +L   + + +    +DS    L+ D  D + L +++P+R
  S:     1 MKFSISRENFLQPLQLVSGAVERRHTLPILSNVLIKVSDSALWLTGTDLEVELISNVTLTGD---FEEGEITVPAKKLLDIIRGLTEGSEISFHVDGNKAILRCGRSKYSLSTLSANDYPNLE----DWQGELEFEISQANLKRLIDSVHFSMAQQDVRY-YLNGMSLET--EDNVIRTVATDGHRLALCRLNYTDATLPNRQVIIPRKGVMEITRLIEDSDKSLKVQVGSNHIRIFSNDFIFTSKLVDGRFPDYRRVLPKDGDKNIIASKLGLKNAFSRA-SILSNEKFKGVRLNLSSGEVKITANNPEQEEAVEIVDVDYQGGD-LEIGFNVAYLIDVLNALNAEEVKFTLADSNSSALIEDGSDDSALYVIMPMR 366
>gi|90408443|ref|ZP_01216603.1| Putative DNA polymerase III, beta chain [Psychromonas sp. CNPT3] >gi|90310427|gb|EAS38552.1| Putative DNA polymerase III, beta chain [Psychromonas sp. CNPT3] (368 aa)
Score = 203, Expect = 4.6e-14, Identities = 83/371 (22%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRL-CNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STP--QDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD-EKDPNFLQILVPIR 377
           M+  +S+   +  L+L   S++    + P+    LI++ D  +  T ++  +    ++ +    +  E+G I +  +    I   L +      +V +  + V++      ++ +    +PNI  S+    + +++   FKK I   ++A+ +   +   ++G+ F +  S  +L  +ATDG++LA    + STP  +   IV    ++EL+  + +   N+ I + ++N+   + N I  SK+++G +P+  R+I    + ++  S+++L +A  R  AI S+EK   V+L  S  +L+++ ++ +   ++E +    + ++   I  N  ++L +L T  ++ I + FS S    L+   + D + L +L+P+R
  S:     1 MQFSISREAFLRPLQLVAGSVAGGRPALPIMANILIQIKDGILSLTGTDLEVE---LITQIHLESPSEEGEITVPARKLLNICRGLSDPCEIKFQVKDDRVTVRSGRSRYLLSSLPASDFPNIE-SWKSLAEFNVAQKEFKKLIEFTQFAMASQDVRY-YLNGMYFEA--SGDSLRSVATDGHRLASCAIKLSTPIEEQSLIVPRKGVVELVKLLDNEQENVTIQIGKNNLRAIIGNFIFTSKLVDGRFPDYRRVIPRNGDKELIASRESLKQAFTRA-AILSNEKFRGVRLTLSKNLLQITANNPEREEAEEYIDIDYQASD-LEIGFNVSYVLDVLNTLKSEKIKITFSSSAHSALIESIDADDDALYVLMPMR 367
>gi|71905644|ref|YP_283231.1| DNA polymerase III, beta subunit [Dechloromonas aromatica RCB] >gi|71845265|gb|AAZ44761.1| DNA polymerase III, beta subunit [Dechloromonas aromatica RCB] (368 aa)
Score = 203, Expect = 4.6e-14, Identities = 76/369 (20%), Positives = 172/369 (46%)
  Q:     9 IIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           I   +  L+  L+  + I E   + P+    L+E   + +    ++  I    I   +E A     G + +  +    I+  L +       +++  ++V+      ++  +  + +P +  S  +  Q SIS   F++ ISK +Y++     +   ++G+    +   K L  +ATDG++LA+   E     P+   I+   +++EL   ++D D  + I L  + + F   + ++ SK+I+G +P+  R++    +N + + ++TL++A++R  AI ++EK   V++      L++  ++++   + E +       +   +  N  +LL +L     D I   F+D+    L+    +  F  +++P+R
  S:     4 IKTQRDTLLAPLQSVSGIVERRHTLPILSNVLLEKKGDRLTLLATDIEIQ---ITTSTECAGGEGDGAVTVGARKMQEILRSLPDTSEVSLVLEDKRLQVRAGKSRFSLQTLPADDFPRMTMSEGETKQFSISQKAFRQLISKTQYSMAAQDVRY-YLNGLLL--LVEGKELRAVATDGHRLAYASVEIDTDLPRQEMILPRKTVLELNRLLVDTDDLLNITLTPNQVRFSFGSVVLVSKLIDGKFPDYERVVPATLKNHMKVGRQTLMQAMQRA-AILTNEKFRGVRVVLGDNSLKLIAANAEQEEAVEEIE-VDYTGDVIDVGFNVGYLLDVLNNIHADEIQWSFNDANSSALITLPGNDRFKYVVMPMR 367
>gi|72383165|ref|YP_292520.1| DNA polymerase III subunit beta [Prochlorococcus marinus str. NATL2A] >gi|72003015|gb|AAZ58817.1| DNA polymerase III, beta subunit [Prochlorococcus marinus str. NATL2A] (386 aa)
Score = 202, Expect = 5.3e-14, Identities = 90/371 (24%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD------------FRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL--NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD-EKDPNFLQILVPIR 377
           MK+  S+++L NAL+L +    N  + PV    L+  ++   K   +   +S    +  S  A+I   G I +  K F  I+SKL N+   +   D +  +V+ ++      +  M  + +P +    N      ++P++   +I    +A + +  K  +++G+  N       +E  ATDG++LA     +   D            F I L    +  +E  L   D    I  F+ +  ++F     II  + +EG YPN S+++    EN++   +K  + +LER +A+ + +  +++K+  + S+ ++++S  + D+G   E++    K  +   I+ N  +LL  LK  D++ I +  +    P +      D NF  +++PI+
  S:     1 MKLSCSQSELNNALQLVSRAVSNRPTHPVLANVLLAADEVTGKLRLTGFDLSLG--IQTSISASIDSSGAITLPAKLFGEIVSKLSNDSPLVLTSDETSQQVELTSKSGTYQVRGMLSDDFPELPLVENG-TSFKLNPLLLSNAIKSTLFASSTDDAK-QLLTGV--NLTFDGYGIESAATDGHRLAVLNLNNILSDSKEIDSSIKFEKFSITLPSKSLREVEKFLSTCDISHPINFFIDKGQVVFISVEDIITIRALEGSYPNYSQLLPDTFENELEFDRKEFISSLER-IAVLADQHNNVIKVTTDGSANLIKISTDAQDIGTGYESLPVSYK-GDSFQIAFNVRYLLDGLKVIDSNLIKLSCNSPTTPAIFSPINSDVNFTYLVMPIQ 383
>gi|37524034|ref|NP_927378.1| DNA polymerase III subunit beta [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36783457|emb|CAE12297.1| DNA polymerase III, beta chain [Photorhabdus luminescens subsp. laumondii TTO1] (366 aa)
Score = 201, Expect = 6.9e-14, Identities = 81/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ + +L+  L+  +S      + P+    L++V +  +  T   G      ++A+   +   E G   +  + FF I   L +      ++D   + V++     +++ +    +PN++    DW    + S+     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       +  P    IV    +IEL+  +   DT +++ +  +NI   V + I  SK+++G +P+  R++    +  +  +   L +A  R  AI S+EK   V+L FS   L ++ ++ +   ++E V    +  E   I  N  ++L +L T   + + +  +D+   V + D  + N   +++P+R
  S:     1 MKFIIEREQLLKPLQQVSSPLSGRPTLPILGNLLLQVTEGSLLLT---GTDLEMEMMARVTLSLPHEVGATTVPARKFFDIWRGLPDGAEISVELDGDRLLVRSGRSRFSLSTLPASDFPNLD----DWQSEVEFSLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMGIGQKLPSHSVIVPRKGVIELMRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEANCDMLKQAFSRA-AILSNEKFRGVRLYFSENQLRITANNPEQEEAEEIVDVSYQGAE-MEIGFNVSYVLDVLNTLRCEEVRLLLTDAISSVQIEDCANHNAAYVVMPMR 365
>gi|86143001|ref|ZP_01061423.1| DNA polymerase III, beta chain [Flavobacterium sp. MED217] >gi|85830446|gb|EAQ48905.1| DNA polymerase III, beta chain [Leeuwenhoekiella blandensis MED217] (372 aa)
Score = 201, Expect = 7.2e-14, Identities = 85/347 (24%), Positives = 173/347 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDA-NILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHY-----KFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS + L+  L++   +  N  + P+    L E+ +N +K + S+    +I+T  +  +SED+ NI    R+L+ T      +     + +T    DN+ I++ ++     +     E++PN     +D ++++I   V   ++S   +A  N+  +  +MSG+ F      + L  +ATD +KL  Y     +   T +       ++L++ +L   D D N+E    +SN  F   N  +  ++I+G YPN   +I     NK+ I +   + ++ R ++I S++    ++L  +   L +S    D  N ++E ++C  + ++   I  N+ FL+ +L   + +++++E S
  S:     1 MKFIVSSSYLLKQLQVLGGVISNSNTLPILDNFLFELEENVLKVSASDLETTMIATLEV--ESEDSGNIAVPARLLLDT------LKTFPEQPLTFVAGDNNTIEISSNHGKYALAYASGEEFPNA-VELDDPSKVTIPAGVLATAVSNTIFATGNDDLR-PVMSGVFFQF--DTEGLTFVATDAHKLVKYGRTDVQANQTAEFIMPKKPLNLLKGILASSDDDINVE--YNDSNAKFSFDNVQLLCRLIDGKYPNYEAVIPKENPNKLIIDRNQFLNSVRR-VSIFSNKTTHQIRLKIAGAELNISAEDVDYSNKAEERLTCDYQGDD-MQIGFNSRFLVEMLNNLNANDVSLEMS 341
>gi|85857847|ref|YP_460049.1| DNA polymerase III, beta chain [Syntrophus aciditrophicus SB] >gi|85720938|gb|ABC75881.1| DNA polymerase III, beta chain [Syntrophus aciditrophicus SB] (372 aa)
Score = 201, Expect = 7.6e-14, Identities = 79/371 (21%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPI---VFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT-LEIIATDGYKLAH-YKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIF--KVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   ++ ++    I E   + P+    L++  DN+IK   ++  +    +VA  E A I+  G I +  K  F +I +++ + I     D+  I + +      I  +  +++P + +  N    L + P+   + K+ ISK+ +A++N++ + N+   +       + T L ++ATDG++LA  Y+       F     I+L    I  + ++ID +   EI +     +F  K +NT++   +I+  YP+ +R+I + +  +V  +   L+  L R + + S+E+ S V L  ++  + ++ ++ D+G + + +    +  E   +  N  +L+  ++    + +  +     KP ++    +  FL +++P++
  S:     1 MEFDIQRQVFLDGVQKTLGIVERKSTMPILGNLLLKTEDNQIKIVATDRELG---LVADYE-AQIISSGAITLSAKKLFEMIREIQGDSIHFSCDDHDQITLSSQKAVYRIPGISADEFPAVAYDEN----LPLYPVPASLLKELISKISFAISNDETRKNLTGALMEAEPGEQGTILRMVATDGHRLARSYEVIEGNSPFTLEKGIILPRKGISEIRKLIDAEQG-EILIGSERGMFVLKTANTLLKVSLIDETYPDYTRVIPSQQGVRVIFNHDLLLHGLRR-MKVISTEQYSGVVLTLNNNRMIMNSTNPDVGEANDELEVAYQ-GEEVKVGFNVDYLIDAIEVIREEEVLFDIGSFMKPSMIMPVHNDRFLCVVMPLK 371
>gi|56477035|ref|YP_158624.1| DNA polymerase III (Beta chain) [Azoarcus sp. EbN1] >gi|56313078|emb|CAI07723.1| DNA polymerase III (Beta chain) [Azoarcus sp. EbN1] (367 aa)
Score = 200, Expect = 9.1e-14, Identities = 84/369 (22%), Positives = 166/369 (44%)
  Q:     9 IIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAK---SEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP------QDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  ++  L+  L+    I E   + P+    LIE + +++    ++  I   +  A     EDA+I    R L        I+  +    +T+  +D+  + VK       +  +    YP +N    D    S+S   FK+ +++V YA+     +   ++G+    I+S   L ++ATDG++LA   F S P          I+   +++EL  ++ D +  +E+ L  + ++F+     + SK+I+G +P+  R+I       +   +  L+  L R +AI ++EK   V+L      L++  S++               ++P  I  N  +LL +L    +D I   F+D     L+    +  F  +++P+R
  S:     4 LTTTRDALLAPLQSVAGIVEKRHTLPILSNVLIEKHGDQLTLLATDIEIQIRTTTAGHIGGEDASITVAARKLQD------ILRAVPEGDVTV-MLDDKRLTVKAGRSRFALQTLPAADYPRMNPPDGDATHFSVSQKSFKRQLAQVAYAMAQQDIRY-YLNGLLL--IASGSELRMVATDGHRLA---FASNPLAGDVPHTEVILPRKTVMELARQLADSEDPLEVILAGNQVVFRFGPIELVSKLIDGKFPDYERVIPQNHPKLLTFERMPLLATLSR-VAILTNEKFRGVRLVLGDGSLKI-VSTNAEQEEALEELEVDYHDDPLDIGFNVTYLLDVLNNVTSDTIEWRFNDGNSSALVTLPGNATFKYVVMPMR 366
>gi|114773475|ref|ZP_01450612.1| DNA polymerase III subunit beta [alpha proteobacterium HTCC2255] (368 aa)
Score = 200, Expect = 9.3e-14, Identities = 81/371 (21%), Positives = 167/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  +S+ + +  L+L +   E   + P+    L+ V +  +  T ++  +    I   S  A+  E G I +  K    I   L +      +VD +   +++      ++ +    YPN+     DW    +  IS    K  I    +A+     +   ++G+   +   +  +  +ATDG++LA     Y  E+ P    I+    ++E+   I   D ++++ +  ++I  K S  +  SK+++G +P+  R++       V  +K  + +A  R  +I S+EK   V+LN S+  L+++ ++ +   ++E V    +  E   I  N  +L+ ++     D +    SDS    L+ D  +   L +++P+R
  S:     1 MKFTISREQFLQPLQLVSGAIERRHTLPILSNILLVVKEGVLTLTGTD--LEVELISHLSLAADSYEDGEITVPAKKLVDICRGLSDGNDITFQVDGTKATIRSGRGRYTLSTLSASDYPNLE----DWQADVEFVISQNDLKHLIDSTSFAMAQQDVRY-YLNGMSLET--EDNNIRTVATDGHRLALCNLAYTTETLPVRQVIIPRKGVLEINRLIEANDNSVKVKIGSNHISVKSSGFVFTSKLVDGRFPDHRRVLPKETTKAVTANKDVMKKAFSRA-SILSNEKFRGVRLNLSNGELKITANNPEQEEAEEIVDVNYQ-GEELEIGFNVAYLIDVMNALKTDEVKFNLSDSSASALIEDATNSTALYVIMPMR 367
>gi|91228347|ref|ZP_01262275.1| DNA polymerase III subunit beta [Vibrio alginolyticus 12G01] >gi|91188107|gb|EAS74411.1| DNA polymerase III subunit beta [Vibrio alginolyticus 12G01] (366 aa)
Score = 200, Expect = 9.8e-14, Identities = 83/371 (22%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + ++ LI  L+  +       + P+    L++V +N +  T ++  +   S V    D    E G I + ++ F  I   L ++ I    ++   ++V++     ++  +    +PNI     DW    ++S+S    +  I K ++++ N   +   ++G+ F    +  TL  +ATDG+++A  + +    DF   +I++    ++ L++++D  +  + + +  SN+  +V+N    SK+++G +P+  R++       +  S   L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E   V+ +G   E   I  N  ++L +L T   +N+ V  SD+    L+ +  D + + +++PIR
  S:     1 MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLLKVEENVLSMTATDLEVELVSKVMLEGD---FEAGSITVPSRKFLDICRGLPDDAIITFVLEGDRVQVRSGRSRFSLATLPANDFPNIE----DWQSEVEVSLSQADLRTLIDKTQFSMANQDVRY-YLNGMLFEIDGT--TLRSVATDGHRMAVSQTQ-LGADFAQKQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFTFTSKLVDGRFPDYRRVLPQSTNKTLIASCDELRQAFSRA-AILSNEKFRGVRVNLADTEMRITANNPEQEEAEEMLDVTFEGDAIE---IGFNVSYVLDVLNTLRCENVRVSMSDANASALIENADDDSAMYVVMPIR 365
>gi|1706497|sp|P52023|DPO3B_SYNP7 DNA polymerase III subunit beta >gi|974615|gb|AAA75109.1| DNA polymerase III beta subunit [Synechococcus sp. PCC 7942] (375 aa)
Score = 200, Expect = 1.0e-13, Identities = 83/371 (22%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINF-SYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STP-QDFRIVLD---VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK++  + +L  +L L +    +  + PV    L+  +    + + +   +S    +  S  A +   G I +  K    I+S+L N+  +TLE  D +   +   +    +  +  +++P +      +  QLS S ++  + +    +A + ++ K  I++G+          LE  ATDG++LA  K E   +TP  +F + +    +  +E ++ I   D  I ++  +   +F+  +  + S+ ++G YPN  ++I       V + +K L+ ALER +A+ + ++ + ++L+   E   L ++  + D+G+ +E V  +  + EP  I+ N  +L   LK  +  +I ++ + +  PV+L          +++PI+
  S:     1 MKLVCRQNELNTSLSLVSRAVPSRPNHPVLANVLLAADAGTQRLSLTAFDLSLG--IQTSFAAQVERSGAITLPAKLLNDIVSRLPNDSDVTLEDND-AAATLSVGSGQYQMRGISADEFPELPLVQSQEALQLSASALI--EGLRGTLFATSGDETK-QILTGVHLKV--QPDGLEFAATDGHRLAVVKTENAAATPATEFAVTVPSRALRDLERMIAIRGSDEAIALYHDQGQTVFQWGDQYLTSRTLDGQYPNYGQLIPREFNRNVAVDRKRLLAALER-IAVLADQQNNAIRLSLDPENNRLALAVDAQDVGSGQEAVPAE-IIGEPLEIAFNVRYLAEGLKALNTTDIQIQLNSNTSPVVLSPLGPVKITYLVMPIQ 372
>gi|86147176|ref|ZP_01065492.1| DNA polymerase III subunit beta [Vibrio sp. MED222] >gi|85835060|gb|EAQ53202.1| DNA polymerase III subunit beta [Vibrio sp. MED222] (366 aa)
Score = 199, Expect = 1.3e-13, Identities = 82/371 (22%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + ++ LI  L+  +       + P+    LI+V DN +  T ++  +   S V    D    E G I + ++ F  I   L +  +    +D   I+V++     ++  +    +PNI     DW+   ++S++    +  I K ++++ N   +   ++G+ F    S   L  +ATDG+++A  + +    DF   +I++    ++ L++++D  +  + + +  SN+  +V+N +  SK+++G +P+  R++       +      L  A  R  AI S+EK   V++N     + ++ ++ +   ++E   V+  G   E   I  N  ++L +L T   + + +  SD+    L+ + +D + + +++PIR
  S:     1 MKFTIERSHLIKPLQQVSGALGGRPTLPILGNLLIKVEDNVLSMTATDLEVELISRVTLEGD---FEAGSITVPSRKFLDICRGLPDSSVITVVLDGDRIQVRSGRSRFSLATLPAADFPNIE----DWSSEVEVSVTQAELRGLIEKTQFSMANQDVRY-YLNGMLFEIEGS--ILRSVATDGHRMAVSQAQ-LGADFAQKQIIVPRKGVQELVKLLDAPEQPVTLQIGNSNVRAEVNNYVFTSKLVDGRFPDYRRVMPQNTTKTLEAGCDELRSAFSRA-AILSNEKFRGVRVNLVDSEMRITANNPEQEEAEEVLDVTFDGDALE---IGFNVSYVLDVLNTLRCEQVRISMSDANASALIENAQDDSAMYVVMPIR 365
>gi|17229502|ref|NP_486050.1| DNA polymerase III subunit beta [Nostoc sp. PCC 7120] >gi|17131100|dbj|BAB73709.1| DNA polymerase III beta subunit [Nostoc sp. PCC 7120] (387 aa)
Score = 199, Expect = 1.3e-13, Identities = 77/355 (21%), Positives = 168/355 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN--DNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNS---------VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN----IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFS--SSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           MK++ +++ L   L L N    +  + PV    L++ +   N++  T  +  +   +    S +A++ + G I +  K    I S+L    ITL+    +         ++ +   T    +  M   ++P +    N    + ++     + +    +A + ++ K  +++G+  +    + TLE  ATDG++LA          E   Q   + +    +  L  ++  +      I ++L +  ++F   N  + S+ +EG YP   ++I    E +V I ++  +  LER +A+ + +K +IVKL   S   E++ S  + ++G+ +E+++ +    E   I+ N  +L+  LK   +  I +  + +  PV+ 
  S:     1 MKLVCAQSDLSTNLSLVNRAVPSRPTHPVLANVLLQADAETNQVSLTAFDLSLGIRT----SFNADVWQSGAIALPAKLLVDITSRLPEGEITLDDESATDGTATGEGLIVSLTPKTGKYQLRAMGAGEFPELPLIENT-TAIYLTATSLIEGLRGSLFATSGDETK-QVLTGV--HLTVKQDTLEFAATDGHRLAVVETTNERPLEDNDQQLEVTVPARALRELERMLAHNAASEEPIALYLDQGQVVFAWQNQRLTSRTLEGQYPAYRQLIPRQFERQVTIERRQFLSTLER-IAVLADQKNNIVKLTIDSTAQELTLSCEAQEMGSGRESMNAE-IAGEDIEIAFNVKYLMEGLKALPSPEIQMHINQNLTPVIF 368
>gi|20806544|ref|NP_621715.1| DNA polymerase III subunit beta [Thermoanaerobacter tengcongensis MB4] >gi|20514981|gb|AAM23319.1| DNA polymerase III beta subunit [Thermoanaerobacter tengcongensis MB4] (370 aa)
Score = 198, Expect = 1.7e-13, Identities = 80/371 (21%), Positives = 181/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-------PQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEV-SFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK +  K  L+  + +      +  + P+  G  I    N IK + ++  I     +     A I E+G  ++  + F  ++ KL    + ++    + + V +   + +I   + E++P I    +      +   + K  I K  + V+  + +  I++G+ F    +E  L+ +A DG+++A Y ++S         + + +V+    I+ +  I+ D +T + I+   + ++F++ NT + S+++EG + N + ++    + ++ I+K   +E+LER   I+ S K ++VK       + + S S     + K  V  KG + E   I+ N+ +LL  LK  + + + + F +S  P++++   +  +L +++P++
  S:     1 MKFVCDKNSLLEGVNIAIRGVSSRTTLPILQGIKITARGNVIKLSGTDLEIGIECQIP----AVIEEEGETVVPARIFSDLVKKLPEGEVEVKSDSQNTVNVVSGDINFSIAGSNPEEFPEIP-EVSREKSFKLPQSILKDLIKKTVFCVSEEQTR-PILTGVLFEVFPNE--LKAVALDGFRMAIYSYKSEKSFFDEEAEKYSLVIPGDTIDEISRILEDEETEVIIYHTSNQVLFQIDNTKVISRLLEGSFINYNAVLPKDFKTEITINKDVFMESLERASLIAES-KNNLVKFEIGDSFIVISSSSEKGSMSEKLEVEVKGMLLE---IAFNSRYLLDALKAINEEEVNLYFINSINPLIIKPVGEKEYLYMILPVK 368
>gi|85711020|ref|ZP_01042081.1| DNA polymerase sliding clamp subunit [Idiomarina baltica OS145] >gi|85695424|gb|EAQ33361.1| DNA polymerase sliding clamp subunit [Idiomarina baltica OS145] (367 aa)
Score = 198, Expect = 1.7e-13, Identities = 76/371 (20%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  VS+   +  L++ +   E   + P+    L++V  + ++ T ++    +IS+  + +   D      G + +  K    I+  L +E       D+  ++V++      ++ +  + +PNI     DW+       S    K+ + K  +++ N   +   ++G+ F +      L  +ATDG++LA    H +     Q   IV    ++ELL  + + D+ + + +  ++I  + ++ +  SK+++G +P+  R++    + ++   +  L +A  R  +I S+EK   V+LN ++  L ++ ++ +   ++E +    +  E   I  N  +LL +L   + + +    SD+    L+  + D +   +++P+R
  S:     1 MKFTVSRDAFLKPLQIVSGAVERRHTLPILSNLLLKVEGDTLRLTGTDLEVELISSVKVESSGGD------GMVTVPAKKLLDIVRSLPDESPIELVGDDEGVRVRSGRSKFKLSSLSADDFPNIE----DWSSEVNFITSQDTLKRLMEKTHFSMANQDVRY-YLNGMLFET--DANMLRSVATDGHRLAMSNCHIEQPGLSQRQVIVPRKGVVELLRLLNEDDSEVAVAIGNNHIRVETADIVFTSKLVDGRFPDYRRVVPQGGDKQIFADRDLLRQAFGRA-SILSNEKFRGVRLNITAGELCITATNPEQEQAEEVIEVNYE-GEAIEIGFNVSYLLDVLNNIEAEEVCFVLSDANSSALIEPKDDDSCCYVVMPMR 366
>gi|148260438|ref|YP_001234565.1| DNA polymerase III subunit beta [Acidiphilium cryptum JF-5] >gi|146402119|gb|ABQ30646.1| DNA polymerase III, beta subunit [Acidiphilium cryptum JF-5] (374 aa)
Score = 197, Expect = 1.9e-13, Identities = 79/371 (21%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVD-NSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--KTLEIIATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTP--ISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+   +  L+ AL    ++ E   + P+    L+ V +  +    ++  I+    VA    A  +  G +       + I+ +   N  I L+    ++ + ++   + + + ++  +++P ++ +    ++ ++     +  I + ++A++  + +   ++GI  ++  SE    L  +ATDG++LA  + E  P+        IV   ++ E+   + +   ++ I L E+ I F++    + SK+I+G YP+ S++I T  +  + +       A+ R  AI +SE+   VKL+   ++L +S +S D G + E +  +      TP  I     +L  + +      +   F+D   P L+R   D + + +L+P+R
  S:     1 MKLKADRATLLKALAHVQNVVEKRNTIPILANVLLSVKEGRLTIAATDLEIALIEEVA----ATTMRDGSVTAPAATLYEIVRRQPDNAEIELDHPGGDAPLALRAGRYATKLVVLPTDEFPKLD-AGKLTHRFAVPAQALRGLIDRTRFAISTEETRY-YLNGIYLHAAESEGVPVLRAVATDGHRLARVE-EPLPEGAAGMPGVIVPRKTVNEIRKLLDEVSGDVSIALSETRIQFELDTMRMTSKLIDGTYPDYSKVIPTGNDKILRVETADFSAAVARVSAI-TSERNKPVKLSVGRDLLVLSATSPDQGTATEELDAEQVEYRATPLEIGFQARYLNDVTEQIKG-KVEFCFADGAAPTLVRAAGDESAIFVLMPMR 373
>gi|119773156|ref|YP_925896.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B] >gi|119765656|gb|ABL98226.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B] (366 aa)
Score = 197, Expect = 2.0e-13, Identities = 84/371 (22%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L +   E   + P+    L+EV+ + +K T ++  +    +V ++     +++GR  +  K    I+  L  +  I +E+ +N  +++   S F  ++  +  E+YPN+     D  + ++     K  I   ++++ N   +   ++G+   +      L  +ATDG++LA  H   E S P+   IV    ++EL   +   D +I + + ES I    +  +  SK+++G +P+  R++    +  V  S+  L +AL R  +I S+EK   V++     +L+++ ++ +   ++E +      N  T  I  N  +LL +L +  +D + V   DS    L+ +  + + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVSGAVERRHNLPILANLLVEVSGHSLKMTGTDLEVE---LVGEATVHGDVQEGRTTVPAKKLLDIVKSLPEQTEIKVEQQENKWLLRCGRSRF--SLATLPAEEYPNVEAFRPDI-EFTLKQGTLKSLIDSTQFSMANQDVRY-YLNGLLIET--EGNVLRAVATDGHRLALSHRMIEASLPEKQVIVPRKGVVELSRLLDAEDQDITLAIGESAIRATTATAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNQLKQALLRA-SILSNEKFRGVRILLEDGLLKITANNPEQEEAEEIIDV--DYNSTTLEIGFNVSYLLDVLNSLRSDEVRVTLIDSNSSALIENHVEEDSMYVVMPMR 365
>gi|33862274|ref|NP_893834.1| DNA polymerase III subunit beta [Prochlorococcus marinus str. MIT 9313] >gi|33640387|emb|CAE20176.1| DNA polymerase III, beta chain [Prochlorococcus marinus str. MIT 9313] (388 aa)
Score = 197, Expect = 2.1e-13, Identities = 81/371 (21%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVD-NSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE--------------KTLEIIATDGYKLA--------------HYKFESTPQDFRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL--NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-DEKDPNFLQILVPIR 377
           MK++ S+ +L  AL+L +    +  + PV    L+  +    + + +   +S    +  +  A++   G I +  +    I+++L ++  ITL   +    +++K+S+    +  M  + +P +             P+V      KV     N +  +  + G  F S S E              K +E  ATDG++LA                + +   ++F + L    +  +E L+     D  + +F  +  ++F  ++ ++ S+ ++G YPN  ++I        ++ ++  + ALER +A+ + +  ++VK+  + +SE+L++S  + D+G+  E++S +    +   I+ N  ++L  LK  D+D I +  +    P ++   + D  F  +++P++
  S:     1 MKLVCSQAELNTALQLVSRAVASRPTHPVLANVLLTADAGTDRLSLTGFDLSLG--IQTALTASVESSGAITLPARLLGEIVARLSSDSPITLATDEAGEQVELKSSSGSYQMRGMSADDFPEL-------------PLVESGKAVKV-----NARALLTALRGTLFASSSDEAKQLLTGVHLHFDGKAMEAAATDGHRLAVLSLADALAVETTVSSEMDDEGENFSVTLPSRSLREVERLIAGWRGDDQVSLFCDKGQVVFLAADQVVTSRTLDGTYPNYRQLIPDGFARSFDVDRRAFIAALER-IAVLADQHNNVVKVSGDNTSELLQISADAQDVGSGSESLSAE-FTGDAVQIAFNVRYVLDGLKVMDSDRIVLRCNAPTTPAIISPKDDDIGFTYLVMPVQ 385
>gi|83857635|ref|ZP_00951163.1| DNA polymerase III, beta chain [Croceibacter atlanticus HTCC2559] >gi|83849002|gb|EAP86871.1| DNA polymerase III, beta chain [Croceibacter atlanticus HTCC2559] (362 aa)
Score = 197, Expect = 2.3e-13, Identities = 74/320 (23%), Positives = 146/320 (45%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           P+    L E+++N +K + S+   +  S +    D+    +G I +  +     +     + +T  K DN+ I++ ++     +   D E++PN   +  D +Q  ++  V   +ISK  +A  N+  +  +MSG+ F    ++  L  +ATD +KL  Y     S   +   ++    + LL  I+   D+++ +   ESN  F   N  +  ++I+G YPN   +I     NK+ I +   + +++R ++I S++    V+L  +   L +S    D  N  E         +   I  N+ FL  +L   + + + +E S
  S:    18 PILDNFLFELDNNSLKISASDLETTMVSTIDVESDS----QGSIAVPARLLLDTLKTFPEQPLTFVKEDNNTIEISSNHGKYAVAYADGEEFPNA-VALEDPSQTVLNGDVLATAISKTIFASGNDDLR-PVMSGVFFQF--AKDGLTFVATDAHKLVKYSRTDVSATNEAEFIMPKKPLTLLKGILAGSDSDVTVEYNESNARFTFDNVELICRLIDGKYPNYEAVIPKENPNKLTIDRSQFLNSVKR-VSIFSNKTTHQVRLKIAGSELNISAEDIDYSNKAEERLTCAYQGDDMQIGFNSRFLSEMLNNLNANEVQLEMS 331
>gi|1361492|pir||A64200 DNA polymerase III beta chain - Mycoplasma genitalium (267 aa)
Score = 196, Expect = 2.5e-13, Identities = 65/254 (25%), Positives = 134/254 (52%)
  Q:   124 QYPNINFS----YNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFL--------FESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++P I F+     +++NQ  I+  +  K I K+ ++V+NN+E  +  +G+ FN  S+ K + + A+D YKL+ ++ +   + F  +L+ +L+  +      +    +F         F + ++  + N +I+   +   +P V+       E K+ + K  L +AL+R   ++ +E+  +  +  +S  L++    +++GNS E +SC         IS N   LL  +++F+++ I  +F  + K  L+  + +P   QILVP R
  S:     3 EFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFNGVNFNG-SNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFLITSKSEPELKQILVPSR 267
>gi|83642916|ref|YP_431351.1| DNA polymerase III, beta subunit [Hahella chejuensis KCTC 2396] >gi|83630959|gb|ABC26926.1| DNA polymerase III, beta subunit [Hahella chejuensis KCTC 2396] (367 aa)
Score = 195, Expect = 3.1e-13, Identities = 77/371 (20%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYK--LAHYKFESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKE-NKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ +++  L+ +L++ + + E   + PV    L++  D ++  T +N  +    +VA+  D NI  + RI +  K F  I   L        ++ +  + V+  +    ++ +  E +PN+     +  ++++     K+ I    +A+     +   ++G+       E+ L  +ATDG++  LA+   ++   + R  IV    ++EL   + D D +  +   ++++   V +    SK+I+G +P+  R+I  P+  +KV ++ + L++ +    +I S E    V+L F   +L+V  ++ D   +++++  +   +E   I  N  +L+ +L   D++ + V  S++    L+      + + +++P+R
  S:     1 MKLTITREALVTSLQMISGVVEKRQTMPVLANVLLDARDGKLVITGTNMEV---ELVAEISDVNIEHESRITVPAKKFTDICRALPEGAAIGIELKDGRLNVRYGSSHFILSTLPAEHFPNVE-EEPESVKVTLPQRELKRLIDATAFAMAQQDVRY-YLNGMLME--LDEQGLRTVATDGHRLALANVSLQTGVSEKRQPIVPRKGILELGRLLNDTDESCTLVFGDNHVRASVGHFTFTSKLIDGKFPDYQRVI--PRSGDKVMLADRVLLKGVLSRASILSHESIRGVRLQFEEGLLKVFANNPDQEEAEDSLEVEYP-HEALQIGFNVGYLIDVLNALDDEQVKVTLSNANSSALVEGVDTRDAVYVVMPMR 366
>gi|15964088|ref|NP_384441.1| DNA polymerase III subunit beta [Sinorhizobium meliloti 1021] >gi|15073264|emb|CAC41772.1| Probable DNA polymerase III, beta chain [Sinorhizobium meliloti 1021] (372 aa)
Score = 195, Expect = 3.9e-13, Identities = 72/371 (19%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN---FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKFES------TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + ++ L+ +L   + + E   + P+    L+  +   ++   ++  +     + ++  A + + G   +     + I+ KL +  E+      + + + V +     ++  + +  +P++    FS++      +     K  I + ++A++  + +   ++GI  +++ S   L++  +ATDG++LA    E+       P        VS ++ LL+  D    +E+   ++ I   + + ++ SK+I+G +P+  R+I    + ++ +  ++  +A++R ++  SSE+   VKL  +   + ++ ++ D G++ E +   G  ++P  I  N  +LL +             +D   P L+RD    + L +L+P+R
  S:     1 MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRSDGASLEMKATDLDLE----ITEATPAQVEQAGATTVPAHLLYDIVRKLPDGSEVRLATNAEGTAMTVASGRSKFSLQCLPQSDFPDLTAGTFSHS----FRLKAPDLKMLIDRTQFAISTEETRY-YLNGIFVHTVESNGDLKLRAVATDGHRLARADVEAPSGSEGMPGIIIPRKTVSELQKLLDSPDVVVTVEVS--DAKIRLTIGSIVMTSKLIDGTFPDYQRVIPASNDKELRVDCQSFSQAVDR-VSTISSERGRAVKLALADGQMTLTVNNPDSGSATEELPV-GYESDPLEIGFNAKYLLDITGQLTGGEAVFLLADPGSPTLVRDLAAEDALYVLMPMR 371
>gi|116619147|ref|YP_821303.1| DNA polymerase III, beta subunit [Solibacter usitatus Ellin6076] >gi|116222309|gb|ABJ81018.1| DNA polymerase III, beta subunit [Solibacter usitatus Ellin6076] (372 aa)
Score = 194, Expect = 4.2e-13, Identities = 74/371 (19%), Positives = 168/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIID--FDTNIEIFLFESN-IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP---NFLQILVPIR 377
           M+  VSK+ L+  L L   + E   + P+    L+E  D+ I  T ++  +        S  A + ++G   +  +     +  L    + ++ +DN    + +    + I  M  E +P +        Q+ +  +     I++  +A++  + +  +   +    +   + L ++ATDG++LA+ + E     S  + FR ++    +  L ++ D   +  + I   + N + F++ + ++ ++ + G++P+  R++    +    + K  +  A+ER +A  + E+   +++ F+S  + V  SS + G S+E+V  +        I  N  +LL  L+    D++  E  D      LR   D     +  +++P+R
  S:     1 MEFTVSKSDLVRELSLSQGVVEKKTTIPILSNVLLEAADDRITLTATDLELGIRC----SCPARVKKEGSGTVPARKLLDYMRLLPEGDVNMKFLDNHWASITSGRSRTRIAGMSRESFPELPQMPEPIAQVPVKTLA--SMIARTSFAISMEESRFTLNGALL---LMRPEGLTMVATDGHRLAYVQAEPAESGSADKPFRALVPKKAMSELTKLSDDAGEGAMAIVAGDDNHLFFQIGHRLLITRKLTGNFPDYERVLPKDHQFMAKLEKGEIRSAIER-VAQFADERSRAIRVQFNSGEVRVFSSSVETGESEESVPAE-YTGPDIEIGFNAQYLLDFLRAISQDHVAFELKDQKSAGELRPAGDAIADQYRYVVMPMR 371
>gi|39938488|ref|NP_950254.1| DNA polymerase III beta subunit [Onion yellows phytoplasma OY-M] >gi|39721597|dbj|BAD04087.1| DNA polymerase III beta subunit [Onion yellows phytoplasma OY-M] (378 aa)
Score = 194, Expect = 4.5e-13, Identities = 80/343 (23%), Positives = 163/343 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDF--DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF---SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           P+F    I+  +N +    +NG I+   I  K E   I ++G+I    + F  II K+ + +I +  ++N+ + +KTS  +  + +MD   +  ++FS+   +   I     K  I ++  + + N+++  +M     N I     L+  ATD ++++  K   +    +F IV+    +E L +I++      ++I+     I  ++ N    + ++EG+YP +  I  T     V+++K  L++ALER   + S E+ +   + F       +E+S SS  LG + E +           I+ N  +L  +LK      +   F +  KP ++   +  + + +++PI
  S:    28 PIFNALKIQTQENNLILEANNGNIAI-KIEIKDESLKIKKQGKIACLGRYFIEIIKKISDSLIKITVMENNFLVIKTSFCEYKLKLMDVCNFLELDFSFQKLDSFQIETHFLKNMIKEINISTSKNEKRPILMG---LNLIYQNNLLKACATDSFRMSQKKINLDIEYHNFNIVIPNKSLEELSKILEHCQSKYLKIYSDTQKIFLEIDNLWFQTSLLEGNYPQIQEIKLTNFPFSVHLNKDDLMKALERVSLLFSKEQMNTNVIKFILTKQNSIEISSSSESLGTALEKIIPLKVSANSFQIAFNAKYLEDVLKVLSVKEVVFYFDNPLKPFIITTLEKDSSIHLILPI 373
>gi|86130089|ref|ZP_01048689.1| DNA polymerase III, beta chain [Cellulophaga sp. MED134] >gi|85818764|gb|EAQ39923.1| DNA polymerase III, beta chain [Dokdonia donghaensis MED134] (372 aa)
Score = 194, Expect = 4.5e-13, Identities = 77/347 (22%), Positives = 157/347 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES--TPQDFRIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS + L+  L++   +  N  + P+    L E++ N +  + S+      + +    D    + G I +  +     +     + +T  + +N+ I++ ++     +   D  ++PN   S  D + + I   V   +IS   +A  N+  +  +MSG+ F   +    L  +ATD +KL  Y        Q    ++    + LL  I+   D  I +   ESN  F   N  +  ++I+G YPN   +I     N++ I +   + ++ R ++I S++    ++L  +   L +S    D  N ++E ++C  + ++   I  N+ FL  +L   + +++++E S
  S:     1 MKFIVSSSYLLKQLQVLGGVINNSNTLPILDNFLFELDGNALTVSASD----LETTMTSKLDVESSDNGAIALPARLLLDTLKTFPEQPLTFTQHENNTIEISSNHGKYALAYADGAEFPNA-VSLEDPSVVKIPGSVLATAISNTIFATGNDDLR-PVMSGVFFQFATD--GLTFVATDAHKLVKYGRTDVVASQAAEFIMPKKPLNLLKGILSTSDDEISVEYNESNAKFTFDNVELVCRLIDGKYPNYEAVIPKENPNRLTIDRNQFLNSVRR-VSIFSNKTTHQIRLKIAGAELNISAEDIDYSNKAEERLTCDYQGDD-MQIGFNSRFLTEMLNNMNANDVSLEMS 341
>gi|78484348|ref|YP_390273.1| DNA polymerase III, beta subunit [Thiomicrospira crunogena XCL-2] >gi|78362634|gb|ABB40599.1| DNA polymerase III, beta subunit [Thiomicrospira crunogena XCL-2] (368 aa)
Score = 193, Expect = 5.4e-13, Identities = 80/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTH-SIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH----YKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQ-ILVPIR 377
           MKI +S+  L+  L+    + E   + P+    L +VN N +  T S+  I T  S   +S D +      + +      +I+  L + +  L + D    ++        ++ +  + +P I+ +  + +  S++    K+ I    +A+ +   +   ++G+ F+   S +TL ++ATDG++L+      + E       I+    ++EL   I D D+ I   L ++ +  +   T+   K+++G +P+ +R++    +  V   ++ L   L+R  AI S++K   ++L  S  +L V   +SD   S E ++      E   I  N ++LL +L +   + +T+   D+    ++  + +    Q +++P+R
  S:     1 MKISLSRENLLKVLQTVGGVVEKRQTMPILANILFQVNQNTLTVTASDLEIETRASTELESSDGDF----SVTLPAVKLISIVRSLPDGLTILLEFDEMRCQLSAGRSRFKLSTLPADDFPTIDLTQTELS-FSMAQHQLKQIIHNTAFAMASQDVRF-YLNGMLFDI--SNQTLRVVATDGHRLSTCSTLLETEGLTATQAILPRKGVLELQKLIGDDDSLIAFSLAKNYLTVQFEETVFTCKLVDGRFPDFNRVLPQHNDQLVQTDRELLRSLLQRA-AILSNDKFKGIRLALSQNLLAVHAQNSDQDESHEDMAIDYNGTE-MEIGFNVNYLLDVLNSMHEEAVTLYMKDANSSCMVDTQNETCHCQHVIMPMR 367
>gi|77961788|ref|ZP_00825618.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Yersinia mollaretii ATCC 43969] (366 aa)
Score = 193, Expect = 6.0e-13, Identities = 81/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ +  L+  L+  +S      + P+    L++V +  ++ T ++  +   + VA S+     E+G   +  + FF I   L         +D   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       ++ P    IV    ++EL+  +   DT + + +  +NI   V + I  SK+++G +P+  R++    +  +  S   L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS  G   E   I  N  ++L +L     +++ +  +DS   V + D        +++P+R
  S:     1 MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALSQPH---EQGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRSRFSLSTLPAVDFPNLD----DWQSDVEFTLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFARA-AILSNEKFRGVRLYVSQNQLKITANNPEQEEAEEILDVSYDGTEME---IGFNVSYVLDVLNALKCEDVRLLLTDSVSSVQIEDGASQAAAYVVMPMR 365
>gi|77958160|ref|ZP_00822198.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Yersinia bercovieri ATCC 43970] (366 aa)
Score = 193, Expect = 6.0e-13, Identities = 81/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ +  L+  L+  +S      + P+    L++V +  ++ T ++  +   + VA S+     E+G   +  + FF I   L         +D   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       ++ P    IV    ++EL+  +   DT + + +  +NI   V + I  SK+++G +P+  R++    +  +  S   L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS  G   E   I  N  ++L +L     +++ +  +DS   V + D        +++P+R
  S:     1 MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALSQPH---EQGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRSRFSLSTLPAVDFPNLD----DWQSEVEFTLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFARA-AILSNEKFRGVRLYVSQNQLKITANNPEQEEAEEILDVSYDGTEME---IGFNVSYVLDVLNALKCEDVRLLLTDSVSSVQIEDGASQAAAYVVMPMR 365
>gi|27364432|ref|NP_759960.1| DNA polymerase III subunit beta [Vibrio vulnificus CMCP6] >gi|27360551|gb|AAO09487.1|AE016800_92 DNA polymerase III, beta chain [Vibrio vulnificus CMCP6] (366 aa)
Score = 193, Expect = 6.5e-13, Identities = 77/371 (20%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  ++++  I  L+  +       + P+    LI V + ++  T ++  +    +++K       E G I + ++ F  I   L ++ +    ++   ++V++     ++  +    +PNI     DW    ++S++    +  I K ++++ N   +   ++G+ F    S  TL  +ATDG+++A  +  +   DF   +I++    ++ L++++D  +  + + +  SN+  +V++ +  SK+++G +P+  R++       +  S   L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E   VS +G+  E   I  N  ++L +L T   + + +  SD+    L+ +  D + + +++PIR
  S:     1 MKFTIARSHFIKPLQQVSGALGGRPTLPILGNLLINVENGQLSMTATDLEVE---LISKVTLEGEFEAGSITVPSRKFIDICRGLPDDAVITFVLEGDRVQVRSGRSRFSLATLPANDFPNIE----DWQSEVEVSLTQGELRALIEKTQFSMANQDVRY-YLNGMLFEIEGS--TLRSVATDGHRMAVAQ-AALSADFAQKQIIVPRKGVQELVKLLDTPEQPVTLQIGSSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTTKTLEASCDELRQAFSRA-AILSNEKFRGVRVNLAGSEMRITANNPEQEEAEEMLDVSFEGEAIE---IGFNVSYVLDVLNTLRCEQVRISMSDANASALVENVDDDSAMYVVMPIR 365
>gi|83749734|ref|ZP_00946711.1| DNA polymerase III, beta chain [Ralstonia solanacearum UW551] >gi|83723586|gb|EAP70787.1| DNA polymerase III, beta chain [Ralstonia solanacearum UW551] (371 aa)
Score = 192, Expect = 6.9e-13, Identities = 79/366 (21%), Positives = 172/366 (46%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNG--IISTHSIV-AKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-------IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S+  L+  L++ + I E   + P+    LI  N   + F +++    I+TH+   A + D       R L+       I+  + +  +TL  +++  + V++      +  +  E++P +  + +   ++++     K  ++ V +A+     +   ++G+    +   K +  +ATDG++LA+   E+  Q          I+   +++EL   + D D  + + L  + + F   N  + SK++EG +P+  R+I     N   I +  L +AL+R  AI +++K   V+    + VL++S +++D   ++E +    +  +   I  N  +LL +L     + + V   DS    L+    D  F  +++P+R
  S:     7 SRDNLLRPLQIVSGIVERRHTLPILANLLIRKNGERVSFLSTDIEIQITTHADCGAGNGDIATTVAARKLVD------ILRAMPDGEVTL-TLNDKRMSVQSGKSRFALQTLAAEEFPTVAEANDFGARITLPQKTLKHLLAMVHFAMAQQDIRY-YLNGMLL--VVDGKQVMAVATDGHRLAYCGVETGEQPAGAGGRHEVIIPRKTILELQRLLEDVDDPVSVQLASNQVKFTFGNIELISKLVEGKFPDFQRVIPKGYRNSFTIDRTFLQQALQR-TAILTTDKFKGVRCMLDTNVLKISSTNADQEEAQEELEIDYQ-GDALDIGFNVTYLLDVLANLKAEKVQVSLGDSNSSALITLPDDDTFKYVVMPMR 370
>gi|116071808|ref|ZP_01469076.1| DNA polymerase III subunit beta [Synechococcus sp. BL107] >gi|116065431|gb|EAU71189.1| DNA polymerase III subunit beta [Synechococcus sp. BL107] (385 aa)
Score = 192, Expect = 7.5e-13, Identities = 81/371 (21%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLI--EVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGIC--FNSISSEKTLEIIATDGYKLAHYKFESTPQD-----------FRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE----VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN-FLQILVPIR 377
           MK++ S+++L  AL+L +       + PV    L+  +   N +  T  +  +   + +A    A++   G I +  +    I+S+L ++       + S  +V+ ++   +  +  +  + YP +    +    L + P    +++    +A + ++ K  +++G+   FN+    K LE  ATDG++LA  + +   QD           F + L    +  +E L+     +  + +F     ++F  ++ ++ S+ +EG YPN  ++I       + + ++ L+ ALER +A+ + +  ++VK  F+S+    V+++S  + D+G+  E+++      +   I+ N  +LL  LK   ++ + +  +    P +L+ E D   F  +++P++
  S:     1 MKVVCSQSELNAALQLVSRAVATRPTHPVLANVLLTADAGTNRLSLTGFDLNLGIQTSLA----ASVETSGAITLPARLLGEIVSRLASDSPITLATEESGEQVQLTSLSGSYQMRGLPADDYPELPMVESGMT-LKLQPAGLVQALKGTLFASSADEAK-QLLTGVHLRFNA----KALEAAATDGHRLAVLQVDDALQDAASASDDASEGFAVTLPARSLREVERLMAGWRSEDPVSLFCDRGQVVFLAADQMVTSRTLEGTYPNYGQLIPDGFNRTLALDRRGLIAALER-IAVLADQHNNVVK--FTSQPDEGVVQISADAQDVGSGSESLAAS-LTGDAIQIAFNVRYLLDGLKAMGSERVVLHCNAPTTPAVLKPEGDAEAFTYLVMPVQ 382
>gi|56459114|ref|YP_154395.1| DNA polymerase sliding clamp subunit [Idiomarina loihiensis L2TR] >gi|56178124|gb|AAV80846.1| DNA polymerase sliding clamp subunit [Idiomarina loihiensis L2TR] (367 aa)
Score = 192, Expect = 7.6e-13, Identities = 82/371 (22%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANILEKGRILIKTKPFFAIISKLKNEMITLE---KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  +++   +  L++ +   E   + P+    L++V++ ++K T ++  +   S V  +S D +      + +  K    I+  L  E  T+E   + D++ +K   S F   ++ +  + +PNI+    DW     L     V K  + K  +++ N   +   ++G+ F +      L  +ATDG++LA            Q   IV    ++ELL  + D D  + + +  ++I  +    +  SK+++G +P+  R++ +  +  +   +  L ++  R  +I S+EK   V+LN SS  L ++ ++ +   ++E +    + ++   I  N  +LL +L   D++ ++   SDS    L+  + D +   +++P+R
  S:     1 MKFSINRDAFLKPLQVVSGAVERRHTLPILSNLLLQVDNGQLKLTGTDLEVELVSAVPLESADMD----AAVTVPAKKLLDIVRSLP-EGSTIEFTSQEDSATVKSGRSKF--KLSTLSSDDFPNID----DWKSDIHLVTEQAVLKDLMLKTHFSMANQDVRY-YLNGMLFET--DNGMLRSVATDGHRLAMSTCAIDQPGLAQRQVIVPRKGVVELLRLLGDDDQEVSVSIGNNHIRVETPELVFTSKLVDGRFPDYRRVLPSGGDKVIVAHRDALRQSFGRA-SILSNEKFRGVRLNLSSGELCITATNPEQEQAEEVIEVDYQGDD-LEIGFNVSYLLDVLNNIDDEQVSFTLSDSNSSALIEPQHDESCCYVIMPMR 366
>gi|86606304|ref|YP_475067.1| DNA polymerase III subunit beta [Synechococcus sp. JA-3-3Ab] >gi|86554846|gb|ABC99804.1| DNA polymerase III, beta subunit [Synechococcus sp. JA-3-3Ab] (454 aa)
Score = 192, Expect = 8.1e-13, Identities = 72/310 (23%), Positives = 165/310 (53%)
  Q:    68 DANILEKGRILIKTKPFFAIISKLKNEMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNI-----NFSYNDWNQLSISPIVFK-------KSISKVKYAVNNNKEKINIMSGICFNSISSEKT-LEIIATDGYKLAHYKFES-----------TPQDFRI-VLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVS--------NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFS--SEVLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +A +   GR  +  K    I+S+L +  I L +V +++ + + ++     +  M  E+YP +       +  D  + S++  + +       + I +  +A + +  K  +++G+    ++ +   LE  ATDG++LA  + E+           T  DF I    +  +E +L      + +E+    S + F +            I S+++EG YP+ +R+I    E  V + ++ L+E+LER + + ++++  I+K N S  ++ L +S  + D+G+ +E++    +++ P   ++ N  +LL  LK F    +++E + + +P + +         +++P++
  S:   108 EAEVKGSGRTTLPAKLLSDIVSRLPSGPIGLSQVPESAAVTLTSAAGQYQLRGMPAEEYPTLPEIAPRTADADAEEESLAAQILELPIESLLQGIGQTLFAASGDDTK-QVLTGVHVKLLTGDPPRLEFAATDGHRLAIVQVEAEGIPVDLAAGGTKLDFTIPARTLREVERILGAQTAASAVELRFDRSQVQFILPPGAGSAQCQQRITSRLLEGQYPDYNRLIPRQFERHVTLERRPLIESLER-VGVFAAQRNEIIKFNLSEATQTLRISTEAPDVGSGEESLPV--QMSGPDLELAFNVRYLLEALKVFHTQQVSLELNGATQPAIWKPIGATRLCYLVMPVQ 450
>gi|57234032|ref|YP_181940.1| DNA polymerase III, beta subunit [Dehalococcoides ethenogenes 195] >gi|57224480|gb|AAW39537.1| DNA polymerase III, beta subunit [Dehalococcoides ethenogenes 195] (378 aa)
Score = 191, Expect = 9.7e-13, Identities = 78/370 (21%), Positives = 173/370 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTN----IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL------NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MK+   +  L   L +    +    + P+    LI  +D  +K   +N  ++    +     A I E+G   +  K     +S L N+ I L     +  + +K + F++ I  +D + +P +    N  +   I+   F++++S+V +A   ++ +  +++G+  N+     TL + A DG++LA YK    E+     ++++    +  L  +   D      I +   +S I+F++ N  + S++++G++P  ++II      KV +     + A  R   I + +   IV+L      N +   L +S  S ++G++   +    +  E   I+ N  +LL +L       +++E +    P +++     N++ +++P+
  S:     1 MKLTCLQENLNKGLNIVGKAAAGRTTLPITNNVLISTDDGRLKLAATNLEMAISCWIG----AKIEEEGSTTVPAKLLTEFVSSLPNDKIELNLNAKSKALNIKCARFEARITGVDAKDFPPVPKVENGIST-KINVEAFRQAVSEVVFASATDESR-PVLTGV--NAEFEGSTLTLAAADGFRLAVYKLPLLEAVKTATKVIIPARTLGELSRLASMDEEEALMINVDTAKSQILFRLKNIELVSQLVQGNFPQYNQIIPQSFTTKVVVDANQFLMA-TRTATIFARDGGGIVRLMMNPGGNNTPGKLTISARSEEVGDNTGELDAVVQ-GEEAKIAFNGKYLLDVLGVLKAQQVSLEVTSPSSPGVIKPVGADNYIHVIMPM 374
>gi|94502202|ref|ZP_01308697.1| DNA polymerase III subunit beta [Oceanobacter sp. RED65] >gi|94425663|gb|EAT10676.1| DNA polymerase III subunit beta [Oceanobacter sp. RED65] (367 aa)
Score = 191, Expect = 1.1e-12, Identities = 76/371 (20%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH----YKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKE-NKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ +++  L+  L+L   + E   + PV    L+EV  +++  T ++    +I + +++    D      G I +  K    I   L ++       D+  ++++T      ++ +   ++PNI+       Q+ +     ++ I +  +A+     +   ++G+       E  L  +ATDG++LA      + +   +   IV   +++EL   ++D ++++E+ L  +++  KV +    SK+++G +P+  R+I  P+  NK  I+ +  +  + +  AI S+EK   V+L   ++ L+V  ++ +   ++E++  + +  E   I  N  +L  +L   D D++ +  +D+    ++ + +  + L +++P+R
  S:     1 MKLTITREALLKPLQLVAGVVERRQTLPVLSNVLLEVKGDQLSLTGTDLELELIGSATLLEPGVD------GAITVPAKKLMDICKSLPDQSTIEISQDDHKVQLQTGRSKFVLSSLPANEFPNID-DIEAQAQVMVPQTQLRRIIDRTAFAMAQQDVRY-YLNGMLIEVKPDE--LRAVATDGHRLATCGVPVELDIADRMQVIVPRKAVLELAKLLMDPESSVELSLSNNHVRAKVGDYTFTSKLVDGKFPDYERVI--PRNGNKTLIADRQALRQVFQRTAILSNEKYRGVRLLLENDNLQVVANNPEQEQAEESIGVEFQ-GEMLEIGFNVSYLQDVLSVLDGDDMKMTLADANSSAVMEEVEGGDSLYVVMPMR 366
>gi|50123358|ref|YP_052525.1| DNA polymerase III subunit beta [Pectobacterium atrosepticum SCRI1043] >gi|49613884|emb|CAG77336.1| DNA polymerase III, beta chain [Erwinia carotovora subsp. atroseptica SCRI1043] (366 aa)
Score = 190, Expect = 1.2e-12, Identities = 82/371 (22%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK IV + +L+  L+  +S      + P+    LI+V +  +  T   G      +VAK       E G   +  +  F I   L    E+  +   D  +++   S F  +++ +    +PN++    DW    + S+     K+ I   ++++ +   +   ++G+ F +   +  L  +ATDG++LA       +S P    IV    ++EL+  +   DT +++ +  +NI   V + I  SK+++G +P+  R++    +  +  S   L +A  R  AI S+EK   V+L+     L+++ ++ +   ++E +  +    E   I  N  ++L +L     + + +  +DS   V + D        +++P+R
  S:     1 MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEGALSLT---GTDLEMEMVAKVALTQPHEPGATTVPARKLFDICRGLPEGAEITIMLDGDRMLVRSGRSRF--SLSTLPAADFPNLD----DWQSDVEFSLPQATMKRLIEATQFSMAHQDVRY-YLNGMLFETEGED--LRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRA-AILSNEKFRGVRLHLIQNQLKITANNPEQEEAEEILDVQYDGTE-MEIGFNVSYVLDVLNALKCEGVRLLLTDSVSSVQIEDSASRAAAYVVMPMR 365
>gi|16329463|ref|NP_440191.1| DNA polymerase III subunit beta [Synechocystis sp. PCC 6803] >gi|2494196|sp|P72856|DPO3B_SYNY3 DNA polymerase III subunit beta >gi|1651945|dbj|BAA16871.1| DNA polymerase III beta subunit [Synechocystis sp. PCC 6803] (391 aa)
Score = 190, Expect = 1.3e-12, Identities = 80/371 (21%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNE-----IKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITL------EKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ--------------DFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSS--EVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I  ++ L + L L +    +  + PV    L+E + ++       F  S GI S+ +       A++ + GRI +  K    I+S+L +  ITL      +  D+ +  + + +    I  +D + +P +  +      L +      + +    +A + ++ K  +++G+      S  +LE  ATDG++LA  +  +  +              DF + +    +  L  ++    N   + + + ++ +IF++ +  + S+ +EG YP   ++I       V + +K L+ +LER +++ + +K ++V     S    L+++  + DLG+ +E++  +  + E   I+ N  +L+  LK   +++I ++ ++  +PV+           +++P+R
  S:     1 MKLICRQSDLSSGLSLVSRAVSSRPTHPVLGNVLLEADADKNYLRLTAFDLSLGIQSSFT-------ADVQQSGRITLPAKLLNDIVSRLPDGDITLAIDPDGDAGDSHLTTITSESGRFQIRGLDADDFPALP-TVEGVKPLLLPVATLNEGLRGALFAASTDETK-QVLTGVHIKG--SGDSLEFAATDGHRLAVVEAPTQIENDEGEAVITGSDLADFAVTIPARALRELERMVASQGNSDLVSLVVNDTQVIFELGDQRLTSRKLEGAYPAYDQLIPRQFSRTVTMERKRLITSLER-VSVLADQKNNLVTFTLQSPGNQLQLAVEAQDLGHGEESMGAE-IIGEGGQIAFNIKYLMDGLKALPSNDIQMQLNEGNQPVIFTPLGGLKMTYLVMPVR 388
>gi|67922001|ref|ZP_00515517.1| DNA polymerase III, beta chain [Crocosphaera watsonii WH 8501] >gi|67856217|gb|EAM51460.1| DNA polymerase III, beta chain [Crocosphaera watsonii WH 8501] (396 aa)
Score = 190, Expect = 1.3e-12, Identities = 81/371 (21%), Positives = 194/371 (52%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITL-------EKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD------------------FRIVLDVSLIELLLEII----DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFS--SSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK + S++ L + L L +    +  + P+    L+  +  + + + +   +S    +  S  A++ E G+I ++ K    I+S+L    ITL       +  D+ ++ +K+++    +  M+ E++P +  +  +   + +  ++  + +    +A ++++ K  I++G+  +   +  +LE  ATDG++L+  +   +P+                   F + +    +  L  ++    + DT I + + E+ ++F++    +  + ++G YPN   +I       + + +K L+ +LER +A+ + +K ++VK  FS+E  +VS S  + DLG++KE++  +   N    I+ N  +L+  LK     +I ++ ++  +PV+L          +++P++
  S:     1 MKFLCSQSDLNSNLSLVSRAVASRPTHPILANVLVVADSQKNRVSLTAFDLSLG--LETSFSADVSEDGKITLRAKLLNEIVSRLPEGEITLMAEEEEDDDDDSQIVVLKSASGQFQVRAMNAEEFPPLP-TVEEGELVQLPIVMLTEGLKGALFAASSDETK-QILTGV--HLTGTPDSLEFAATDGHRLSVVETTLSPETDDEGNEQGESPEMPNLEGFAVTIPARALRELERMLGSRSESDT-IALQVDEAQVVFQLGYQRLTVRKLDGAYPNYQMLIPQQFSRSICLERKRLLSSLER-VAVLADQKNNLVKCTFSNEDGQVSLSVDTQDLGSAKESMPAEVTGNS-GEIAFNVKYLMDGLKALATKDIKIQLNEGNQPVILNPLGGLQMTYLVMPVQ 393
>gi|88713000|ref|ZP_01107085.1| DNA polymerase III, beta chain [Flavobacteriales bacterium HTCC2170] >gi|88708898|gb|EAR01133.1| DNA polymerase III, beta chain [Flavobacteriales bacterium HTCC2170] (372 aa)
Score = 190, Expect = 1.3e-12, Identities = 75/347 (21%), Positives = 155/347 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK IVS T L+  L++   +  N  + P+    L ++  N++  + S+   +  S++    D     +G I +  K     +     + +T    DN+ +++ ++     +   D  ++P       + +  +I   +   +I+K  +A  N+  +  +MSG+ F    S + L  +ATD +KL  Y+    +  Q    ++    + LL  I+   ++ + I   +SN  F   N  +  ++I+G YPN   +I     NK++I++   + ++ R ++I S++    ++L  +   L +S    D  N  E         +   I  N+ FL  +L   ++D + +E S
  S:     1 MKFIVSSTYLLKQLQVLGGVINNSNTLPILDNFLFDLKQNKLTVSASDLETTMSSVLDVDSD----NEGTIAVPAKLLLETLKTFPEQPLTFVVEDNNTVEISSNHGKYALAYADGAEFPKA-VELANPSSTNIMGDILATAINKTIFAAGNDDLR-PVMSGVFFQF--SPENLTFVATDAHKLVKYQRSDVTASQVAEFIMPKKPLNLLKGILAGSESEVAIEYNDSNAKFTFDNAELICRLIDGKYPNYEAVIPKENPNKLSIARNQFLSSVRR-VSIFSNKTTHQIRLKIAGAELNISAEDIDYSNKAEERLTCSYQGDDMQIGFNSRFLTEMLNNLNSDEVALEMS 341
>gi|92112138|ref|YP_572066.1| DNA polymerase III subunit beta [Chromohalobacter salexigens DSM 3043] >gi|91795228|gb|ABE57367.1| DNA polymerase III, beta subunit [Chromohalobacter salexigens DSM 3043] (367 aa)
Score = 190, Expect = 1.3e-12, Identities = 79/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM---ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCK--GKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  +++  L+  L L   + E   + PV    L++V D+++  T ++  +    ++ ++   ++ E G   +  +    I   L  +     TLE+   ++++   S F   ++ +   ++PNI  S +D   L+++    K  I    +A+     +   ++G+          +  +ATDG++LA        E  P    IV    ++EL   +   D  +E+ +  +++  +  +    SK+++G +P+  R+I    +  V   +  L + L R  AI S+EK   V+LN     L V+ ++ +   ++E V+ +  G   E   +  N  +L+ +L   D D + +  SD     LL +    + + +++P+R
  S:     1 MRFTITREALLRPLSLVAGVVERRQTLPVLSNVLLQVQDSQLALTGTDLEVE---LIGRTTPHHVDEPGSATVPARKLMDICKSLPEQTDITFTLEE-GRAILRAGRSRF--TLSTLPVAEFPNIEGSQSD-TTLTLARGTLKHLIDATSFAMAQQDVRY-YLNGMLLEF--GHHLVRTVATDGHRLAVCARSADVEVEPSQKLIVPRKGILELARLLDGSDEPVELTIGGTHLRAQTGDFTFTSKLVDGKFPDYDRVIPRGGDKVVIAERGELRQVLSR-TAILSNEKYRGVRLNLEENNLRVTANNPEQEEAEENVAIEYDGGALE---VGFNVGYLVDVLGVLDADRVQMTLSDPNSSALLEEPGGGDAMYVVMPMR 366
>gi|37678196|ref|NP_932805.1| DNA polymerase III subunit beta [Vibrio vulnificus YJ016] >gi|37196935|dbj|BAC92776.1| DNA polymerase III, beta chain [Vibrio vulnificus YJ016] (366 aa)
Score = 190, Expect = 1.4e-12, Identities = 77/371 (20%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  ++++  I  L+  +       + P+    LI V + ++  T ++  +    +++K       E G I + ++ F  I   L ++ +    ++   ++V++     ++  +    +PNI     DW    ++S++    +  I K ++++ N   +   ++G+ F    S  TL  +ATDG+++A  +      DF   +I++    ++ L++++D  +  + + +  SN+  +V++ +  SK+++G +P+  R++       +  S   L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E   VS  G+  E   I  N  ++L +L T   + + +  SD+    L+ +  D + + +++PIR
  S:     1 MKFTIARSHFIKPLQQVSGALGGRPTLPILGNLLINVENGQLSMTATDLEVE---LISKVTLEGEFEAGSITVPSRKFLDICRGLPDDAVITFVLEGDRVQVRSGRSRFSLATLPANDFPNIE----DWQSEVEVSLTQGELRALIEKTQFSMANQDVRY-YLNGMLFEIDGS--TLRSVATDGHRMAVAQ-APLSADFAQKQIIVPRKGVQELVKLLDTPEQPVTLQIGSSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTTKTLEASCDELRQAFSRA-AILSNEKFRGVRVNLAGSEMRITANNPEQEEAEEMLDVSFDGEAIE---IGFNVSYVLDVLNTLRCEQVRISMSDANASALVENVDDDSAMYVVMPIR 365
>gi|53714271|ref|YP_100263.1| DNA polymerase III beta chain [Bacteroides fragilis YCH46] >gi|60682327|ref|YP_212471.1| putative DNA polymerase III beta chain [Bacteroides fragilis NCTC 9343] >gi|52217136|dbj|BAD49729.1| DNA polymerase III beta chain [Bacteroides fragilis YCH46] >gi|60493761|emb|CAH08551.1| putative DNA polymerase III beta chain [Bacteroides fragilis NCTC 9343] (374 aa)
Score = 189, Expect = 1.6e-12, Identities = 76/348 (21%), Positives = 159/348 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLF-ESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSD 354
           MK IVS T L + L+  + +  +  + P+    L ++ D  +  T S+   S  ++V   E       G+  +  K     + ++  + +T + K D   I V+      ++   + +++P      ++  ++ +   +    I++  +A  +++ +  +M+GI F+  + + T+  +A+DG+KL   K  +   + R   +L      LL  ++  ++ + +  F E N +F + +  +  ++IEG YPN + +I     +KV + +  L+ AL R ++I SS+  S++KL      + VS    D   S E             I   + FL+ +L     D + +E +D
  S:     1 MKFIVSSTALFSHLQAVSRVINSKNALPILDCFLFQLEDGTLSVTVSD---SETTMVTSVEVNESDSNGKFAVAAKTLLDALKEIPEQPLTFDIKPDTYEITVQYQNGKYSLMGQNADEFPQSATLGDNAVRVEMEAQILLGGINRSVFATADDELR-PVMNGIYFDITTEDITM--VASDGHKLVRCKTLAARGNERAAFILPKKPATLLKNLLPKESGMVVIEFDERNAVFTLESYRMVCRLIEGRYPNYNSVIPQNNPHKVTVDRMQLMGALRR-VSIFSSQASSLIKLRMQENQIVVSAQDIDFSTSAEETQVCQYAGAAMSIGFKSTFLIDILNNISADEVVIELAD 345
>gi|74316020|ref|YP_313760.1| DNA polymerase III, beta subunit [Thiobacillus denitrificans ATCC 25259] >gi|74055515|gb|AAZ95955.1| DNA polymerase III, beta chain [Thiobacillus denitrificans ATCC 25259] (367 aa)
Score = 189, Expect = 1.7e-12, Identities = 51/200 (25%), Positives = 108/200 (54%)
  Q:   178 KTLEIIATDGYKLAHYKFE-STPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           + L ++ATDG++L++ +     P D +  I+   ++IEL   + D D  +E+ +  + +   +  T + +K+++G +P+  R+I   +   +  +++T+V+AL+R  AI S+EK   V+L  S   L +  ++++   + + +       +P  +  N  +LL  L   + D IT+   D+   +LL  E +P F  +++P+R
  S:   166 QQLRVVATDGHRLSYAETTLDAPTDAQEVIIPRKTVIELSKLLSDSDEPVELRIGSNQVTIMLPGTELVTKVVDGKFPDYQRVIPANQPRHLKANRQTVVQALQRA-AILSNEKFRGVRLVMSDNTLGIVCNNNEQEEAADEIEVSYN-GDPLDVGFNVTYLLDGLGAVNTDEITLSLGDANSSMLLTSEGEPGFKYVVMPMR 366
>gi|23335940|ref|ZP_00121171.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Bifidobacterium longum DJO10A] >gi|23465221|ref|NP_695824.1| DNA polymerase III subunit beta [Bifidobacterium longum NCC2705] >gi|189440297|ref|YP_001955378.1| DNA polymerase sliding clamp subunit [Bifidobacterium longum DJO10A] >gi|23325849|gb|AAN24460.1| DNA polymerase III, beta chain [Bifidobacterium longum NCC2705] >gi|189428732|gb|ACD98880.1| DNA polymerase sliding clamp subunit [Bifidobacterium longum DJO10A] (374 aa)
Score = 189, Expect = 1.7e-12, Identities = 82/371 (22%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ----DFRIVLDVSLIELLLEIIDFDTNIEI-FLFESNII--FKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP------NFLQILVPIR 377
           MK+ +    L +A+   + + +   S+P+  G  +E  D  ++F+  N  IS  H I     +A + E G +L++ K    I   L++E   L   D S + + +      + +M + +YP++        Q  +    F +++++   AV+  +E   +++G+       +K + + +TD ++LA   F  TPQ    D   ++  SL++ +   +D   NI + F  +S  +  F+ +  +  S++I+G++P V R+ A     +  ++K+ L++A+ R   +  +E+ + +++ F+ + + +S  S D   + ET+      ++ T ++ N  +L   L       + ++ +   KPV    +++       ++  +LVP+R
  S:     1 MKVEIDTAALADAVAWTSRVIDARPSNPILAGVKLEAIDGTLQFSAFNYEISARHHI-----EAGVDEAGSVLVQGKLLADITKSLRSEKTYL-VTDGSTLTITSGKSKFTLQLMPDTEYPDLPVVPAMLGQ--VDAPTFVQAVNQACVAVSR-EENRPVLTGVRMQ-FQGDKVV-MTSTDRFRLARATFTWTPQNPDVDTTTLVRGSLLKDVARALDEHQNIRLDFDADSPTLLGFENAGRVSTSQLIDGEFPAVDRLFADEYPIQAVVNKQDLLDAISRVALV--AERNAPIRMTFTGQEVALSAGSVDEAQANETLDIDMDGDDIT-VAFNPSYLKEGLSAVTEPFVRIKMTTPVKPVEFNGQQEADSDESMDYRYLLVPMR 371
>gi|121596426|ref|YP_988322.1| DNA polymerase III, beta subunit [Acidovorax sp. JS42] >gi|120608506|gb|ABM44246.1| DNA polymerase III, beta subunit [Acidovorax sp. JS42] (368 aa)
Score = 189, Expect = 1.7e-12, Identities = 82/366 (22%), Positives = 168/366 (45%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILI---KTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K++  L+    I E   + P+    L+    N I+ TTS+    I +T  +   + D       R LI   KT P         ++ ++LE   + +I +K       +  +  E +P +  + +     S+   V K  + +V +A+     +   ++GI F  ++   TL ++ATDG++LA    +     P+   I+   +++EL   + D D  IE+    +   F        +K++EG +P+ +R+I     N V + +  L+ +L+R  AI +S+K   V+LN    +L V+ ++++   + + +       +   I  N  +L+  L     D + V+ +D     L+    + +F  +++P+R
  S:     7 TQDKVLAVLQSVAGIVERRHTLPILANVLLRKTGNAIQLTTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMP--------SDQTVSLESNQSKLI-LKGGKSRFTLQTLPAEDFPLVQEAASFGPAFSVPQKVLKSLLGQVSFAMAVQDIRY-YLNGILF--VAEGTTLSLVATDGHRLAFASAQLDVEVPKQEVILPRKTVLELQRLLSDADGAIEMQFANNQAKFSFGGMEFVTKLVEGKFPDYNRVIPKNHHNSVTLGRAPLLASLQR-TAIMTSDKFKGVRLNIEPGLLRVASNNAEQEEAVDELDIDYG-GDAIEIGFNVSYLIDALANMGQDMVKVDLADGNSSALMTIPDNEHFKYVVMPMR 367
>gi|91791371|ref|YP_561022.1| DNA polymerase III, beta subunit [Shewanella denitrificans OS217] >gi|91713373|gb|ABE53299.1| DNA polymerase III, beta subunit [Shewanella denitrificans OS217] (366 aa)
Score = 189, Expect = 1.8e-12, Identities = 80/371 (21%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+L     E   + P+    L++V+ + I  T ++  +    +V ++     +  G   +  K    I+  L  +  + +E+ DN  +++   S F   +  +    YPN+  ++    + +I   V K  I   ++++ N   +   ++G+ F +     TL+ IATDG++LA  H + + S P+   IV    ++E+   +   D +I I + ES I       +  SK+++G +P+  R++    +  V  S++ L +AL R  +I S+EK   V++     +L ++ ++ +   ++E +      +    I  N  +LL +L    ++++ +   D     L+ + K+ + + +++P+R
  S:     1 MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVKVSQDVISLTGTDLEVE---LVGQAAIHGDIVPGNTTVPAKKLLDIVKSLPEQSELHVEQQDNRWLLRSGRSRF--TLATLPASDYPNVE-AFQAEIEFTIKQGVLKSIIDSTQFSMANQDVRY-YLNGLLFET--EGNTLKAIATDGHRLALSHRQIDVSLPEKQVIVPRKGVVEMSRLLDSDDKDISIAIGESAIRAVTDTAVFTSKLVDGRFPDYRRVLPKGGDKVVVASRQQLKQALTRA-SILSNEKFRGVRIQLEPGLLRITANNPEQEEAEEIIDVDYD-SANLEIGFNVSYLLDVLNNLASEDVRITLIDGNSSALIENHKEEDSMYVVMPMR 365
>gi|110599409|ref|ZP_01387648.1| DNA-directed DNA polymerase [Geobacter sp. FRC-32] >gi|110549954|gb|EAT63141.1| DNA-directed DNA polymerase [Geobacter sp. FRC-32] (164 aa)
Score = 188, Expect = 2.1e-12, Identities = 42/155 (27%), Positives = 96/155 (61%)
  Q:   223 NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISL--NNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +I +   +++ + K  NT+I  ++I+G++P+ +++I    + KV +S++ L+ +L R +AI SSEK   +KL+  S  +E+S S+ +LG+++E    +  + + TP+S+  N  +L+ +L    +D + ++  D   P++++     +F+ +++P+R
  S:    11 DIMMGFMDNSAVIKKDNTVIVMRLIDGEFPDYTKVIPANNDKKVTVSREALLHSLRR-MAILSSEKFKGIKLDVRSGSIEISSSNPELGDAREE---QEVLYDGTPLSVRFNARYLIDVLTVLRDDQVELDLRDELSPIIMKPIAKDDFMSVIMPMR 163
>gi|121607006|ref|YP_994813.1| DNA polymerase III, beta subunit [Verminephrobacter eiseniae EF01-2] >gi|121551646|gb|ABM55795.1| DNA polymerase III, beta subunit [Verminephrobacter eiseniae EF01-2] (372 aa)
Score = 188, Expect = 2.1e-12, Identities = 84/366 (22%), Positives = 164/366 (44%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKY--AVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIEL--LLEIIDFDT--NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K++ AL+    I E   + P+    LI    N ++ TTS+  I   +      D     +    +  +    I+  +  E     + D S + +K       ++ +  + +P +  S       S+     K  + +V +  AV + +  +N   GI F  ++  +TL +IATDG++LA          P+   I+   +++EL  LL   D D   +IE+    +   F        +K++EG +P+ +R+I     N V + +  L+ +L+R  AI +S+K   V+LN     L V+ S+++   + + +       +   I  N  +L+  L   + D + + F+D     LL    + NF  +++P+R
  S:     7 TQDKVLAALQSVAGIVERRHTLPILANVLIRKTGNALQLTTSDLEIQIRTTAELGGDTG---ECMTTMSVRKLIDILRTMPGEQTVSLESDQSRLILKAGKSRFTLHSLPGQDFPLVQESAAFGPVFSVPQKTLKSLLGQVSFTMAVQDIRYYLN---GILF--VAEGQTLSLIATDGHRLAFACATLDVQVPKQEVILPRKTVLELQRLLSDADGDNRPHIEMQFASNQAKFTFGGMEFVTKLVEGKFPDYNRVIPKNHHNCVTLGRAALLTSLQR-TAIMTSDKFKGVRLNLEPGALRVASSNAEQEEAVDELDVD-YAGDNIEIGFNVTYLIDALANMEQDMVQLAFADGNSSALLTIPANDNFKYVVMPMR 371
>gi|16124205|ref|NP_407518.1| DNA polymerase III subunit beta [Yersinia pestis CO92] >gi|22127980|ref|NP_671403.1| DNA polymerase III subunit beta [Yersinia pestis KIM] >gi|45443727|ref|NP_995266.1| DNA polymerase III subunit beta [Yersinia pestis biovar Microtus str. 91001] >gi|51598226|ref|YP_072417.1| DNA polymerase III subunit beta [Yersinia pseudotuberculosis IP 32953] >gi|108810132|ref|YP_654048.1| DNA polymerase III subunit beta [Yersinia pestis Antiqua] >gi|108814114|ref|YP_649881.1| DNA polymerase III subunit beta [Yersinia pestis Nepal516] >gi|150260969|ref|ZP_01917697.1| DNA polymerase III, beta subunit protein [Yersinia pestis CA88-4125] >gi|153950603|ref|YP_001403094.1| DNA polymerase III subunit beta [Yersinia pseudotuberculosis IP 31758] >gi|162419235|ref|YP_001608447.1| DNA polymerase III subunit beta [Yersinia pestis Angola] >gi|165926167|ref|ZP_02221999.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936833|ref|ZP_02225399.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166009556|ref|ZP_02230454.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213164|ref|ZP_02239199.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401667|ref|ZP_02307161.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422858|ref|ZP_02314611.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425558|ref|ZP_02317311.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470925|ref|ZP_02335629.1| DNA polymerase III, beta subunit [Yersinia pestis FV-1] >gi|170022264|ref|YP_001718769.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis YPIII] >gi|186893346|ref|YP_001870458.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis PB1/+] >gi|21961125|gb|AAM87654.1|AE014012_11 DNA polymerase III, beta-subunit [Yersinia pestis KIM] >gi|45438597|gb|AAS64143.1| DNA polymerase III, beta subunit protein [Yersinia pestis biovar Microtus str. 91001] >gi|51591508|emb|CAH23180.1| DNA polymerase III, beta subunit protein [Yersinia pseudotuberculosis IP 32953] >gi|108777762|gb|ABG20281.1| DNA polymerase III, beta subunit [Yersinia pestis Nepal516] >gi|108782045|gb|ABG16103.1| DNA polymerase III, beta subunit [Yersinia pestis Antiqua] >gi|115349684|emb|CAL22665.1| DNA polymerase III, beta subunit protein [Yersinia pestis CO92] >gi|149290377|gb|EDM40454.1| DNA polymerase III, beta subunit protein [Yersinia pestis CA88-4125] >gi|152962098|gb|ABS49559.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis IP 31758] >gi|162352050|gb|ABX85998.1| DNA polymerase III, beta subunit [Yersinia pestis Angola] >gi|165915075|gb|EDR33686.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165922027|gb|EDR39204.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991478|gb|EDR43779.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205462|gb|EDR49942.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958250|gb|EDR55271.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049049|gb|EDR60457.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055572|gb|EDR65365.1| DNA polymerase III, beta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169748798|gb|ACA66316.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis YPIII] >gi|186696372|gb|ACC87001.1| DNA polymerase III, beta subunit [Yersinia pseudotuberculosis PB1/+] (366 aa)
Score = 188, Expect = 2.2e-12, Identities = 80/371 (21%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ +  L+  L+  +S      + P+    L++V +  ++ T ++  +   + VA S+     E G   +  + FF I   L         +D   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       ++ P    IV    ++EL+  +   DT + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS +G   E   I  N  ++L +L     +++ +  +DS   V + D        +++P+R
  S:     1 MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLTGTDLEMEMVACVALSQSH---EPGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRSRFSLSTLPAIDFPNLD----DWQSEVEFTLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKMLEAGCDLLKQAFSRA-AILSNEKFRGVRLYVSHNQLKITANNPEQEEAEEILDVSYEGTEME---IGFNVSYVLDVLNALKCEDVRLLLTDSVSSVQIEDSASQAAAYVVMPMR 365
>gi|73748915|ref|YP_308154.1| DNA polymerase III, beta subunit [Dehalococcoides sp. CBDB1] >gi|73660631|emb|CAI83238.1| DNA polymerase III, beta subunit [Dehalococcoides sp. CBDB1] (378 aa)
Score = 188, Expect = 2.3e-12, Identities = 78/370 (21%), Positives = 172/370 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTN----IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKL------NFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MK+   +  L   L +    +    + P+    LI  +D  +K   +N  ++    +     A I E+G   I  K     +S L N+ I L     +  + +K + F++ I  +D + +P I    N  +   +S   F++++S+V +A   ++ +  +++G+  N+     TL + A DG++LA YK    ES     ++++    +  L  +   D      I +   +S I+F++ N  + S++++G++P  ++II      +V +     + A +    I + +   IV+L      + +   L +S  S ++G++   +    +  E   I+ N  +LL +L       + +E +    P +++     N++ +++P+
  S:     1 MKLTCLQENLNKGLNIVGKAAAGRTTLPITNNVLISTDDGRLKLAATNLEMAISCWIG----AKIEEEGSTTIPAKLLTEFVSSLPNDKIDLSLNAKSKALNIKCARFEARITGVDSKDFPPIPKVENGIST-KVSIDAFRQAVSEVVFASAADESR-PVLTGV--NAEFEGSTLTLAAADGFRLAVYKLPLLESVKTTTKVIIPARTLGELSRLASMDEEEALVINVDTAKSQILFRLKNIELVSQLVQGNFPQYNQIIPQSFTTRVVVDANQFLMATKTA-TIFARDGGGIVRLMMNPGGDTTPGKLTISARSEEVGDNTGELDAVIQ-GEEAKIAFNGKYLLDVLGVLKAQQVALEVTSPSSPGVIKPVGADNYIHVIMPM 374
>gi|110832863|ref|YP_691722.1| DNA polymerase III, beta subunit [Alcanivorax borkumensis SK2] >gi|110645974|emb|CAL15450.1| DNA polymerase III, beta subunit [Alcanivorax borkumensis SK2] (366 aa)
Score = 188, Expect = 2.3e-12, Identities = 83/371 (22%), Positives = 166/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  +++ +L+  L+   ++ E   + PV    L+EV D ++  T ++  +    +VA+      LE G   +  +    I   L  E     +VD   + V++      ++ +   ++PN+       + L I P V +  I +  +++     +   ++G+ F   S    L  +ATDG++LA    + +   ++  ++L    +  L  I+ D      + +  +++   V      SK+++G +P   R+I      KV   ++TL +AL R +AI S+EK   V++  S   L +  ++ +   ++E VS       P  I  N  +LL +L T       +E  DS    L+ D +    + +++P+R
  S:     1 MKFSINREQLLKPLQQVAAVVEKRQTLPVLSNVLLEVGDGQLSMTGTDLELE---LVARLPLEGELEPGETTVPARKLVDIGKSLPAEADIRFEVDGERMLVRSGRSRFTLSTLPASEFPNLEEDAAG-SSLEIKPDVLRGLIDRTAFSMAQQDVRY-YLNGMLFELKSGR--LRAVATDGHRLALCDAELDVPVEEASVILPRKGVMELSRILGDSGEVARLTIGRNHVRIVVGAITFTSKLVDGKFPEYDRVIPKEGSRKVVADRETLRQALAR-VAILSNEKYRGVRVQLSEGSLRIVANNPEQEEAEEEVSVDFN-GSPLEIGFNVSYLLDVLNTMGGTQAELEMGDSNSSALVFDPESKAAVYVVMPMR 365
>gi|89210815|ref|ZP_01189199.1| DNA polymerase III, beta chain [Halothermothrix orenii H 168] >gi|89159556|gb|EAR79220.1| DNA polymerase III, beta chain [Halothermothrix orenii H 168] (367 aa)
Score = 188, Expect = 2.4e-12, Identities = 58/309 (18%), Positives = 161/309 (52%)
  Q:    69 ANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR-IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           A+I+ +G+I++       II +L ++ I   K D    + + +   S   I   D +++P +    N  ++++++     + I +VK++ + ++ +  +  G   + +     + ++AT+ Y+L+      + +P+  + ++L  + +  L  ++D D  +EI + ++ + F  +  ++ S++IEG +PN  +++      KV + +  L+ ++ R +++ +    +++ ++     + ++   S+ G ++E +  + +  E   I+++  +LL +LK  ++D + +E      P+ L+ E   +F+ +++P+R
  S:    60 ADIITEGKIVLPASHLSGIIRELPDDNINF-KADLDKYEAELTCLSSRFKIKGFDADEFPQLP-EVNIPHKITLNCGDLNRLIDEVKFSTSTDQTQPALTGG---SMVIDSGKIRMVATNTYRLSLSSLDLDGSPEGKKEVILPGNTLSELSHLLDDDGEVEILIGDNYVRFNFNGIVLVSRVIEGQFPNYQQVLPKEYNTKVRVDRNNLLRSVRR-VSLIARLDSNVISISVKDNKMIITSQDSEEGFAREEIEIESQGPEQN-INIDAGYLLDVLKVLNDDVVILELIGPLNPLTLKKENSDDFIYLVMPVR 366
>gi|42520873|ref|NP_966788.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410613|gb|AAS14722.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Drosophila melanogaster] (365 aa)
Score = 188, Expect = 2.5e-12, Identities = 93/371 (25%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMD--EEQYPNI---NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNE-PTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  VS+T L+N L   + + E   +  VF    I+     IK   ++  IS  + +A    A +L +G + I       I+ KL  ++    +V+N   K+  S  ++N ++ +     +P +   N+ + D+  L+   I     ++K K+AV+ +  + N ++GI  ++   E+ L  +ATDG++L+  K         +F +++    +  LL+I+D    I++ L +  I F     I+ SK+I+G +PN   +I   ++  + I  K L + ++R   + S + KSI K +   ++L +  +S +  ++ E++      NE P  I  N+ +LL +L    N       +D     ++ DE D + L +++P+R
  S:     1 MRFSVSRTSLLNTLSRVSGVVERRNAIDVFACINIKAQHGSIKLMATDLDISMFASLA----ATVLTEGEVKISAHTLHDIVKKLPADLDVNFEVNNQG-KLLMSCGNANFSLPNVVSSSFPALEEDNYKH-DFTLLNTDLIDL---LTKTKFAVSLDDTRYN-LNGIYLHT--DEQFLYCVATDGHRLSCIKRPKPGNINGEFGVIIPRKTVMELLKILDDCNEIKVKLSDRKIKFTCGEYILISKLIDGTFPNYKAVIPASQDKHMIIESKKLSDVIDRVSVVVSDKVKSI-KFSLQEKLLTLHSNSQECSDATESIEV--DYNEAPIEIGFNSRYLLDVLSCIKN-KCKFSLADGNSATIITDEDDSSALYVVMPMR 364
>gi|17548158|ref|NP_521560.1| DNA polymerase III subunit beta [Ralstonia solanacearum GMI1000] >gi|17430465|emb|CAD16938.1| probable dna polymerase III (beta chain) protein [Ralstonia solanacearum] (371 aa)
Score = 188, Expect = 2.5e-12, Identities = 78/366 (21%), Positives = 171/366 (46%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNG--IISTHSIV-AKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-------IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S+  L+  L++ + I E   + P+    LI  N   + F +++    I+TH+   A + D       R L+       I+  + +  + L  +++  + V++      +  +  E++P +  + +   ++++     K  ++ V +A+     +   ++G+    +   K +  +ATDG++LA+   E+  Q          I+   +++EL   + D D  + + L  + + F   N  + SK++EG +P+  R+I     N   I +  L +AL+R  AI +++K   V+    + VL++S +++D   ++E +    +  +   I  N  +LL +L     + + V   DS    L+    D  F  +++P+R
  S:     7 SRDNLLRPLQIVSGIVERRHTLPILANLLIRKNGERVSFLSTDIEIQITTHADCGAGNGDIATTVAARKLVD------ILRAMPDGEVAL-TLNDKRMSVQSGKSRFALQTLAAEEFPTVAEANDFGARITLPQKTLKHLLAMVHFAMAQQDIRY-YLNGMLL--VVDGKQVMAVATDGHRLAYCGVETGEQPAGAGGRHEVIIPRKTILELQRLLEDVDDPVSVQLASNQVKFTFGNIELISKLVEGKFPDFQRVIPKGYRNSFTIDRAFLQQALQR-TAILTTDKFKGVRCMLDTNVLKISSTNADQEEAQEELEIDYQ-GDALDIGFNVTYLLDVLANLKAEKVQVSLGDSNSSALITLPDDDTFKYVVMPMR 370
>gi|91785915|ref|YP_546867.1| DNA polymerase III, beta subunit [Polaromonas sp. JS666] >gi|91695140|gb|ABE41969.1| DNA polymerase III, beta subunit [Polaromonas sp. JS666] (368 aa)
Score = 187, Expect = 2.7e-12, Identities = 78/366 (21%), Positives = 169/366 (46%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K+++ L+    I E   + P+    LI     +++ TTS+  I   +      DA         +  +    I+  +  ++ ++LE   + +I +K       +  +  E +P +  + N     S+   V K+ +++V +A+  +  +   ++GI F  ++  K L ++ATDG++LA          P+   I+   +++E+   + D +  IE+    +   F        +K++EG +P+ +R+I    +N + + +  L+ +L+R  AI +SEK   V+LN     L V+ ++++   + + +       +   I  N  +L+  L   + D + +E +DS    LL    D  F  +++P+R
  S:     7 TQDKVLSVLQSVAGIVERRHTLPILANVLIRKTGAQLQLTTSDLEIQIRTSADLDGDAGNFTT---TVGARKLIDILRSMPSDQTVSLESAQSKLI-LKGGKSRFTLQTLPAEDFPLVQEAANFGPSFSVPQKVLKELLNQVSFAMAVHDIRY-YLNGILF--VAEGKQLSLVATDGHRLAFSSATLDVEVPKQEVILPRKTVLEMQRLLSDKEGAIEMQFAGNQAKFSFEGMEFVTKLVEGKFPDYNRVIPKNHKNIITLGRVPLLASLQR-TAILTSEKFKGVRLNIEPGTLRVASNNAEQEEAVDELDIDYG-GDAIEIGFNVTYLIDALANMEQDMVKIELADSNSSALLTIPDDAAFKYVVMPMR 367
>gi|51891140|ref|YP_073831.1| DNA polymerase III beta subunit [Symbiobacterium thermophilum IAM 14863] >gi|51854829|dbj|BAD38987.1| DNA polymerase III beta subunit [Symbiobacterium thermophilum IAM 14863] (368 aa)
Score = 187, Expect = 2.9e-12, Identities = 71/370 (19%), Positives = 165/370 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVD--NSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP---QDFRIVLDVSLIELLLEII--DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MKI++S+  L   L           + PV  G  +     E+    ++  ++  ++        ++ +G  ++  + F  +I ++    I L  VD  N V  ++       I+    +Q+P +    +  +  ++   + +  + +  +A  +++ K   ++G+ F     +  L   ATDG ++A+ +  +       F +++    +  +  ++  D D+ + + +  + + F + NT + S+++EG YP+V R++      +  +     +EALER   I+   K   VK++F ++ + ++ ++ ++G   E ++      +P  I  N  +LL  LK  +      + S S  P  L       FL +++P+
  S:     1 MKILISQESLNATLATVARAVSTKNTIPVLSGVYLSARGGELTIRATDMELAIEAVTP----CEVISEGETVLPARYFADLIRRIPYGNIELS-VDYHNHVATLRWGRSQYVIHGFAADQFPTLP-DVDGASAFTVKQSLLRDLLRQTTFAAGHDESK-PWLTGVLFKL--RDDLLTGTATDGIRIAYAEAAAENAQGHSFSVIIPSRSLNEVTRLLTGDEDSQVNVAVTANQVFFDLGNTRVISRLLEGQYPDVMRLVPQHYPTEAVLPGAEFMEALERATLIT---KDGAVKISFQTDKVTITSNTPEVGQVYEELAVTSMAGDPLDIGFNARYLLDFLKVLEEKQFRFQCSGSRNPARLMPADSSQFLYVVLPL 365
>gi|156740759|ref|YP_001430888.1| DNA polymerase III, beta subunit [Roseiflexus castenholzii DSM 13941] >gi|156232087|gb|ABU56870.1| DNA polymerase III, beta subunit [Roseiflexus castenholzii DSM 13941] (377 aa)
Score = 186, Expect = 3.8e-12, Identities = 81/343 (23%), Positives = 156/343 (45%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVD--NSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFES--NIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSC--------KGKVN-----EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           PV    LI  +D  +K   +N  I     +     A I E+G + +  K    ++  L N+ I L  +D     + +K + F+SNI   +  ++P I    N        P + +++I +V +A +  +E   ++ G+      +       A DG++LA    E     + PQD  I+   +L EL   + D ++ +E+ +  S   ++F  S   + S++I+G YP+V R+I    + +  +  + L +A++     + +   S V+L+             DLG  + T+S         KG+V+     E   I+LN  FL   +       + +E      P + +      ++ I++P+
  S:    28 PVLSNILIASDDGRLKLAATNLEIGITCWIG----AKIEEEGAVAVPAKLLSDVVGSLPNDRIDL-TLDGRTQTLNLKCARFESNIKGTESGEFPAIPTVDNRTPTAVFPPTLLRETIQQVAFAAST-EETRPVLQGVQLRLRDNRAIFA--AADGFRLAQRIVELPEPVAQPQDL-IIPARALNELARILNDDESQVEMIVTHSGGQVLFHTSTVDLVSRLIDGKYPDVDRVIPQQYQTRAVLDTQELTKAVKLASYFTVAPSNS-VRLHME--------PGGDLGPGRMTISANAVDVGDNKGQVDAMIEGEGGQIALNVKFLSDAIAAIPTPQLALETQSPQHPAVFKPVGADGYIHIVMPM 374
>gi|86609004|ref|YP_477766.1| DNA polymerase III subunit beta [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557546|gb|ABD02503.1| DNA polymerase III, beta subunit [Synechococcus sp. JA-2-3B'a(2-13)] (439 aa)
Score = 186, Expect = 4.0e-12, Identities = 74/310 (23%), Positives = 169/310 (54%)
  Q:    68 DANILEKGRILIKTKPFFAIISKLKNEMITLEKV----DNSVIKVKTSTFDSNINIMDEEQYPN---INFSYNDWN--------------QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEK-TLEIIATDGYKLAHYKFES-----TPQDFRIVLDVSL-------IELLLEIIDFDTNIEIFLFESNIIF----KVSNTI----IASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFS--SEVLEVSFSSSDLGNSKETVSCKGKVNEPT-PISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +A +   GR  +  K    I+S+L +  +TL+      +++ + + ++     +  M  E+YP    I+    D +              +L I  ++  + I +  +A + ++ K  +++G+    ++ +   LE  ATDG++LA  + E+           I LD ++       +E +L      + +E+    S + F    + S T     I S+++EG YP+ +R+I    E +V + ++ L+E+LER + + ++++  IVK N S  ++ L +S  + D+G+ +E++    +++ P   ++ N  +LL  L+ F    +++E + + +P + +         +++P++
  S:    87 EAQVRGSGRTTLPAKLLSDIVSRLPSGPVTLDASSQAQESAPVILMSAAGQYQVRSMSAEEYPTLPEISLRTADADGDFVGEESPTAQALELPIESLL--QGIGQTLFAASGDETK-QVLTGVHVKLLAGDPPCLEFAATDGHRLAIVQVEAEGIPVASAHGEIGLDFTIPARTLREVERILGTQTAASTVELRFDRSQVQFVLPPRASKTQCQQRITSRLLEGQYPDYNRLIPKQFERQVTLERRPLIESLER-VGVLAAQRNDIVKFNLSAATQTLRISTEAPDVGSGEESLPV--QMSGPDLELAFNVRYLLDALRVFHTQQVSLELNGATQPAIWKPLGAMRLCYLVMPVQ 435
>gi|15804295|ref|NP_290334.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 EDL933] >gi|15833890|ref|NP_312663.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str. Sakai] >gi|16131569|ref|NP_418156.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12 substr. MG1655] >gi|26250442|ref|NP_756482.1| DNA polymerase III subunit beta [Escherichia coli CFT073] >gi|74314015|ref|YP_312434.1| DNA polymerase III subunit beta [Shigella sonnei Ss046] >gi|82546035|ref|YP_409982.1| DNA polymerase III subunit beta [Shigella boydii Sb227] >gi|82779230|ref|YP_405579.1| DNA polymerase III subunit beta [Shigella dysenteriae Sd197] >gi|89110312|ref|AP_004092.1| DNA polymerase III, beta subunit [Escherichia coli W3110] >gi|91213223|ref|YP_543209.1| DNA polymerase III subunit beta [Escherichia coli UTI89] >gi|110644044|ref|YP_671774.1| DNA polymerase III subunit beta [Escherichia coli 536] >gi|117625977|ref|YP_859300.1| DNA polymerase III subunit beta [Escherichia coli APEC O1] >gi|157156673|ref|YP_001465186.1| DNA polymerase III subunit beta [Escherichia coli E24377A] >gi|157163181|ref|YP_001460499.1| DNA polymerase III subunit beta [Escherichia coli HS] >gi|168709442|ref|ZP_02741719.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4045] >gi|168716635|ref|ZP_02748912.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4206] >gi|168735274|ref|ZP_02767551.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4115] >gi|168748583|ref|ZP_02773605.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4113] >gi|168753590|ref|ZP_02778597.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4401] >gi|168759887|ref|ZP_02784894.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|168766188|ref|ZP_02791195.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4486] >gi|168772264|ref|ZP_02797271.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4196] >gi|168779923|ref|ZP_02804930.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4076] >gi|168791011|ref|ZP_02816018.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4042] >gi|168798736|ref|ZP_02823743.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC508] >gi|170018063|ref|YP_001723017.1| DNA polymerase III, beta subunit [Escherichia coli ATCC 8739] >gi|170083203|ref|YP_001732523.1| DNA polymerase III, beta subunit [Escherichia coli str. K12 substr. DH10B] >gi|170682488|ref|YP_001746029.1| DNA polymerase III, beta subunit [Escherichia coli SMS-3-5] >gi|187730327|ref|YP_001882465.1| DNA polymerase III, beta subunit [Shigella boydii CDC 3083-94] >gi|188492542|ref|ZP_02999812.1| DNA polymerase III, beta subunit [Escherichia coli 53638] >gi|191165808|ref|ZP_03027646.1| DNA polymerase III, beta subunit [Escherichia coli B7A] >gi|191170441|ref|ZP_03031994.1| DNA polymerase III, beta subunit [Escherichia coli F11] >gi|193063787|ref|ZP_03044874.1| DNA polymerase III, beta subunit [Escherichia coli E22] >gi|194428142|ref|ZP_03060686.1| DNA polymerase III, beta subunit [Escherichia coli B171] >gi|194431323|ref|ZP_03063616.1| DNA polymerase III, beta subunit [Shigella dysenteriae 1012] >gi|194435912|ref|ZP_03068015.1| DNA polymerase III, beta subunit [Escherichia coli 101-1] >gi|195936322|ref|ZP_03081704.1| DNA polymerase III subunit beta [Escherichia coli O157:H7 str. EC4024] >gi|71159297|sp|P0A988|DPO3B_ECOLI DNA polymerase III subunit beta >gi|71159295|sp|P0A990|DPO3B_ECO57 DNA polymerase III subunit beta >gi|71159296|sp|P0A989|DPO3B_ECOL6 DNA polymerase III subunit beta >gi|494833|pdb|2POL|A Chain A, Three-Dimensional Structure Of The Beta Subunit Of Escherichia Coli Dna Polymerase Iii Holoenzyme: A Sliding Dna Clamp >gi|494834|pdb|2POL|B Chain B, Three-Dimensional Structure Of The Beta Subunit Of Escherichia Coli Dna Polymerase Iii Holoenzyme: A Sliding Dna Clamp >gi|34809863|pdb|1MMI|A Chain A, E. Coli Dna Polymerase Beta Subunit >gi|34809864|pdb|1MMI|B Chain B, E. Coli Dna Polymerase Beta Subunit >gi|39654966|pdb|1UNN|A Chain A, Complex Of Beta-Clamp Processivity Factor And Little Finger Domain Of Poliv >gi|39654967|pdb|1UNN|B Chain B, Complex Of Beta-Clamp Processivity Factor And Little Finger Domain Of Poliv >gi|51247132|pdb|1OK7|A Chain A, A Conserved Protein Binding-Site On Bacterial Sliding Clamps >gi|51247133|pdb|1OK7|B Chain B, A Conserved Protein Binding-Site On Bacterial Sliding Clamps >gi|166235467|pdb|3BEP|A Chain A, Structure Of A Sliding Clamp On Dna >gi|166235468|pdb|3BEP|B Chain B, Structure Of A Sliding Clamp On Dna >gi|194709177|pdb|3D1E|A Chain A, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To A Polymerase Ii Peptide >gi|194709178|pdb|3D1E|B Chain B, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To A Polymerase Ii Peptide >gi|194709180|pdb|3D1F|A Chain A, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To A Polymerase Iii Peptide >gi|194709181|pdb|3D1F|B Chain B, Crystal Structure Of E. Coli Sliding Clamp (Beta) Bound To A Polymerase Iii Peptide >gi|194709184|pdb|3D1G|A Chain A, Structure Of A Small Molecule Inhibitor Bound To A Dna Sliding Clamp >gi|194709185|pdb|3D1G|B Chain B, Structure Of A Small Molecule Inhibitor Bound To A Dna Sliding Clamp >gi|12518540|gb|AAG58898.1|AE005601_4 DNA polymerase III, beta-subunit [Escherichia coli O157:H7 EDL933] >gi|26110872|gb|AAN83056.1|AE016769_171 DNA polymerase III, beta chain [Escherichia coli CFT073] >gi|145761|gb|AAB59150.1| DNA polymerase III beta-subunit >gi|290549|gb|AAA62052.1| DNA polymerase III beta-subunit >gi|1790136|gb|AAC76724.1| DNA polymerase III, beta subunit [Escherichia coli str. K-12 substr. MG1655] >gi|13364111|dbj|BAB38059.1| DNA polymerase III beta-subunit [Escherichia coli O157:H7 str. Sakai] >gi|73857492|gb|AAZ90199.1| DNA polymerase III beta subunit [Shigella sonnei Ss046] >gi|81243378|gb|ABB64088.1| DNA polymerase III, beta-subunit [Shigella dysenteriae Sd197] >gi|81247446|gb|ABB68154.1| DNA polymerase III beta-subunit [Shigella boydii Sb227] >gi|85676343|dbj|BAE77593.1| DNA polymerase III, beta subunit [Escherichia coli W3110] >gi|91074797|gb|ABE09678.1| DNA polymerase III, beta-subunit [Escherichia coli UTI89] >gi|110345636|gb|ABG71873.1| DNA polymerase III, beta chain [Escherichia coli 536] >gi|115515101|gb|ABJ03176.1| DNA polymerase III subunit beta [Escherichia coli APEC O1] >gi|157068861|gb|ABV08116.1| DNA polymerase III, beta subunit [Escherichia coli HS] >gi|157078703|gb|ABV18411.1| DNA polymerase III, beta subunit [Escherichia coli E24377A] >gi|169752991|gb|ACA75690.1| DNA polymerase III, beta subunit [Escherichia coli ATCC 8739] >gi|169891038|gb|ACB04745.1| DNA polymerase III, beta subunit [Escherichia coli str. K12 substr. DH10B] >gi|170520206|gb|ACB18384.1| DNA polymerase III, beta subunit [Escherichia coli SMS-3-5] >gi|187427319|gb|ACD06593.1| DNA polymerase III, beta subunit [Shigella boydii CDC 3083-94] >gi|187771361|gb|EDU35205.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4196] >gi|188016968|gb|EDU55090.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4113] >gi|188487741|gb|EDU62844.1| DNA polymerase III, beta subunit [Escherichia coli 53638] >gi|189002623|gb|EDU71609.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4076] >gi|189359039|gb|EDU77458.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4401] >gi|189364639|gb|EDU83058.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4486] >gi|189369478|gb|EDU87894.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC4501] >gi|189378717|gb|EDU97133.1| DNA polymerase III, beta subunit [Escherichia coli O157:H7 str. EC508] >gi|190904132|gb|EDV63843.1| DNA polymerase III, beta subunit [Escherichia coli B7A] >gi|190909249|gb|EDV68835.1| DNA polymerase III, beta subunit [Escherichia coli F11] >gi|192930502|gb|EDV83109.1| DNA polymerase III, beta subunit [Escherichia coli E22] >gi|194413900|gb|EDX30178.1| DNA polymerase III, beta subunit [Escherichia coli B171] >gi|194420778|gb|EDX36854.1| DNA polymerase III, beta subunit [Shigella dysenteriae 1012] >gi|194425455|gb|EDX41439.1| DNA polymerase III, beta subunit [Escherichia coli 101-1] (366 aa)
Score = 185, Expect = 4.5e-12, Identities = 78/371 (21%), Positives = 164/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       + P+    L++V D  +  T   G      +VA+       E G   +  + FF I   L        +++   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       +S P    IV    +IEL+  +   D  + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E +       E   I  N  ++L +L     +N+ +  +DS   V + D    +   +++P+R
  S:     1 MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT---GTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARA-AILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAE-MEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 365
>gi|29346774|ref|NP_810277.1| DNA polymerase III, beta chain [Bacteroides thetaiotaomicron VPI-5482] >gi|29338671|gb|AAO76471.1| DNA polymerase III, beta chain [Bacteroides thetaiotaomicron VPI-5482] (374 aa)
Score = 185, Expect = 4.8e-12, Identities = 79/348 (22%), Positives = 158/348 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSE-DANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR--IVLDVSLIELLLEIIDFDT-NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSD 354
           MK IVS T L + L+  + +  +  + P+    L E+ D  +  T S+   +  + V  +E D N    GR  +  K     + ++  + +T     DN  I V+      ++   + +++P       +  ++ +   V    I++  +A  +++ +  +M+GI F+  + + T+  +A+DG+KL   K  +   + R   +L      LL  ++  +   + I   E N +F + +  +  ++IEG YPN + +I     +KV + ++ L+ AL R ++I SS+  S++KL      + +S    D   S E             I   + FL+ +L     D + +E +D
  S:     1 MKFIVSSTALSSHLQAISRVINSKNALPILDCFLFELEDGTLSVTVSDSETTMVTTVEVNESDTN----GRFAVVAKTLLDALKEIPEQPLTFYVNTDNYEITVQYQNGKYSLMGQNADEFPQSAVLGENAVRVEMEAGVLLGGINRSVFATADDELR-PVMNGIYFDITTEDITM--VASDGHKLVRCKTLAAKGNERAAFILPKKPATLLKNLLPKEQGTVTIEFDERNAVFMLESYRMVCRLIEGRYPNYNSVIPQNNPHKVTVDRQQLIGALRR-VSIFSSQASSLIKLRMQENQIVISAQDIDFSTSAEETQVCQYSGAAMSIGFKSTFLIDILNNISADEVVIELAD 345
>gi|90019651|ref|YP_525478.1| DNA polymerase III subunit beta [Saccharophagus degradans 2-40] >gi|89949251|gb|ABD79266.1| DNA polymerase III, beta subunit [Saccharophagus degradans 2-40] (367 aa)
Score = 185, Expect = 5.0e-12, Identities = 78/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVS-------LIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK IVS+  ++  L+L   + E   + PV    LI +   ++  T ++  +    IV +      + +G I +  K F  I   L +  +    +D+  + VK+      ++ +   ++P +    ND N  S      K+ I +  +A+     +   ++G+ +   +    L +++TDG++LA     + P +  +   V        +IEL   + D + N+E+ +  ++I    +     SK+++G +P+  R++    +  V   +  L +A  R  AI S+EK   V+L   +  L +  ++ +   +++ V+ + +  +   +  N  +L  +    D D I +  SDS    LL + ++ + + +++P+R
  S:     1 MKFIVSRETILKPLQLVAGVVERRQTLPVLANVLIVLEGEQLSLTGTDLEVE---IVGRVTVDQAISEGEITVPAKKFLDICRALPDGSVIEFTLDDQKVTVKSGRSRFTLSSLSANEFPAVEQGSNDIN-FSCEQKEVKRLIDRTAFAMAQQDVRY-YLNGMLWEVRAG--ALRVVSTDGHRLA---MCTRPINIDVAEPVQAILPRKGVIELSRLLNDSEENVELTMGPNHIRATTTEYTFTSKLVDGKFPDYERVLPKGGDKIVLGERAVLKQAFAR-TAILSNEKYRGVRLLLETGQLTIIANNPEQEEAEDQVAVEYE-GDSIEVGFNVSYLQDVTNVLDTDKIKMTLSDSNSSALLEEPENADSVYVVMPMR 366
>gi|152977690|ref|YP_001343319.1| DNA polymerase III subunit beta [Actinobacillus succinogenes 130Z] >gi|150839413|gb|ABR73384.1| DNA polymerase III, beta subunit [Actinobacillus succinogenes 130Z] (366 aa)
Score = 185, Expect = 5.1e-12, Identities = 75/371 (20%), Positives = 166/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN--IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IVS+  L+  L+    +  +  + PV    L+++  + +  T ++  +     ++     N   +G   I  K F  I   L  + +     +     V++S    N+     E+YPN+     DW      ++S    ++ I   ++++ NN  +   ++G+ F +      L  +ATDG++LA    + E   Q+  ++L    +  L  ++D  +     + +  +N   ++ + +  SK+I+G +P+  R++       +    + L ++  R  +I SSEK   V+L  +   L ++  + +    +E +    + +EP  I  N  ++L +L       + V F+D+    L+ D +D     +++P++
  S:     1 MQFIVSRENLLKPLQQVCGVLSSRPNVPVLNNVLLQIEGDRLTITGTDLEVE----LSTQAQLNSHGEGTFTIPAKKFLDICRSLPEDAVITVDFEQDRAIVRSSRTKFNLATFPAEEYPNLT----DWQSEVDFTVSQATMRRLIEATQFSMANNDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTIELEQDLQNHSVILPRKGVLELARLLDATSEQPARVQIGTNNFRVELGSVVFTSKLIDGRFPDYRRVLPRNANRILESDWENLKQSFVRA-SILSSEKVRTVRLELNQNQLTITAKNPEQEEVEEILDVSYQ-SEPIEIGFNVSYVLDVLNALKCQRVRVRFTDASSSCLIEDCEDNTAEYVIMPMK 365
>gi|85057980|ref|YP_453682.1| DNA polymerase III subunit beta [Sodalis glossinidius str. 'morsitans'] >gi|84778500|dbj|BAE73277.1| DNA polymerase III beta subunit protein DnaN [Sodalis glossinidius str. 'morsitans'] (366 aa)
Score = 185, Expect = 5.4e-12, Identities = 75/371 (20%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK IV + +L+  L+  +S      + P+    L++V+++ +  T   G      +VA+   +   E G   +  + FF I   L         ++   + +++     +++ +    +PN++    DW    + ++S  + K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       E+ P    IV    ++EL+  +   +  +++ +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S+  L+++ ++ +   ++E +    + +E   I  N  ++L +L     + + +  +D    V + D        +++P+R
  S:     1 MKFIVEREQLLKPLQQVSSPLGGRPTLPILGNLLLQVSEDRLLLT---GTDLEMEMVAQVALSAAHEPGATTVPARKFFDICRGLPEGAEIAVTLEGERMLIRSGRSRYSLSTLPASNFPNLD----DWQSEVEFTLSQSILKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCAMSVGEALPSHSVIVPRKGVMELVRMLDGGENPVKLQIGSNNIRASVGDYIFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDVLKQAFARA-AILSNEKFRGVRLYLSANQLKITANNPEQEEAEEILDVTYQGSE-MEIGFNVSYVLDVLNALKCEEVRLLLTDGVSSVQIEDSASQAAAYVVMPMR 365
>gi|33864540|ref|NP_896099.1| DNA polymerase III subunit beta [Synechococcus sp. WH 8102] >gi|33632063|emb|CAE06516.1| DNA polymerase III beta subunit [Synechococcus sp. WH 8102] (385 aa)
Score = 184, Expect = 5.9e-12, Identities = 78/371 (21%), Positives = 183/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD-----------FRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN-FLQILVPIR 377
           MK++ S+++L  AL+L +       + PV    L+  +    + + +      +  +  S  A++   G I +  +    I+S+L ++       + S  +V+ ++   +  +  M  + YP++    +    +L  S +V  +++    +A + ++ K  +++G+  +   ++  LE  ATDG++LA  +     Q            F + L    +  +E L+     +  I +F     ++F  ++ ++ S+ +EG YPN  ++I       + + ++ LV ALER +A+ + +  ++VK +   E  V+ +S  + D+G+  E+++ +    +   I+ N  ++L  LK    D + +  +    P +LR  +D + F+ +++P++
  S:     1 MKVVCSQSELNAALQLVSRAVATRPTHPVLANVLLTADAGTDRLSLTG--FDLNLGIQTSLAASVETSGAITLPARLLGEIVSRLASDSPLTLTTEESGEQVQLNSLSGSYQMRGMPADDYPDLPMVESGLTLKLQASGLV--QALKGTLFASSGDEAK-QLLTGVHLSF--TDTNLEAAATDGHRLAVLQVNDALQAAAEGTEGEGAAFAVTLPARSLREVERLVAGWRSEDPISLFCDRGQVVFLAADQMVTSRTLEGTYPNYRQLIPDGFSRTLTMDRRALVGALER-IAVLADQHNNVVKFSSQPESGVVLISADAQDVGSGSESLAAELS-GDAIQIAFNVRYMLDGLKAMAGDRVVLHCNAPTTPAVLRPVEDGDGFIYLVMPVQ 382
>gi|193069140|ref|ZP_03050097.1| DNA polymerase III, beta subunit [Escherichia coli E110019] >gi|192957464|gb|EDV87910.1| DNA polymerase III, beta subunit [Escherichia coli E110019] (366 aa)
Score = 184, Expect = 5.9e-12, Identities = 78/371 (21%), Positives = 164/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       + P+    L++V D  +  T   G      +VA+       E G   +  + FF I   L        +++   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       +S P    IV    +IEL+  +   D  + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E +       E   I  N  ++L +L     +N+ +  +DS   V + D    +   +++P+R
  S:     1 MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT---GTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPISQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARA-AILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAE-MEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 365
>gi|90581123|ref|ZP_01236922.1| DNA polymerase III subunit beta [Vibrio angustum S14] >gi|90437644|gb|EAS62836.1| DNA polymerase III subunit beta [Vibrio angustum S14] (366 aa)
Score = 184, Expect = 6.5e-12, Identities = 77/371 (20%), Positives = 169/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES---TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+   +      S P+    L++V D  +  T ++  +   + VA   D    E G + + ++ F  I   L +        +   + +++S     +  +    +PNI     DW    + ++     ++ I   ++++ N   +   ++G+ F +    + L  +ATDG+++A    ++    P    IV    ++EL+    + ++ + I +  SNI   V+N +  SK+++G +P+  R++       V    + +  A  R  AI S+EK   V++N S+  + ++ ++ +   ++E +    +  +   I  N  ++L +L T   D + +  SD+  P L+ D  +   + +++PIR
  S:     1 MKFTVEREYLLKPLQQVAAALGGRPSLPILGNILLKVEDGCLSMTGTDLEVELIAKVALEGD---YESGTVTVPSRKFLDICRGLPSNATISVSYEGDRVLIRSSRSRYTLTTLPAADFPNIE----DWQSEVEFTLEQGRMRQLIDSTQFSMANQDVRY-YLNGMLFET--DGQHLRSVATDGHRMAVCAIDTGHELPTKQIIVPRKGVLELVRLFDNPESLVNIQIGNSNIRATVNNFVFTSKLVDGRFPDYRRVMPQNSTKFVEAGCEEMRNAFARA-AILSNEKFRGVRVNLSNGEMRITANNPEQEEAEEFLDVDYQ-GDSLEIGFNVSYVLDVLNTLKCDQVRLSLSDANAPSLIEDATNDEAMYVVMPIR 365
>gi|73539708|ref|YP_294228.1| DNA polymerase III subunit beta [Ralstonia eutropha JMP134] >gi|72117121|gb|AAZ59384.1| DNA polymerase III, beta subunit [Ralstonia eutropha JMP134] (371 aa)
Score = 184, Expect = 6.5e-12, Identities = 77/366 (21%), Positives = 176/366 (48%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNG--IISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH----YKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S+  L+  L++ + I E   + P+    LI  + + + F +++    I+TH+      D+         +  +    I+  + +  + L  +++  + V++      +  +  E++P +  +      +S+    FK  ++ V +A+     +   ++G+    +   K +  +ATDG++LA+     + E+T    R   I+   +++EL   + D D  +++ L  + + F  +N  + SK++EG +P+  R+I    +N   I +  L +AL+R  AI +++K   V+    + +L++S +++D   ++E +       +   I  N  +LL +L    ++ + V   DS    L+   +D NF  +++P+R
  S:     7 SRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVSFLSTDIEIQITTHAECGVGNDSVA-----TTVAARKLLDILRAMPDGDVALS-LNDKRMTVQSGKSRFALQTLAAEEFPTVAEASEFNASVSLPQKTFKHLLAMVHFAMAQQDIRY-YLNGMLL--VVDGKKVMAVATDGHRLAYCGVELENEATGVGSRQEVIIPRKTILELQRLLEDNDDPVQVQLAANQVKFSFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVRLQQALQR-TAILTTDKFKGVRCILDTHMLKISSTNADQEEAQEELEIDYS-GDALDIGFNVTYLLDVLANLKSEQVQVSLGDSNSSALITVPEDDNFKYVVMPMR 370
>gi|113953564|ref|YP_729240.1| DNA polymerase III subunit beta [Synechococcus sp. CC9311] >gi|113880915|gb|ABI45873.1| DNA polymerase III, beta subunit [Synechococcus sp. CC9311] (385 aa)
Score = 184, Expect = 7.0e-12, Identities = 76/371 (20%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLI--EVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV--IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----------STPQDFRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD-EKDPNFLQILVPIR 377
           MK++ S+ +L  AL+L +    +  + PV    L+  +   + +  T  +  +   + +A S D +    G + +  +    I+SKL ++       D     +++ +S+    +  M  + +P +    N    L + P    K++    +A + ++ K  +++G+      ++K LE  +TDG++LA    E           S P +  + L    +  +E L+        + +F     ++   ++ ++ S+ +EG YPN  ++I       +++ ++  + ALER +A+ + +  ++V++    ++ ++++S  + D+G+  E  S   ++N +   I+ N  ++L  LK  D D + +  +    P +L     DP    +++P++
  S:     1 MKLVCSQAELNAALQLVSRAVASRPTHPVLANVLLTADAGTDRLSLTGFDLNLGIQTSLAASVDTS----GAVTLPARLLGEIVSKLSSDSPVSLSSDAGADQVELTSSSGSYQMRGMPADDFPELPLVENG-TALRVDPASLLKALRATLFASSGDEAK-QLLTGVHLRF--NQKRLEAASTDGHRLAMLTVEDALQAEISAEESEPDELAVTLPARSLREVERLMASWKGGDPVSLFCERGQVVVLAADQMVTSRTLEGTYPNYRQLIPDGFSRTIDLDRRAFISALER-IAVLADQHNNVVRIATEPATGLVQISADAQDVGSGSE--SLPAEINGDAVQIAFNARYVLDGLKAMDCDRVRLSCNAPTTPAILTPANDDPGLTYLVMPVQ 382
>gi|30065009|ref|NP_839180.1| DNA polymerase III subunit beta [Shigella flexneri 2a str. 2457T] >gi|56480410|ref|NP_709499.2| DNA polymerase III subunit beta [Shigella flexneri 2a str. 301] >gi|110807609|ref|YP_691129.1| DNA polymerase III subunit beta [Shigella flexneri 5 str. 8401] >gi|30043270|gb|AAP18991.1| DNA polymerase III, beta-subunit [Shigella flexneri 2a str. 2457T] >gi|56383961|gb|AAN45206.2| DNA polymerase III, beta-subunit [Shigella flexneri 2a str. 301] >gi|110617157|gb|ABF05824.1| DNA polymerase III, beta-subunit [Shigella flexneri 5 str. 8401] (366 aa)
Score = 184, Expect = 7.0e-12, Identities = 78/371 (21%), Positives = 164/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       + P+    L++V D  +  T   G      +VA+       E G   +  + FF I   L        +++   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       +S P    IV    +IEL+  +   D  + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E +       E   I  N  ++L +L     +N+ +  +DS   V + D    +   +++P+R
  S:     1 MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT---GTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNLLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARA-AILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAE-MEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 365
>gi|77976617|ref|ZP_00832096.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Yersinia intermedia ATCC 29909] (366 aa)
Score = 184, Expect = 7.2e-12, Identities = 80/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ +  L+  L+  +S      + P+    L++V +  +  T   G      +VA+   +N   +G   +  + FF I   L         +D   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       ++ P    IV    ++EL+  +   DT + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS +G   E   I  N  ++L +L     +++ +  +DS   V + D        +++P+R
  S:     1 MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLT---GTDLEMEMVARVALSNPHTQGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARA-AILSNEKFRGVRLYVSHNQLKITANNPEQEEAEEILDVSYEGTEME---IGFNVSYVLDVLNALKCEDVRLLLTDSVSSVQIEDGASQAAAYVVMPMR 365
>gi|121607000|ref|YP_984329.1| DNA polymerase III, beta subunit [Polaromonas naphthalenivorans CJ2] >gi|120595969|gb|ABM39408.1| DNA polymerase III, beta subunit [Polaromonas naphthalenivorans CJ2] (368 aa)
Score = 184, Expect = 7.3e-12, Identities = 80/366 (21%), Positives = 168/366 (45%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K +  L+    I E   + P+    LI     +++ TTS+    I +T  +     D       R LI       + S   ++ ++LE   N +I +K       +  +  E +P +  + +     S+   V K+ +++V +A+  +  +   ++GI F  ++  K L ++ATDG++LA          P+   I+   +++E+   + D +  IE+    +   F        +K++EG +P+ +R+I    +N + + +  L+ +L+R  AI +SEK   V+LN     L V+ ++++   + + +       +   I  N  +L+  L   + D + +E +DS    LL    +  F  +++P+R
  S:     7 TQDKFLGVLQSVAGIVERRHTLPILANVLIRKTGAQLQLTTSDLEIQIRTTAELDGDEGDFTTTVGARKLIDV-----LRSMPSDQTVSLESAQNKLI-LKGGKSRFTLQTLPAEDFPLVQEAASFGPVFSVPQKVLKELLNQVSFAMAVHDIRY-YLNGILF--VAEGKQLSLVATDGHRLAFSSATLDVEVPKQEVILPRKTVLEMQRLLSDKEGAIEMQFAGNQAKFSFEGMEFVTKLVEGKFPDYNRVIPKNHKNIITLGRAPLLASLQR-TAILTSEKFKGVRLNIEPGTLRVASNNAEQEEAVDELDIDYD-GDAIEIGFNVTYLIDALNNMNQDMVKIELADSNSSALLTIPDNAAFKYVVMPMR 367
>gi|90421530|ref|YP_529900.1| DNA polymerase III subunit beta [Rhodopseudomonas palustris BisB18] >gi|90103544|gb|ABD85581.1| DNA polymerase III, beta subunit [Rhodopseudomonas palustris BisB18] (372 aa)
Score = 184, Expect = 7.3e-12, Identities = 75/371 (20%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIAT--DGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V + +L+ +L   + + E   + P+    L+      +    ++  +     V ++  A     G   +    F+ I+ KL +   I LE   + +V+ ++       +  + E  +P++  +    +  +++    K+ I + ++A++  + +   ++GI  +   +     + A   DG++LA         +      IV   ++ E+   I D +  + I L    I F + + ++ SK+I+G +P+  R+I    + ++ + KK    A++R ++  SSE+   VKL  S+  L +S ++ D G++ E +  +   ++   I  N+ +LL +    + +   ++ +D   P L++D      L +L+P+R
  S:     1 MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLLRAEKGRLSLKATDLDLE----VTETLPAETATGGSTTVPAHMFYDIVRKLPDGSQIVLESDGERAVLAIRAGRSRFTLQTLPENDFPDLA-AGEMTHSFTLTAADVKRLIDRTQFAISTEETRY-YLNGIYLHGAGTAAAATLRAVATDGHRLAQVDLPLPSGAAGMPGVIVPRKTVGEVQRLIEDTEAAVGIELSVGKIRFTLGDVVLTSKLIDGTFPDYGRVIPQNNDKELVVDKKDFEAAVDR-VSTISSERGRAVKLALSAGKLVLSVTNPDSGSATEELEVE-YASDALDIGFNSRYLLDIAAQIEGEVAVLKLADPGSPTLVQDRDAKGALYVLMPMR 371
>gi|77973771|ref|ZP_00829316.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Yersinia frederiksenii ATCC 33641] (366 aa)
Score = 184, Expect = 7.4e-12, Identities = 80/371 (21%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ +  L+  L+  +S      + P+    L++V +  +  T ++  +   + VA S+      +G   +  + FF I   L         +D   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       ++ P    IV    ++EL+  +   DT + + +  +NI   V + I  SK+++G +P+  R++    +  +  S   L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS  G   E   I  N  ++L +L     +++++  +DS   V + D        +++P+R
  S:     1 MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALSQPHT---QGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPVGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLKASCDLLKQAFARA-AILSNEKFRGVRLYVSQNQLKITANNPEQEEAEEILDVSYDGAEME---IGFNVSYVLDVLNALKCEDVSLLLTDSVSSVQIEDGNSQAAAYVVMPMR 365
>gi|42630172|ref|ZP_00155716.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Haemophilus influenzae R2846] (366 aa)
Score = 184, Expect = 7.5e-12, Identities = 81/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE---MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  +S+  L+  L+    +  N  + PV    L+++ DN +  T ++  +   S    S  +   E G   I  K F  I   L ++    +T E+ D ++++   S F   +     E+YPN+     DW       +     ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E   Q+  ++L    ++EL+  +   D    + +  +N+   + NT+  SK+I+G +P+  R++       V  S + L +A  R  +I S+E+   V+L+     L+++ S+++   ++E V       E   +  N  ++L +L     + + +  +D+F   L+ + +D +   +++P+R
  S:     1 MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLSSSS---ENGTFTIPAKKFLDICRTLSDDSEITVTFEQ-DRALVQSGRSRF--TLTTQPAEEYPNLT----DWQSEVDFQLPQNTLRRLIESTQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTISLEQELQNHSVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTSKLIDGRFPDYRRVLPRNATKIVEGSWEMLKQAFVRA-SILSNERARSVRLSLKENQLKITASNTEHEEAEEIVDVNYN-GEELEVGFNVTYILDVLNALKCNQVRMRLTDAFSSCLIENCEDSSSEYVIMPMR 365
>gi|68249577|ref|YP_248689.1| DNA polymerase III subunit beta [Haemophilus influenzae 86-028NP] >gi|68057776|gb|AAX88029.1| DNA polymerase III, beta chain [Haemophilus influenzae 86-028NP] (366 aa)
Score = 183, Expect = 8.6e-12, Identities = 80/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE---MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  +S+  L+  L+    +  N  + PV    L+++ DN +  T ++  +   S    S  +   E G   I  K F  I   L ++    +T E+ D ++++   S F   +     E+YPN+     DW       +     ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E   Q+  ++L    ++EL+  +   D    + +  +N+   + NT+  SK+I+G +P+  R++       V  + + L +A  R  +I S+E+   V+L+     L+++ S+++   ++E V       E   +  N  ++L +L     + + +  +D+F   L+ + +D +   +++P+R
  S:     1 MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLSSSS---ENGTFTIPAKKFLDICRTLSDDSEITVTFEQ-DRALVQSGRSRF--TLTTQPAEEYPNLT----DWQSEVDFQLPQNTLRRLIEATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTISLEQELQNHSVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTSKLIDGRFPDYRRVLPRNATKTVEGNWEMLKQAFVRA-SILSNERARSVRLSLKENQLKITASNTEHEEAEEIVDVNYN-GEELEVGFNVTYILDVLNALKCNQVRMRLTDAFSSCLIENCEDSSCEYVIMPMR 365
>gi|146295087|ref|YP_001178858.1| DNA polymerase III, beta subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408663|gb|ABP65667.1| DNA polymerase III, beta subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (367 aa)
Score = 182, Expect = 1.0e-11, Identities = 83/371 (22%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD--FRIVLDVSLIELLLEIIDFD--TNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ +V K+ L + +      + +   + V    LIE  D  + FTT++  +   +       A ILE+G  L+K K    I+ KL +  I + + DN V K++    +  +  +D   +P ++    D +    +   F+ ++ KV +A + ++ +    +G+ F       ++ ++  DG++LA  K +    D  F  ++    ++ + +IID +    + +  FE+  +F++ +T +   +I G + +   +I T    K++IS   L   LER   +S  EK ++  + F  S  +  V   S+D G  +E V C  +  +   I  N  + L +LK  D   + +  +    P +++ + D  ++ +++P++
  S:     1 MRFVVDKSTLQDNISKVIPAAASTKVTSVLECVLIEAED-VVVFTTNDMRMQMQT----EFQAEILERGAALVKAKLLSDIVKKLPSGDIEIIREDNEV-KIRCQKIEFRLPTLDPLDFPKMDRKPID-SFCEFAANEFEDAMDKVIFATSKDETR-PTFTGVLFE--REGDSVNLVGMDGHRLAICKLKPIEVDGEFSKIVPAENLDDITKIIDIEEAEKVRVSFFENQALFEIGSTSVIVTLISGRFFDYKNVIPTEYSTKISISADVLESTLERASIVSKDEKTNVQAVIFEVSGMMFRVMSYSTD-GRYEEDVLCDVE-GKDIRIGFNVKYFLDVLKVLDG-GVDIYITSLTSPSVVKQQGDEGYIYLVLPVK 364
>gi|52424541|ref|YP_087678.1| DNA polymerase III subunit beta [Mannheimia succiniciproducens MBEL55E] >gi|52306593|gb|AAU37093.1| DnaN protein [Mannheimia succiniciproducens MBEL55E] (370 aa)
Score = 182, Expect = 1.1e-11, Identities = 80/375 (21%), Positives = 179/375 (47%)
  Q:     3 KDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILE--KGRILIKTKPFFAIISKLKNEM---ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++  M+ IVS+  L+  L+    +  +  + PV    L+++ D+ +  T       T   V  S  A ++   +G+  I  K F  I   L +E    +T E+ + ++++   + F  N+  +  E+YPN+     DW      +      ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E   Q+  +++    ++EL  LLE  D    ++I    +N+  +++N +  SK+I+G +P+  R++    ++ +      L +A  R  AI S+E+   V+L      ++++ ++ +   ++E +      NE   +  N  ++L +L       + +  +D+    L+ + +D +   +++P+R
  S:     2 RERAMQFIVSRDNLLKPLQQVCGVLSSRPNIPVLNNVLLQIADDCLTIT------GTDLEVELSTQAKLISGTEGKFTIPAKKFLDICRSLPDEAEIHVTFEE-ERAIVRSARTKF--NLATLPAEEYPNLA----DWQSEVDFTTEQATLRRLIEATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTIALEQDLQNHSVIVPRKGVLELARLLEATDAPARLQIG--TNNLRVQLANVVFTSKLIDGRFPDYRRVLPRNADHILEADWDVLKQAFVRA-AILSTERFRSVRLQLDQNQMKITATNPEQEEAEEIIDVSYSGNE-MEVGFNVSYILDVLNALKCQRVRMRLTDASSSCLIENCEDASAEYVIMPMR 369
>gi|85057282|ref|YP_456198.1| DNA polymerase III, beta subunit [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789387|gb|ABC65119.1| DNA polymerase III, beta subunit [Aster yellows witches'-broom phytoplasma AYWB] (378 aa)
Score = 182, Expect = 1.2e-11, Identities = 78/343 (22%), Positives = 164/343 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDF--DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF---SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           P+F    I+  +N++    +NG I+   I  K +   I ++G+I    + F  II K+ + +I +  ++N+ + +KT   +  + +MD   +  ++FS+   +   I    FK  I +V  + + N+++  +M     N I     L+  ATD ++++  K   +    +F IV+    +E L +I++     +++I+     I  ++ N    + ++EG+YP +  I  T     ++++K  L++ALER   +   E+ +   + F       +E+S SS  LG + E +           I+ N  +L  +LK      +   F +  KP ++   +  + + +++PI
  S:    28 PIFNALKIQTQENKLILEANNGNIAI-KIEIKDKSLKIKKQGKIACLGRYFIEIIKKINDSLIKITVMENNFLVIKTIFCEYKLKLMDVCNFLELDFSFQKLDFFQIETHFFKNIIKEVNISTSKNEKRPILMG---LNLIYQNNLLKACATDFFRMSQKKINLDIKYHNFNIVIPNKSLEELSKILEHCQSKHLKIYSDAQKIFLEIDNLWFQTSLLEGNYPQIQEIKLTNFPFSIHLNKDDLMKALERVSLLFYKEQINTNVIKFILTERNSIEISSSSESLGTALEKIIPLKVSANSFQIAFNAKYLEDVLKVLSVKEVVFYFDNPLKPFIITTLEKDSSIHLILPI 373
>gi|116326857|ref|YP_796577.1| DNA-directed DNA polymerase, beta subunit [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116329804|ref|YP_799522.1| DNA-directed DNA polymerase, beta subunit [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116119601|gb|ABJ77644.1| DNA-directed DNA polymerase, beta subunit [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116123493|gb|ABJ74764.1| DNA-directed DNA polymerase, beta subunit [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (373 aa)
Score = 182, Expect = 1.2e-11, Identities = 90/371 (24%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE--MITLEKVD--NSVIKVKTST----FDSNINIMDEEQYPNINFSYNDWNQLSISPI-VFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST---PQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI V+ +  + A+     +        +     +E  + E+  + ++  IS    +  S  A +++ G I +  K   +    +  E  +++LE+ D  +S++ +  ++    + S I+ MD E+   I  S    +Q+S  P  +    I K  YA+ +  ++  I +G+    I     L  + TDG +L   K E T   P  F+  I++    +  + ++I       + L +S I    +N  +  K+IEG++PN  ++I    +  + ISK+    +L R +  ++ E    VKL FS   L  +  +  LG S+  ++   + +     I+    +L+ + ++ D++ I +EFSDS  PV+ +D  DP F+ +++P++
  S:     1 MKIKVNTSDFLKAIHAVEGVISAREIKSILSNLKVEAEEKEVFLSATDLEIS----IKTSLSAEVIQAGSISLPAKQLSSFFKTIHFEETILSLEESDGDSSIVYITDASGKNDYKSKISGMDAEEIKTI--SKVSPSQISSFPSNLINDMIRKTSYAIAHEDQRF-IFNGLYM--IPDGNKLTFVGTDGRRLC--KIERTLPSPLQFKDSIIVPAKAVREISKMIATSETGNLGLIDSQIYASANNIELLCKLIEGNFPNYEQVIPKSTKFSITISKEEFQVSL-RQVLTAAEEPSRQVKLTFSKNNL--NLFAQTLGASEANINRPIEYSGNEIAIAFKGEYLMDIFRSIDDNEIKIEFSDSSSPVIFKDPSDPEFISVIMPMK 372
>gi|94967033|ref|YP_589081.1| DNA polymerase III, beta subunit [Acidobacteria bacterium Ellin345] >gi|94549083|gb|ABF39007.1| DNA polymerase III, beta subunit [Acidobacteria bacterium Ellin345] (371 aa)
Score = 182, Expect = 1.3e-11, Identities = 76/371 (20%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHY-----KFESTPQDFRIVLDVSLIELLLEIIDFDT-NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN---FLQILVPIR 377
           M+I VSK  L+  L     + E   + P+    L E   +++  T ++  +S  +         + ++G   I  +  +  +  L +  IT++ ++N  + +++   ++ +  M    +P++   +     + I     +  I K  +A++N + +  +   +    +   ++L +++TDG++LAH      KFE + +   +V   ++ EL   +   +T +IE    ES + F++   ++ S+ + G +PN   ++    +  V I     + A+ R +A  + E+   +K+    + L +S SS++ G S++++       E   I  N+ +L+  LK    D + +EF ++     LR E   +   +  +++P+R
  S:     1 MEITVSKFDLLKELTATQGVVERKTTIPILSNFLFEAVGDKLNITATDLDLSLRTACV----TKVKKEGSCTIPARKLYDYVKLLPDGDITIKLLENHWVNIRSGRSNTKMVGMARSNFPSLPV-FPTTGMVKIPAAALRTMIGKTIFAISNEESRYTLNGALM---VLKPESLIMVSTDGHRLAHIERQGGKFEISGEMKTLVPKKAMSELYSLLQSTETEDIEFAKDESTLFFRIGGRLLTSRQLTGQFPNYEAVLPKDNDKSVTIRTDEFMAAILR-VAQFADERSQAIKVRLEKDELRISSSSTETGESEDSI-VTAYTGEVVTIGFNSQYLIEFLKAAGADEVRLEFKNAQSAGQLRPEATSDEFKYRYVVMPMR 370
>gi|46133231|ref|ZP_00156851.2| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Haemophilus influenzae R2866] (366 aa)
Score = 182, Expect = 1.3e-11, Identities = 81/371 (21%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE---MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  +S+  L+  L+    +  N  + PV    L+++ DN +  T ++  +   S    S  +   E G   I  K F  I   L ++    +T E+ D ++++   S F   +     E+YPN+     DW       +     ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E   Q+  ++L    ++EL+  +   D    + +  +N+   + NT+  SK+I+G +P+  R++       V  + + L +A  R  +I S+E+   V+L+     L+++ S+++   ++E V       E   +  N  ++L +L T   + + +  +D+F   L+ + +D +   +++P+R
  S:     1 MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTITGTDLEVELSSQTQLSSSS---ENGTFTIPAKKFLDICRTLSDDSEITVTFEQ-DRALVQSGRSRF--TLTTQPAEEYPNLT----DWQSEVDFELPQNTLRRLIESTQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTISLEQELQNHSVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTSKLIDGRFPDYRRVLPRNATKIVEGNWEMLKQAFVRA-SILSNERARSVRLSLKENQLKITASNTEHEEAEEIVDVNYN-GEELEVGFNVTYILDVLNTLKCNQVRMCLTDAFSSCLIENCEDSSCEYVIMPMR 365
>gi|50083299|ref|YP_044809.1| DNA polymerase III, beta chain [Acinetobacter sp. ADP1] >gi|49529275|emb|CAG66987.1| DNA polymerase III, beta chain [Acinetobacter sp. ADP1] (382 aa)
Score = 181, Expect = 1.4e-11, Identities = 78/371 (21%), Positives = 173/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE-MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLD------VSLIELLLEIIDFDTNIEIFLFESNIIFKVSN---------TIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++ ++K  L+N L       E   +  +     I+ N   +  T S+  +   +    +E A I E G   +  +    I   L +  +I L+  ++    +K+      +  +  E YP +    +   Q+ ++    K+   K  +A+     +   ++G        +  L  + TDG++LA  + +++    + V        V  ++ LL I D   ++ I     N+   ++N             +K+I+G +P+  R+I    +  V I+     ++L+R +AI S+EK   V LNF+ +VL++  ++ +   + E ++ + + +    +S N  +LL +L   D D++++  +++ + VL++D   P+   +++P+R
  S:     1 MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQANAQALTITGSDLEVELVASTTLAEGACI-EAGETTVPARKLVDICKSLPSAALIDLQITEDQRCILKSGNSRFVLGTLPAEDYPLLTTESSQGTQVQVTQRELKRLFEKTSFAMAVQDVRF-YLTGTLLEI--DQNQLRAVTTDGHRLALCEVQASSTAMQAVQAIVPRKAVGELQRLLSIEDDQLSLLIGRELLNVTINIANRDKEQHPITVRFTTKLIDGKFPDYRRVIPRGGDKHVQIAHDVFKQSLQR-VAILSNEKLRGVFLNFNPDVLQLRANNPEQDEAIEDIAIQYQ-DASLEMSFNAQYLLDVLSVLDGDDVSMSMTEANQSVLVQDAAHPDQTYVVMPMR 381
>gi|89074701|ref|ZP_01161159.1| DNA polymerase III subunit beta [Photobacterium sp. SKA34] >gi|89049465|gb|EAR55026.1| DNA polymerase III subunit beta [Photobacterium sp. SKA34] (366 aa)
Score = 181, Expect = 1.6e-11, Identities = 76/371 (20%), Positives = 168/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES---TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+   +      S P+    L++V D  +  T ++  +    ++AK       E G + + ++ F  I   L +        +   + +++S     +  +    +PNI     DW      ++     ++ I   ++++ N   +   ++G+ F +    + L  +ATDG+++A    ++    P    IV    ++EL+    + ++ + I +  SNI   V+N +  SK+++G +P+  R++       V    + +  A  R  AI S+EK   V++N S+  + ++ ++ +   ++E +    +  +   I  N  ++L +L T   D + +  SD+  P L+ D  +   + +++PIR
  S:     1 MKFTVEREYLLKPLQQVAAALGGRPSLPILGNILLKVEDGCLSMTGTDLEVE---LIAKVVLEGDYESGTVTVPSRKFLDICRGLPSNATISVSYEGDRVLIRSSRSRYTLTTLPAADFPNIE----DWQSEVAFTLEQGRMRQLIDSTQFSMANQDVRY-YLNGMLFET--DGQHLRSVATDGHRMAVCAIDTGHELPTKQVIVPRKGVLELVRLFDNPESLVNIQIGNSNIRATVNNFVFTSKLVDGRFPDYRRVMPQNSTKFVEAGCEEMRNAFARA-AILSNEKFRGVRVNLSNGEMRITANNPEQEEAEEFLDVDYQ-GDSLEIGFNVSYVLDVLNTLKCDQVRLSLSDANAPSLIEDATNDEAMYVVMPIR 365
>gi|15805043|ref|NP_293727.1| DNA polymerase III, beta subunit [Deinococcus radiodurans R1] >gi|6457660|gb|AAF09595.1|AE001864_1 DNA polymerase III, beta subunit [Deinococcus radiodurans R1] (393 aa)
Score = 181, Expect = 1.6e-11, Identities = 73/359 (20%), Positives = 154/359 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE---KTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSC-KGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEK 365
           MK  V+K  L   L L   +  +  S+P+     +E ++  +  + +N  I     V     A + +    ++    F  I+  L  E++ LE +    + V++   D  +   D E YP ++F       +S+      ++ S V+YA +N   +        F  I  E   ++  ++A+DGY++A   F ++     +++    ++ L+ ++  D        +  +        +  K+++GD+P+  R+I    + +V +    L EA+ R   ++     + V+   S   L ++ +  D G +++T+S  +G   +   ++ N   +L  L   D D   + FS S  P + R  +
  S:     2 MKANVTKKTLNEGLGLLERVIPSRSSNPLLTALKVETSEGGLTLSGTNLEIDLSCFVP----AEVQQPENFVVPAHLFAQIVRNLGGELVELE-LSGQELSVRSGGSDFKLQTGDIEAYPPLSFPAQ--ADVSLDGGELSRAFSSVRYAASNEAFQA------VFRGIKLEHHGESARVVASDGYRVAIRDFPASGDGKNLIIPARSVDELIRVLK-DGEARFTYGDGMLTVTTDRVKMNLKLLDGDFPDYERVIPKDIKLQVTLPATALKEAVNRVAVLADKNANNRVEFLVSEGTLRLA-AEGDYGRAQDTLSVTQGGTEQAMSLAFNARHVLDALGPIDGD-AELLFSGSTSPAIFRARR 348
>gi|75761787|ref|ZP_00741722.1| DNA polymerase III, beta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490720|gb|EAO54001.1| DNA polymerase III, beta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (273 aa)
Score = 180, Expect = 1.8e-11, Identities = 59/247 (23%), Positives = 131/247 (53%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDAN----ILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE----STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERG 280
           P+  G  +   +  +  T S+  IS  S +   ED      I + G I+++ K F  I+ KL  + + +   ++ + K+K+   + N+N +D  +YP +     + +   I   + K  I +  +AV+ ++ +  I++G+ +   +SE  L  IATD ++LA  K +    +   +F+   ++   SL EL   + + +  ++I + E  ++F+  + +  S+++EG+YP+ +R+I    +  + ++ K  ++A++R 
  S:    11 PILTGIKVVATEEGVTLTGSDADISIESFIPVEEDGKEIVEIAQSGSIVLQAKYFSEIVKKLPKDTVEISVENHFMTKIKSGKSEFNLNGLDSAEYPLLP-QIEEHHVFKIPTDLLKHMIRQTVFAVSTSETR-PILTGVNWKVYNSE--LTCIATDSHRLALRKAKIEGHNIADEFQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRA 264
>gi|16767122|ref|NP_462737.1| DNA polymerase III subunit beta [Salmonella typhimurium LT2] >gi|167992431|ref|ZP_02573529.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168242057|ref|ZP_02666989.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168473087|ref|ZP_02702110.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194444384|ref|YP_002043087.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449346|ref|YP_002047870.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|3915668|sp|P26464|DPO3B_SALTY DNA polymerase III subunit beta >gi|2653647|gb|AAB87631.1| DNA polymerase III beta clamp subunit [Salmonella typhimurium] >gi|16422411|gb|AAL22696.1| DNA polymerase III, beta-subunit [Salmonella typhimurium LT2] >gi|194403047|gb|ACF63269.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407650|gb|ACF67869.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (366 aa)
Score = 180, Expect = 1.8e-11, Identities = 80/371 (21%), Positives = 166/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       + P+    L++V D  +  T   G      +VA+   +   E G   +  + FF I   L        +++   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +  SE  L  +ATDG++LA        S P    IV    +IEL+  +   +  + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS  G   E   I  N  ++L +L     + + +  +DS   V + D    +   +++P+R
  S:     1 MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT---GTDLEMEMVARVTLSQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATMKRLIESTQFSMAHQDVRY-YLNGMLFETEGSE--LRTVATDGHRLAVCSMPLEASLPSHSVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARA-AILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVSYGGTEME---IGFNVSYVLDVLNALKCETVRIMLTDSVSSVQIEDAASQSAAYVVMPMR 365
>gi|16762488|ref|NP_458105.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143976|ref|NP_807318.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415710|ref|YP_152785.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182325|ref|YP_218742.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161505632|ref|YP_001572744.1| DNA polymerase III subunit beta [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161616955|ref|YP_001590920.1| DNA polymerase III subunit beta [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167548873|ref|ZP_02342632.1| hypothetical protein Sentente_00090 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167555697|ref|ZP_02348715.1| hypothetical protein Sententeri_02345 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168219979|ref|ZP_02645211.1| hypothetical protein Senterenterica_06301 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168225003|ref|ZP_02650234.1| hypothetical protein Sententeric_04473 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168233392|ref|ZP_02658450.1| hypothetical protein Sententerica_20570 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168260378|ref|ZP_02682351.1| hypothetical protein Salmentericaenterica_04790 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464832|ref|ZP_02698724.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168818303|ref|ZP_02830303.1| hypothetical protein Salentericaenterica_02871 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194471413|ref|ZP_03077397.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|25288590|pir||AB0958 DNA polymerase III beta-chain [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504793|emb|CAD03158.1| DNA polymerase III beta-subunit [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139612|gb|AAO71178.1| DNA polymerase III beta-subunit [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129967|gb|AAV79473.1| DNA polymerase III beta-subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129958|gb|AAX67661.1| DNA polymerase III, beta-subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|160866979|gb|ABX23602.1| hypothetical protein SARI_03808 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161366319|gb|ABX70087.1| hypothetical protein SPAB_04776 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194457777|gb|EDX46616.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|195632425|gb|EDX50909.1| DNA polymerase III, beta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (366 aa)
Score = 180, Expect = 2.0e-11, Identities = 80/371 (21%), Positives = 166/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       + P+    L++V D  +  T   G      +VA+   +   E G   +  + FF I   L        +++   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +  SE  L  +ATDG++LA        S P    IV    +IEL+  +   +  + + +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS  G   E   I  N  ++L +L     + + +  +DS   V + D    +   +++P+R
  S:     1 MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT---GTDLEMEMVARVTLSQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRY-YLNGMLFETEGSE--LRTVATDGHRLAVCSMPLEASLPSHSVIVPRKGVIELMRMLDGGENPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDILKQAFARA-AILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVSYGGTEME---IGFNVSYVLDVLNALKCETVRIMLTDSVSSVQIEDAASQSAAYVVMPMR 365
>gi|15603025|ref|NP_246097.1| DNA polymerase III subunit beta [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721508|gb|AAK03244.1| DnaN [Pasteurella multocida subsp. multocida str. Pm70] (366 aa)
Score = 180, Expect = 2.0e-11, Identities = 84/371 (22%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGII--STHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM---ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IVS+  L+  L+    +  +  + PV    L+++    +  T ++  +  ST + + +++      +G   I  K F  I   L  E    ++ E+ D +++K   S F  N++ +  E+YPN+     DW      ++     ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E   Q   ++L    ++EL  LLE  D    ++I    +N+   + N I  SK+I+G +P+  R++       +      L +A  R  AI S+E+   V+L  S   L+++ ++ +   ++E +     V E   +  N  ++L +L       + +  +D+    L+ D  D +   +++P+R
  S:     1 MQFIVSRENLLKPLQQVCGVLSSRPNIPVLNNVLLQIRGERLVITGTDLEVELSTETALLRTD-----VQGSFTIPAKKFLDICRSLPEEAEISVSFEE-DRAIVKSGRSKF--NLSTLPAEEYPNLT----DWQSEVDFTLEQSTLRRLIEATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTIALEQDLQTHSVILPRKGVLELVRLLENTDLPARLQIG--TNNLRIDLGNIIFTSKLIDGRFPDYRRVLPRNATRILEAEWDVLKQAFVRA-AILSNERFRSVRLQLSENQLKITATNPEQEVAEEIIDVS-YVGEEMEVGFNVSYILDVLNALKCQRVRMRLTDASSSCLIEDCDDASAEYVIMPMR 365
>gi|117923320|ref|YP_863937.1| DNA polymerase III, beta subunit [Magnetococcus sp. MC-1] >gi|117607076|gb|ABK42531.1| DNA polymerase III, beta subunit [Magnetococcus sp. MC-1] (376 aa)
Score = 179, Expect = 2.8e-11, Identities = 71/371 (19%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKT--------LEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  VS+   + AL+   S+ E   + P     L+E +   +  T ++  +S  S       A +   G I +  +  F I+ +L  + + L       + +        +  +  + +P            ++S     + I+K  +A++ ++ +   ++GI  + +S+           + I+ATD ++LA  +        +   +++    ++ + ++++ D   +E+ L E+ I       ++ SK++ G +PN  R+I T   + + + K+ L   ++R + + S EK   +++  SS+ ++VS  + +   ++E + C     + T +  N  +L  ++   + D + ++  D   PVL+ +     +L +L+P+R
  S:     1 MEFHVSREPFLKALQRLQSVVEKRNTMPELGNALLEASAEGLTLTATDLEVSMKSHCP----AEVESSGAIAVSARKLFEIVRELPQDSLRLRSEAGERLVLTCGRARFTLVGIRADIFPPFP-ETTQGQSFTLSGPRLAEMIAKTHFAMSQDETRYT-LNGILLHLVSAADAELAGENGLVRIVATDTHRLAMAEMALDIPVEESAELIIPRKGVQEIRKLVEEDDEAVELGLDENFIRVSKPGIVLTSKLVSGRFPNYQRVIPTDNPHLLELEKEPLFGVVKR-MMVLSHEKSRGIRMALSSDHIKVSAQNPEQEAAEEEMPCSFAGKDMT-VGFNARYLQEIVSVANGDTVRMKLRDEESPVLVEEHSATGYLYVLMPMR 375
>gi|91214601|ref|ZP_01251574.1| DNA polymerase III, beta chain [Psychroflexus torquis ATCC 700755] >gi|91187028|gb|EAS73398.1| DNA polymerase III, beta chain [Psychroflexus torquis ATCC 700755] (364 aa)
Score = 179, Expect = 2.8e-11, Identities = 68/338 (20%), Positives = 156/338 (46%)
  Q:    16 LINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD--FRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           ++  L+    +  N  + P+    L E++ N +K + S+      + +  + D    ++G+I +  +     +     + +T  K+DN  I++ +      +   + E +P+   S  D +Q  +   +   +I+K  +A  N+  +  +M+G+ F    + + L  + TD +KL  Y       D     ++    + LL  ++   + +++I   ESN  F   N  +  ++++G YPN   +I     N + I +   + ++ R ++I S++    ++L  +   L +S    D  N ++E ++C  + ++ T I  N+ FL  +L   ++++I ++ S
  S:     1 MLKNLQTLGGVINNNNTMPILDNFLFELDHNSLKISASD----LETTMCSALDVESSDQGKIAVPARLLLDTLKSFPEQPLTFHKLDNHTIEISSEQGKYALAYANAEDFPS-PVSIEDPSQTILVGDILATAINKTIFATGNDDLR-PVMNGVFFRF--TPEALIFVGTDAHKLVKYSRTDIKADKPAEFIMPKKPLNLLKGVLLGSEEDVQIEFNESNAKFSFENLELTCRLVDGKYPNYEAVIPQENPNTLTIDRSLFLSSVRR-VSIFSNKTTHQIRLKIAGAELNISAEDLDYSNKAEERLTCDYQGDDLT-IGFNSKFLTEMLNNLNSEDIKIKMS 332
>gi|81251085|gb|ABB69885.1| DNA polymerase III beta chain [Nitrosospira sp. NIJS18] (369 aa)
Score = 178, Expect = 3.6e-11, Identities = 86/371 (23%), Positives = 181/371 (48%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE-MITLEKVDNSVI-KVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L++   I E   + P+    LIE     I F  ++  I   +    S D +  E+  + +  K    I+  L ++  + LE  +N ++ K   S F  N+  +  E +P    S     ++++     K  +S V+YA+     +  +        +  +  L+++ATDG++LA      E+  +   ++L   ++  L +++ D D  I I + ++ + F  SN ++ SK+++G +P+ +R+I +  + + +I++  L++ L+R  +I S+EK   V+L  +++ L +  S+S+   ++E +  +    E   I  N  +LL +L    ++ I   F D+    L+    + NF  +++P+R
  S:     1 MKLIETDRDTLLKPLQMVTGIVERRHTLPILSNVLIERKHESISFIATDLEIQITTSAQDSVDND--EEHSVTVAAKKLQDILRALPDKAQVVLEMGENRLLAKAGKSRF--NLQTLPAEDFPKFPESKEAQGKVTVQQKELKHLLSMVQYAMAQQDIRYYLNG---LLLLLEDSYLKVVATDGHRLAFALMTLEAPQEKKEVILPRKVVLELAKLLNDSDEPITIEMLQNQVRFTFSNVVLVSKVVDGKFPDYNRVIPSGYQKQFDINRLLLLQTLQRA-SILSNEKFRGVRLILTTDNLRIVCSNSEQEEAQEELELQYD-GEALDIGFNITYLLDVLNNTTSEAIRCAFGDANSSALITIPGNDNFKYVVMPMR 368
>gi|21229480|ref|NP_635397.1| DNA polymerase III subunit beta [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66766354|ref|YP_241116.1| DNA polymerase III subunit beta [Xanthomonas campestris pv. campestris str. 8004] >gi|188989398|ref|YP_001901408.1| DNA polymerase III beta chain [Xanthomonas campestris pv. campestris] >gi|21110940|gb|AAM39321.1| DNA polymerase III beta chain [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66571686|gb|AAY47096.1| DNA polymerase III beta chain [Xanthomonas campestris pv. campestris str. 8004] >gi|167731158|emb|CAP49330.1| DNA polymerase III beta chain [Xanthomonas campestris pv. campestris] (366 aa)
Score = 178, Expect = 3.8e-11, Identities = 77/371 (20%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIS--THSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   + PV    L++VN+ ++  T ++  +   + ++V  ++D      G   I  +  F I+  L +   +T+ +  D   ++   S F   +  +    +P+++       ++++     K+ + +  +A+     +   ++G+ F+    +  L  +ATDG++LA    + E +    R  IV    + ELL  +   D ++E+ L  S+I  K  +    SK+I+G +P+   +I    + +V + ++ L  +L+R  AI S+EK   V++  S   L++S  + +   ++E +    KV++   I  N ++LL  L    ++++ ++  D+    L+R+        +++P+R
  S:     1 MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVNNGQLSLTGTDLEVEMISRTMVEDAQD------GETTIPARKLFDILRALPDGSRVTVSQTGDKVTVQAGRSRF--TLATLPANDFPSVD-EVEATERVAVPEAGLKELMERTAFAMAQQDVRY-YLNGLLFDL--RDGLLRCVATDGHRLALCETELEKSGSAKRQIIVPRKGVTELLRLLEAADRDVELELGRSHIRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRA-AILSNEKYRGVRVEVSPGQLKISAHNPEQEEAQEEIEADTKVDD-LAIGFNVNYLLDALSALRDEHVVIQLRDANSSALVREASSEKSRHVVMPLR 365
>gi|65319987|ref|ZP_00392946.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Bacillus anthracis str. A2012] (236 aa)
Score = 177, Expect = 4.2e-11, Identities = 53/194 (27%), Positives = 106/194 (54%)
  Q:   184 ATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKE-----TVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ATD ++LA      ST      ++  + I  LL++++ +   + I+L ES+IIF    T + S++IEG YPN+S +I    +  +NI ++ +++ ++R   ++S    + V L   +E  +++S ++S +G   E      +  K ++N    IS +  F+L  L+    + +T+ FS S +P+L+        + ++ P+R
  S:    37 ATDSHRLAIRETLISTNMKANCIVPSATINELLKLMNSNLEFVSIYLSESHIIFTFGTTTLYSRLIEGKYPNISTLIPNEFQTVINIDRQRMLQGVDRSSLLASEWANNNVNLEIVNESTIQISSNASQIGKISEKQQIDVIQGKKQLN----ISFDGRFMLDALRAIKEETVTLSFSGSMRPILIEAGTQSAAIHLISPVR 234
>gi|91774358|ref|YP_544114.1| DNA polymerase III, beta subunit [Methylobacillus flagellatus KT] >gi|91708345|gb|ABE48273.1| DNA polymerase III, beta subunit [Methylobacillus flagellatus KT] (367 aa)
Score = 177, Expect = 4.6e-11, Identities = 87/371 (23%), Positives = 180/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL-SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLE-VSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M I +++  L+  L   +SI E   + P+    L+E   ++IK T ++        ++ S D+    +    I  K    I   L +N  IT+   D S I+VKT     N+  +    YP +  + +  + L  I     K+   +V++A+     +   ++G+ F    +   L ++ TDG++L+    E  S+ +   I+L   ++IEL+  + + +  + I L      F   +  + SK+I+G +P+ +R+I T  +N  ++ +  ++ +++R  +I S+EK   +++  S+  L+ +S +S      +E     G  N    I  N  +++ +L   D++++T  F+D+    L+  E D N+  +++P+R
  S:     1 MNIKINRDTLLKPLSSVSSIVERRHTLPILSNLLLEAKQDKIKLTATD----LEMQISLSVDSAAGGELSTTISAKKLLDICRSLPENAEITMATQD-SRIQVKTGKSRFNLQTLPAGDYPLMTKTEDASSTLIKIGQKSLKRLFKQVEFAMAQQDIRY-YLNGLLFEV--NGNRLNVVGTDGHRLSFTSTELASSYEKQEIILPRKTVIELIKLLDESEDEVTIELANGQANFAFGDIHLISKVIDGKFPDYTRVIPTGHQNSFSVDRTMILLSMQRA-SILSNEKYRGIRMVLSANSLKLISTNSEQEEAEEELEISYGGSN--LDIGFNVTYMIDVLNNSDSESVTFSFADANSSCLVTVENDDNYKYVVMPMR 366
>gi|81251081|gb|ABB69882.1| DNA polymerase III beta chain [Nitrosospira sp. NIJS16] (369 aa)
Score = 177, Expect = 4.7e-11, Identities = 86/371 (23%), Positives = 180/371 (48%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE-MITLEKVDNSVI-KVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L++   I E   + P+    LIE     I F  ++  I   +    S D +  E+  + +  K    I+  L ++  + LE  +N ++ K   S F  N+  +  E +P    S     ++++     K  +S V+YA      +  +        +  +  L+++ATDG++LA      E+  +   ++L   ++  L +++ D D  I I + ++ + F  SN ++ SK+++G +P+ +R+I +  + + +I++  L++ L+R  +I S+EK   V+L  +++ L +  S+S+   ++E +  +    E   I  N  +LL +L    ++ I   F D+    L+    + NF  +++P+R
  S:     1 MKLIETDRDTLLKPLQMVTGIVERRHTLPILSNVLIERKHESISFIATDLEIQITTSAQDSVDND--EEHSVTVAAKKLQDILRALPDKAQVVLEMGENRLLAKAGKSRF--NLQTLPAEDFPKFPESKEAQGKVTVQQKELKHLLSMVQYATAQQDIRYYLNG---LLLLLEDSYLKVVATDGHRLAFALMTLEAPQEKKEVILPRKVVLELAKLLNDSDEPITIEMLQNQVRFTFSNVVLVSKVVDGKFPDYNRVIPSGYQKQFDINRLLLLQTLQRA-SILSNEKFRGVRLILTTDNLRIVCSNSEREEAQEELELQYD-GEALDIGFNITYLLDVLNNTTSEAIRCAFGDANSSALITIPGNDNFKYVVMPMR 368
>gi|116074276|ref|ZP_01471538.1| DNA polymerase III subunit beta [Synechococcus sp. RS9916] >gi|116069581|gb|EAU75333.1| DNA polymerase III subunit beta [Synechococcus sp. RS9916] (390 aa)
Score = 176, Expect = 5.0e-11, Identities = 75/372 (20%), Positives = 183/372 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRI------------VLDVSL-------IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNF--SSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN---FLQILVPIRN 378
           MK++ S+++L +AL+L +    +  + PV    L+  +    + + +      +  +  S  A++   G + +  +    I+S+L  +       D++  +V+ ++   +  +  M  +++P++    N    L +      +++    +A + ++ K  +++G+        + LE  +TDG++LA    +   QD               VL V+L       +E L+     D  + +F     ++   ++ ++ S+ +EG YPN  ++I       +++ ++  + ALER +A+ + +  ++V+++   ++ ++++S  + D+G+  E++     V +   I+ N  ++L  LK  + D I ++ +    P +L    D +   +L + V IRN
  S:     1 MKLVCSQSELNSALQLVSRAVASRPTHPVLANVLLTADAGTGRLSLTG--FDLNLGIQTSFTASVEASGAVTLPARLLGEIVSRLSADSPITLATDDASEQVELTSLSGSYQMRAMPADEFPDLPLVENG-TALRVEAASLVQALRGTLFASSADEAK-QLLTGVHLRF--QARNLEAASTDGHRLAVLAVKDALQDDPSGAPDADTTTEDGVLAVTLPARSLREVERLIAGWKGDDPVTLFYDRGQVVVLAADQMVTSRTLEGTYPNYRQLIPDGFTRTIDLERRPFMAALER-VAVLADQHNNVVRISTEPTAGLVQISADAQDVGSGSESLPAT-LVGDAMQIAFNVRYVLDGLKAMEADRIVLQCNAPTTPAILTPADDTSGFTYLVMPVQIRN 390
>gi|58584686|ref|YP_198259.1| DNA polymerase III beta clamp subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419002|gb|AAW71017.1| DNA polymerase III beta clamp subunit [Wolbachia endosymbiont strain TRS of Brugia malayi] (393 aa)
Score = 176, Expect = 6.0e-11, Identities = 81/372 (21%), Positives = 173/372 (46%)
  Q:     6 KMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ----DFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +M+  + +T L++ L   + + E   +  +     I+     IK   ++  IS  + +A    A++L +G + +       I+ KL  ++ +  E  D   + +     + ++  +   + P +    + ++  ++        ++K K+AV+ +  + N ++GI  ++   E+ L  +ATDG++L+  K +  PQ    +F +++    +  LL+++D    I I L +  I F     II SK+I+G +P+   +I   ++ ++ +    L   ++R   + S   KSI + +   + L +  +S +  ++ E +        P  I  N+ +LL  L    +       SDS    ++ DE DPN L I++P+R
  S:    28 QMRFRIGRTSLLSTLSRVSGVVERRNAIDILACINIKAQHGSIKLMATDLDISIFASLA----ADVLTEGEVKVSAHTLHDIVKKLPADLDVNFEVNDQGKLLISYGNANFSLPNVVLNKLPVLEEGDHKYD-FTLLNTDLIDLLNKTKFAVSLDDTRYN-LNGIYLHT--DEQFLYCVATDGHRLSCVK-KPKPQNINSEFGVIIPRKTVIELLKVLDDCDEINIKLSDRKIKFTCGKYIIISKLIDGAFPDYKCVIPASQDKQMVVESSKLASVIDRVSVVVSDRIKSI-EFSLQEKSLTLHSNSQECSDATEFIEVDYN-GAPIEIGFNSRYLLDALSCIKS-KCKFSLSDSSSATVITDENDPNVLYIVMPVR 392
>gi|28197947|ref|NP_778261.1| DNA polymerase III subunit beta [Xylella fastidiosa Temecula1] >gi|182680574|ref|YP_001828734.1| DNA polymerase III, beta subunit [Xylella fastidiosa M23] >gi|28056007|gb|AAO27910.1| DNA polymerase III beta chain [Xylella fastidiosa Temecula1] >gi|182630684|gb|ACB91460.1| DNA polymerase III, beta subunit [Xylella fastidiosa M23] (366 aa)
Score = 176, Expect = 6.3e-11, Identities = 79/371 (21%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   +  +    LI+VN++++  T ++  +   S   K ED    E G I I  +  + I+  L +  ++   +  D   ++   S F   +  +    +P+I+       ++ I+ ++ K+ I +  +A+     +   ++G+ F+    +  L  +ATDG++LA  + E    +D +   I+    ++EL   +   D  IE+ +  ++I  K  +    SK+I+G +P+   +I    + +V ++++ L +AL+R  AI S+EK   V++  S   L+++ + +      +       + +   I  N ++LL  L +   D + ++  DS    L+R+      LQ+++P+R
  S:     1 MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLTGTDLEVEMIS-KTKIEDP---ESGEITIPARKIYEIVRALPDASQLSVYQSDDKITLQAGRSRF--TLATLPANDFPSID-KIEVTERIIIAEVLLKELIERTAFAMAQQDVRY-YLNGLLFDL--RDTKLRCVATDGHRLALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNHIRMKSFDVTFTSKLIDGSFPDYEGVIPIGADREVKVAREVLRDALQRA-AILSNEKYRGVRIEVSPGQLKIN-AHNPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRGDFVNIQLRDSNSSALIRESNSEKSLQVVMPLR 365
>gi|71275533|ref|ZP_00651819.1| DNA polymerase III, beta chain [Xylella fastidiosa Dixon] >gi|71900180|ref|ZP_00682320.1| DNA polymerase III, beta chain [Xylella fastidiosa Ann-1] >gi|170729253|ref|YP_001774686.1| DNA-directed DNA polymerase [Xylella fastidiosa M12] >gi|71163833|gb|EAO13549.1| DNA polymerase III, beta chain [Xylella fastidiosa Dixon] >gi|71730069|gb|EAO32160.1| DNA polymerase III, beta chain [Xylella fastidiosa Ann-1] >gi|167964046|gb|ACA11056.1| DNA-directed DNA polymerase [Xylella fastidiosa M12] (366 aa)
Score = 175, Expect = 6.9e-11, Identities = 79/371 (21%), Positives = 179/371 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKS--EDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   +  +    LI+VN++++  T ++  +    +++K+  EDA   E G I I  +  + I+  L +  ++   +  D   ++   S F   +  +    +P+I+       ++ I+ ++ K+ I +  +A+     +   ++G+ F+    +  L  +ATDG++LA  + E    +D +   I+    ++EL   +   D  IE+ +  ++I  K  +    SK+I+G +P+   +I    + +V ++++ L +AL+R  AI S+EK   V++  S   L+++ + +      +       + +   I  N ++LL  L +   D + ++  DS    L+R+      LQ+++P+R
  S:     1 MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLTGTDLEVE---MISKTIIEDA---ESGEITIPARKIYEIVRALPDASQLSVYQSDDKITLQAGRSKF--TLATLPANDFPSID-KIEVTERIIIAEVLLKELIERTAFAMAQQDVRY-YLNGLLFDL--RDTKLRCVATDGHRLALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNHIRMKSFDVTFTSKLIDGSFPDYEGVIPIGADREVKVAREVLRDALQRA-AILSNEKYRGVRIEVSPGQLKIN-AHNPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRGDFVNIQLRDSNSSALIRESNSEKSLQVVMPLR 365
>gi|58579625|ref|YP_198641.1| DNA polymerase III subunit beta [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84621659|ref|YP_449031.1| DNA polymerase III subunit beta [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188574272|ref|YP_001911201.1| DNA polymerase III, beta subunit [Xanthomonas oryzae pv. oryzae PXO99A] >gi|58424219|gb|AAW73256.1| DNA polymerase III beta chain [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84365599|dbj|BAE66757.1| DNA polymerase III beta chain [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188518724|gb|ACD56669.1| DNA polymerase III, beta subunit [Xanthomonas oryzae pv. oryzae PXO99A] (366 aa)
Score = 175, Expect = 7.9e-11, Identities = 77/371 (20%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   + PV    L++V D ++  T ++  +    ++A++  A  ++ G   I  +  F I+  L +   +T+ +  D   ++   S F   +  +    +P+++       ++ +     K+ I +  +A+     +   ++G+ F+    +  L  +ATDG++LA    + E+     R  IV    + ELL  +   D  +E+ +  S+I  K  +    SK+I+G +P+   +I    + +V + ++ L  +L+R  AI S+EK   V++  S   L++S  + +   ++E +    KV++   I  N ++LL  L    ++++ ++  D+    L+R+        +++P+R
  S:     1 MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVE---MIARTM-AEDVQDGETTIPARKLFDILRALPDGSRVTISQTGDKVTVQAGRSRF--TLATLPANDFPSVD-EVEATERVVVPEAGLKELIERTAFAMAQQDVRY-YLNGLLFDL--RDGLLRCVATDGHRLALCEMELENAGGAKRQIIVPRKGVTELLRLLEGADREVELEVGRSHIRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRA-AILSNEKYRGVRVEVSPGQLKISAHNPEQEEAQEEIEADTKVDD-LAIGFNVNYLLDALSALRDEHVVIQLRDANSSALVREASSEKSRHVVMPLR 365
>gi|94308947|ref|YP_582157.1| DNA polymerase III subunit beta [Ralstonia metallidurans CH34] >gi|93352799|gb|ABF06888.1| DNA polymerase III, beta subunit [Ralstonia metallidurans CH34] (371 aa)
Score = 175, Expect = 8.1e-11, Identities = 77/366 (21%), Positives = 172/366 (46%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNG--IISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH----YKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S+  L+  L++ + I E   + P+    LI  + + + F +++    I+TH+      D+         +  +    I+  + +  + L  +++  + V++      +  +  E++P +  +      +S+    FK  ++ V +A+     +   ++G+    +   K +  +ATDG++LA+     + E+T    R   I+   +++EL   + D D  +++ L  + + F  +N  + SK++EG +P+  R+I    +N   I +  L +AL+R  AI +++K   V+    + VL++S S++      +         +   I  N  +LL +L    ++ + V   DS    L+   +D NF  +++P+R
  S:     7 SRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVSFLSTDIEIQITTHAECGVGSDSVA-----TTVAARKLLDILRAMPDGDVALS-LNDKRMTVQSGKSRFALQTLAAEEFPTVAEAAEFNASVSLPQKTFKHLLAMVHFAMAQQDIRY-YLNGMLL--VVDGKKVMAVATDGHRLAYCGVELENEATGVGSRQEVIIPRKTILELQRLLEDTDDPVQVQLAANQVKFTFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVQLQQALQR-TAILTTDKFKGVRCILDTHVLKIS-STNADQEEAQEELELDYSGDALDIGFNVTYLLDVLANLKSEQVQVSLGDSNSSALITVPEDDNFKYVVMPMR 370
>gi|118801|sp|P22838|DPO3B_PROMI DNA polymerase III subunit beta >gi|150879|gb|AAA83959.1| DNA polymerase III beta subunit >gi|194684438|emb|CAR46154.1| DNA polymerase III beta subunit [Proteus mirabilis HI4320] (367 aa)
Score = 175, Expect = 8.3e-11, Identities = 77/371 (20%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDF--DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK I+ + +L+  L+  +       + P+    L++V +N +  T ++  +   + V+ S+   I   G   +  + FF I   L        ++D   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F + ++E  L  +ATDG++LA       +S P    IV    +IEL+  ++D   ++ +++ +  +N+   V + I  SK+++G +P+  R++       V      L +A  R  AI S+EK   V++N ++  L+++ ++ +   ++E V  + +  E   I  N  +LL +L T   + + +  +D+   V + +        +++P+R
  S:     1 MKFIIEREQLLKPLQQVSGPLGGRPTLPILGNLLLKVTENTLSLTGTDLEMEMMARVSLSQSHEI---GATTVPARKFFDIWRGLPEGAEISVELDGDRLLVRSGRSRFSLSTLPASDFPNLD----DWQSEVEFTLPQATLKRLIESTQFSMAHQDVRY-YLNGMLFETENTE--LRTVATDGHRLAVCAMDIGQSLPGHSVIVPRKGVIELM-RLLDGSGESLLQLQIGSNNLRAHVGDFIFTSKLVDGRFPDYRRVLPKNPTKTVIAGCDILKQAFSRA-AILSNEKFRGVRINLTNGQLKITANNPEQEEAEEIVDVQYQ-GEEMEIGFNVSYLLDVLNTLKCEEVKLLLTDAVSSVQVENVASAAAAYVVMPMR 366
>gi|81251054|gb|ABB69862.1| DNA polymerase III beta chain [Nitrosospira sp. KAN8] (369 aa)
Score = 174, Expect = 9.5e-11, Identities = 84/371 (22%), Positives = 177/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F  ++  +        ++D    E+  + +  K    I+  L  +M +TLE  DN  ++ K      N+  +  E +P    S      + +     K  +S V+YA+ +   +  +   +     +  K   ++ATDG++LA      E+  +   ++L   ++ EL   + + +  + I + ++ + F  SN ++ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  +++ L +  ++S+   ++E +  +    E   I  N  +LL +L   D++ +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIATD--LEIQITTYTTDDGKADEEYSVTVAAKKLQDILRALPEKMQVTLETSDNR-LQAKAGKSRFNLQTLPAEDFPKFPESNEPQGTVKVQQKELKHLLSMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALMMLETPLEKKEVILPRKVVLELSRLLNETEEPVTIEVLQNQVRFTFSNVVLVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTTDNLRIVCNNSEQEEAQEELELQYD-GEGLDIGFNITYLLDVLNNTDSETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|120608716|ref|YP_968394.1| DNA polymerase III, beta subunit [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120587180|gb|ABM30620.1| DNA polymerase III, beta subunit [Acidovorax avenae subsp. citrulli AAC00-1] (372 aa)
Score = 174, Expect = 9.7e-11, Identities = 86/366 (23%), Positives = 168/366 (45%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILI---KTKPFFAIISKLKNEMITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDF----DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K++  L+    I E   + P+    LI    N ++ TTS+    I +T  +   + D       R LI   KT P         ++ ++LE   +  V+K   S F   +  +  E +P +  S       S+   V K  + +V +A+     +   ++GI F  ++   TL ++ATDG++LA          P+   I+   +++EL   + D       +IE+    +   F        +K++EG +P+ +R+I    +N V + +  L+ +L+R  AI +S+K   V+LN     L V+ ++++   + + +       +   I  N  +L+  L     D + V+ SD     L+   ++ NF  +++P+R
  S:     7 TQDKVLAVLQSVAGIVERRHTLPILANVLIRKTGNALQLTTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMP--------ADQTVSLESQQSKLVLKGGKSRF--TLQSLPAEDFPLVQESAAFGPAFSVPQKVLKDLLGQVSFAMAVQDIRY-YLNGILF--VAEGNTLSLVATDGHRLAFASATLDVEVPKQEVILPRKTVLELQRLLSDAGGENQPHIEMQFANNQAKFTFGGMEFVTKLVEGKFPDYNRVIPKNHKNSVTLGRAPLLASLQR-TAIMTSDKFKGVRLNIEPGTLRVASNNAEQEEAVDELDIDYG-GDTIEIGFNVTYLIDALANMGQDMVRVDLSDGNSSALMTIPENDNFKYVVMPMR 371
>gi|88705399|ref|ZP_01103110.1| DNA polymerase III, beta chain [gamma proteobacterium KT 71] >gi|88700489|gb|EAQ97597.1| DNA polymerase III, beta chain [Congregibacter litoralis KT71] (367 aa)
Score = 173, Expect = 1.1e-10, Identities = 78/371 (21%), Positives = 160/371 (43%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  VS+  L+  L L   + E   + PV    L+ ++ + +  T ++  +    +V +       E G I +  +    I   L +       V +    V++      +  +   ++PNI  S    +Q ++     ++ I +  +A+     +   ++G+ +   +    L  +ATDG++LA   F  T +D      I+    ++EL   +   D ++ I L  +++    +     SK+++G +P+  R++    +  V  S+  L +A  R  AI S+EK   V+L  S   LE+  ++ +   ++E++       +   I  N  +LL +L     + I    SD     LL +    + L +++P+R
  S:     1 MKFRVSRDALLKPLNLVAGVVERRQTLPVLSNVLLNLDGDRLSITGTDLEVE---LVGRVNLETAGEAGEITVPARKLADICKSLPDGADLEIAVADGKATVRSGRSRFTLATLPAREFPNIEDSIGT-HQFTLKQGQLRRLIERTGFAMAQQDVRY-YLNGMYWELRAGR--LRAVATDGHRLAICTFPGTLKDLEDTQVILPRKGVLELSRLMQSDDEDVTIILGSNHLRATTAEFTFTSKLVDGKFPDYERVLPRAADKIVQSSRTELRQAFTR-TAILSNEKYRGVRLKLSEGSLEIVANNPEQEQAEESLPVDYS-GDALEIGFNVGYLLDVLGVLSGEKIRFSLSDPNSSALLEETDGGDSLYVVMPMR 366
>gi|67153554|ref|ZP_00415299.1| DNA polymerase III, beta chain [Azotobacter vinelandii AvOP] >gi|67087687|gb|EAM07153.1| DNA polymerase III, beta chain [Azotobacter vinelandii AvOP] (367 aa)
Score = 173, Expect = 1.2e-10, Identities = 75/371 (20%), Positives = 156/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E+A   E G I +  +    I   L N+ +   ++D   + +K      +++ +    +P            S+     ++ I +  +A+     +   ++G+      +   L  +ATDG++LA        E   +   IV    ++EL   + D D  + I L + +I          SK+++G +P+  R++    + KV   ++ L EA  R  AI S+EK   ++L  +S +L++  +++      E         +   I  N  +LL +L     + + +  SDS    LL++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEKQQLSLTGTDLEVELVGRVPLEENA---EPGEITVPARKLMDICKSLPNDTLIDIRLDEQKLLIKAGRSRFSLSTLPASDFPTAEEGLGSLT-FSLGQSKLRRLIERTSFAMAQQDVRY-YLNGMLLEM--NGGVLRAVATDGHRLALCSMQSGIEHADRHQVIVPRKGILELARLLTDQDGEVSIVLGQYHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKKVLGDRQLLREAFSR-TAILSNEKYRGIRLQLASGLLKIQ-ANNPEQEEAEEEVAVDYSGDALEIGFNVSYLLDVLGVMSAEQVCLTLSDSNSSALLQEADNDDSAYVVMPMR 366
>gi|15836607|ref|NP_297295.1| DNA polymerase III subunit beta [Xylella fastidiosa 9a5c] >gi|9104762|gb|AAF82815.1|AE003855_2 DNA polymerase III, beta chain [Xylella fastidiosa 9a5c] (366 aa)
Score = 173, Expect = 1.3e-10, Identities = 79/371 (21%), Positives = 178/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKS--EDANILEKGRILIKTKPFFAIISKL--KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   +  +    LI+VN++++  T ++  +    +++K+  EDA   E G I I  +  + I+  L   +++   +  D   ++   S F   +  +    +P+I+       ++ I  ++ K+ I +  +A+     +   ++G+ F+    +  L  +ATDG++LA  + E    +D +   I+    ++EL   +   D  IE+ +  ++I  K  +    SK+I+G +P+   +I    + +V ++++ L +AL+R  AI S+EK   V++  S   L+++ + +      +       + +   I  N ++LL  L +   D + ++  DS    L+R+      LQ+++P+R
  S:     1 MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLTGTDLEVE---MISKTIIEDA---ESGEITIPARKIYEIVRALPDSSQLSVYQSDDKITLQAGRSRF--TLATLPANDFPSID-KIEVTERIIIPEVLLKELIERTAFAMAQQDVRY-YLNGLLFDL--RDTKLRCVATDGHRLALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNHIRMKSFDVTFTSKLIDGSFPDYEGVIPIGADREVKVAREVLRDALQRA-AILSNEKYRGVRIEVSPGQLKIN-AHNPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRGDFVNIQLRDSNSSALIRESNSEKSLQVVMPLR 365
>gi|21326650|gb|AAL30090.1| DNA polymerase III beta chain [Xanthomonas campestris pv. campestris] (366 aa)
Score = 173, Expect = 1.3e-10, Identities = 76/371 (20%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIS--THSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKL--AHYKFESTPQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   + PV    L++VN+ ++  T ++  +   + ++V  ++D      G   I  +  F I+  L +   +T+ +  D   ++   S F   +  +    +P+++       ++++     K+ + +  +A+     +   ++G+ F+    +  L  +ATDG++L     + E +    R  IV    + ELL  +   D ++E+ L  S+I  K  +    SK+I+G +P+   +I    + +V + ++ L  +L+R  AI S+EK   V++  S   L++S  + +   ++E +    KV++   I  N ++LL  L    ++++ ++  D+    L+R+        +++P+R
  S:     1 MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVNNGQLSLTGTDLEVEMISRTMVEDAQD------GETTIPARKLFDILRALPDGSRVTVSQTGDKVTVQAGRSRF--TLATLPANDFPSVD-EVEATERVAVPEAGLKELMERTAFAMAQQDVRY-YLNGLLFDL--RDGLLRCVATDGHRLPLCETELEKSGSAKRQIIVPRKGVTELLRLLEAADRDVELELGRSHIRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRA-AILSNEKYRGVRVEVSPGQLKISAHNPEQEEAQEEIEADTKVDD-LAIGFNVNYLLDALSALRDEHVVIQLRDANSSALVREASSEKSRHVVMPLR 365
>gi|23007031|ref|ZP_00049078.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Magnetospirillum magnetotacticum MS-1] (233 aa)
Score = 173, Expect = 1.4e-10, Identities = 53/194 (27%), Positives = 94/194 (48%)
  Q:   183 IATDGYKLAHYKF------ESTPQDFRIVLDVSLIELLLEIIDFDTN--IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           +ATDG++LA  +       E  P    I+L   L+  + ++ D D     E+ L  S I     +T + SK+I+G +P+  R+I     + + +  K L  AL+R   I +SE+   VKL   ++ + ++ ++ D G + E    K     P  I  N  +L  +L   D++++     D+  P L R   D     +L+P+
  S:    37 VATDGHRLARARLPRPEGAEGMPG---IILPRKLVTEIGKLADGDGGPAFEVALSPSKIRIGRDDTTLTSKLIDGTFPDYERVIPRDNPHTLALDGKALAPALDRVTTI-ASERGRAVKLALDADRIVLTQNNPDAGEATEEADAKFD-GAPMQIGFNGKYLAEILALLDSEHVEARLGDAGAPTLWRRRGDALLTVVLMPM 233
>gi|16272930|ref|NP_439155.1| DNA polymerase III subunit beta [Haemophilus influenzae Rd KW20] >gi|1169393|sp|P43744|DPO3B_HAEIN DNA polymerase III subunit beta >gi|1574022|gb|AAC22654.1| DNA polymerase III, beta subunit (dnaN) [Haemophilus influenzae Rd KW20] (366 aa)
Score = 172, Expect = 1.6e-10, Identities = 79/371 (21%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE---MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  +S+  L+  L+    +  N  + PV    L+++ D  +  T ++  +   S    S  +   E G   I  K F  I   L ++    +T E+ D ++++   S F   +     E+YPN+     DW       +     ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E   Q+  ++L    ++EL+  +   D    + +  +N+   + NT+  SK+I+G +P+  R++       V  + + L +A  R  +I S+E+   V+L+     L+++ S+++   ++E V       E   +  N  ++L +L     + + +  +D+F   L+ + +D +   +++P+R
  S:     1 MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDYRLTITGTDLEVELSSQTQLSSSS---ENGTFTIPAKKFLDICRTLSDDSEITVTFEQ-DRALVQSGRSRF--TLATQPAEEYPNLT----DWQSEVDFELPQNTLRRLIEATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTISLEQELQNHSVILPRKGVLELVRLLETNDEPARLQIGTNNLRVHLKNTVFTSKLIDGRFPDYRRVLPRNATKIVEGNWEMLKQAFARA-SILSNERARSVRLSLKENQLKITASNTEHEEAEEIVDVNYN-GEELEVGFNVTYILDVLNALKCNQVRMCLTDAFSSCLIENCEDSSCEYVIMPMR 365
>gi|157368282|ref|YP_001476271.1| DNA polymerase III subunit beta [Serratia proteamaculans 568] >gi|157320046|gb|ABV39143.1| DNA polymerase III, beta subunit [Serratia proteamaculans 568] (366 aa)
Score = 172, Expect = 1.8e-10, Identities = 80/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK IV +  L+  L+  +S      + P+    L++V +  +  T ++  +   + VA S+     E G   +  +  F I   L         ++   + V++     +++ +    +PN++    DW    + S+     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       +  P    IV    ++EL+  +   DT +++ +  +NI   V + I  SK+++G +P+  R++    +  +      L +A  R  AI S+EK   V+L  S   L+++ ++ +   ++E   VS  G   E   I  N  ++L +L     +++ +  +DS   V + D    +   +++P+R
  S:     1 MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGCLLLTGTDLEMEMVARVALSQPH---EAGATTVPARKLFDICRGLPEGAEITVTLEGERMLVRSGRSRFSLSTLPAVDFPNLD----DWQSEVEFSLPQATLKRLIEATQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQQLPSHSVIVPRKGVMELVRLLDGGDTLLQLQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARA-AILSNEKFRGVRLYVSQNQLKITANNPEQEEAEEILDVSYDGTEME---IGFNVSYVLDVLNALKCEDVRLLLTDSVSSVQIEDGASKSAAYVVMPMR 365
>gi|83720585|ref|YP_443734.1| DNA polymerase III subunit beta [Burkholderia thailandensis E264] >gi|167582969|ref|ZP_02375843.1| DNA polymerase III subunit beta [Burkholderia thailandensis TXDOH] >gi|167620900|ref|ZP_02389531.1| DNA polymerase III subunit beta [Burkholderia thailandensis Bt4] >gi|83654410|gb|ABC38473.1| DNA polymerase III, beta subunit [Burkholderia thailandensis E264] (367 aa)
Score = 172, Expect = 1.8e-10, Identities = 70/365 (19%), Positives = 165/365 (45%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  S +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +   S  +   IV   +++EL   + D D  ++I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQSKDFGASLAVPQKAFRQLLGMVYFAMAQQDIRY-YLNGMLL--VVDGDRLMAVATDGHRLAFSSMKIEGSFSRQEVIVPRKTILELQRLLEDIDDTVKIDIAQTQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRA-AILTSDKFKGVRCIIAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENDEFKYVVMPMR 366
>gi|31544930|ref|NP_853508.1| hypothetical protein MGA_0618 [Mycoplasma gallisepticum R] >gi|31541777|gb|AAP57076.1| DnaN [Mycoplasma gallisepticum R] (398 aa)
Score = 171, Expect = 2.2e-10, Identities = 79/342 (23%), Positives = 160/342 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEII-----DFDTNIEIFLFESNIIFKVSNTIIASKIIEGD-YPNVSRIIATPKENKVNISKKTLV----EALERGLAISSSEKKSI-VKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNI 348
           MK   SK+  + A++  ++ S +     +     I++++ E K  +SNG +S  SI    +D ++ E+G +++  K    II  + ++  TL K+DN +I ++     +++N+ ++  YP I    ++++ + +   +F KSI KV ++ +    K +I S I F   + +  + I  +D  KL+  +YK   T    +   + S+  L L  +     D D  +     +S+ +   +N  +    +E + +P   +I+   K     +  K L+     AL   L++S   K +           L +S +S D+ +            E   I+LN  +L   +K F++ +I
  S:     8 MKFFTSKSSFLEAIKFSSNFSSDNNFEQLLKNLYIKIDNKECKIYSSNGQVS--SIYKIEDDIDVEEEGEVIVNAKKLITIIQSIVSDNFTLAKLDNQLI-IRAGKMQTSLNLEEDVSYPEIEIDDSNFSVIDVDSFLFAKSIKKVIHSTSFQTTKNSISSAINFQKEADDMNIWITGSDAIKLSSCYYKVNDTEDALKAKFNFSVNALSLSYVAAFLKDKDQLLLKISKKSDKVVLTNNKFVLYLRVENEPFPEFKKILNANKVVSSFVVDKDLISNNLHALTGVLSLSDQGKNNADANFEILKNTLRISTNSFDIASYNSEFDISEFQGEVKDINLNPFYLQEHIKMFESKDI 359
>gi|24212702|ref|NP_710183.1| DNA polymerase III beta subunit [Leptospira interrogans serovar Lai str. 56601] >gi|45655916|ref|YP_000002.1| DNA polymerase III beta subunit [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24193333|gb|AAN47201.1|AE011192_2 DNA polymerase III beta subunit [Leptospira interrogans serovar Lai str. 56601] >gi|45599149|gb|AAS68639.1| DNA polymerase III beta subunit [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (373 aa)
Score = 171, Expect = 2.3e-10, Identities = 90/371 (24%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTK---PFFAIISKLKNEMITLEKVDN--SVIKVKTST----FDSNINIMDEEQYPNINFSYNDWNQLSISP-IVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST---PQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI V+ ++ + A+     +        +     IE    E   + ++  IS    +  S  A++ ++G + +  K    FF  I   ++  ++LE+ D+  S++ +  ++    + S I+ MD ++   I  S  D +Q+S  P  +    I K  YA+ +  ++  I +G+    I +   L  + TDG +L   K E T   P  F+  I++    I  + ++I       I L +  I    +N  +  K+IEG++PN  ++I    +   +ISK+    +L R +  ++ E    V+L FS   L  +  +  LG S+ +++   + + +   I+    +L+ + ++ D++ + +EFSD+  PV+ +D  DP F+ +++P++
  S:     1 MKIKVNTSEFLKAIHAVEGVITTREIKSILSNLKIEAEGKETFLSATDLEIS----IKTSVPADVTQEGNVSLPAKQLSSFFKTI-HFEDTNLSLEESDSNSSIVYITDASGKNDYKSKISGMDADEIKTI--SKIDSSQVSSFPSTLINDMIRKTSYAIAHEDQRF-IFNGLYM--IPNGDKLIFVGTDGRRLC--KIERTLPSPLQFKDSIIVPAKAIREISKMIATSEVGNIGLIDGQIYVSANNIELLCKLIEGNFPNYEQVIPKNTKFSTSISKEEFQVSL-RQVLTAAEEPSRQVRLTFSKNNL--NLFAQTLGASEASINKPIEYSGDEVTIAFKGEYLMDIFRSIDDNEVKIEFSDANSPVIFKDPSDPEFISVIMPMK 372
>gi|24753762|gb|AAN64010.1|AF434658_7 DNA polymerase III, beta subunit [Leptospira interrogans] (373 aa)
Score = 170, Expect = 2.6e-10, Identities = 89/371 (23%), Positives = 184/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTK---PFFAIISKLKNEMITLEKVDN--SVIKVKTST----FDSNINIMDEEQYPNINFSYNDWNQLSISP-IVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST---PQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI V+ ++ + A+     +        +     IE    E   + ++  IS    +  S  A++ ++G + +  K    FF  I   ++  ++LE+ D+  S++ +  ++    + S I+ MD ++   I  S  D +Q+S  P  +    I K  YA+ +  ++  I +G+    I +   L  + TDG +L   K E T   P  F+  I++    I  + ++I       I L +  I    +N  +  K+IEG++PN  ++I    +   +ISK+    +L R +  ++ E    V+L FS   L  +  +  LG S+ +++   + + +   I+    +L+ + ++ D++ + +EFSD+  P++ +D  DP F+ +++P++
  S:     1 MKIKVNTSEFLKAIHAVEGVITTREIKSILSNLKIEAEGKETFLSATDLEIS----IKTSVPADVTQEGNVSLPAKQLSSFFKTI-HFEDTNLSLEESDSNSSIVYITDASGKNDYKSKISGMDADEIKTI--SKIDSSQVSSFPSTLINDMIRKTSYAIAHEDQRF-IFNGLYM--IPNGDKLIFVGTDGRRLC--KIERTLPSPLQFKDSIIVPAKAIREISKMIATSEVGNIGLIDGQIYVSANNIELLCKLIEGNFPNYEQVIPKNTKFSTSISKEEFQVSL-RQVLTAAEEPSRQVRLTFSKNNL--NLFAQTLGASEASINKPIEYSGDEVTIAFKGEYLMDIFRSIDDNEVKIEFSDANSPIIFKDPSDPEFISVIMPVK 372
>gi|15638997|ref|NP_218443.1| DNA polymerase III, subunit beta (dnaN) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025238|ref|YP_001933010.1| DNA-directed DNA polymerase beta subunit [Treponema pallidum subsp. pallidum SS14] >gi|4033379|sp|O83048|DPO3B_TREPA DNA polymerase III subunit beta >gi|3322257|gb|AAC65000.1| DNA polymerase III, subunit beta (dnaN) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189017813|gb|ACD70431.1| DNA-directed DNA polymerase beta subunit [Treponema pallidum subsp. pallidum SS14] (371 aa)
Score = 170, Expect = 2.6e-10, Identities = 76/371 (20%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHY--KFESTPQDFR-IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSS----SDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MKI+  K   +  +     +  N  ++ +F   L+      +    ++    T      S   N+L +G   +       ++S L  + I L   +   VI          +  +  E +P   F  N+    L++     +  I+   +AV+ +  + + ++G+  +       +  ++TDG +LA+   K ES+PQ F  +++   ++ ++   +  + ++ + +   ++ F       +S +IEG +PN  R+I   +E    + +  L+EAL+R +++   +K   + +     +L +S  +    +++G+++E ++C     E   I+LN  +L   LK F +  + VEF+D  K + LR   + +   I++P++
  S:     1 MKILCEKEAFLKEISTAQEVISNKKNTSIFSNVLLAAQGALLTIRATD----TKVTFETSIPVNVLAEGTTTVFCDKLVNVVSALPTKEIELTLCEEQLVITPPNKKISFQLRTLSHESFPC--FPQNEGGVSLAVPTSDLRNMINHTVFAVSEDSTR-HFINGVHVDF--QYGNIICVSTDGKRLAYIEKKGESSPQSFSGVIVPTKILGIVNRKLTPEGSVTLCITSQHVYFFFGGYKFSSVLIEGQFPNYKRVIPDHQERSFCVGRVELMEALKR-VSLLVEQKSHRIFITIQQGLLTLSSKAHTQENEIGDAQEEIAC-AYTGESEVIALNYLYLEEPLKVFTSKEVQVEFTDPAKALTLRAVPNTDCFHIIMPMQ 369
>gi|53717713|ref|YP_106699.1| DNA polymerase III subunit beta [Burkholderia pseudomallei K96243] >gi|53724902|ref|YP_101863.1| DNA polymerase III subunit beta [Burkholderia mallei ATCC 23344] >gi|67642368|ref|ZP_00441125.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Burkholderia mallei GB8 horse 4] >gi|76811898|ref|YP_331716.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 1710b] >gi|121599744|ref|YP_994143.1| DNA polymerase III subunit beta [Burkholderia mallei SAVP1] >gi|124384769|ref|YP_001028200.1| DNA polymerase III subunit beta [Burkholderia mallei NCTC 10229] >gi|126438733|ref|YP_001057143.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 668] >gi|126448071|ref|YP_001079585.1| DNA polymerase III subunit beta [Burkholderia mallei NCTC 10247] >gi|134281596|ref|ZP_01768304.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 305] >gi|161375425|ref|ZP_02114957.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 1710a] >gi|167001181|ref|ZP_02266980.1| DNA polymerase III subunit beta [Burkholderia mallei PRL-20] >gi|167717461|ref|ZP_02400697.1| DNA polymerase III subunit beta [Burkholderia pseudomallei DM98] >gi|167736496|ref|ZP_02409270.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 14] >gi|167813574|ref|ZP_02445254.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 91] >gi|167822115|ref|ZP_02453586.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 9] >gi|167843720|ref|ZP_02469228.1| DNA polymerase III subunit beta [Burkholderia pseudomallei B7210] >gi|167892199|ref|ZP_02479601.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 7894] >gi|167900711|ref|ZP_02487916.1| DNA polymerase III subunit beta [Burkholderia pseudomallei NCTC 13177] >gi|167908928|ref|ZP_02496019.1| DNA polymerase III subunit beta [Burkholderia pseudomallei 112] >gi|167916969|ref|ZP_02504060.1| DNA polymerase III subunit beta [Burkholderia pseudomallei BCC215] >gi|194317193|ref|YP_002013134.1| DNA polymerase III, beta subunit [Burkholderia mallei ATCC 10399] >gi|194502267|ref|YP_002031845.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 1655] >gi|194512762|ref|YP_002025286.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei Pasteur 52237] >gi|194517951|ref|YP_002053559.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei S13] >gi|194523852|ref|YP_002059384.1| DNA polymerase III, beta subunit [Burkholderia mallei FMH] >gi|194528832|ref|YP_002064354.1| DNA polymerase III, beta subunit [Burkholderia mallei JHU] >gi|194569696|ref|YP_002104698.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 406e] >gi|194573663|ref|YP_002108549.1| DNA polymerase III, beta subunit [Burkholderia mallei 2002721280] >gi|52208127|emb|CAH34057.1| DNA polymerase III, beta chain [Burkholderia pseudomallei K96243] >gi|52428325|gb|AAU48918.1| DNA polymerase III, beta subunit [Burkholderia mallei ATCC 23344] >gi|76581351|gb|ABA50826.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 1710b] >gi|121228554|gb|ABM51072.1| DNA polymerase III, beta subunit [Burkholderia mallei SAVP1] >gi|124292789|gb|ABN02058.1| DNA polymerase III, beta subunit [Burkholderia mallei NCTC 10229] >gi|126218226|gb|ABN81732.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 668] >gi|126240941|gb|ABO04034.1| DNA polymerase III, beta subunit [Burkholderia mallei NCTC 10247] >gi|134247263|gb|EBA47349.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 305] >gi|147747862|gb|EDK54938.1| DNA polymerase III, beta subunit [Burkholderia mallei FMH] >gi|147752842|gb|EDK59908.1| DNA polymerase III, beta subunit [Burkholderia mallei JHU] >gi|148028823|gb|EDK86755.1| DNA polymerase III, beta subunit [Burkholderia mallei 2002721280] >gi|157808569|gb|EDO85739.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 406e] >gi|157934303|gb|EDO89973.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei Pasteur 52237] >gi|160696348|gb|EDP86318.1| DNA polymerase III, beta subunit [Burkholderia mallei ATCC 10399] >gi|169651274|gb|EDS83967.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei S13] >gi|184214679|gb|EDU11722.1| DNA polymerase III, beta subunit [Burkholderia pseudomallei 1655] (367 aa)
Score = 170, Expect = 2.7e-10, Identities = 70/365 (19%), Positives = 165/365 (45%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  S +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +   S  +   IV   +++EL   + D D  ++I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQSKDFGASLAVPQKAFRQLLGMVYFAMAQQDIRY-YLNGMLL--VVDGDRLMAVATDGHRLAFSSMKIEGSFGRQEVIVPRKTILELQRLLEDIDDTVKIDIAQTQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRA-AILTSDKFKGVRCIIAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENDEFKYVVMPMR 366
>gi|89092265|ref|ZP_01165219.1| DNA polymerase III subunit beta [Oceanospirillum sp. MED92] >gi|89083353|gb|EAR62571.1| DNA polymerase III subunit beta [Oceanospirillum sp. MED92] (367 aa)
Score = 170, Expect = 2.7e-10, Identities = 84/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE-----MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKE-NKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK ++S+  LI  L+L   + E   + PV    L+    +++  T ++  +     V   E A   E G + +  +    I   L +       +T +K+   VIK   S F   ++ +   ++PN+  S     +LS+     +  I K  +++     +   ++G+     + +  L  ++TDG++LA      + E   Q   IV    ++EL   + + +  + + +  S+I   V +    SK+++G +P+  R+I  PK  +K+ +S +  +  +   +AI S+EK   V+L+ SS  L+V  ++ +   ++ET++   +  E   +  N ++LL  L   ++D + +  SDS    L+    +   + +++P+R
  S:     1 MKFVISREALIKPLQLVAGVVERRQTLPVLSNILLVAEGDQLSMTGTDLEVELVGRVTLDEPA---EAGSVTVPARKLMDICKSLPDSARIELTLTGQKM---VIKAGRSRF--TLSTLPAAEFPNVEDSPETL-ELSMVQHQLRNLIDKTGFSMAQQDVRY-YLNGMLLEIANGQ--LRSVSTDGHRLATSVTDVEAEDGMQHQIIVPRKGILELARLLQNGEEELRLVIGASHIRAHVGDFTFTSKLVDGKFPDYERVI--PKNGDKILLSDRMELRQVLSRIAILSNEKYRGVRLSLSSGYLQVMANNPEQEEAEETLAVDYE-GETLEVGFNVNYLLDCLSILNSDVVRLTLSDSNSSALVEGFDEEGSVYVVMPMR 366
>gi|113866033|ref|YP_724522.1| DNA polymerase III subunit beta [Ralstonia eutropha H16] >gi|113524809|emb|CAJ91154.1| DNA polymerase III beta subunit [Ralstonia eutropha H16] (371 aa)
Score = 170, Expect = 2.8e-10, Identities = 74/366 (20%), Positives = 169/366 (46%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNG--IISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR-------IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S+  L+  L++ + I E   + P+    LI  + + + F +++    I+TH+      D+         +  +    I+  + +  + L  +++  + V++      +  +  E++P +  +      +S+    FK  ++ V +A+     +   ++G+    +   K +  +ATDG++LA+   E   +          I+   +++EL   + D D  +++ L  + + F  +N  + SK++EG +P+  R+I    +N   I +  L +AL+R  AI +++K   V+    + +L++S S++      +         +   I  N  +LL +L    ++ + V   DS    L+   +D NF  +++P+R
  S:     7 SRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVSFLSTDIEIQITTHAECGVGSDSVA-----TTVAARKLLDILRAMPDGDVALS-LNDKRMTVQSGKSRFALQTLAAEEFPTVAEASEFNASVSLPQKTFKHLLAMVHFAMAQQDIRY-YLNGMLL--VVEGKKVMAVATDGHRLAYCGVELETEAVGVGARQEVIIPRKTILELQRLLEDNDDPVQVQLAANQVKFTFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVRLQQALQR-TAILTTDKFKGVRCILDTHMLKIS-STNADQEEAQEELELDYSGDALDIGFNVTYLLDVLANLKSEQVQVSLGDSNSSALITVPEDDNFKYVVMPMR 370
>gi|82701137|ref|YP_410703.1| DNA polymerase III, beta subunit [Nitrosospira multiformis ATCC 25196] >gi|81251042|gb|ABB69853.1| DNA polymerase III beta chain [Nitrosospira multiformis] >gi|82409202|gb|ABB73311.1| DNA polymerase III, beta subunit [Nitrosospira multiformis ATCC 25196] (369 aa)
Score = 169, Expect = 3.3e-10, Identities = 77/371 (20%), Positives = 177/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F  ++  +      + ++   + E+  + +  K    I+  L  +M    + ++S ++ K      N+  +  E +P    S      + +     K  ++ V+YA+ +   +  +   +     +  K   ++ATDG++LA      E++ +   ++L   ++ EL   + + +  + I + ++ + F  SN ++ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  +++ L +  ++S+   ++E +  +    +   I  N  +LL +L   D++ +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIEADRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIATD--LEIQITTSTTDGGKVREEYSVTVAAKKLQDILRALPEKMRVTLETNDSRLQAKAGKSRFNLQTLPAEDFPKFPESNETQGTVKVQQKELKHLLAMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALMMLETSLERKEVILPRKVVLELSRLLNETEDPVTIEVLQNQVRFTFSNVVLVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTADNLRIVCNNSEQEEAQEELELQYN-GDGLDIGFNITYLLDVLNNADSETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|81251046|gb|ABB69856.1| DNA polymerase III beta chain [Nitrosospira sp. 9SS1] (369 aa)
Score = 169, Expect = 3.3e-10, Identities = 85/371 (22%), Positives = 178/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F  ++  I   +       A+  E+  + +  K    I+  L  +M +TLE  D S ++ K      N+  +  E +P    S      +++     K  +S V+YA+ +   +  +   +     +  K   ++ATDG++LA      E++ +   ++L   ++ EL   + + +  + I + ++ + F  SN ++ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  ++  L +  ++S+   ++E +  +    E   I  N  +LL +L   D++ +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIEADRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIATDLEIQITTSTTDGGKAD--EEYSVTVAAKKLQDILRALPEKMRVTLETSD-SRLQAKAGKSRFNLQTLPAEDFPKFPESNEKQGTVTVQQKELKHLLSMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALMMLETSLERKEVILPRKVVLELSRLLNETEEPVTIEVLQNQVRFTFSNVVLVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTANNLRIVCNNSEQEEAQEELELQYN-GEGLDIGFNITYLLDVLNNADSETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|84394124|ref|ZP_00992858.1| DNA polymerase III subunit beta [Vibrio splendidus 12B01] >gi|84375270|gb|EAP92183.1| DNA polymerase III subunit beta [Vibrio splendidus 12B01] (304 aa)
Score = 169, Expect = 3.4e-10, Identities = 66/306 (21%), Positives = 152/306 (49%)
  Q:    72 LEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKET--VSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
            E G I + ++ F  I   L +  +    +D   ++V++     ++  +    +PNI     DW+   ++S++    +  I K ++++ N   +   ++G+ F    S   L  +ATDG+++A  + +    DF   +I++    ++ L++++D  +  + + +  SN+  +V+N +  SK+++G +P+  R++       +      L  A  R  AI S+EK   V++N     + ++ ++ +   ++E   V+  G   E   I  N  ++L +L T   + + +  SD+    L+ + +D + + +++PIR
  S:     1 FEAGSITVPSRKFLDICRGLPDSSVITVVLDGDRVQVRSGRSRFSLATLPAADFPNIE----DWSSEVEVSVTQAELRGLIEKTQFSMANQDVRY-YLNGMLFEIEGS--ILRSVATDGHRMAVSQAQ-LGADFAQKQIIVPRKGVQELVKLLDAPEQPVTLQIGNSNVRAEVNNYVFTSKLVDGRFPDYRRVMPQNTTKTLEAGCDELRSAFSRA-AILSNEKFRGVRVNLVDTEMRITANNPEQEEAEEVLDVTFDGDALE---IGFNVSYVLDVLNTLRCEQVRISMSDANASALIENAQDDSAMYVVMPIR 303
>gi|134294130|ref|YP_001117865.1| DNA polymerase III subunit beta [Burkholderia vietnamiensis G4] >gi|134137287|gb|ABO53030.1| DNA polymerase III, beta subunit [Burkholderia vietnamiensis G4] (368 aa)
Score = 169, Expect = 3.6e-10, Identities = 70/365 (19%), Positives = 163/365 (44%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  + +    LS+    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +     F     IV   +++EL   + D D  + I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQAKDFAASLSVPQKSFRQLLGMVHFAMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAFSSMKIEGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQTQAKFTFGGVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRA-AILTSDKFKGVRCIIAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENDEFKYVVMPMR 367
>gi|89898824|ref|YP_521295.1| DNA polymerase III, beta subunit [Rhodoferax ferrireducens T118] >gi|89343561|gb|ABD67764.1| DNA polymerase III, beta subunit [Rhodoferax ferrireducens T118] (367 aa)
Score = 169, Expect = 3.7e-10, Identities = 78/366 (21%), Positives = 164/366 (44%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRIL--IKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K+++ L+    I E   + P+    LI      ++ TTS+    I +T  +   + D   +   +++  ++T P         ++ ++LE     +I +K       +  M  E +P +  + +     S+     K  +S+V +A+  +  +   ++GI F  ++    L ++ATDG++LA          P+   I+   ++IEL   + D    IE+    +   F        +K++EG +P+ +R+I    +N + + +  L+  L+R  AI +SEK   V+LN     L V+ ++++   + + +       +   I  N  +L+  L     D + +E SD     L     +  F  +++P+R
  S:     7 TQDKVLSVLQSVAGIVERRHTLPILANVLIRKTGTSLQLTTSDLEIQIRTTAELDGDTGDFTTVGARKLIDILRTMP--------ADQTVSLESSAAKLI-LKGGKSRFTLQTMAAEDFPLVQEAASFGPVFSVPQKTLKDLLSQVSFAMAVHDIRY-YLNGILF--VAEGSQLSLVATDGHRLAFASATLDVEVPKQEVILPRKTVIELQRLLSDTQGAIEMQFANNQAKFSFDGMEFVTKLVEGKFPDYNRVIPKNHQNSITLGRSALLATLQR-TAILTSEKFKGVRLNIDPGTLRVASNNAEQEEAVDELDIDYG-GDSIEIGFNVTYLIDALANMSQDMVRLELSDGNSSALFTIPDNATFKYVVMPMR 366
>gi|83814447|ref|YP_444160.1| DNA polymerase III, beta subunit [Salinibacter ruber DSM 13855] >gi|83755841|gb|ABC43954.1| DNA polymerase III, beta subunit [Salinibacter ruber DSM 13855] (377 aa)
Score = 169, Expect = 4.1e-10, Identities = 77/370 (20%), Positives = 173/370 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIST-HSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF----ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNS---KETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP--VLLRD-EKDPNFLQILVPI 376
           MK   S   L+ AL        +  + P+    L E + + ++ + ++  IS   ++  + E     E   I +  +     +  L +  I      +  I++ T      +   D   YP +     + +++++   +  +SI K  +AV+ +  +  +M G+ F    SE+   ++ATDG++L           T  DF  ++     +L   I++ D    + + +S++ F+   + + +++I+  YPN   +I    +  + ++++ ++ A++R + + SS   + ++L+ +++   V+ S+ D+  S   +ET+ C    NEP  I  N+ +L  +L   + D +  E S   +   VL R+   D + L +++P+
  S:     1 MKFTASSADLLEALNTVKGAVPSKSTMPILECILFERDGDTLRLSATDLEISIIQTVPVQFEKNGTPESTPIAVPAQRLIDTLRALPDLPIEFAADSDFEIRMDTDQGHYKMVGHDGSDYPELP-ELEEQHEINVEGGLLGRSIDKTAFAVSQDALRPAMM-GVYFQV--SEEETSVVATDGHRLVKLTLPELRADTSADF--IVPEKATKLAGRIVEDDEICTVRVDDSHVSFEFGESRVLARLIDETYPNYQSVIPDGNDRNLVVNREDMLNAVKR-VGLYSSSMTNQIRLDITADT--VTISAEDVERSSEAEETIHCDYD-NEPMEIGFNSEYLTEVLSNVECDEVVFELSSPNRAGIVLPREGADDEDILMLIMPV 371
>gi|121998016|ref|YP_001002803.1| DNA polymerase III, beta subunit [Halorhodospira halophila SL1] >gi|121589421|gb|ABM62001.1| DNA polymerase III, beta subunit [Halorhodospira halophila SL1] (366 aa)
Score = 169, Expect = 4.1e-10, Identities = 78/371 (21%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES---TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESN-IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  V +  L+ AL+    + E   + PV     +E    +++ T ++  +    +VA  E AN  ++G I +  + +  I   L +   I++E   D + ++  +S F  ++  +  +++P +  S  D   + I     ++ I +  +++  +  +   ++G+      S      +ATDG++LA  + +S     Q  ++++    ++ LL ++D         F +N +   + +  + SK+I+G +P+ +R+I    +  V I ++ L +AL R +AI S+EK   ++     + L +   + +   ++E +  +    E   +  N ++LL  L   D + + V  +D+    L+R E   N   +++P+R
  S:     1 MRFEVQREPLLAALQSIVGVVERRQTLPVLGNIRVEARSQQLQLTATDLEVE---LVAYLE-ANTKDEGVITLPARKWLDICRNLPEGASISIEANQDRATLRAASSRF--SLATLPADEFPEVE-SIGDTEAVEIPRGELRRLIERTHFSMAQHDVRY-YLNGLLLELTGSGA--RAVATDGHRLALAESDSPVQVAQPRQVIVPRKGVQELLRLLDDADEPATLEFGTNHVRVTLQSVRLTSKLIDGVFPDYNRVIPQDGDKHVLIDRQYLRQALTR-VAILSNEKYRGIRFAVEGDTLRIGSHNPEQEEAEEELGIEYG-GEAVELGFNANYLLDALGALDTERVQVTLTDASSSGLIRAEGSDNARYVVMPMR 365
>gi|21240776|ref|NP_640358.1| DNA polymerase III subunit beta [Xanthomonas axonopodis pv. citri str. 306] >gi|78045558|ref|YP_361733.1| DNA polymerase III subunit beta [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|21106040|gb|AAM34894.1| DNA polymerase III beta chain [Xanthomonas axonopodis pv. citri str. 306] >gi|78033988|emb|CAJ21633.1| DNA polymerase III beta chain [Xanthomonas campestris pv. vesicatoria str. 85-10] (366 aa)
Score = 169, Expect = 4.2e-10, Identities = 76/371 (20%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIIS--THSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVL----DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + +   +  L    ++ E   + PV    L++V D ++  T ++  +   + ++V  ++D      G   I  +  F I+  L +   +T+ +  D   ++   S F   +  +    +P+++       ++ +     K+ I +  +A+     +   ++G+ F+    +  L  +ATDG++LA    + E      R ++     V+ ++ LLE  D +  +E+    S+I  K  +    SK+I+G +P+   +I    + +V + ++ L  +L+R  AI S+EK   V++  S   L++S  + +   ++E +    KV++   I  N ++LL  L    ++++ ++  D+    L+R+        +++P+R
  S:     1 MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLEVEMISRTLVEDAQD------GETTIPARKLFDILRALPDGSRVTISQTGDKVTVQAGRSRF--TLATLPSNDFPSVD-EVEATERVVVPEAGLKELIERTAFAMAQQDVRY-YLNGLLFDL--RDGLLRCVATDGHRLALCEMELEKAGGAKRQIIVPRKGVTELQRLLEGADREVELEVG--RSHIRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRA-AILSNEKYRGVRVEVSPGQLKISAHNPEQEEAQEEIEADTKVDD-LAIGFNVNYLLDALSALRDEHVVIQLRDANSSALVREASSEKSRHVVMPLR 365
>gi|54307246|ref|YP_128266.1| DNA polymerase III subunit beta [Photobacterium profundum SS9] >gi|46911666|emb|CAG18464.1| Putative DNA polymerase III, beta chain [Photobacterium profundum SS9] (366 aa)
Score = 168, Expect = 4.3e-10, Identities = 76/371 (20%), Positives = 171/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       S P+    L++V +  +  T ++  +   + +A   D    E G + + ++ F  I   L +       ++   I +++     +++ +    +PNI     DW    + ++      + I   ++++ +   +   ++G+ F +  S   L  +ATDG+++A        E T +   IV    ++EL+  + + +  ++I +  SNI   V+N +  SK+++G +P+  R++       V  S   L +A  R  AI S+EK   V++N S   + ++ ++ +   ++E +    + ++   I  N  ++L +L T   D + +  +D+    L+ D  +   + +++PIR
  S:     1 MKFTVEREHLLKPLQQVSGALGGRPSLPILGNILLKVEEGYLSMTGTDLEVELIAKLALEAD---FEVGAVTVPSRKFLDICRGLPDGAKIAVTLEGDRILIRSGRSRYSLSTLPAADFPNIE----DWQSDVEFTLPQGRMSQLIQSTQFSMAHQDVRY-YLNGMLFETDGSH--LRSVATDGHRMAVCAIDLAQELTTKQI-IVPRKGVLELVRLLDNAEAMVDIQIGNSNIRATVNNFVFTSKLVDGRFPDYRRVMPQSSNKFVEASCDELRKAFSRA-AILSNEKFRGVRVNLSKGEMRITANNPEQEEAEEFLDVDYQGDD-LEIGFNVSYVLDVLNTLKCDQVRLSLTDANASALVEDCANDEAMYVVMPIR 365
>gi|90413731|ref|ZP_01221719.1| DNA polymerase III subunit beta [Photobacterium profundum 3TCK] >gi|90325200|gb|EAS41697.1| DNA polymerase III subunit beta [Photobacterium profundum 3TCK] (366 aa)
Score = 168, Expect = 4.7e-10, Identities = 76/371 (20%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       S P+    L++V +  +  T ++  +   + +A   D    E G + + ++ F  I   L +       ++   I +++     +++ +    +PNI     DW    + ++      + I   ++++ +   +   ++G+ F +  S   L  +ATDG+++A    +     +T Q   IV    ++EL+  + + +  ++I +  SNI   V+N +  SK+++G +P+  R++       V  S   L +A  R  AI S+EK   V++N S   + ++ ++ +   ++E +    + ++   I  N  ++L +L T   D + +  +D+    L+ D  +   + +++PIR
  S:     1 MKFTVEREHLLKPLQQVSGALGGRPSLPILGNILLKVEEGYLSMTGTDLEVELIAKLALEAD---FEIGAVTVPSRKFLDICRGLPDSAKIAVTLEGDRILIRSGRSRYSLSTLPAADFPNIE----DWQSEVEFTLPQGRMSQLIQSTQFSMAHQDVRY-YLNGMLFETDGSH--LRSVATDGHRMAVCAIDLAQELATKQ--IIVPRKGVLELVRLLDNAEAMVDIQIGNSNIRATVNNFVFTSKLVDGRFPDYRRVMPQSSNKFVEASCDELRKAFSRA-AILSNEKFRGVRVNLSKGEMRITANNPEQEEAEEFLDVDYQGDD-LEIGFNVSYVLDVLNTLKCDQVRLSLTDANASALVEDCANDEAMYVVMPIR 365
>gi|78064660|ref|YP_367429.1| DNA polymerase III subunit beta [Burkholderia sp. 383] >gi|115350058|ref|YP_771897.1| DNA polymerase III subunit beta [Burkholderia ambifaria AMMD] >gi|170697755|ref|ZP_02888842.1| DNA polymerase III, beta subunit [Burkholderia ambifaria IOP40-10] >gi|172059069|ref|YP_001806721.1| DNA polymerase III, beta subunit [Burkholderia ambifaria MC40-6] >gi|77965405|gb|ABB06785.1| DNA polymerase III, beta subunit [Burkholderia sp. 383] >gi|115280046|gb|ABI85563.1| DNA polymerase III, beta subunit [Burkholderia ambifaria AMMD] >gi|170137370|gb|EDT05611.1| DNA polymerase III, beta subunit [Burkholderia ambifaria IOP40-10] >gi|171991586|gb|ACB62505.1| DNA polymerase III, beta subunit [Burkholderia ambifaria MC40-6] (368 aa)
Score = 168, Expect = 5.4e-10, Identities = 69/365 (18%), Positives = 163/365 (44%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  + +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +     F     IV   +++EL   + D D  + I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQAKDFGATLTVPQKSFRQLLGMVHFAMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAFSSMKLEGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQTQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRA-AILTSDKFKGVRCIIAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENEEFKYVVMPMR 367
>gi|148658484|ref|YP_001278689.1| DNA polymerase III, beta subunit [Roseiflexus sp. RS-1] >gi|148570594|gb|ABQ92739.1| DNA polymerase III, beta subunit [Roseiflexus sp. RS-1] (377 aa)
Score = 168, Expect = 5.4e-10, Identities = 79/343 (23%), Positives = 164/343 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIIS-THSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSI-SPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFES--NIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERG--LAISSSEKKSIVKLNFS--SEV----LEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           PV    L+  +D  +K   +N  I  T  I AK ED     +G + +  K    ++  L N+ I L   V    + +K + F++NI   +  ++P I  + +D    +I  P + +++I +V +A    +E   ++ G+      +       A DG++LA    E       Q   I+   +L EL   + D ++ +E+ +      ++F  S   + S++IEG +P+V R+I    + +  + ++ L +A++     A++SS   +IV+L+     E+    + +S ++ ++G++K  +    +  +   I+LN  FL   +       I +E      P + +      ++ I++P+
  S:    28 PVLSNILLASDDGRLKLAATNLEIGITCWIGAKIED-----EGAVTVPAKLLSDVVGSLPNDRIDLTLDVRTQTLNLKCARFETNIKGTEAGEFPTIP-TIDDRTPAAIFPPALLRETIEQVAFAAAT-EETRPVLQGVQLRLRDNRAIFA--AADGFRLAQRIIELPEPIVQQQELIIPARALTELARIVDDDESPVEMMITPGGGQVLFHTSTVDLVSRLIEGRFPDVDRVIPQQYQTRAVLDRQELTKAVKLASFFAVASS---NIVRLHMEPGGEMGPGRITISANAVEVGDNKGQIDATIQ-GDGGQIALNVKFLSDAIAAIPTPQIALETQSPQHPAVFKPVGADGYIHIVMPM 374
>gi|194562036|ref|YP_002097059.1| DNA polymerase sliding clamp subunit [Burkholderia dolosa AUO158] >gi|124893660|gb|EAY67540.1| DNA polymerase sliding clamp subunit [Burkholderia dolosa AUO158] (368 aa)
Score = 167, Expect = 5.8e-10, Identities = 69/365 (18%), Positives = 163/365 (44%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  + +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +     F     IV   +++EL   + D D  + I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDQVATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQAKDFGASLTVPQKSFRQLLGMVHFAMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAFSSMKLEGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQTQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFQIGREELQRSLQRA-AILTSDKFKGVRCIVAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENDEFKYVVMPMR 367
>gi|81251058|gb|ABB69865.1| DNA polymerase III beta chain [Nitrosospira sp. TCH711] (369 aa)
Score = 167, Expect = 6.2e-10, Identities = 85/371 (22%), Positives = 175/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F  ++  +      + ++     E+  + +  K    I+  L   M +TLE  D S ++VK      N+  +  E +P    S      + +     K  +S V+YA+ +   +  +   +     +  K   ++ATDG++LA      E+  +   ++L   ++ EL   + + +  + I + ++ + F  SN I+ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  ++  L +  ++S+   ++E +  +    E   I  N  +LL +L   D + +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIATD--LEIQITTSATDGGKADEEYSVTVAAKKLQDILRALPERMQVTLETSD-SRLQVKAGKSRFNLQTLPAEDFPKFPESNEPQGTVKVQQKELKHLLSMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALMMLETPLEKKEVILPRKVVLELARLLNETEEPVTIEVLQNQVRFTFSNVILVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTTGNLRIVCNNSEQEEAQEELELQYD-GEGLDIGFNITYLLDVLNNTDCETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|161523182|ref|YP_001578194.1| DNA polymerase III subunit beta [Burkholderia multivorans ATCC 17616] >gi|189348957|ref|YP_001944585.1| DNA polymerase III, beta chain [Burkholderia multivorans ATCC 17616] >gi|56798247|dbj|BAD82890.1| DnaN [Burkholderia multivorans] >gi|160340611|gb|ABX13697.1| DNA polymerase III, beta subunit [Burkholderia multivorans ATCC 17616] >gi|189332979|dbj|BAG42049.1| DNA polymerase III, beta chain [Burkholderia multivorans ATCC 17616] (368 aa)
Score = 167, Expect = 7.0e-10, Identities = 69/365 (18%), Positives = 163/365 (44%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  + +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +     F     IV   +++EL   + D D  + I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGSDQVATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQAKDFGASLTVPQKSFRQLLGMVHFAMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAFSSMKIDGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQTQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFQIGREELQRSLQRA-AILTSDKFKGVRCIVAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENDEFKYVVMPMR 367
>gi|107024099|ref|YP_622426.1| DNA polymerase III subunit beta [Burkholderia cenocepacia AU 1054] >gi|116688026|ref|YP_833649.1| DNA polymerase III subunit beta [Burkholderia cenocepacia HI2424] >gi|170731358|ref|YP_001763305.1| DNA polymerase III, beta subunit [Burkholderia cenocepacia MC0-3] >gi|105894288|gb|ABF77453.1| DNA polymerase III, beta subunit [Burkholderia cenocepacia AU 1054] >gi|116646115|gb|ABK06756.1| DNA polymerase III, beta subunit [Burkholderia cenocepacia HI2424] >gi|169814600|gb|ACA89183.1| DNA polymerase III, beta subunit [Burkholderia cenocepacia MC0-3] (368 aa)
Score = 167, Expect = 7.0e-10, Identities = 69/365 (18%), Positives = 163/365 (44%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     ++    +  +    I+  + +  +TL   D   + V++      +  +  +++P +  + +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA    +     F     IV   +++EL   + D D  + I + ++   F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+   +   L++  +++D   ++E +    +  +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDQIATTVAARKLLDILRAMPDGQVTLSLADKR-LTVQSGKSRFALQTLAADEFPTVAQAKDFGATLTVPQKSFRQLLGMVHFAMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAFSSMKLEGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQTQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFEIGREELQRSLQRA-AILTSDKFKGVRCIIAPGQLKIMSTNADQEEAQEELEIAYQ-GDTVDIGFNVTYLLDVLANLKVDTVQVSLGDASSSALITVPENDEFKYVVMPMR 367
>gi|66043273|ref|YP_233114.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. syringae B728a] >gi|63253980|gb|AAY35076.1| DNA polymerase III, beta chain [Pseudomonas syringae pv. syringae B728a] (367 aa)
Score = 166, Expect = 7.7e-10, Identities = 75/371 (20%), Positives = 160/371 (43%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E A   E G I +  +    I   L N+ +   K+D+S + VK       ++ +    +P +          ++     ++ I +  +A+     +   ++G+      S   L  +ATDG++LA        E   +   IV    ++E+   + + D  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  +S  L++  ++ +   ++E +S +    +   I  N  +LL +L     + + +  SDS    L+++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLEEPA---EPGEITVPARKLMDICKSLSNDALIDIKLDDSKLIVKAGRSRFTLSTLPANDFPTVEEGPGSLT-FTLVQSKLRRLIERTSFAMAQQDVRY-YLNGMLLEV--SAGILRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGTVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSR-TAILSNEKYRGIRLQLASGQLKIQANNPEQEEAEEEISVEYN-GDSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALVQESDNDDSAYVVMPMR 366
>gi|15988190|pdb|1JQL|A Chain A, Mechanism Of Processivity Clamp Opening By The Delta Subunit Wrench Of The Clamp Loader Complex Of E. Coli Dna Polymerase Iii: Structure Of Beta-Delta (1-140) >gi|16974833|pdb|1JQJ|A Chain A, Mechanism Of Processivity Clamp Opening By The Delta Subunit Wrench Of The Clamp Loader Complex Of E. Coli Dna Polymerase Iii: Structure Of The Beta-Delta Complex >gi|16974834|pdb|1JQJ|B Chain B, Mechanism Of Processivity Clamp Opening By The Delta Subunit Wrench Of The Clamp Loader Complex Of E. Coli Dna Polymerase Iii: Structure Of The Beta-Delta Complex (366 aa)
Score = 166, Expect = 7.8e-10, Identities = 77/371 (20%), Positives = 165/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKT-LVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  V +  L+  L+  +       + P+    L++V D  +  T   G      +VA+       E G   +  + FF I   L        +++   + V++     +++ +    +PN++    DW    + ++     K+ I   ++++ +   +   ++G+ F +   E  L  +ATDG++LA       +S P    IV    +IEL+  +   D  + + +  +NI   V + I  SK+++G +P+  R++  PK    ++     L++      A +S+EK   V+L  S   L+++ ++ +   ++E +       E   I  N  ++L +L     +N+ +  +DS   V + D    +   +++P+R
  S:     1 MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT---GTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLD----DWQSEVEFTLPQATMKRLIEATQFSMAHQDVRY-YLNGMLFETEGEE--LRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVL--PKNPDKHLEAGCDLLKQAFARAAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAE-MEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 365
>gi|110637953|ref|YP_678160.1| DNA polymerase III, beta subunit [Cytophaga hutchinsonii ATCC 33406] >gi|110280634|gb|ABG58820.1| DNA polymerase III, beta subunit [Cytophaga hutchinsonii ATCC 33406] (374 aa)
Score = 166, Expect = 8.4e-10, Identities = 81/347 (23%), Positives = 158/347 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFD-----SNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK---FESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGN-SKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK +VS   L+  L   N +       P+    L E+ D  +    S+   S  + +A    A    KG I +  K     +  L  + +T   +D     ++ S+ +     S  N  D  + P +   Y+    + IS  +  ++IS   +A +N++ K   M+G+  +   S  T   +ATDG++L  Y+     S   +  I+   +L  L   +   +TN++I    SN  F  +N  +  ++I+  +P+    I     N + I++  ++ +L+R ++I +++    V+L  +   L++S    D  N + E ++C+ +  +   I  N  FL+ +L   D+  I++ FS
  S:     1 MKFVVSSNALLKQLTAINGVITTNPVVPILENFLFEIGDGMLVVYASDLQTSMITEIAVEAKA----KGSIAVPAKILLDTLKNLPEQPVTF-TIDPETYSIEISSDNGRYKLSGENATDFPKVPGVKNGYS----VDISTEILNRAISSTIFAASNDELK-PAMTGVYVSLTESNATF--VATDGHRLIRYRRTDIVSEMANTLIIPKKALNLLKASLPSENTNVKIEYNASNAFFSFNNIKMICRLIDERFPDYENAIPVDNPNVLTITRTDMMNSLKR-ISIYANKTTHQVRLKLAGSELQISAEDLDFSNEANERLACEFE-GQDMEIGFNAKFLVEMLSNLDSPQISMHFS 342
>gi|146305044|ref|YP_001185509.1| DNA polymerase III subunit beta [Pseudomonas mendocina ymp] >gi|145573245|gb|ABP82777.1| DNA polymerase III, beta subunit [Pseudomonas mendocina ymp] (367 aa)
Score = 165, Expect = 1.1e-09, Identities = 77/371 (20%), Positives = 167/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-----NFSYNDWNQLSISPIVFKKSIS----KVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +    +V +    +  E G I +  +    I   L ++ +   +VD+  + VK       ++ +    +P +     + ++N   Q  +  ++ + S +     V+Y +N     + + SG+          L  +ATDG++LA    E+   QD +   IV    ++EL   + + D  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  ++ +L++  ++ +   ++E +           I  N  +LL +L     + + +  SDS    LL++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVE---LVGRVTLEDAAEPGEITVPARKLMDICKSLPSDALIDIRVDDQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLTFN-LPQAKLRRLIERTSFAMAQQDVRYYLNG--MLLEVQSGM----------LRAVATDGHRLAMCSMEAAIQQDGKHQVIVPRKGILELARLLTEQDAEVAIVLGQHHIRANTGEFTFTSKLVDGKFPDYERVLPRGGDKLVLADRQGLREAFSR-TAILSNEKYRGIRLTLAAGLLKIQANNPEQEEAEEEIVVD-YAGGGLEIGFNVSYLLDVLGVMGTEQVRLILSDSNSSALLQEADNDDSAYVVMPMR 366
>gi|53729133|ref|ZP_00134099.2| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207490|ref|YP_001052715.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae L20] >gi|165975459|ref|YP_001651052.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149271|ref|YP_001967796.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126096282|gb|ABN73110.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae L20] >gi|165875560|gb|ABY68608.1| DNA polymerase III beta chain [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189914402|gb|ACE60654.1| DNA polymerase III subunit beta [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (367 aa)
Score = 164, Expect = 1.3e-09, Identities = 75/371 (20%), Positives = 169/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  +++ +L+  L+    +  +  + PV    L+E+  + +  T ++  +   ++    +  +    G+  I  K F  I   L ++  I+++ + D ++++   S F  N+  +    YPN+     DW      SI      + I   ++++ N   +   ++G+ F +      L  +ATDG++LA        +      IV   +++EL   +   D  + + +  SN+   ++  +  SK+I+G +P+  R++    +  +    + L  AL R  AI S+EK   V+L  S  +L+++ ++ +   ++E +    +  E   +  N  +LL +L T   + +     D+    L+ D  +     +++P+R
  S:     1 MQFTITREQLLKPLQQVCGVLSSRPTLPVINNILLEIEGDRLSLTGTDLEVELTTVATLEQAVDF--AGKFTIPAKKFLDICRSLPEDSSISVQFEEDRALVRAARSKF--NLATLPASDYPNLM----DWKPEVDFSIEQSTLARLIDATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTMALNQELLTHSVIVPRKAVLELSRLVAVSDETVRLEIGTSNLRVSMNGVVFTSKLIDGRFPDYRRVLPRNADRILEAETEVLKRALMRA-AILSNEKFRGVRLALSENLLKITANNPEQEEAEEIIDVAYQSPE-MEVGFNVSYLLDVLNTLKCERVRFNLVDASSSCLIEDCDNSTAEYVIMPMR 366
>gi|81251069|gb|ABB69873.1| DNA polymerase III beta chain [Nitrosospira sp. GS832] (369 aa)
Score = 164, Expect = 1.5e-09, Identities = 89/371 (23%), Positives = 180/371 (48%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANIL-EKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFRIVL--DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE    +I F  ++  I    I    ED N   E+  + +  K    I+  L +++ +TLE  +N  +  K      N+  +  E +P    S     +++I     K  +S V+YA+     +   ++G+    +  +  L+++ATDG++LA        PQ+ + V+     ++EL   + D D  + +   ++ + F  SN I+ SK+++G +P+ +R+I    E + +I++  L++ L+R  +I S+EK   V+L  +S  L +  ++S+   ++E +  + +  E   I  N  +LL +L   + + +   F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQEKISFIATDLEIQ---ITTSVEDVNPAGEEHSVTVPAKKLQDILRALPDKVQVTLETGENR-LHAKAGKSRFNLQTLPVEDFPKFPESTEPQAKITIQQKELKHILSMVQYAMAQQDIRY-YLNGLLL--LMEDNYLKVVATDGHRLAFALMLLAAPQEKKEVILPRKVVLELSRLLNDVDEPVTVEFLQNQVRFTFSNVILVSKVVDGKFPDYNRVIPEGYEKQFDINRLLLLQTLQRA-SILSNEKFRGVRLILTSGNLRIVCNNSEQEEAQEELELQYE-GEALDIGFNITYLLDVLNHLNCETVRCAFGDANSSALISIPGNDDFKYVVMPMR 368
>gi|46447339|ref|YP_008704.1| DNA polymerase III subunit beta [Candidatus Protochlamydia amoebophila UWE25] >gi|46400980|emb|CAF24429.1| putative DNA polymerase III, beta chain [Candidatus Protochlamydia amoebophila UWE25] (403 aa)
Score = 164, Expect = 1.5e-09, Identities = 75/371 (20%), Positives = 182/371 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI-NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQ-DFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTP---ISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEK------DPNFLQILVPIR 377
           MK ++S  +L   +    ++     + P+    LIE  ++E+  T ++  +  H       +A ILE+G   +  K    ++ +L    + +    N +  +   +    +N M +  YP++ + S +   ++  S +  K  + +  +AV+    +  +++G+ F  I++  ++  I TDG +LA  K   ++ P    + ++ +  ++ +L+ +  +  ++I L    +  + +   I +K++ GDYP+V+R+I    E  V + ++ L  +L R +++ +++    V+  F    L+++ ++ D+G    ++     VN   P   I+ N  F + +L+    + + +  +D++ P ++ D        D + L +++P+R
  S:    30 MKFVISTQELNYLISKILNVVAQKPTIPILSNFLIEAYNDELILTATDLTVGIHC----HTEAKILEEGSTTLPAKRLSQLVRELTAVNVEISTNTNEITTIIAGSSRFKLNGMSKTDYPSLPDLSQSHTFEMKQSEL--KDLLYRTSFAVSKEDNRY-VLTGV-FIQIAN-GSITFIGTDGKRLARAKGVIDNDPSFSGQAIIPIKAVDEILKNLTDEGEVKISLMADKVAIEANQMRILTKLLSGDYPDVNRVIPEKSEIIVTLHREEL-SSLLRQISLFTADHNHSVRFTFIPGELKLTANTMDIGEGNVSMP----VNYDGPKLEIAFNPGFFIDILRHCKGETVIMGLTDAYNPGIITDSAELANSLDASPLFVIMPMR 399
>gi|104779318|ref|YP_605816.1| DNA polymerase III subunit beta [Pseudomonas entomophila L48] >gi|95108305|emb|CAK12999.1| DNA polymerase III, beta chain [Pseudomonas entomophila L48] (367 aa)
Score = 163, Expect = 1.6e-09, Identities = 78/371 (21%), Positives = 159/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E A   E G I +  +    I   L ++ +   KVD   + VK       ++ +    +P +         QL  S +  ++ I +  +A+     +   ++G+      S  TL  +ATDG++LA        +   +   IV    ++EL   + D +  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  ++  L++  ++ +   ++E +S          I  N  +LL +L     + + +  SDS    LL++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLEEPA---EPGEITVPARKLMDICKSLPSDALIDIKVDEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLTCQLEQSKL--RRLIERTSFAMAQQDVRY-YLNGMLLEV--SPGTLRAVATDGHRLALCAMQAPIDQADRHQVIVPRKGILELARLLTDPEGTVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVIGDRQALREAFSR-TAILSNEKYRGIRLQLAAGQLKIQANNPEQEEAEEEISVDYN-GSSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALLQEAGNDDSSYVVMPMR 366
>gi|116514953|ref|YP_802582.1| DNA polymerase III, b subunit [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|116256807|gb|ABJ90489.1| DNA polymerase III, b subunit [Buchnera aphidicola str. Cc (Cinara cedri)] (368 aa)
Score = 163, Expect = 1.7e-09, Identities = 79/371 (21%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  + K    N+ +  N I       P+    +I++N+ ++K T+SN  +  ++ + K +   + + G + I  K    I   +  + I   K+ N  +++        +N M    +P  N  +    +  IS  + K+ IS + +++ NN  + N+++GI       +  L  + TDGY+L+ YK       ++F I+++   I  L  +I++ +  +++ +  + + FK++  ++ +KI++G++PN + +I   K+  + I  K L ++L +   + ++  K +  LNF    L ++  + +   S ++     K        +N  +LL +L   D + IT+ F      + ++ +K    L I++P++
  S:     1 MEFKIKKNDFFNSFKKMNRIITKNPIFPILENIIIKINEKKLKLTSSNLEVELNAYIDK-KFFILYKSGCVAISGKKILNICRNISKDAILHFKIINKKMRICILNSLFELNTMICTNFPIFN-DFIKKKEFFISEKILKEIISLIFFSIANNDIR-NVLNGILIEY--KKNNLYGVTTDGYRLSVYKIAINLNIKNFSIIINKKSILELFRLINYTNKKVKVIINNNYVAFKINEILLKTKILDGNFPNYNDVILKKKKYSILIPTKPLKKSLSKTSILCNTIFKGVC-LNFLKNKLIITSKNQEDEKSYDSFIIDNK-KIKISFHINVFYLLDILNVLDVEVITISFRIPISSIQIQSDKKKEILYIIMPLK 367
>gi|94676682|ref|YP_588601.1| DNA polymerase III, beta subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|94219832|gb|ABF13991.1| DNA polymerase III, beta subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (370 aa)
Score = 163, Expect = 1.7e-09, Identities = 85/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSIS-PI-VFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK-----FESTPQDFRIVLDVSLIELLLEIIDFDTN---IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+  +S        P+    L++V +N +  T +N  I    IVAK     + + G I++  +  F I   L  + +    ++ +V+ V       ++  +    +P I    +  NQ+  + P+   KK I   ++++ +   + + ++G+ F     E  L  +ATDG++LA         +  P    IV    +IELL  I+D D     +++ +  +NI   +SN I  S +IEG++P+   ++       + + +  + +AL R +AI S++K   V+L      L+++  + +   ++E +    +  E   +S N +++L +L     D + + F++    V + D  +P  + I++P+R
  S:     1 MKFTIERKYLLKPLQQVSSRLSGRHQLPILTHLLLQVTENYLILTGTNLEIE---IVAKITINKVDKIGIIMVCARKLFDICRSLPEDALINITLEGTVMLVIAGRSRFSLMTLPATNFPKIA---DGENQIVFNLPLDTLKKVIQSTQFSMAHQDVRYS-LNGLLFEITGKE--LRTVATDGHRLAACTIYINVLKQLPYCSIIVPRKGVIELL-RILDLDYGDNMVKLQICSNNIRIYISNYIFTSNLIEGNFPDYHSVLPKNVNKILKVRRDLIKQALTR-VAILSNDKFRCVRLYLRKNQLKITAKNLEQEEAEEILDVSYEGPE-IEVSFNVNYILDILGILKCDTVRLLFNNEASSVQIDDCMNPMSIYIVMPMR 369
>gi|26986756|ref|NP_742181.1| DNA polymerase III subunit beta [Pseudomonas putida KT2440] >gi|148545261|ref|YP_001265363.1| DNA polymerase III subunit beta [Pseudomonas putida F1] >gi|60392201|sp|P0A120|DPO3B_PSEPK DNA polymerase III subunit beta >gi|60392202|sp|P0A121|DPO3B_PSEPU DNA polymerase III subunit beta >gi|24981347|gb|AAN65645.1|AE016191_2 DNA polymerase III, beta subunit [Pseudomonas putida KT2440] >gi|45691|emb|CAA32894.1| unnamed protein product [Pseudomonas putida] >gi|148509319|gb|ABQ76179.1| DNA polymerase III, beta subunit [Pseudomonas putida F1] (367 aa)
Score = 163, Expect = 1.7e-09, Identities = 80/371 (21%), Positives = 158/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI---------NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E A   E G I +  +    I   L N+ +   KVD   + VK       ++ +    +P +         N   +   +L I    F  +   V+Y +N    ++            S  TL  ++TDG++LA        E   +   IV    ++EL   + D +  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  ++  L++  ++ +   ++E +S   +      I  N  +LL +L     + + +  SDS    LL++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLEEPA---EPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRL-IERTSFAMAQQDVRYYLNGMLLEV------------SRNTLRAVSTDGHRLALCSMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSR-TAILSNEKYRGIRLQLAAGQLKIQANNPEQEEAEEEISVDYE-GSSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALLQEAGNDDSSYVVMPMR 366
>gi|71736736|ref|YP_272317.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557289|gb|AAZ36500.1| DNA polymerase III, beta subunit [Pseudomonas syringae pv. phaseolicola 1448A] (367 aa)
Score = 163, Expect = 1.7e-09, Identities = 80/371 (21%), Positives = 162/371 (43%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI---------NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E A   E G I +  +    I   L N+ +   K+D+S + VK       ++ +    +P +         N   +   +L I    F  +   V+Y +N     + + +GI          L  +ATDG++LA        E   +   IV    ++E+   + + D  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  +S  L++  ++ +   ++E +S +    +   I  N  +LL +L     + + +  SDS    L+++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLEEPA---EPGEITVPARKLMDICKSLSNDALIDIKLDDSKLIVKAGRSRFTLSTLPANDFPTVEEGPGSLTFNLVQSKLRRL-IERTSFAMAQQDVRYYLNG--MLLEVSAGI----------LRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSR-TAILSNEKYRGIRLQLASGQLKIQANNPEQEEAEEEISVEYN-GDSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALVQESDNDDSAYVVMPMR 366
>gi|94984112|ref|YP_603476.1| DNA polymerase III, beta subunit [Deinococcus geothermalis DSM 11300] >gi|94554393|gb|ABF44307.1| DNA polymerase III, beta subunit [Deinococcus geothermalis DSM 11300] (360 aa)
Score = 163, Expect = 1.8e-09, Identities = 71/371 (19%), Positives = 156/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVS-CKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+  V+K  L   L L   +  +  S+P+     +E ++  +  + +N  I     V     A +      +I    F  I+  L  E++ LE +    + V+    D  +   D E YP ++F  +    +S+      +++  V+YA +N   +  +  GI         +  ++A+DGY++A   F ++     +++     + L+ ++  D        E  +        +  K+++G++P+  R+I    + +V +    L EA+ R   ++     + V+   S   L ++ +  D G +++T+   +G       ++ N   +L  L   + D   + FS S  P + R     +++ ++V +R
  S:     1 MRAHVTKKTLSEGLGLLERVIPSRSSNPLLTALKVEASEAGLTLSGTNLEIDLSYFVP----AEVQAPQSFVIPAHLFAQIVRNLGGELVELE-LTGGELSVRAGGSDFKLQTGDLEAYPPLSFPTH--TDVSLDAAELARALGSVRYAASNEAFQA-VFRGIKLEH--RPASARVVASDGYRVAIRDFPASGDGRNLIVPARSADELIRVLK-DGEARFTYGEGLLSVTTDRVRMNLKLLDGEFPDYERVIPKDVKLQVTLPATALKEAVGRVAVLADKNANNRVEFLVSEGKLRLA-AEGDYGRAQDTLDVVQGGAEPAMSLAFNARHVLDALGPIEGD-AELLFSGSTSPAIFRASGGGDYMAVMVTLR 359
>gi|81251077|gb|ABB69879.1| DNA polymerase III beta chain [Nitrosospira sp. TYM9] (369 aa)
Score = 163, Expect = 1.8e-09, Identities = 89/371 (23%), Positives = 181/371 (48%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANIL-EKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFRIVL--DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE    +I F  ++  I    I    EDAN   E+  + +  K    I+  L +++ +TLE  +N  +  K      N+  +  E +P    S     ++++     K  +S V+YA+     +   ++G+    +  +  L+++ATDG++LA        PQ+ + V+     ++EL   + D D  + +   ++ + F  SN I+ SK+++G +P+ +R+I    E + +I++  L++ L+R  +I S+EK   V+L  +S  L +  ++S+   ++E +  + +  E   I  N  +LL +L   + + +   F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKREKISFIATDLEIQ---ITTSVEDANPAGEERSVTVPAKKLQDILRALPDKVQVTLETGENR-LHAKAGKSRFNLQTLPVEDFPKFPESTEPQAKITVQQKELKHILSMVQYAMAQQDIRC-YLNGLLL--LMEDSYLKVVATDGHRLAFALMLLAAPQEKKEVILPRKVVLELSRLLNDVDEPVTMEFLQNQVRFTFSNVILVSKVVDGKFPDYNRVIPEGYEKQFDINRLLLLQTLQRA-SILSNEKFRGVRLILTSGNLRIVCNNSEQEEAQEELELQYE-GEALDIGFNITYLLDVLNHLNCETVRCAFGDANSSALISIPGNNDFKYVVMPMR 368
>gi|81251050|gb|ABB69859.1| DNA polymerase III beta chain [Nitrosospira sp. HBN8222A] (369 aa)
Score = 163, Expect = 1.9e-09, Identities = 83/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F  ++  +      + ++     E+  + +  K    I+  L  ++ +TLE  D S ++ K      N+  +  E +P    S      + +     K  +S V+YA+ +   +  +   +     +  K   ++ATDG++LA      E+  +   ++L   ++ EL   + + +  + I + ++ + F  SN I+ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  +++ L +  ++S+   ++E +  +    E   I  N  +LL +L   D + +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIATD--LEIQITTSATDGGKADEEYSVTVAAKKLQDILRALPEKVQVTLETSD-SRLQAKAGKSRFNLQTLPAEDFPKFPESNEPQGTVKVQQKELKHLLSMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALMMLETPLEKKEVILPRKVVLELARLLNETEEPVTIEVLQNQVRFTFSNVILVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTTDNLRIVCNNSEQEEAQEELELQYD-GEGLDIGFNITYLLDVLNNTDCETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|81251062|gb|ABB69868.1| DNA polymerase III beta chain [Nitrosospira sp. TCH716] (369 aa)
Score = 162, Expect = 2.3e-09, Identities = 84/371 (22%), Positives = 175/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F  ++  +      + ++     E+  + +  K    I+  L   + +TLE  D S ++VK      N+  +  E +P    S      + +     K  +S V+YA+ +   +  +   +     +  K   ++ATDG++LA      E+  +   ++L   ++ EL   + + +  + I + ++ + F  SN I+ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  ++  L +  ++S+   ++E +  +    E   I  N  +LL +L   D + +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIATD--LEIQITTSATDGGKADEEYSVTVAAKKLQDILRALPERVQVTLETSD-SRLQVKAGKSRFNLQTLPAEDFPKFPESNEPQGTVKVQQKELKHLLSMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALMMLETPLEKKEVILPRKVVLELARLLNETEEPVTIEVLQNQVRFTFSNVILVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTTGNLRIVCNNSEQEEAQEELELQYD-GEGLDIGFNITYLLDVLNNTDCETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|28867245|ref|NP_789864.1| DNA polymerase III subunit beta [Pseudomonas syringae pv. tomato str. DC3000] >gi|28850479|gb|AAO53559.1| DNA polymerase III, beta subunit [Pseudomonas syringae pv. tomato str. DC3000] (367 aa)
Score = 162, Expect = 2.4e-09, Identities = 79/371 (21%), Positives = 162/371 (43%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNI---------NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E A   E G I +  +    I   L N+ +   K+D+S + VK       ++ +    +P +         N   +   +L I    F  +   V+Y +N     + + +GI          L  +ATDG++LA        E   +   IV    ++E+   + + D  + I L + +I          SK+++G +P+  R++    +  V   +++L EA  R  AI S+EK   ++L  ++  L++  ++ +   ++E +  +    E   I  N  +LL +L     + + +  SDS    L+++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLEEPA---EPGEITVPARKLMDICKSLPNDALIDIKLDDSKLIVKAGRSRFTLSTLPANDFPTVEEGPGSLTFNLVQSKLRRL-IERTSFAMAQQDVRYYLNG--MLLEVSAGI----------LRAVATDGHRLAMCSMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQSLREAFSR-TAILSNEKYRGIRLQLANGQLKIQANNPEQEEAEEEIGVEYN-GEALEIGFNVSYLLDVLSVMTTEQVRLILSDSNSSALVQESDNDDSAYVVMPMR 366
>gi|77456230|ref|YP_345735.1| DNA polymerase III subunit beta [Pseudomonas fluorescens PfO-1] >gi|77380233|gb|ABA71746.1| DNA polymerase III, beta subunit [Pseudomonas fluorescens PfO-1] (367 aa)
Score = 162, Expect = 2.7e-09, Identities = 77/371 (20%), Positives = 156/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST--PQDFR--IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V+  ++  T ++  +     V   E A   E G I +  +    I   L N+ +   KVD   + VK       ++ +    +P +          S+     ++ I +  +A+     +   ++G+      S   +  +ATDG++LA    ++    QD    IV    ++EL   + + D N+ I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  +S  L++  +++      E             I  N  +LL +L     + + +  SDS    L+++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVDGQQLSLTGTDLEVELVGRVQLEEPA---ETGSITVPARKLMDICKSLPNDALIDIKVDEQKLVVKAGRSRFTLSTLPANDFPTVEEGPGSLTT-SLEQSKLRRLIERTSFAMAQQDVRY-YLNGMLLEV--STGVIRAVATDGHRLAMCSMQADIGQQDRHQVIVPRKGILELARLLTEPDGNVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSR-TAILSNEKYRGIRLQLASGQLKIQ-ANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALVQESDNDDSAYVVMPMR 366
>gi|16124411|ref|NP_418975.1| DNA polymerase III subunit beta [Caulobacter crescentus CB15] >gi|1352300|sp|P48198|DPO3B_CAUCR DNA polymerase III subunit beta >gi|1049324|gb|AAB51448.1| DNA polymerase III beta subunit >gi|13421269|gb|AAK22143.1| DNA polymerase III, beta subunit [Caulobacter crescentus CB15] (372 aa)
Score = 162, Expect = 2.7e-09, Identities = 79/371 (21%), Positives = 165/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNS---VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISS--EKTLEIIATDGYKLAHYKFES-----------TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ AL    S+ E   + P+    L+    + + F+ ++  +     +     A I   G+I       + I+ KL +   ++L    +    VI+   S F  N+ ++    +P ++ S    +++++      + I K ++A++  + +   ++G+  ++++   E  L  +ATDG++LA  +  +            P+   I     L+E   E +D   + +       + F+     + SK+I+G +P+  R+I       + +      +A++R +A  S+EK   VKL      + ++  + + G + E V       EP  I  N  +LL +            F+D   P L+ D  DP    +L+P+R
  S:     1 MKLTIERAALLKALGHVQSVVERRNTIPILSNILLSAEGDRLSFSATDLDME----IIDEGFAQIDVPGQITAPAHTLYEIVRKLPDGADVSLSFSGDDPRLVIQAGRSRF--NLPVLPAGDFPVMS-SDGLSSRIAVDTNELIRLIDKTRFAISTEETRY-YLNGLYVHTVNEGGETKLRAVATDGHRLALAEMPAPEGAVGIPGVIVPRK-TIAEARRLMESAGETVDLQVSPQ------KVRFEFGAAALTSKVIDGAFPDYMRVIPRDNAKILTLDNDLFAKAVDR-VATISAEKSRSVKLAVEPGRITLTVRNMEAGQAVEEVEVDYD-GEPFEIGFNARYLLDVCGQIAGPQAEFRFADPASPTLVVDPVDPGVKYVLMPLR 371
>gi|23006928|ref|ZP_00049021.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Magnetospirillum magnetotacticum MS-1] (328 aa)
Score = 162, Expect = 2.7e-09, Identities = 62/309 (20%), Positives = 154/309 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKV-DNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEI--IATDGYKLAHYKFESTPQDFR-----IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTI-IASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKE 315
           M++ V +  L+ +L   + + E   + P+    L+   ++ ++   ++  I     V ++  A++L+ G   +     + I+ KL +   ++LE   D   + +++      +  + E  +P++       +  SI+    K  I K ++A++  + +   ++GI  +++  +  L++  +ATDG++LA  +  + P+  R     IV   ++ E+   + D   ++++ L  + I    +  + + SK+I+G +P+  R+I +  +  + + +    +A++R ++  SSE+   VKL  +   + +S ++ D G+  E
  S:     1 MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRTGEDGLRLKATDLDIE----VTETVPADVLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGDTGQMTIRSGRSRFALGALPEGDFPDLAAGELP-HSFSIAAAELKLLIEKTQFAISTEETRY-YLNGIYLHTVEVDGALKLRAVATDGHRLARVE-TAAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQVELSPAKIRLTFAGGVTLISKLIDGTFPDYQRVIPSGNDKHLTVVRDAFAKAVDR-VSTISSERGRAVKLAMADGRVALSVTNPDAGSRTE 311
>gi|59710617|ref|YP_203393.1| DNA polymerase III subunit beta [Vibrio fischeri ES114] >gi|59478718|gb|AAW84505.1| DNA polymerase III, beta subunit [Vibrio fischeri ES114] (366 aa)
Score = 161, Expect = 2.7e-09, Identities = 72/371 (19%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL---KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + ++ L+  L+  +       S P+    L++V + ++  T ++  +   S +    D    E G + + ++ F  I   L    N  I LE  D  +++   S F   +  +    +PNI   +    ++++S    +K I   ++++ N   +   ++G+ F +         +ATDG+++A  +   ES   + ++++    I+ L+ ++D  + ++ +    SN+  +V+N +  SK+++G +P+  R++       +      L +A  R  AI S+EK   V++N ++  + ++ ++ +   ++E +    + ++   I  N  ++L +L T   + + +  + +    L+ D  +     +++PIR
  S:     1 MKFSIERSLLLKPLQQVSGALGGRPSLPILGNILLQVENGQLSMTATDLEVELISKITLEGD---FEAGAVTVPSRKFLDICRGLPDSANITIVLEG-DRVLVRSGRSRF--TLATLPANDFPNIE-GWESEVEITLSQAQLRKLIESTQFSMANQDVRY-YLNGMMFET--QGNIFRSVATDGHRMAVCNMPVESELPEQQVIMPRKGIQELVRLLDSPEQSVTLQFGNSNVRAEVNNFVFTSKLVDGRFPDYRRVMPQSSNKTLEADCDELRQAFARA-AILSNEKFRGVRVNLANNQMRITANNPEQEEAEEILDVDFQGDD-IEIGFNVSYVLDVLNTLKCERVRISMTTANASALVEDCANDEAQYVVMPIR 365
>gi|84497193|ref|ZP_00996015.1| DNA polymerase III subunit beta [Janibacter sp. HTCC2649] >gi|84382081|gb|EAP97963.1| DNA polymerase III subunit beta [Janibacter sp. HTCC2649] (377 aa)
Score = 161, Expect = 2.7e-09, Identities = 77/344 (22%), Positives = 162/344 (47%)
  Q:    34 PVFLGTLIEVNDN-EIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIIDFDTNIEIFLFESN-----IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEP-TPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR------DEKDPNFLQILVPIR 377
           PV  G LIE ND   +  +  +  +S    V     A + E G +L+  +    I   L N+ + +E V  S ++V   +   ++  M  + YP +  S       SI   +F +++++V  A +   + + I++G+    I  +K + ++ATD Y+LA  +    P D      +++    +      +    +I++ L  +      + F+  +    +++++G+YP VS I  T  E +  ++   LVEA++R   +  +E+ + V+L F+   + +   + +   + E V  +  +  P   ++ N  FLL  L     +   + F+   +P +L        E D ++  +++P+R
  S:    28 PVLAGILIEANDEGTVTLSAFDYEVSARLTVP----AEVSESGTVLVLGRLLADISRNLPNKPVDVE-VQGSKVQVVCGSSRFSLLQMPSDDYPTLPSSPEPSG--SIDGQLFTQAVNQVSIAADRG-DTLPILTGVRV-EIEGDK-MTLLATDRYRLAMRELTWNPTDSAASHIVLVPARTLADTARSLGASGSIDVALGSAAGGDGLVGFEAGSRRTTTRLLDGEYPKVSSIFPTTSETESVVNTAELVEAVKRVALV--AERNTPVRLRFTEGQVAIEAGTGEDAQASEAV--EATLTGPDVEVAFNPGFLLDGLGAVGTEFSRLSFTQPSRPAVLSGQAEADGEADTSYRYVIMPVR 374
>gi|81251065|gb|ABB69870.1| DNA polymerase III beta chain [Nitrosospira sp. PJA1] (369 aa)
Score = 161, Expect = 2.9e-09, Identities = 84/371 (22%), Positives = 176/371 (47%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAH--YKFESTPQDFRIVLDVSLI-ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE     I F   +  I   +       A+  E+  + +  K    I+  L  ++ +TLE  DN  ++ K      N+  +  E +P    S      + I     K  +S V+YA+ +   +  +   +     +  K   ++ATDG++LA      E+  +   ++L   ++ EL   + + +  + I + ++ + F  SN ++ SK+++G +P+ +R+I T  + + +I++  L++ L+R  AI S+EK   V+L  +++ L +  ++S+   ++E +  +    E   I  N  +LL +L   +++ +T  F D+    L+    + +F  +++P+R
  S:     1 MKLIEADRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQENISFIAPDLEIQITTYTTDGGKAD--EEYSVTVAAKKLQDILRALPEKVQVTLETSDNR-LQAKAGKSRFNLQTLPAEDFPKFPESNEPQGTVKIQQKELKHLLSMVQYAMAHQDIRYYLNGLLLLLENNQLK---VVATDGHRLAFALIMLETPLEKKEVILPRKVVLELSRLLNETEEPVTIEVLQNQVRFTFSNVVLVSKVVDGKFPDYNRVIPTGYQKQFDINRLLLLQTLQRA-AILSNEKFRGVRLILTTDNLRIVCNNSEQEETQEELELQYN-GEGLDIGFNITYLLDVLNNAESETVTCAFGDANSSALITIPGNDSFKYVVMPMR 368
>gi|56707189|ref|YP_169085.1| DNA polymerase III, beta chain [Francisella tularensis subsp. tularensis SCHU S4] >gi|89255451|ref|YP_512812.1| DNA polymerase III, beta chain [Francisella tularensis subsp. holarctica] >gi|110669659|ref|YP_666216.1| DNA polymerase III, beta chain [Francisella tularensis subsp. tularensis FSC198] >gi|115313983|ref|YP_762706.1| DNA-directed DNA polymerase [Francisella tularensis subsp. holarctica OSU18] >gi|134301171|ref|YP_001121139.1| DNA polymerase III, beta subunit [Francisella tularensis subsp. tularensis WY96-3418] >gi|156501372|ref|YP_001427436.1| DNA polymerase III, beta subunit [Francisella tularensis subsp. holarctica FTNF002-00] >gi|56603681|emb|CAG44635.1| DNA polymerase III, beta chain [Francisella tularensis subsp. tularensis SCHU S4] >gi|89143282|emb|CAJ78443.1| DNA polymerase III, beta chain [Francisella tularensis subsp. holarctica LVS] >gi|110319992|emb|CAL08018.1| DNA polymerase III, beta chain [Francisella tularensis subsp. tularensis FSC 198] >gi|115128882|gb|ABI82069.1| DNA-directed DNA polymerase [Francisella tularensis subsp. holarctica OSU18] >gi|134048948|gb|ABO46019.1| DNA polymerase III, beta subunit [Francisella tularensis subsp. tularensis WY96-3418] >gi|134252689|gb|EBA51783.1| DNA polymerase III, beta chain [Francisella tularensis subsp. holarctica 257] >gi|151569642|gb|EDN35296.1| DNA polymerase III [Francisella tularensis subsp. tularensis FSC033] >gi|156251975|gb|ABU60481.1| DNA polymerase III, beta subunit [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157121327|gb|EDO65528.1| DNA polymerase III [Francisella tularensis subsp. holarctica FSC022] (367 aa)
Score = 161, Expect = 3.1e-09, Identities = 86/371 (23%), Positives = 186/371 (50%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKV-KTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK-------FESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M  ++++  L+  L+   S++ +  + P+    L ++++N +K T S+        +A S +  I    ++ +     + I+  L +N MI     +N V  V   STF  N+  ++ + YP I+ + N+     +S   F   ISKV +++ N+  +   ++G+ F  I++   L  ++TDG++++  +        +S  Q   I+   +++EL   +   + NI+I L ++ +     N    SK+I+G YP+  ++I       + + K+    +L R  +I +++K   V+LN S   L +S ++ D   +++ +  +   ++P  I  N  +LL ++     + +++   +     L++DEKD N L I++P++
  S:     1 MNFVLNRDDLLKPLQSMLSVANSKSTMPLLSCILFDIDNNNLKITASDLDTEISCNIAVSCNTTI----KLALNADKIYNIVRSLNENSMIDFRINENKVTIVSNNSTF--NLISLNADNYPLIDSNINEQASFDLSQQDFHHIISKVDFSMANDDTRY-FLNGM-FWEINA-NLLRAVSTDGHRMSITEAIIDSKVLDSASQS--IIPKKAILELKKIVGKTEENIKICLGKNYLKAIFGNYAFISKLIDGRYPDYQKVIPKNNTKLLAVDKQFFKNSLLR-TSILANDKYKGVRLNISQNQLLLSANNPDNEKAEDKIEVQYN-DQPMEICFNYKYLLDIINVLSEETMSIYLDNPNMSALVKDEKD-NSLFIIMPMK 366
>gi|49086146|gb|AAT51331.1| PA0002 [synthetic construct] (368 aa)
Score = 161, Expect = 3.1e-09, Identities = 75/371 (20%), Positives = 159/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E + + PV    L+ V   ++  T ++  +    +V +    +  E G I +  +    I   L N+++   +V+   + VK       ++ +    +P +       N  SI+    ++ I +  +A+     +   ++G+      +  TL  +ATDG++LA    ++  P   R   IV    ++EL   + + D  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  S+ +L++  +++      E             I  N  +LL +L     + +    SDS    L+ +  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERLQTLPVLSNVLLVVEGQQLSLTGTDLEVE---LVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLN-FSIAQSKLRRLIDRTSFAMAQQDVRY-YLNGMLLEV--NGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSR-TAILSNEKYRGIRLQLSNGLLKIQ-ANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMR 366
>gi|89885797|ref|YP_515995.1| DNA polymerase III, beta subunit [Rhodoferax ferrireducens T118] >gi|89347795|gb|ABD71997.1| DNA polymerase III, beta subunit [Rhodoferax ferrireducens T118] (378 aa)
Score = 161, Expect = 3.4e-09, Identities = 70/299 (23%), Positives = 139/299 (46%)
  Q:    79 IKTKPFFAIISKLKN-EMITL--EKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTP---ISLNNHFLLSLLKTFDNDNITVEFSDSFKP--VLLRDEKDPNFLQILVPIR 377
           ++++    I+  + N E +TL  E  D+ V+     TF   ++ +  + +P +  + N      I   V K  I K  +A+  +  +  ++ G+ F  +     L +  +DG+++A  +     S P    ++L   S++EL     D D  +E+ L  +    +       +K++EG +P++  ++    +N V +S+  L+ A++R  A+  S+K + V+     +++             ETV     V    P   I  N  +LL  L T + D++ + FS +  P   L+    D +F  IL+P+R
  S:    73 VESRKLMDILQTMANDEPVTLASENPDHLVLTGANGTF--KLSCLPADDFPRMEIAPNYQETFRIKQGVLKGLIEKTGFAMALHDIRYYLI-GMQF--VVEGGRLTVCTSDGFRVATDEVAVESSIPTRREVILPRKSVLELKRLTRDTDDQVEVQLSANQARIRFGALEFVTKLVEGKFPDIRAVVPQHNDNVVTLSRSALLLAIQRA-AVIMSQKVNGVRFILDHDLISGHLKVESSNEKNETVDLSMPVEYSGPMVDIGFNVKYLLDALPTMEGDDLVLAFSHTLVPGAALMTLPSDDHFKYILMPMR 377
>gi|113460283|ref|YP_718342.1| DNA polymerase III subunit beta [Haemophilus somnus 129PT] >gi|170718298|ref|YP_001783357.1| DNA polymerase III, beta subunit [Haemophilus somnus 2336] >gi|112822326|gb|ABI24415.1| DNA polymerase III, beta subunit [Haemophilus somnus 129PT] >gi|168826427|gb|ACA31798.1| DNA polymerase III, beta subunit [Haemophilus somnus 2336] (366 aa)
Score = 161, Expect = 3.5e-09, Identities = 75/371 (20%), Positives = 175/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNE--MITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQ---LSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSC--KGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+ IVS+  L+  L+    +  +  + P+    L+++  N ++ T ++    + +   ++  S+D      G   I  K F  I     +E  +  + + + ++++   S F  N+  +  ++YPN+     DW       +     ++ I   ++++ N   +   ++G+ F +      L  +ATDG++LA      E       ++L    ++EL+  + + +    + +  +N+   + + I  SK+I+G +P+  R++     + +  + + L +A  R +AI SS+K   V+L  +S  L+++ ++ +   ++E +     G   E   +  N  ++L +L       + + F+D+    LL D  D +   +++P+R
  S:     1 MQFIVSREHLLKPLQQVCGVLSSRPNFPILNNVLLQIEGNVLRITGTDLEVELSTQAQLIQASQD------GSYTIPAKKFLDICRSFPDEAEITVIFEEERALVRSGRSKF--NLTALPADEYPNLA----DWQSEVDFYLPQSTLRRLIEATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTIPLEQDLHTHAVILPRKGILELMRLLENSEHAAHVQIGTNNLRIDLGSIIFTSKLIDGRFPDYRRVLPRNATHIMEGNWELLKQAFAR-MAILSSDKVKTVRLQLTSNQLKITATNPEQEVAEEILDVIYNGADME---VGFNVSYILDVLNALKCQQVRLCFTDASSSCLLEDADDESAEYVVMPMR 365
>gi|119714274|ref|YP_921239.1| DNA polymerase III subunit beta [Nocardioides sp. JS614] >gi|119534935|gb|ABL79552.1| DNA polymerase III, beta subunit [Nocardioides sp. JS614] (408 aa)
Score = 161, Expect = 3.5e-09, Identities = 74/346 (21%), Positives = 163/346 (47%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQD----------FRIVLDV--SLI---ELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-----DEKDPNFLQILVPIR 377
           S PV  G L+E +D+ +  +T +   S  + +     A + ++G+ L+  +    I   L  + + +  +D + + +   +   ++  M  + YP++          ++    F  ++++   A   + + + +++G+      S  T+ ++ATD ++L+H + E +P+            R++ D   SL    E+ + +    +   I  FE +    +  T   +++++G++P V  +     +    + K  LVE+++R   +  +E+ + V+L FS  VL +   S D   + E++       E      N  FLL  L   D   + + F+ + KPV++      D+ D +F  +L+P R
  S:    55 SVPVLAGLLVEASDDGLVLSTFDYETSARATLT----AEVSDEGQALVSGRLLADICRSLPAKPVEM-VLDGARVSLTCGSARFSLQTMPVDDYPSL--PSMPAATGTVQSEAFAHAVAQAVTAAGRD-DMLPVLTGVRIEIDGS--TISLLATDRFRLSHRELEWSPRTPDESAAALVPARVLGDTAKSLTGGGEVTIALATTGSGEGIIGFEGHGPGGLRRT--TTRLLDGEFPKVRSLFPNEHQTTALVDKAALVESVKRVALV--AERNTAVQLAFSDGVLTLDAGSGDEAQASESIEATID-GEDITTGFNPQFLLDGLTAIDQPVVELAFTQASKPVVISGAVDGDDTDSSFRYLLMPRR 405
>gi|91781386|ref|YP_556592.1| DNA polymerase III subunit beta [Burkholderia xenovorans LB400] >gi|187922037|ref|YP_001893679.1| DNA polymerase III, beta subunit [Burkholderia phytofirmans PsJN] >gi|91685340|gb|ABE28540.1| DNA polymerase III, beta subunit [Burkholderia xenovorans LB400] >gi|187713231|gb|ACD14455.1| DNA polymerase III, beta subunit [Burkholderia phytofirmans PsJN] (367 aa)
Score = 160, Expect = 4.4e-09, Identities = 67/365 (18%), Positives = 167/365 (45%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     +     +  +    I+  + +  +TL  +++  + V++      +  +  +++P +  + +    L +    F++ +  V +++     +   ++G+    +     L  +ATDG++LA    K E + Q   +++   +++EL   + D D  ++I + ++ + F      + SK++EG +P+  R+I    +N+  I ++ L  +L+R  AI +S+K   V+       L++  +++D   ++E +       +   I  N  +LL +L     D + V   D+    L+   ++  F  +++P+R
  S:     8 RDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGDSVATTVAARKLLDILRAMPDGQVTL-TLNDKRLTVQSGKSRFALQTLAADEFPTVAQAKDYGANLVVPQKTFRQLLGMVHFSMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAFSSMKIEGSFQRQEVIIPRKTILELQRLLEDIDDTLKIDIAQTQVKFTFGQVELVSKLVEGKFPDFQRVIPKSHKNQFVIGREELQRSLQRA-AILTSDKFKGVRCIIEPGQLKIMSTNADQEEAQEELEIAYD-GDSVDIGFNVTYLLDVLANLKVDTLQVSLGDASSSALITIPENDEFKYVVMPMR 366
>gi|33322985|gb|AAQ07229.1|AF496537_1 DNA polymerase III, beta chain [Lactobacillus delbrueckii subsp. lactis] (153 aa)
Score = 160, Expect = 4.5e-09, Identities = 40/149 (26%), Positives = 79/149 (53%)
  Q:   210 LIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVK--LNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP 358
           L EL   I D D +I+++L +S I F+  N    ++++EG YP+V R++ T     V  +   L++ L R   ++ + + + V+  LN + + + VS +S ++G  +E V           IS N  ++ + L+    D++ + F++S +P
  S:     1 LQELAQIIGDADQDIKVYLGDSQIRFEFENLSFYTRLLEGAYPDVDRLLPTESTTSVQFAVSDLMQTLSRASLLTHANRTNAVQMTLNVADQTVLVSGNSPEVGKIEEEVGFSSLTGRDLTISFNPDYMAAALRASVTDSVIINFTESLRP 151
>gi|81251073|gb|ABB69876.1| DNA polymerase III beta chain [Nitrosospira sp. NRS527] (369 aa)
Score = 160, Expect = 4.5e-09, Identities = 88/371 (23%), Positives = 180/371 (48%)
  Q:     7 MKII-VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANIL-EKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFRIVL--DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+I   +  L+  L+    I E   + P+    LIE    +I F  ++  I    I    ED N   E+  + +  K    I+  L +++ +TLE  +N  +  K      N+  +  E +P    S     +++I     K  +S V+YA+     +   ++G+    +  +  L+++ATDG++LA        PQ+ + V+     ++EL   + D D  + +   ++ + F  SN ++ SK+++G +P+ +R+I    E + +I++  L++ L+R  +I S+EK   V+L  +S  L +  ++S+   ++E +  + +  E   I  N  +LL +L   + + +   F D+    L+    + +F  +++P+R
  S:     1 MKLIETDRDTLLKPLQTVTGIVERRHTLPILSNVLIERKQEKISFIATDLEIQ---ITTSVEDVNPAGEERSVTVPAKKLQDILRALPDKVQVTLETGENR-LHAKAGKSRFNLQTLPVEDFPKFPESTEPQAKITIQQKELKHILSMVQYAMAQQDIRY-YLNGLLL--LMEDNYLKVVATDGHRLAFALMLLAAPQEKKEVILPRKVVLELSRLLNDVDEPVTVEFLQNQVRFTFSNVMLVSKVVDGKFPDYNRVIPEGYEKQFDINRLLLLQTLQRA-SILSNEKFRGVRLILTSGNLRIVCNNSEQEEAQEELELQYE-GEALDIGFNITYLLDVLNHLNCETVRCAFGDANSSALISIPGNNDFKYVVMPMR 368
>gi|71279230|ref|YP_266784.1| DNA polymerase III, beta subunit [Colwellia psychrerythraea 34H] >gi|71144970|gb|AAZ25443.1| DNA polymerase III, beta subunit [Colwellia psychrerythraea 34H] (367 aa)
Score = 159, Expect = 4.6e-09, Identities = 76/344 (22%), Positives = 163/344 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           P+    L EV+   +  T ++  +    +VA +E  N  + G+I I  +    I   L ++ +I+ E +D + IK+ +     +++ +    +PNI     D  +  +    F + I    +++ N   +   ++G+   S  +E  +  +ATDG++LA  K      + P    IV    ++E++  +   D  +++FL  ++I    S     SK+++G +P+  R++    +     +K  L + L R  +I S+EK   V+LNFS   L+++ ++ +   ++E +       E   I  N  ++L +L    ++N+    +D+   V++    +   L +++P+R
  S:    28 PILSNILFEVSGQSLTLTATDLELE---MVAYAEIQNQGDDGKITIPARKLLDICKSLPESSLISFEVIDET-IKLSSGRSKYSLSTLPAVDFPNIEEWKGDV-EFQLLKSEFLRLIESTHFSMANQDVRY-YLNGMSIESEGNE--IRSVATDGHRLAICKISNETLALPARQVIVPRKGILEIIRLLAPVDEAVQVFLGSNHIRIIDSEFSFTSKLVDGRFPDYRRVLPRNGDKVFETNKDALRQVLSRA-SILSNEKFKGVRLNFSDTNLKITANNPEQEQAEEEIEINFPYGE-LEIGFNVSYVLDVLSAIKDENVKFTLADANSSVVIEGSSNGEALYVVMPMR 366
>gi|54021966|ref|YP_116208.1| DNA polymerase III subunit beta [Nocardia farcinica IFM 10152] >gi|54013474|dbj|BAD54844.1| putative DNA polymerase III beta subunit [Nocardia farcinica IFM 10152] (386 aa)
Score = 159, Expect = 5.6e-09, Identities = 79/344 (22%), Positives = 162/344 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLFE---SNIIFKVSNT--IIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL--RDEKDP-------------NFLQILVPIR 377
           PV  G L+  N++ +  +  +  +S    VA    A +   G +L+  +    I   L N+ + +  VD + + +   +   ++  M  E YP +        +LS+   VF +++ +V  A   + + + +++GI      S+  L   ATD ++LA    E TP    I   V     +L E    +   D  +++ L     S+ +  + N      +++++ ++P   +++     +   ++   L EA++R   ++  E+ + V+L FS+E L +S    D G ++E +    +  EP  I+ N  +L+  L     D +T  F+   +P +L    E++P             N+  +L+P+R
  S:    28 PVLGGVLLVANEDGLTVSGFDYEVSAQMRVA----AEVAGPGEVLVSGRLLADITKALSNKPVDVS-VDGTRVLITCGSAKFSLPTMPVEDYPQLPEVPQQTGELSVD--VFAEAVGQVAVAAGRD-DTLPMLTGIRVEIEGSQVVLA--ATDRFRLAVRHIEWTPARPDIETAVLIPARTLSEAAKTLGASDAPVQLSLGTGAGSDGLLGIVNAGRRTTTRLLDAEFPKFRQLLPKEHTSVATLAVAALTEAIKRVALVA--ERGAQVRLEFSTEGLLLSAGGDDAGRAEEWLEADFR-GEPLTIAFNPGYLVDGLSALHADRVTFGFTTPSRPAVLLPASEEEPQTLDSGAFAALTGNYTYLLMPVR 383
>gi|154174460|ref|YP_001407306.1| DNA polymerase III subunit beta [Campylobacter curvus 525.92] >gi|112803507|gb|EAU00851.1| DNA polymerase III, beta subunit [Campylobacter curvus 525.92] (355 aa)
Score = 158, Expect = 6.3e-09, Identities = 63/291 (21%), Positives = 145/291 (49%)
  Q:    65 KSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES-TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDS 355
           K  +  I ++G      K    II  LK++ + LE V+N + IK K S +   + +   E +P    S    ++  +  ++  +S+ K+  ++++N  K  +   +       +  + I+ TD  +L+ +KFE+ T ++F I++    I  + ++  F   IEI+  E+ +I + +N    +K+I G YP+  R++    + ++ +++  +++ + R +++ S +    +K+ F+ + +       D   +K T+  +  + +   I + N +LL  L + ++D+  + F+DS
  S:    56 KLSNVKITDEGYATANGKKLLDIIKSLKDDEVILETVNNYLYIKQKNSKY--KLPMYKFEDFPEFPSSEGK-SKFDVDAVMLGRSLKKILPSIDSNNPKFELNGALL---DIRQNFINIVGTDTKRLSIFKFETPTEREFSIIIPKKAINEIQKL--FFDRIEIYYDENILIAQSANFEFFTKLINGKYPDYERVVPKEIKKRLKLNRDKMIDGI-RTISMLSDQ----MKITFTKDSITFESIIEDNSEAKTTIEYQTGLEDEIFIGIKNRYLLDFLTSIEDDDFELGFNDS 335
>gi|90415377|ref|ZP_01223311.1| DNA polymerase III, beta subunit [marine gamma proteobacterium HTCC2207] >gi|90332700|gb|EAS47870.1| DNA polymerase III, beta subunit [marine gamma proteobacterium HTCC2207] (366 aa)
Score = 158, Expect = 6.7e-09, Identities = 77/371 (20%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV----SLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  +S+  L+N L+L   + E   + P+    L+ ++ + +  T ++  +    I+  ++  +  E G + +  + F  I   L +   I     D    +V +      +  +   ++P+++   N+  Q  I+ ++ K  I    +A+     +   ++G+ +  +S+ K L  +ATDG+++A    E   +   +   +     +IEL   + D +  + + +  ++I    S+    SK+++G YP+  R++    +  V  ++  L +A  R  AI S+EK   V++  S+  +++  ++ +   ++E V      +E   I  N  +LL +L     D + +  SDS    L+ D  D + + +++P+R
  S:     1 MKFSLSREALLNPLQLVVGVVERRQTLPILSNVLLTLDGSRLAVTGTDLEVE---IIGHADVVSADEAGEVTVSARKFLDICRSLPEGANIKFSSSDGKA-QVVSGRSRFTLATLPANEFPSVDNGENNI-QFDIAGVILKNLIDATSFAMAQQDVRY-YLNGMLW-EVSANK-LRAVATDGHRMALCDAECNIEIGELTKAILPRKGVIELSRLVAD-EGVVRVAMGSNHIRVDGSDYCFTSKLVDGAYPDYDRVLPKGGDKLVEGNRAELKQAFGR-TAILSNEKYRGVRIMLSNGAIKMVANNPEQEEAEEEVGVDYAGDE-LEIGFNVSYLLDVLNVLKGDGVRLTLSDSSSSALVEDAADGSAVYVVMPMR 365
>gi|68535064|ref|YP_249769.1| DNA polymerase III subunit beta [Corynebacterium jeikeium K411] >gi|68262663|emb|CAI36151.1| DNA polymerase III, beta subunit [Corynebacterium jeikeium K411] (394 aa)
Score = 158, Expect = 6.8e-09, Identities = 75/330 (22%), Positives = 154/330 (46%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLS--ISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ--DFRIVLDVSLIELLLEIIDFDTN----IEIFLFESNII-------FKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           + P+  G +I  +D  ++ +  +  +ST   +    +A + E G+IL+  K    I+  L N+ I +E  D + + +KT      +  M  E YP +     +  +++  I P +F +SIS+V  A   + + + +++G+    I  E  + ++ATD ++LA   F+  P   D +  L +    L       D N    IEI +     I           +    +++++ ++P    ++        ++    L EA++R   ++  E+ S ++++F    + +S   SD+G++ ET+ C     EP  I+ N  +L   L       +   F+ + +P +L
  S:    31 TQPILRGVMIVADDEGLELSGFDREVSTRVRI----NAEVNEPGKILVAGKLASDIVGSLPNKPINIE-FDGTTVILKTGKSKFELPAMTIEDYPVLP----ELPEVTGTIDPNLFAESISQVAVAAGRD-DTLPMLTGVHV-EIDGENVI-MVATDRFRLAVRSFQWNPAQADAQAKLLIPARTLADTARSMDPNNTDPIEIAVGSGEDIGADGLLGISTESRHTTTRLLDAEFPKFRPLLPKTHTALASVEIAPLQEAIKRVSIVA--ERNSQIRMDFKDNTVTLSAGGSDVGSATETLDC-AFAGEPLVIAFNPSYLKEGLAAIHTPRVVFGFTMASRPAIL 360
>gi|88798538|ref|ZP_01114122.1| DNA polymerase III subunit beta [Reinekea sp. MED297] >gi|88778638|gb|EAR09829.1| DNA polymerase III subunit beta [Reinekea sp. MED297] (369 aa)
Score = 158, Expect = 6.9e-09, Identities = 76/367 (20%), Positives = 176/367 (47%)
  Q:    11 VSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYN------DWNQLS--ISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +++ +L+  L+L + + E   + PV    L+EV  N++  T ++  +     V  SE A+    G I +  K F  I+  L ++ +I+L++ ++ V +V +      ++ +   ++PNI    N        N LS  I    F  +   V+Y +N    ++N            +  +  ++TDG++LA    H    + P+  ++++    ++EL   + D D  +++++  +++          +K+++G +P+  R+I    + +V +  + +++A+    AI ++EK   V+++ S   L V  ++ +   ++  V       E   +  N  +LL ++     + +    +D+    LL D  D + + +++P+R
  S:     6 LAREQLLKPLQLVSGVVEKRQTLPVLSNVLLEVEGNQLALTGTDLEVELIGRVELSEPAS---DGAITVPAKKFLDIVRSLPEDAIISLQQTEDRV-QVASGRSKFTLSSLPATEFPNIEQDENAQEYRLPQNLLSQLIDATAFAMAQQDVRYYLNGMSVELN------------QSLVRTVSTDGHRLAMSSRHVDGLNVPERKQVIVPRKGILELNRLLSDDDQPVQLYIGSTHLRTTTDEFTFTTKLVDGKFPDYERVIPRGGDKEV-VGDRQVMKAIFSRAAILANEKYRGVRMSLSEGSLVVKANNPEQEEAEVAVEVDYSGPE-LEVGFNVSYLLDVMNVIRGEQVRFVLADANSSALLTDFDDDSSMYVVMPMR 368
>gi|62425104|ref|ZP_00380241.1| COG0592: DNA polymerase sliding clamp subunit (PCNA homolog) [Brevibacterium linens BL2] (379 aa)
Score = 158, Expect = 6.9e-09, Identities = 83/371 (22%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVN-DNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELL----LEIIDFDTNIEIFLFESN------IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEK------DPNFLQILVPIR 377
           +K  V++  L +A+        +  S+PV  G LI       ++ +  +  +S+   +A    A+++  G +L+  +    I   L N+ +TLE++D S + V  S+   ++  M   +YP++    +    +S     F+ ++S+V  A + + + + I++ +    I  EK + ++ATD Y+LA  +F   P       DVS + LL    L  +      ++ +  SN      I F  +  +  S ++EG+YP V  +          +    L EA+ R   ++  E+ + ++   S  +L +   + D   + E V    +  +P  +  N H++   L   ++  +   F+   KPV++  ++      D ++  +L+P R
  S:     8 LKFKVNRDVLADAVTWATKTLPSRPSAPVLTGILITAEAGGTVRLSVFDYEVSSRVEIA----ADVVTPGTVLVSGRLLADISKALPNQDVTLEQID-SKVDVTCSSSRFSLMTMPVGEYPSLPQVPDASGTVSAGE--FQNAVSQVTIATSKD-DTLPILTSVRV-EIEGEK-VTLLATDRYRLAVREFTWNPGR----PDVSAVALLRGRTLSDVSKSLGGDVTIGLSNDAGKDLISFTSAGRVTTSLLVEGEYPKVRSLFPDSVPIHAIVETGVLREAVRRVSLVA--ERNTPLRFEVSDGMLTLHAGTGDDAQASEAVEAVLQ-GDPITVGFNPHYIAEGLAAIESPYVNFSFTQPMKPVIISGQRDLESTADESYRYLLMPTR 378
>gi|186474775|ref|YP_001856245.1| DNA polymerase III, beta subunit [Burkholderia phymatum STM815] >gi|184191234|gb|ACC69199.1| DNA polymerase III, beta subunit [Burkholderia phymatum STM815] (367 aa)
Score = 157, Expect = 9.6e-09, Identities = 67/365 (18%), Positives = 166/365 (45%)
  Q:    13 KTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +  L+  L+  + I E   + P+    LI  N  ++ F +++  +    I  +++     E     +  +    I+  + +  +TL  +++  + V++      +  +  +++P +  + +    L++    F++ +  V +A+     +   ++G+    +     L  +ATDG++LA+   +   S  +   I+   +++EL   + D D  ++I +  + + F      + SK++EG +P+  R+I    +N   I ++ L  +L+R  AI +S+K   V+       L++  +++D   ++E +    +  +   I  N  +LL +L     D + +   D+    L+   ++  F  +++P+R
  S:     8 RDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSFLSTDLELQ---ITTRADFGVGGESVATTVAARKLLDILRAMPDGQVTL-TLNDKRLTVQSGKSRFALQTLAADEFPTVAQAKDFGANLAVPQKTFRQLLGMVHFAMAQQDIRY-YLNGMLL--VVDGDQLMAVATDGHRLAYSSMKIEGSFARQEVIIPRKTILELQRLLEDIDDVLKIDIAPTQVKFTFGGVELVSKLVEGKFPDFQRVIPKSHKNTFVIGREELQRSLQRA-AILTSDKFKGVRCIVEPGQLKIMSTNADQEEAQEELEIPYQ-GDSIDIGFNVTYLLDVLANLKVDMLEISLGDASSSALITIPENDEFKYVVMPMR 366
>gi|15595200|ref|NP_064722.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa PAO1] >gi|107098996|ref|ZP_01362914.1| hypothetical protein PaerPA_01000002 [Pseudomonas aeruginosa PACS2] >gi|116053722|ref|YP_788157.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa UCBPP-PA14] >gi|194548740|ref|YP_002083768.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa C3719] >gi|194554101|ref|YP_002089128.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa 2192] >gi|13959347|sp|Q9I7C4|DPO3B_PSEAE DNA polymerase III subunit beta >gi|9945820|gb|AAG03392.1|AE004440_2 DNA polymerase III, beta chain [Pseudomonas aeruginosa PAO1] >gi|115588943|gb|ABJ14958.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa UCBPP-PA14] >gi|126169686|gb|EAZ55197.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa C3719] >gi|126196494|gb|EAZ60557.1| DNA polymerase III, beta chain [Pseudomonas aeruginosa 2192] (367 aa)
Score = 157, Expect = 1.0e-08, Identities = 75/371 (20%), Positives = 158/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +    +V +    +  E G I +  +    I   L N+++   +V+   + VK       ++ +    +P +       N  SI+    ++ I +  +A+     +   ++G+      +  TL  +ATDG++LA    ++  P   R   IV    ++EL   + + D  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  S+ +L++  +++      E             I  N  +LL +L     + +    SDS    L+ +  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVE---LVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLN-FSIAQSKLRRLIDRTSFAMAQQDVRY-YLNGMLLEV--NGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSR-TAILSNEKYRGIRLQLSNGLLKIQ-ANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMR 366
>gi|87123348|ref|ZP_01079199.1| DNA polymerase III, beta chain [Synechococcus sp. RS9917] >gi|86169068|gb|EAQ70324.1| DNA polymerase III, beta chain [Synechococcus sp. RS9917] (390 aa)
Score = 156, Expect = 1.1e-08, Identities = 74/371 (19%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINI--MDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF----------------ESTPQDFRIVL---DVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP-VLLRDEKDPNFLQILVPIR 377
           MK++ S+ +L  AL+L +    +  + PV    L+  +    + + +      +  +  S  A++   G + +  +    I+S+L +E       D++  +V+ ++      +  M  +++P +    N    L +      +++    +A + ++ K  +++G+      S   LE  +TDG++LA                    +    D  + L    +  +E L+     D  + +F     ++   ++ ++ S+ +EG YPN  ++I         + ++  V ALER +A+ + +  ++V+++   E  ++++S  + D+G+  E+++      EP  I+ N  ++L  LK  + D I +  +    P VL   + D  F  +++P++
  S:     1 MKLVCSQAELNAALQLVSRAVASRPTHPVLANVLLTADAGTGRLSLTG--FDLNLGIQTSLPASVESSGAVTLPARLLGEIVSRLSSESPVTLASDDAGEQVELTSLSGCYQMRGMPADEFPELPLVENG-TALKLEAAALARALRATLFASSADEAK-QLLTGVHLRFSGSH--LEAASTDGHRLAVLAVTDALREAPTLEGGEANDGEAADLSVTLPARSLREVERLVTSWKGDDPVTLFYDRGQVVVLAADQMVTSRTLEGTYPNYRQLIPDSFSRVFELDRRGFVAALER-VAVLADQHNNVVRISSEPESGLVQISADAQDVGSGSESLASDLS-GEPVQIAFNVRYVLDGLKAMEADRIKLRCNAPTTPAVLSAADDDSGFTYLVMPVQ 387
>gi|70733515|ref|YP_257154.1| DNA polymerase III subunit beta [Pseudomonas fluorescens Pf-5] >gi|68347814|gb|AAY95420.1| DNA polymerase III, beta subunit [Pseudomonas fluorescens Pf-5] (367 aa)
Score = 156, Expect = 1.2e-08, Identities = 75/371 (20%), Positives = 158/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES---TPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +     V   E A   E G I +  +    I   L N+ +   KVD   + VK       ++ +    +P +         QL  S +  ++ I +  +A+     +   ++G+      S   +  +ATDG++LA    ++    P   ++++    ++EL   + + D N+ I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  ++  L++  +++      E             I  N  +LL +L     + + +  SDS    L+++  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVQLEEPA---EPGEITVPARKLMDICKSLPNDALIDIKVDEQKLVVKAGRSRFTLSTLPANDFPTVEEGPGSLTCQLEQSRL--RRLIERTSFAMAQQDVRY-YLNGMLLEV--SAGIIRAVATDGHRLAMCSMQADIGQPDRHQVIVPRKGILELARLLTEPDGNVSIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVLGDRQALREAFSR-TAILSNEKYRGIRLQLANGQLKIQ-ANNPEQEEAEEEVGVEYNGGSLEIGFNVSYLLDVLGVMTTEQVRLILSDSNSSALVQESDNDDSAYVVMPMR 366
>gi|88860615|ref|ZP_01135252.1| DNA polymerase III, beta-subunit [Pseudoalteromonas tunicata D2] >gi|88817210|gb|EAR27028.1| DNA polymerase III, beta-subunit [Pseudoalteromonas tunicata D2] (368 aa)
Score = 156, Expect = 1.3e-08, Identities = 75/371 (20%), Positives = 174/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTI-IASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + + + +  L   +   E   + P+    L+E+ D ++  T ++  I    +VA    ++ +E  ++ +  K    I   L +   ITL   D+ V+ + +     ++  +    +PN+   ++      I+    +K +    +++ N   +   ++G+ F   +SE  ++ +ATDG++LA       Y   +  Q   +++    ++ ++ ++  D N+    F +N    +       SK+++G +P+  R++    +  V  +++ L  A  R ++I S+EK   V+LNFS+  L+++ ++ +   ++E V           I  N  ++L +L T   ++++   SDS    L+    D   + +++P+R
  S:     2 MQITIPRDQFLKPLIQVSGAIERKHTLPILSNVLLEIADGKLMMTGTDLEIE---LVACVTLSHFVEDSKLTLPAKKLLDICKSLPDGSEITLSAQDSQVL-LTSGKSRFSLASLPALDFPNLE-QWDGEVDFQITRNELRKLLESTHFSMANQDVRY-YLNGMSFEVDNSE--IKTVATDGHRLALSQKKLDYSLNTQRQ---LIIPRKGVQEIMRLMVSDDNLVTIQFGANHFRIIDQEFTFTSKLVDGRFPDYRRVLPRGGDKVVTANREWLRSAFSR-VSILSNEKFRGVRLNFSAGELKITANNPEQEQAEEIVEVVYS-GPDLEIGFNVSYVLDVLNTLKTEDVSFTLSDSNSSALVEGTGDDEAMYVVMPMR 367
>gi|30248033|ref|NP_840103.1| DNA polymerase III, beta chain [Nitrosomonas europaea ATCC 19718] >gi|30179918|emb|CAD83913.1| DNA polymerase III, beta chain [Nitrosomonas europaea ATCC 19718] (373 aa)
Score = 155, Expect = 1.4e-08, Identities = 76/368 (20%), Positives = 168/368 (45%)
  Q:    10 IVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTH--SIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPN-INFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKK-SIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           I  +  L   L+  + I E   + P+   TLIE+ + ++   T++  I     S + + E+   L+    + K +     +       I L + +N  +++ +     ++ ++  E +P  I  S       +++  V KK + +V +A+     +   ++G+    +  +  L ++ATD ++L     +   +  +   IV   +++EL+ ++ D D  + + ++   + F+ S+ ++ SK+I G + +  R I      + ++++   + AL+R   ISSS      V LN ++  L +S  + +   ++E +      NE    S N  +L+ +L   D++ I   F      +L+    D  F  +L+P+R
  S:     5 ITDRDLLFKPLQTVSGIVERRHTLPILSNTLIEIRNGQLTLVTTDLEIEAEATSNIPELENQGALQTTVSVRKLQDILRALPS--GAAIELTRSENR-LQIVSGKSRFSLQLLPAEDFPRMIRDSEPCSATYTLAQRVLKKHLQRVAHAMAQQDLRY-YLNGMLL--LIEDNKLTLVATDTHRLGITSIDLDGNFEKSETIVPRKTVLELIRQLEDSDKPVIVEIYPKKVCFRFSDAVLVSKVISGKFLDFRRAIPQTSVFQFDVNRLDFLHALQRTAIISSSNDLFRNVHLNITNGKLNISAKNKEQEEAQEEIDIVYS-NETIDTSFNIVYLMEVLNNLDSEQIRCSFESMQSAILITLPDDEQFKHVLMPMR 372
>gi|32476252|ref|NP_869246.1| DNA polymerase III, beta chain [Rhodopirellula baltica SH 1] >gi|32446796|emb|CAD76632.1| DNA polymerase III, beta chain [Rhodopirellula baltica SH 1] (444 aa)
Score = 155, Expect = 1.4e-08, Identities = 77/370 (20%), Positives = 175/370 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNIN-FSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---------RIVLD--VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKEN--KVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDN-ITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MKI   +  L NA  L  SI+ +     +     +    ++I    ++  +     V  SE   +  +G  L+       I+ +  +E IT+E  D + IK+  S     +   + +++P+++ F  + ++Q+S     F++ + +  +A ++   +   + G+       E ++  + TDG +LA  + E T +            IV    + LIE  L   + D  +E+    ++++ +    +I+S+++EG YPN  +++   +EN  ++++    L  AL +   ++  + +  V   F+   L++   ++DLG S+  +       E   +++++ +L    K  DN++ + +E   +  P LL  + D  +  +++P+
  S:    73 MKITCQRDILANAFVLAASIAPSRSPKEILQNVKVTAAGDKITLMATDQEVGIRLDV--SEGIEVETEGTALLPVARTGPILRESNDETITIE-TDEAGIKISGSRSKFRLPGNNPDEFPSVHEFDESKYHQISTR--TFREMLRRTVFATDSESSRY-ALGGVLLEM--EENSVIAVGTDGRRLA--RMEGTGESVGGHATSGMTTIVPTRAIGLIERALS--EKDDFVEVASRGNDLLIRTPRAVISSRLVEGRYPNWRQVLPQ-RENAIQIDVVVGPLFAALRQAAIVTDLDSRG-VDFTFADGTLKLEAKTADLGESQIELPIAYD-GESITLTMDHRYLADFCKVMDNESTVVMEIESAKSPALL--QTDDGYAYVIMPM 440
>gi|33151999|ref|NP_873352.1| DNA polymerase III subunit beta [Haemophilus ducreyi 35000HP] >gi|33148221|gb|AAP95741.1| DNA polymerase III beta chain [Haemophilus ducreyi 35000HP] (367 aa)
Score = 155, Expect = 1.5e-08, Identities = 73/371 (19%), Positives = 177/371 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGII--STHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ--DFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M++ +++ +L+  L+    +  +  + PV    L+++N + +  T ++  +  +T + + ++ D +    G+  +  K +  I   L +N +I+++ + D ++I+   S F  N+  +    YPN+     DW      S+      + I   ++++ N   +   ++G+ F +      L  +ATDG++LA      + +     +++    +  L  I+    + + + +  +N+   ++  +  SK+I+G +P+  R++    +  +    + L  AL R  AI S+EK   V+L  S  +L+++ ++ +   ++E +    + N    I  N  +LL +L T   + +     D+    L+ D ++     +++P+R
  S:     1 MQLTITREQLLKPLQQVCGVLSSRPTLPVINNILLDINGSRLSLTGTDLEVELTTQAELEQAVDFS----GKFTLPAKKWLDICRSLPENSLISIQFEQDRALIRADRSKF--NLATLPASDYPNLM----DWKPEVDFSMEQSTLSRLIDATQFSMANQDARY-FLNGMKFET--EGNLLRTVATDGHRLAVCTMALSQELTTHSVIVPRKAVLELSRILSMTADPVRLEIGTNNLRISMNGVVFTSKLIDGRFPDYRRVLPRNADRILEAETEMLKRALMRA-AILSNEKFHGVRLALSENMLKITANNPEQEEAEEIIDVAYQ-NTAMEIGFNVSYLLDVLNTLKCERVRFNLVDASSSCLIEDCENSTAEYVIMPMR 366
>gi|81251105|gb|ABB69900.1| DNA polymerase III beta chain [Nitrosomonas sp. OZK11] (373 aa)
Score = 154, Expect = 1.9e-08, Identities = 81/368 (22%), Positives = 170/368 (46%)
  Q:    10 IVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRI--LIKTKPFFAIISKL-KNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLS--ISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA------HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKK-SIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           I ++  L   L+  + I E   + P+   TLIE+ + ++   T++  I   +I +  E  N   +G +   +  K    I+  L  N  I L + +N  +++ +     ++ ++  E +P +    N+   +S  +   VFKK + +V +A+     +   ++G+    +  +  + + ATD ++L          FE +     I+   +++EL+ ++ D D  +EI ++   + F+  + ++ SK+I G + +  R I      + ++++     AL+R   ISSS      V LN +S  L +S + +      +        +E    S N  +L+ +L   D++ +T  F      +L+    D  F  +L+P+R
  S:     5 ITNRDLLFKPLQTVSGIVERRHTLPILSNTLIEIRNGKLTLVTTDLEIEAEAISSIPELEN---QGTLQTTVSVKKLQDILRALPANTAIELTRSENR-LQIVSGKSRFSLQLLPAEDFPRM-IRDNEPCSMSYTLPQRVFKKQLQRVSHAMAQQDLRY-YLNGLLL--LIEDNKMTLAATDTHRLGITSIALKGNFEKSET---IIPRKTVLELIRQLEDSDRPVEIEIYPKKVCFRFPDAVLISKVISGKFLDFRRAIPQTSVFRFDVNRLDFFHALQRTAIISSSNDLFRNVHLNITSGKLNIS-AKNKEQEEAQEEIEIVYSDETIDTSFNIVYLMEVLNNLDSEQVTCSFESMQSAILITLPDDEQFKHVLMPMR 372
>gi|33598883|ref|NP_886526.1| DNA polymerase III subunit beta [Bordetella parapertussis 12822] >gi|33575013|emb|CAE39679.1| DNA polymerase iii, beta chain [Bordetella parapertussis] (371 aa)
Score = 154, Expect = 2.2e-08, Identities = 49/195 (25%), Positives = 102/195 (52%)
  Q:   183 IATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVE-FSDSFKPVLLRDEKDPNFLQILVPIR 377
           +ATDG++LAH   E+     R   IV   +++E+   + D D  + + +    I F+  +  + SK++EG +P+ +R+I T    + ++S++ L  +L+R  AI +++K   V+L  +   +++S S+++   ++E +       EP  +  N  +LL +L     +N+      D+    L+    D  F  +++P+R
  S:   174 VATDGHRLAHCATEADGIAERHEVIVPRKTVLEMQRLLEDSDEPVALDVAPGQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRQFSVSREALQGSLQRA-AILTTDKFKGVRLQLAQHQMKISSSNAEQEEAQEEIDIDYSF-EPLDVGFNVSYLLDVLSNIKAENVQWSVMPDANASALITLSDDEQFKYVVMPMR 370
>gi|118051711|ref|ZP_01520259.1| DNA polymerase III, beta subunit [Comamonas testosteroni KF-1] >gi|118001054|gb|EAV15210.1| DNA polymerase III, beta subunit [Comamonas testosteroni KF-1] (373 aa)
Score = 153, Expect = 2.4e-08, Identities = 73/366 (19%), Positives = 161/366 (43%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLI---ELLLEIIDFDTN--------IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++ K++  L+    I E   + P+    LI+   N ++ TTS+  I   +      DA         I  +    I+  +  +     +   + + +K       +  +  E +P +  S       S+   V K  + +V +A+     +   ++GI F  ++   TL ++ATDG++LA   + S   D  + +   +I   + +LE+    ++        IE+    +   F        +K++EG +P+ +R+I     N V + +  L+ +L+R  AI +S+K   V+L+     L V+ ++++   + + +       +   I  N  +L+ +L     D + ++  D     L+   ++ +F  +++P+R
  S:     7 TQDKVLAVLQSVAGIVERRHTLPILANVLIKKTGNALQLTTSDLEIQIRTTAELGGDAGDFTT---TIGARKLIDILKTMPGDQTVSLETQQAKMILKGGKSRFTLQTLPAEDFPLVQESAAFGPAFSVPQKVLKDLLGQVSFAMAVQDIRY-YLNGILF--VAEGNTLSLVATDGHRLA---WASATLDVEVPIKQEVILPRKTVLELQRLLSDASGENQPVIEMQFANNQAKFTFGGMEFVTKLVEGKFPDYNRVIPRNHTNSVTLGRAPLLASLQR-TAIMTSDKFKGVRLSVEPGTLRVASNNAEQEEAMDELDIDYG-GDTIEIGFNVTYLIDVLTNMSQDMVKIDLQDGNSSALVTIPENESFKYVVMPMR 372
>gi|38198902|emb|CAE48513.1| DNA polymerase III, beta chain [Corynebacterium diphtheriae] (405 aa)
Score = 153, Expect = 2.6e-08, Identities = 76/346 (21%), Positives = 165/346 (47%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL-----SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDTN-----------IEIFLFESNII-------FKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE---------------KDPNFLQILVPIR 377
           + PV    +I  +D  ++F   +  +ST   +    +A++ + GRI +  K    II  L N+ I +  V+ + ++V   +    + ++  ++YP +        QL     +I P +F  ++ +V  A   + E + +++GI         TL   ATD ++LA  +F  +P +       +  +LL+   +   N           +EI +     I         + N    +++++ D+PNVS ++        ++    L +A+ R   ++  E+ + +++ F+ + + +S   SD G+++E+V C    ++   I+ N+ +L   L       +   F++  +P ++  E                D  F  +L+P+R
  S:    41 TQPVLRAVVITADDEGLEFAGFDYEVSTKVHI----NADVRQPGRIAVAGKLMSDIIGTLPNKTIEV-FVEGTQVQVVCGSSRFELPLIPLDEYPPLP-------QLPAVTGAIDPNLFTDAVLQVAAAAGRD-ETLPMLTGIHMEIDGENVTL--TATDRFRLALRRFTWSPANPE-----AKAKLLIPAKNLSDNARSLDSGSTEPVEIAVGTGENIGAEGLFGIHIDNRQTTTRMLDADFPNVSPLLPKVHNAMASVEISALSDAIRRVALVA--ERNAQIRMQFTRDEVILSAGGSDAGHAEESVPCAFTGDQEFLIAFNSAYLRDGLSVIRTSRVVFGFTEPSRPAIMIPEPETLPEASADGTYPTPDTEFTYLLMPVR 402
>gi|33591699|ref|NP_879343.1| DNA polymerase III subunit beta [Bordetella pertussis Tohama I] >gi|33571342|emb|CAE44819.1| DNA polymerase iii, beta chain [Bordetella pertussis Tohama I] (369 aa)
Score = 153, Expect = 2.7e-08, Identities = 49/195 (25%), Positives = 102/195 (52%)
  Q:   183 IATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVE-FSDSFKPVLLRDEKDPNFLQILVPIR 377
           +ATDG++LAH   E+     R   IV   +++E+   + D D  + + +    I F+  +  + SK++EG +P+ +R+I T    + ++S++ L  +L+R  AI +++K   V+L  +   +++S S+++   ++E +       EP  +  N  +LL +L     +N+      D+    L+    D  F  +++P+R
  S:   172 VATDGHRLAHCATEADGIAERHEVIVPRKTVLEMQRLLEDSDEPVALDVAPGQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRQFSVSREALQGSLQRA-AILTTDKFKGVRLQLAQHQMKISSSNAEQEEAQEEIDIDYSF-EPLDVGFNVSYLLDVLSNIKAENVQWSVMPDANASALITLPDDEQFKYVVMPMR 368
>gi|58697440|ref|ZP_00372737.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Drosophila simulans] >gi|58536133|gb|EAL59745.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Drosophila simulans] (353 aa)
Score = 153, Expect = 2.7e-08, Identities = 59/229 (25%), Positives = 118/229 (51%)
  Q:   149 ISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNE-PTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           ++K K+AV+ +  + N ++GI  ++   E+ L  +ATDG++L+  K         +F +++    +  LL+I+D    I++ L +  I       I+ SK+I+G +PN   +I   ++  + I  K L + ++R   + S + KSI K +   ++L +  +S +  ++ E++      NE P  I  N+ +LL +L    N       +D     ++ DE D + L +++P+R
  S:   127 LTKTKFAVSLDDTRYN-LNGIYLHT--DEQFLYCVATDGHRLSCIKRPKPGNINGEFGVIIPRKTVMELLKILDDCNEIKVKLSDRKIKLTCGEYILISKLIDGTFPNYKAVIPASQDKHMIIESKKLSDVIDRVSVVVSDKVKSI-KFSLQEKLLTLHSNSQECSDATESIEV--DYNEAPIEIGFNSRYLLDVLSCIKN-KCKFSLADGNSATIITDEDDSSVLYVVMPMR 352
>gi|88608357|ref|YP_506066.1| DNA polymerase III, beta subunit [Neorickettsia sennetsu str. Miyayama] >gi|88600526|gb|ABD45994.1| DNA polymerase III, beta subunit [Neorickettsia sennetsu str. Miyayama] (372 aa)
Score = 153, Expect = 2.8e-08, Identities = 66/341 (19%), Positives = 160/341 (46%)
  Q:    36 FLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF-ESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLF------ESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           F GT +E+   + + + ++ ++    ++             I +     + I+ +L  ++  +  ++ + + V++   + ++  +D + +P I+       Q++ +    +   +KV++A +    + + ++G+ F S   + T  + ATD ++LA     + T   F  ++    +   LE+I   +  E+ LF       S I        + SK+I G +PN + +I    ++ +   +K L  ++ER + + S ++   + +    + L +  S+SD    +E++     + E   I  N+ +LL +L   DN  +T++F+++   VL   + D + L +++P+
  S:    43 FTGTSVELTTTDNELSLTDSLLGIEGVI----------DAVISVDAFRLYEIVKRLPTDVGVVLSIEKNNLVVRSRRIEFSLPYLDAKHFPLIS-EEEKIGQINFAVDEIRSLFNKVRFATSTESTRQH-LNGVYFESDGEKIT--VAATDVHRLAVATLMKKTGLKFSCIIPKKTV---LEMIKLSSGKEVELFLHGREYVSRIKMVFGGVRLNSKLIAGTFPNFAAVIPHSFKSSLTFDRKALATSIER-VGLVSPDQSRAISIGIKGKQLYLDASNSDASFGRESLELNEDIGEEISIYFNHIYLLDILLALDNKEVTMKFNNATSQVLF--QGDESALYVVMPM 370
>gi|33603962|ref|NP_891522.1| DNA polymerase III subunit beta [Bordetella bronchiseptica RB50] >gi|33568938|emb|CAE35352.1| DNA polymerase iii, beta chain [Bordetella bronchiseptica RB50] (371 aa)
Score = 153, Expect = 2.8e-08, Identities = 49/195 (25%), Positives = 102/195 (52%)
  Q:   183 IATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVE-FSDSFKPVLLRDEKDPNFLQILVPIR 377
           +ATDG++LAH   E+     R   IV   +++E+   + D D  + + +    I F+  +  + SK++EG +P+ +R+I T    + ++S++ L  +L+R  AI +++K   V+L  +   +++S S+++   ++E +       EP  +  N  +LL +L     +N+      D+    L+    D  F  +++P+R
  S:   174 VATDGHRLAHCATEADGIAERHEVIVPRKTVLEMQRLLEDSDEPVALDVAPGQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRQFSVSREALQGSLQRA-AILTTDKFKGVRLQLAQHQMKISSSNAEQEEAQEEIDIDYSF-EPLDVGFNVSYLLDVLSNIKAENVQWSVMPDANASALITLPDDEQFKYVVMPMR 370
>gi|56966599|pdb|1VPK|A Chain A, Crystal Structure Of Dna Polymerase Iii, Beta Subunit (Tm0262) From Thermotoga Maritima At 2.00 A Resolution (378 aa)
Score = 152, Expect = 3.1e-08, Identities = 80/371 (21%), Positives = 171/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDT--NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V+  +L + + + +         P+  G L EV D       ++   G+ +T +    S +A  +  G ++ K      ++  L +E+  L  + D  VI   ++ F   I  M  +++P I  + +      +   + ++ + KV +A   + E +  ++G+ +     +  L ++A+DG++LA   +     ++   +L +  ++ +  ++D  T   I +      +    ++     ++++ ++P+  R+I    + KV +S+K L E+L+R + I+S   +S VK      V+ +   S D G   + V  + K  E   I+ N  F+  +LK  + + I + F DS  P  +       +L I++PIR
  S:    13 MKVTVTTLELKDKITIASKALAKKSVKPILAGFLFEVKDGNFYICATDLETGVKATVNAAEISGEARFVVPGDVIQK------MVKVLPDEITELSLEGDALVISSGSTVF--RITTMPADEFPEITPAESGIT-FEVDTSLLEEMVEKVIFAAAKD-EFMRNLNGVFWEL--HKNLLRLVASDGFRLALAEEQIENEEEASFLLSLKSMKEVQNVLDNTTEPTITVRYDGRRVSLSTNDVETVMRVVDAEFPDYKRVIPETFKTKVVVSRKELRESLKRVMVIASKGSES-VKFEIEENVMRLVSKSPDYGEVVDEVEVQ-KEGEDLVIAFNPKFIEDVLKHIETEEIEMNFVDSTSPCQINPLDISGYLYIVMPIR 376
>gi|15643032|ref|NP_228075.1| DNA polymerase III, beta subunit [Thermotoga maritima MSB8] >gi|4980758|gb|AAD35350.1|AE001708_18 DNA polymerase III, beta subunit [Thermotoga maritima MSB8] (366 aa)
Score = 152, Expect = 3.2e-08, Identities = 80/371 (21%), Positives = 171/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA-HYKFESTPQDFRIVLDVSLIELLLEIIDFDT--NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ V+  +L + + + +         P+  G L EV D       ++   G+ +T +    S +A  +  G ++ K      ++  L +E+  L  + D  VI   ++ F   I  M  +++P I  + +      +   + ++ + KV +A   + E +  ++G+ +     +  L ++A+DG++LA   +     ++   +L +  ++ +  ++D  T   I +      +    ++     ++++ ++P+  R+I    + KV +S+K L E+L+R + I+S   +S VK      V+ +   S D G   + V  + K  E   I+ N  F+  +LK  + + I + F DS  P  +       +L I++PIR
  S:     1 MKVTVTTLELKDKITIASKALAKKSVKPILAGFLFEVKDGNFYICATDLETGVKATVNAAEISGEARFVVPGDVIQK------MVKVLPDEITELSLEGDALVISSGSTVF--RITTMPADEFPEITPAESGIT-FEVDTSLLEEMVEKVIFAAAKD-EFMRNLNGVFWEL--HKNLLRLVASDGFRLALAEEQIENEEEASFLLSLKSMKEVQNVLDNTTEPTITVRYDGRRVSLSTNDVETVMRVVDAEFPDYKRVIPETFKTKVVVSRKELRESLKRVMVIASKGSES-VKFEIEENVMRLVSKSPDYGEVVDEVEVQ-KEGEDLVIAFNPKFIEDVLKHIETEEIEMNFVDSTSPCQINPLDISGYLYIVMPIR 364
>gi|167644134|ref|YP_001681797.1| DNA polymerase III subunit beta [Caulobacter sp. K31] >gi|167346564|gb|ABZ69299.1| DNA polymerase III, beta subunit [Caulobacter sp. K31] (372 aa)
Score = 152, Expect = 3.3e-08, Identities = 76/371 (20%), Positives = 167/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNS---VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISS--EKTLEIIATDGYKLAHYKFESTPQDFR----IVLDVSLIELLLEIID-FDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ + +  L+ AL    S+ E   + P+    L+  + + + F+ ++  +     +     A I   G+I       + I+ KL +   ++L    +    VI+   S F  N+ ++    +P ++ S     ++S+      + I K ++A++  + +   ++G+  ++++   E  L  +ATDG++LA  +  + P+       I++    I+    +++     +++ +    + F+     + SK+I+G +P+  R+I       + +      +A++R +A  S+EK   VKL      + ++  + + G + E V       E   I  N  +LL +            F+D   P L+ D  DP    +L+P+R
  S:     1 MKLTIERAALLKALGHVQSVVERRNTIPILSNILLSADRDTLSFSATDLDME----IIDEGLAQIDIPGQITAPAHTLYEIVRKLPDGSDVSLSFSGDDPRLVIQAGRSRF--NLPVLPAGDFPVMS-SDGLSGRISVDTNELIRLIDKTRFAISTEETRY-YLNGLYLHTVNDGGEVKLRAVATDGHRLALAEM-AAPEGAAGLPGIIVPRKTIQEARRLMESAGEQVDLQISAQKVRFEFGRAALTSKVIDGAFPDYLRVIPRDNAKILTLDNDLFAKAVDR-VATISAEKSRSVKLAVEPGRITLTVRNMEAGQAVEEVEVDYD-GEAFEIGFNARYLLDVCGQIGGPIAEFRFADPASPTLVVDPTDPGVKYVLMPLR 371
>gi|194538585|ref|YP_002073664.1| hypothetical protein VEx25_0001 [Vibrio sp. Ex25] >gi|151937140|gb|EDN56012.1| hypothetical protein VEx25_0001 [Vibrio sp. Ex25] (256 aa)
Score = 152, Expect = 3.5e-08, Identities = 59/253 (23%), Positives = 132/253 (52%)
  Q:   125 YPNINFSYNDWN---QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDF---RIVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +PNI     DW    ++S+S    +  I K ++++ N   +   ++G+ F    +  TL  +ATDG+++A  + +    DF   +I++    ++ L++++D  +  + + +  SN+  +V+N    SK+++G +P+  R++       +  S   L +A  R  AI S+EK   V++N +   + ++ ++ +   ++E +    +  +   I  N  ++L +L T   +N+ V  SD+    L+ +  D + + +++PIR
  S:     6 FPNIE----DWQSEVEVSLSQADLRTLIDKTQFSMANQDVRY-YLNGMLFEIDGT--TLRSVATDGHRMAVSQTQ-LGADFAQKQIIVPRKGVQELVKLMDAPEQPVVLQIGSSNVRAEVNNFTFTSKLVDGRFPDYRRVLPQSTNKTLIASCDELRQAFSRA-AILSNEKFRGVRVNLADTEMRITANNPEQEEAEEMLDVTFE-GDAIEIGFNVSYVLDVLNTLRCENVRVSMSDANASALIENADDDSAMYVVMPIR 255
>gi|87198663|ref|YP_495920.1| DNA polymerase III beta subunit family protein [Novosphingobium aromaticivorans DSM 12444] >gi|87134344|gb|ABD25086.1| DNA polymerase III beta subunit family protein [Novosphingobium aromaticivorans DSM 12444] (415 aa)
Score = 152, Expect = 3.6e-08, Identities = 39/138 (28%), Positives = 78/138 (56%)
  Q:   240 TIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFS-SEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE-KDPNFLQILVPIR 377
           T+IA K ++G +P+ +R+I +   + + + ++ L+ A++R  A+  S+K   VKL    +E   VS +S ++G++ E ++C+    EP  I  N  +  S L     D + ++F+D+  P  +  E  +   +Q+L+P+R
  S:   278 TLIA-KTVDGTFPDYARVIPSAPSSFLTVDREALLAAIKRVAAV-CSDKTRAVKLELDGAEKAIVSTASPEIGDAMEEIACE-YAGEPLTIGFNGDYWRSCLSAVATDKVLMKFTDAGGPCRIEAEGGESALVQVLMPLR 414
>gi|57504598|ref|ZP_00370710.1| DNA polymerase III, beta subunit [Campylobacter coli RM2228] >gi|57019493|gb|EAL56187.1| DNA polymerase III, beta subunit [Campylobacter coli RM2228] (355 aa)
Score = 151, Expect = 4.0e-08, Identities = 77/348 (22%), Positives = 161/348 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP-QDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSD 354
           MK+ ++K  L +A+ LCN+  E   SS +    L E +++++    S+  I  +  + K     +   G      K    +I  L NE + LE +DN +   + ST    + + + E +PN   +    NQ  I      +S+ K+  +++ N  K ++     F  I +++ +  + TD  +LA Y  E T  Q+F I +    I  + ++  F   IEI+  E+ +I K  N    +K+I   +P+  ++I    + ++  S +  +++L++   ++       +KL+F+ + +     S D   +K  +  +  V+E   +++   +LL  L + + +  T+  ++
  S:     1 MKLSINKNTLESAVLLCNAYVEKKDSSTITSHLLFEADEDKLIIRASDFEIGINYKIRK---IRVESGGFATANAKSIADVIKSLNNEEVVLETIDNFLFIRQKST-KYKLPMFNHEDFPNFPKTEGK-NQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGA--FLDIKTDR-INFVGTDTRRLAVYTLEKTNNQEFHISIPKKAIMEMQKL--FYEKIEIYYDENMLIAKNDNFEFFTKLINDKFPDYEKVIPKTFKQELKFSTEDFIDSLKKISVVTEK-----MKLHFNKDKIIFEGISLDNMEAKTELEIETGVSEEFNLNIKIKYLLDFLTSIEEEQFTLSVNE 334
>gi|11320909|gb|AAG33950.1| DNA polymerase III beta subunit [Buchnera aphidicola] (368 aa)
Score = 151, Expect = 5.0e-08, Identities = 81/372 (21%), Positives = 169/372 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN-EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPN-INFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF----ESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN 378
           MK  +     +  L+  N       S P+    LI + +  +  T +N  I   S +  S+       G I + ++    I     N   I +E  DN  I V +      +N +  + +PN  NF Y   ++++I   + ++ I K+ +++     +  +   +C      + +L ++ATDGY+L   K     E   ++F I++    I  L  +++F    +++F+  SNI   +   I  +++IEG +P+   I    K N + I  + L ++L R  AI + EK   ++++ +    +V  S +    + E +     +     IS+N +++L +L   ++ NI +  + S   + +  E D + + I++ +++
  S:     1 MKFNIKNNIFVQHLQKVNRFITKNTSFPILENILISIKNGILSLTATNLEIELISNIKLSQH---YISGSITVSSRKLLQICRNSSNLSNIQIELHDNK-IHVISDKSHYTLNTLPADNFPNHQNFCY--ISEITIQSRILREIIEKIYFSMGKQDVRYYLNGMLC---KIIDNSLHMVATDGYRLGISKTLLLKEEIIKNFSIIIARKGITELYXLLNFSXQLVKVFIGRSNIRIYIXXLIFTAQLIEGKFPDYESIFLKKKNNGILIDCQLLKQSLSRA-AILAHEKFCGIEIHINKNQFKV-LSDNQEEETAEDIFDINYIGPSIEISINVYYILDILNVINSQNILLFLNHSNNSIQIEAENDASTIYIVMLLKH 368
>gi|114330038|ref|YP_746260.1| DNA polymerase III, beta subunit [Nitrosomonas eutropha C91] >gi|114307052|gb|ABI58295.1| DNA polymerase III, beta subunit [Nitrosomonas eutropha C91] (373 aa)
Score = 150, Expect = 5.4e-08, Identities = 79/371 (21%), Positives = 171/371 (46%)
  Q:     7 MKIIVSKTKLI-NALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTH--SIVAKSEDANILEKGRILIKTKPFF-AIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKK-SIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ +S   L+   L+  + I E   + P+ L  LI + D ++   T++  I     S + + E+   L+    + K +    A+ S    E+I  E    + +++ +     ++ ++  E +P +       +   +++  + KK + +V +A+     +  +   +    +  +  L ++ATD ++LA   F+   Q  +   I+   +++EL+ ++ D D  + + ++   I F  S+ ++ SK+I G + +  R I      + +I++   + AL+R   ISSS      V LN ++  L +S + +      +        NE    S N  +L+ +L   D+++I   F +    +L+    D  F  +L+P+R
  S:     1 MKLTISDRDLLFKPLQTVSGIVERRHTLPILLNVLISIRDGKLALVTTDLEIEVEATSNIPELENQGSLQMTVSVRKLQDILRALPSGSPVELIRSE----NRLQIVSGKSRFSLQLLPAEDFPRMAKDNERCDASFTLTQQILKKHLQRVSHAMAQQDLRYYLNGTLL---LIEDNKLMLVATDTHRLAITSFDLDGQFEKSETIIPRKTVLELIRQLEDSDKPVIVEIYSKKICFHFSDAVLVSKVISGKFIDFRRAIPQTSVFQFDINRLDFLHALQRTAIISSSNDLFRNVHLNITNGKLNIS-AKNKEQEEAQEEIEIVYSNETIDTSFNIVYLMEVLNNLDSEHIRCSFENMQSAILITLPDDDQFNHVLMPMR 372
>gi|71891808|ref|YP_277537.1| DNA polymerase III, beta-subunit [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71795914|gb|AAZ40665.1| DNA polymerase III, beta-subunit [Candidatus Blochmannia pennsylvanicus str. BPEN] (367 aa)
Score = 150, Expect = 6.3e-08, Identities = 89/371 (23%), Positives = 166/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKL-KNEMITLEKVDNSVI------KVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST---PQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD-EKDPNFLQILVPIR 377
           M  ++ +  L  +L+    I       P+    L+EVNDN +  T ++  I     V   +   I   G +++  + FF I   L ++  I++   D  +I      K   STF S         +P +    N+  +L IS  + KK I   ++++ +   +   ++GI F +   E  L I+ATDG++LA  +       P    I+    +IE+L  +   +  + I    +N+  +  N    SK+I+  +PN   +     +N + +    L +AL+R  AI ++EK  IV+    +  L+++  + +   S+E +       +   IS N  +L+ +L+  D   +    +D    V +   EK      I++PIR
  S:     1 MNFVIDRKLLYQSLQKVVGILSGRPRMPILTHVLLEVNDNCLCITATDLEIEITVRVILQDKYPI---GSVIVPGRKFFEICRSLSESSKISIVSKDKKMIICSGCSKFYLSTFSS-------LDFPKLEKWGNNL-KLVISQAILKKMIELTQFSMGHQDVRY-CLNGILFET--KEHILRIVATDGHRLASCEITMDLLLPNQSSIIPRKGVIEILRLLNVKEKLVNIQTNSNNLRMETENYTFTSKLIDAVFPNCHDVFIKRSKNVLEVECGILKQALKRA-AILANEKLRIVRFTLITNQLKITAHNFEHEASEEILDVLYS-GKSIKISFNVDYLIDVLQVMDTQFLRFYLTDEISSVQIESTEKCHGATYIVMPIR 366
>gi|28492969|ref|NP_787130.1| DNA polymerase III subunit beta [Tropheryma whipplei str. Twist] >gi|28572177|ref|NP_788957.1| DNA polymerase III subunit beta [Tropheryma whipplei TW08/27] >gi|28410308|emb|CAD66694.1| DNA polymerase III, beta chain [Tropheryma whipplei TW08/27] >gi|28476009|gb|AAO44099.1| DNA polymerase III beta chain [Tropheryma whipplei str. Twist] (377 aa)
Score = 150, Expect = 6.5e-08, Identities = 85/347 (24%), Positives = 163/347 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSE-DANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKIN-IMSGICFNSISSEKTLEIIATDGYKLAHYKFEST---PQDFRIVLDV-SLIELLLEIIDFDTNIEIFLF---ESNII-FKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS 353
           MK+IV +  L +++     +      SP+  G LIE  + ++  +T N     +   AK E  AN++E G++L+      +I  KL +E + + K D   I +     +  +N+M   +YP +  +  +  Q  I    F KS+S+V    +  K+ I+ +++GI  N   S +++E+  TD Y++A     S    P D  +++   +L E+   + + ++ I +F+    E+ +I F+  N  + S +I G+YP V+++      +   +     +E+ +R   +   ++     + FS     V+   S +  + E V C+    +   I L   FL   L     D I V F+
  S:     1 MKLIVDRGLLSSSVNFVTRMIPARPPSPILSGMLIEAKNEKVTLSTFN-----YETSAKVEFSANVIEGGKVLVPGTLISSISQKLPDEPVEISKEDEK-ISLTCGPVNYILNLMPIAEYPPLP-NLENAEQYRIPSEDFVKSVSQV--TTSAAKDDISAVITGI--NLRLSNESIELTGTDRYRVAVKTLNSVSGHPSDSSVIVSSKTLFEVSKTLGNLESEISVFIKNDGENKVIGFESGNKTVTSLLISGNYPPVAKLFTEETGHYAILKTSDFLESTKRVSVVVERDE----PIEFSFVKNTVTIKGSGIALASEKVECE-LFGDEISIMLRPQFLCDGLIACQEDFIKVAFT 341
>gi|113473946|ref|YP_720007.1| DNA polymerase III, beta subunit [Trichodesmium erythraeum IMS101] >gi|110164994|gb|ABG49534.1| DNA polymerase III, beta subunit [Trichodesmium erythraeum IMS101] (200 aa)
Score = 150, Expect = 6.5e-08, Identities = 38/167 (22%), Positives = 93/167 (55%)
  Q:   211 IELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFS--SSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDN-DNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +E ++ +    +++ +   E+ +IF++    + S+ +EG YP   +++     N++N+ +K  + A+ER +A+ + +K +I+K    S   E+S S  + D+G+ +E+++ +   +EP  I+ N  +L+  LK   +   I+++ + +  PV+L          +++P++
  S:    29 VERMISMGKSGSSVTLKFDENQVIFELGKQRLTSRKLEGQYPAYQQLLPNQFTNQINVDRKKFLGAVER-IAVLADQKNNILKCTIDSVNQEISLSVDAQDVGSGRESMAAQISSDEPEEIAFNVKYLIEGLKAIPSASEISIQLNTATTPVVLNPLGGFQMTYLIMPVQ 197
>gi|81251097|gb|ABB69894.1| DNA polymerase III beta chain [Nitrosomonas sp. CNS332] (373 aa)
Score = 149, Expect = 6.8e-08, Identities = 79/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLI-NALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTH--SIVAKSEDANILEKGRILIKTKPFF-AIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKK-SIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ +S   L+   L+  + I E   + P+ L  LI + D ++   T++  I     S + + E+   L+    + K +    A+ S    E+I  E    + +++ +     ++ ++  E +P +       +   +++  + KK + +V +A+     +  +   +    +  +  L ++ATD ++LA   F+   Q  +   I+   +++EL+ ++ D D  + + ++   I F  S+ ++ SK+I G + +  R I      + +I++   + AL+R   ISSS      V LN ++  L +S + +      +        NE    S N  +L+ +L   D+++I   F      +L+    D  F  +L+P+R
  S:     1 MKLTISDRDLLFKPLQTVSGIVERRHTLPILLNVLISIRDGKLALVTTDLEIEVEATSNIPELENQGSLQMTVSVRKLQDILRALPSGSPVELIRSE----NRLQIVSGKSRFSLQLLPAEDFPRMAKDNERCDASFTLTQQILKKHLQRVSHAMAQQDLRYYLNGTLL---LIEDNKLMLVATDTHRLAITSFDLDGQFEKSETIIPRKTVLELIRQLEDSDKPVIVEIYSKKICFHFSDAVLVSKVISGKFIDFRRAIPQTSVFQFDINRLDFLHALQRTAIISSSNDLFRSVHLNITNGKLNIS-AKNKEQEEAQEEIEIVYSNETIDTSFNIVYLMEVLNNLDSEHIRCSFESMQSAILITLPDDDQFNHVLMPMR 372
>gi|58700013|ref|ZP_00374572.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Drosophila ananassae] >gi|58533470|gb|EAL57910.1| DNA polymerase III, beta subunit [Wolbachia endosymbiont of Drosophila ananassae] (332 aa)
Score = 149, Expect = 8.1e-08, Identities = 84/334 (25%), Positives = 165/334 (49%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMD--EEQYPNI---NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQ---DFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNE-PTPISLNNHFLLSLL 340
           M+  VS+T L+N L   + + E   S  V     I+     IK   ++  IS  + +A    A +L +G + I       I+ KL  ++    +V+N   K+  S  ++N ++ +     +P +   N+ + D+  L+   I     ++K K+AV+ +  + N ++GI  ++   E+ L  +ATDG++L+  K         +F +++    +  LL+I+D    I++ L +  I       I+ SK+I+G +PN   +I   ++  + I  K L + ++R   + S + KSI K +   ++L +  +S +  ++ E++      NE P  I  N+ +LL +L
  S:     1 MRFSVSRTSLLNTLSRVSGVVERRNSIDVLACINIKAQHGSIKLMATDLDISMFASLA----ATVLTEGEVKISAHTLHDIVKKLPADLDVNFEVNNQG-KLLMSCGNANFSLPNVVSSSFPALEEDNYKH-DFILLNTDLIDL---LTKTKFAVSLDDTRYN-LNGIYLHT--DEQFLYCVATDGHRLSCIKRPKPGNINGEFGVIIPRKTVMELLKILDDCNEIKVKLSDRKIKLTCGEYILISKLIDGTFPNYKAVIPASQDKHMIIESKKLSDVIDRVSVVVSDKVKSI-KFSLQEKLLTLHSNSQECSDATESIEV--DYNEAPIEIGFNSRYLLDVL 328
>gi|157164122|ref|YP_001465927.1| DNA polymerase III subunit beta [Campylobacter concisus 13826] >gi|112801712|gb|EAT99056.1| DNA polymerase III, beta subunit [Campylobacter concisus 13826] (355 aa)
Score = 147, Expect = 1.3e-07, Identities = 77/359 (21%), Positives = 160/359 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV-IKVKTSTFDSNI-NIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES-TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEK 365
           MK++++K  L + +   N   E    S +     I   D  +    ++  I    +  K  +  I+++G      K    II  LK+E +TLE V+N + IK K S +   +    D  ++P I       ++ +I  I+  +S+ K+   +++N  K  +   +       +  + I+ TD  +LA +KF +    +F +++    I  + ++  F   IEI+  E+ +I +  N    +K+I G +P+  R+I      +  +S+  +VE ++    +S       +K+ FS E +       D   +K  +  +  + E   I++ N  L+  L++ +++     F D   P ++  ++
  S:     1 MKVLINKNMLESIVTNTNPYLEKRDLSAITSHIYISAKDGVLNIKATDHEIG---LAYKLSNVKIVDEGYATANGKKLLDIIKSLKDEEVTLETVNNYLYIKQKNSKYKLPMYKFEDFPEFPTIEGK----SKFNIDAIMLGRSLKKILPCIDSNNPKFELNGALL---DIKQNYINIVGTDTKRLAVFKFANEASNEFSLIIPKKAINEIQKL--FFDKIEIYYDENVLIAQSQNFEFFTKLINGKFPDYERVIPKDIAIRFELSRDKMVEGIKTISMLSDQ-----MKITFSKENITFESIIEDNSEAKTMIEFQTGLEEDISINVKNRNLIDFLQSIEDEKFEFGFKDKNLPFVVSSKE 345
>gi|11320911|gb|AAG33951.1| DNA polymerase III beta subunit [Buchnera aphidicola] (368 aa)
Score = 146, Expect = 1.7e-07, Identities = 76/372 (20%), Positives = 172/372 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF----ESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIRN 378
           MK  +     +  L+  N       S P+    LI + +  +  T +N  I    +++  E +     G I + ++    I     N      ++ N+ + V +      +N +  + +PN N +    ++ +I   + K+ I K  +++     +   ++G+ F     + +L I+ATDGY+L   K     E   ++F I++    I  L ++++  T  +++F+  SNI   +   I  +++IEG +PN   I    K N + ++ + L ++L R  AI + EK   ++++ + +  +V   + +   +++T      +     IS+N +++L +L   ++ NI +  + S   + +  E D + + I++ +++
  S:     1 MKFNIKNNIFVQHLQNVNRFITKNTSFPILENVLISIKNRILSLTATNLEIE---LISNIELSKHYVPGSITVSSRKLLQICRNSLNSSNIQVELHNNKMHVISEKSHYILNTLPSDDFPNHN-NXCYISEFTIQSKILKEMIEKTHFSMGKQDVRY-YLNGMLFKI--XDNSLHIVATDGYRLGTSKTLLTKEEIIKNFSIIIARKGITELYKLLNSSTQLVKVFIGRSNIRIYIEQLIFTAQLIEGKFPNYESIFLKKKNNGIILNCQLLKQSLLRA-AILAHEKFCGIEIHVNKDQFKVLSDNQEEETAEDTFDIN-YIGPSIEISINVYYILDILNVINSKNILLFPNYSNNSIQIEAENDASTIYIVMLLKH 368
>gi|81251101|gb|ABB69897.1| DNA polymerase III beta chain [Nitrosomonas sp. IWT310] (373 aa)
Score = 146, Expect = 1.8e-07, Identities = 79/371 (21%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLI-NALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTH--SIVAKSEDANILEKGRILIKTKPFF-AIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWN-QLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKK-SIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK+ +S   L+   L+  + I E   + P+ L  LI + D ++   T++  I     S + + E+   L+    + K +    A+ S    E+I  E    + +++ +     ++ ++  E +P +       +   +++  + KK + +V +A+     +  +   +    +  +  L ++ATD ++LA   F+   Q  +   I+   +++EL+ ++ D D  + + ++   I F  S+ ++ SK+I G + +  R I      + +I++   + AL+R   ISSS      V LN ++  L +S + +      +        NE    S N  +L+ +L   D+++I   F      +L+    D  F  +L+P+R
  S:     1 MKLTISDRDLLFKPLQTVSGIVERRHTLPILLNVLISIRDGKLALVTTDLEIEVEATSNIPELENQGSLQMTVSVRKLQDILRALPSGSPVELIRSE----NRLQIVSGKSRFSLQLLPAEDFPRMVRDNERCDTSFTLTQQMLKKHLQRVSHAMAQQDLRYYLNGTLL---LIEDNKLMLVATDTHRLAITSFDLDGQFEKSETIIPRKTVLELIRQLEDSDKPVIVEIYSKKICFHFSDAVLVSKVISGKFIDFRRAIPQTSVFQFDINRLDFLHALQRTAIISSSNDLFRNVHLNITNGKLNIS-AKNKEQEEAQEEIEIVYSNETIDTSFNIVYLMEVLNNLDSEHIRCSFESMQSAILITLPDDDQFNHVLMPMR 372
>gi|17158705|ref|NP_478216.1| DNA polymerase III beta subunit [Nostoc sp. PCC 7120] >gi|17134654|dbj|BAB77212.1| DNA polymerase III beta subunit [Nostoc sp. PCC 7120] (456 aa)
Score = 146, Expect = 1.9e-07, Identities = 86/355 (24%), Positives = 170/355 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSF--SSSDLGNSKETVSCKGKVN--EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           MK+ + ++KL   L           + P+    L+  N++ I   T   +  T   +  +  AN+   G++ +  K     I+ ++ E ITLE V+N    +  ++    +     +++P +    N   ++++S    + ++    Y  N ++ K+ +++G+ F  I + K  +  +T+G+KLA          S P DF  V   SL EL  +L      +   I L    I F + +T + S+++EG+YP ++ +I    E +  + +K    AL+R ++  +  K+ +VK+ +  E  + +    ++D+G++ ++V  K   N  E   I LN  +LL  LK    D I V  +   +PV++
  S:     1 MKLSIEQSKLAEILETAYFAISPKPTDPILGNILLIANEDGIVSATGTNLNLT---IHTTTTANVETSGQVALPAKLLTDTINNVRGE-ITLE-VENQACIITHNSGKCRLIGGKPDEFPTLPKGENPI-EVNLSAKKLQAALEGTLYCTNGDETKL-VLTGVNFK-IDTNK-WQAASTNGHKLALVTGTLDSEYSDPIDF-TVPGKSLSELSKILSQSADTSVCNILLSNKTIEFSLPHTKVISRLLEGEYPKINSLIPRTFEYEFTLERKGFESALKR-VSYLAERKQKVVKILWELEATQATLYTEATDIGDAVDSVLMKPATNHSENISIGLNIDYLLEGLKHISTDEIVVRCNKPTQPVII 355
>gi|152987905|ref|YP_001345398.1| DNA polymerase III subunit beta [Pseudomonas aeruginosa PA7] >gi|150963063|gb|ABR85088.1| DNA polymerase III, beta subunit [Pseudomonas aeruginosa PA7] (367 aa)
Score = 145, Expect = 2.1e-07, Identities = 73/371 (19%), Positives = 157/371 (42%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFEST-PQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M   + +  L+  L+L   + E   + PV    L+ V   ++  T ++  +    +V +    +  E G I +  +    I   L ++++   +V+   + VK       ++ +    +P +       N  SI+    ++ I +  +A+     +   ++G+      +   L  +ATDG++LA    ++  P   R   IV    ++EL   + + D  + I L + +I          SK+++G +P+  R++    +  V   ++ L EA  R  AI S+EK   ++L  S+ +L++  +++      E             I  N  +LL +L     + +    SDS    L+ +  + +   +++P+R
  S:     1 MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVE---LVGRVVLEDAAEPGEITVPARKLMDICKSLPSDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLN-FSIAQSKLRRLIDRTSFAMAQQDVRY-YLNGMLLEV--NGGALRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVIGDRQQLREAFSR-TAILSNEKYRGIRLQLSNGLLKIQ-ANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMR 366
>gi|114319168|ref|YP_740851.1| DNA polymerase III, beta subunit [Alkalilimnicola ehrlichei MLHE-1] >gi|114225562|gb|ABI55361.1| DNA polymerase III, beta subunit [Alkalilimnicola ehrlichei MLHE-1] (366 aa)
Score = 145, Expect = 2.1e-07, Identities = 73/371 (19%), Positives = 165/371 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKY--AVNNNKEKINIMSGICFNSISSEKTL-EIIATDGYKLA--HYKFESTPQDFR-IVLDVSLIELLLEIIDF-DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I + +  L+  L+    + E   + PV     +E+ D   + T ++  +     +  S    + E G I +  +    I   L ++     +VD     ++       +  +  + YP+I         + +     +K I +  +  AV + +  +N +       +  E  +  ++ATDG++LA      ++  +  R +++    ++ LL ++D  D   ++ L +++I  K+ +    SK+I+G +P+  R++    E    ++++ L  AL R ++I S+EK   V+       L+V+  + +   ++E VS       P  +  N  ++L  L   D++++ +   DS    L++   D     +++P+R
  S:     1 MRIDIQREDLLKPLQAIIGVVERRQTLPVLANVRLELGDGLARLTATDLEVE----LVASLPCQVTEGGDITLPARKLLDICRNLPDQSQIQLQVDGERASLRAGRSRFTLATLSADDYPSIE-DIGARETVRLPQGQLRKLIERTHFSMAVQDVRYYLNGLM------VELEPAMARMVATDGHRLALAEQAIDTGVEAPRQVIVPRKGVQELLRLLDHSDEGADLELGDNHIRVKLGDVRFTSKLIDGRFPDYRRVVPEATETPATVNREDLRHALLR-VSILSNEKYRGVRFLLDGGTLKVASHNPEQEEAEEEVSVDYG-GAPLEVGFNAGYVLDALGALDDEDVRLTLRDSASSGLIQGVDDQTSRYVVMPMR 365
>gi|9966390|gb|AAG10236.1|AF201699_1 DNA polymerase III beta subunit [Sinorhizobium meliloti] (164 aa)
Score = 145, Expect = 2.3e-07, Identities = 35/157 (22%), Positives = 80/157 (50%)
  Q:   221 DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           D  + + + ++ I   + + ++ SK+I+G +P+  R+I    + ++ +  ++  +A++R ++  SSE+   VKL  +   + ++ ++ D G++ E +   G  ++P  I  N  +LL +             +D   P L+RD    + L +L+P+R
  S:     9 DVVVTVEVSDAKIRLTIGSIVMTSKLIDGTFPDYQRVIPASNDKELRVDCQSFSQAVDR-VSTISSERGRAVKLALADGQMTLTVNNPDSGSATEELPV-GYESDPLEIGFNAKYLLDITGQLTGGEAVFLLADPGSPTLVRDLAAEDALYVLMPMR 163
>gi|189499002|ref|YP_001958472.1| DNA polymerase III, beta subunit [Chlorobium phaeobacteroides BS1] >gi|189494443|gb|ACE02991.1| DNA polymerase III, beta subunit [Chlorobium phaeobacteroides BS1] (374 aa)
Score = 144, Expect = 2.6e-07, Identities = 53/212 (25%), Positives = 112/212 (52%)
  Q:   166 MSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESN--IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNS-KETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP---NFLQILVPIR 377
           M G+ F     +  L  IATDG++L  ++     S  +  RIV+   ++ +L +++  + NI I +  +N  I F   + ++ + +I   YPN   +I    + K++I + +  ++++R   +        ++ + S   ++++  + + G S +E ++C    NEP  I  N+ F+ + L   D+D++ VE S     V+L+ EK+    N + +++P+R
  S:   158 MMGVLFEI--EQNLLSAIATDGHRLVRFRKTCEVSLSEKQRIVIPARVLSILQKLVS-EGNIRISIDSANRSIRFSTESLVLDAALIVEQYPNYEAVIPLENDKKLSIERASFYDSVKR---VGRFSNIGDIRFSISPSTMKLTAENINEGESAQEDLACSYD-NEPIEIGFNSKFIEAALAHIDDDSLIVELSTPTTAVILKPEKEKENENMMILVMPVR 371
>gi|416236|dbj|BAA03628.1| DNA polymerase III beta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (165 aa)
Score = 144, Expect = 2.9e-07, Identities = 41/159 (25%), Positives = 82/159 (51%)
  Q:   217 IIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETV-SCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVP 375
           ++D   N++I + E  I F + N I  S +I+G +PNV     T  E  + + +K++++ L R   ++     +IV +  + + +E     S++G  +E       + N+   IS N  FL+  +KT   D I ++  +S KP+++ +  D +  Q+++P
  S:     1 LLDNAENLKIIIVEGYITFIIDNVIFQSNLIDGKFPNVQIAFPTKFETIITVKQKSILKVLSRFDLVADDGLPAIVNIKVNEDKIEFKSFISEVGKYEEDFDDFVIEGNKSLSISFNTRFLIDAIKTLSEDRIELKLINSTKPIVINNVYDEHLKQVILP 160
>gi|55979970|ref|YP_143267.1| DNA polymerase III, beta subunit [Thermus thermophilus HB8] >gi|55771383|dbj|BAD69824.1| DNA polymerase III, beta subunit [Thermus thermophilus HB8] (375 aa)
Score = 144, Expect = 2.9e-07, Identities = 86/371 (23%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITL----EKVDNSVIKVKTSTFDSNINIMDEEQYPNI-------NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFD-TNIEIFLFESNIIFKV---SNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEP-TPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M I V K  L + L L   I  +  ++P++    +   +  +    +NG +     V    +A  L   R+L+  +PFF ++  L  +++ L    E      +++ +  F + +++   E YP +         ++    ++    +V  K+++ V+YA +N +E   I  G+      S +    +A+DGY+LA Y     PQ F+   +V   S+ E++  +   D    ++ L E  +   +   S   +A +++EG++P+  R+I      KV +  + L EA+ R +++ S  +   V L      + +S +  D G  +E V    +V  P   ++ N  +LL  L     D   +  S    P L+  + +  +  ++VP+R
  S:     1 MNITVPKKLLSDQLSLLERIVPSRSANPLYTYLGLYAEEGALILFGTNGEVDLE--VRLPAEAQSLP--RVLVPAQPFFQLVRSLPGDLVALGLASEPGQGGQLELSSGRFRTRLSLAPAEGYPELLVPEGEDKGAFPLRTRMPSGELV--KALTHVRYAASN-EEYRAIFRGVQLEF--SPQGFRAVASDGYRLALYDL-PLPQGFQAKAVVPARSVDEMVRVLKGADGAEADLALGEGVLALALEGGSGVRMALRLMEGEFPDYQRVIPQEFALKVQVEGEALREAVRR-VSVLSDRQNHRVDLLLEEGRILLS-AEGDYGKGQEEVP--AQVEGPGMAVAYNARYLLEALAPV-GDRAHLGISGPTSPSLIWGDGE-GYRAVVVPLR 374
>gi|187479880|ref|YP_787905.1| DNA polymerase III, beta chain [Bordetella avium 197N] >gi|115424467|emb|CAJ51021.1| DNA polymerase III, beta chain [Bordetella avium 197N] (371 aa)
Score = 144, Expect = 3.1e-07, Identities = 53/195 (27%), Positives = 103/195 (52%)
  Q:   183 IATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFS---DSFKPVLLRDEKDPNFLQILVPIR 377
           +ATDG++LAH   E+     R   IV   +++E+   + D D  + + +    I F+  +  + SK++EG +P+ SR+I T       +S++ L  +L+R  AI +++K   V+L     V+++S S+++   ++E +      +E   +  N  +LL +L     +N  VE+S   D+    L+    D  F  +++P+R
  S:   174 VATDGHRLAHCATEADGIAERHEVIVPRKTVLEMQRLLEDSDEPVSLDVAPGQIRFRFGDVELVSKLVEGKFPDFSRVIPTNYTRHFLVSREALQGSLQRA-AILTTDKFKGVRLQLGHNVMKISSSNAEQEEAQEEIDIDYS-HEALDVGFNVGYLLDVLANVKVEN--VEWSVMPDANASALITLPDDDQFKYVVMPMR 370
>gi|50953927|ref|YP_061215.1| DNA polymerase III subunit beta [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950409|gb|AAT88110.1| DNA polymerase III, beta subunit [Leifsonia xyli subsp. xyli str. CTCB07] (381 aa)
Score = 143, Expect = 3.4e-07, Identities = 67/325 (20%), Positives = 153/325 (47%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE----STPQDFRIVL-DVSLIELLLEIIDFDTNIEIFLFESN----IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP 358
           P+  G LIE  +N ++ ++ +  +S  + +A    A + E GR+L+  +    I +KL N  +     ++ +I VK  + +  +  M  E+YP+I     +   +      F +++++V  A + + +   +++G+       + TL ++ATD Y++A  + +    +T  + +  L     +  + + +     + I +   +    I F      + S +I+G++P V R+     EN   ++   L+EA  R   +   E+++ ++  F+++ L +    S+   + E++       + T +SL   FLL  L    ++ + + F+ +  P
  S:    28 PILSGVLIETTENGLQLSSFDYEVSAQTKIA----AEVEETGRVLVSGRLLAEIAAKLPNAPVQFSTEESKII-VKAGSANFTLLSMPVEEYPSIPDVSGEAGLVPAEE--FAEAVAQVGVAASRD-DVTPVITGVQLEV--GDNTLGLVATDRYRVAVREIDWDNGTTLGETKTALVPARTLTEIGKTLGHSGTVSIAITNRDDRELIAFTDDRKTVTSLLIKGNFPPVRRLFPDQVENHAVMNTAELIEATRRVSLV--LEREAALRYTFTADGLTLEAIGSEQAQASESIDAL-LTGQETVVSLKPQFLLDGLGAVHSEFVRISFTKTENP 348
>gi|86150533|ref|ZP_01068757.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85838985|gb|EAQ56250.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni CF93-6] (355 aa)
Score = 142, Expect = 4.3e-07, Identities = 74/358 (20%), Positives = 164/358 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE 364
           MK+ ++K  L +A+ LCN+  E   SS +        +++++    S+  I  +  + K     +   G   +  K    +I  L NE + LE +DN +   + ST    + + + E +PN   +    NQ  I      +S+ K+  +++ N  K ++     F  I ++K +  + TD  +LA Y  E +  Q+F   +    I  + ++  F   IEIF  ++ +I K  N    +K+I   +P+  ++I    + +++ S +  +++L++   ++       +KL+F+ + +     S D   +K  +  +  V+E   +++   +LL  L + + +  T+  ++     +++ +
  S:     1 MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIRASDYEIGINYKIKK---IRVESSGFATVNAKSIADVIKSLNNEEVILETIDNFLFIRQKST-KYKLPMFNHEDFPNFPNTEGK-NQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGA--FLDIKTDK-INFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKL--FYEKIEIFYDQNMLIAKNENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEK-----MKLHFNKDKIIFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKYLLDFLTSIEEEKFTLSVNEPNSAFIVKSQ 344
>gi|78776203|ref|YP_392518.1| DNA polymerase III subunit beta [Sulfurimonas denitrificans DSM 1251] >gi|78496743|gb|ABB43283.1| DNA polymerase III, beta subunit [Sulfurimonas denitrificans DSM 1251] (355 aa)
Score = 142, Expect = 4.4e-07, Identities = 81/370 (21%), Positives = 163/370 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE--STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MKI + K+ + N L       E   +S +     I+ ++N++    ++  I    ++  ++  NI + G +    K    I+  LK+  I LE V + ++ +  S     +      ++P    S    +++ I       S+ K+  +++ N  K  +   +       +  +   +TD  +LA    E  S+ +   IV   +++E+     D   NIE++  E+ +I         +K+I G +P  SRII    +N + + K  ++EA+++   IS+      VK+ F ++ +     S D   +K  ++       P  I++N+ +LL  L T ++    +  +DS  P +L    D NF  +++PI
  S:     1 MKITIQKSIIENILIHSQPFLEKKDTSQITSHVFIDASNNKLTLKATDYEIG---LIVSTDKLNISQDGNVTANGKKLLDIVRILKDGEINLE-VKSDILYISQSHSKFKLPTFSYNEFPVFPMSEGK-SRILIDSHSLIDSLKKITPSIDINNPKFELNGALI---DIKQNNINFASTDTRRLAVVNIENQSSSELSIIVPKKAIVEIQKLFFD---NIELYYDENYLIIHSKEYTFFTKLINGKFPEYSRIIPKEIKNTLILQKAKMIEAIKQITTISTD-----VKITFLNDTVIFESLSDDNIEAKTEINSITGFTTPFTIAVNSRYLLDFLNTINSSEFNIGLNDSNLPFVL---NDGNFKTVVMPI 353
>gi|6606558|gb|AAF19208.1|AF213933_1 DNA polymerase III beta subunit [Buchnera aphidicola] (366 aa)
Score = 142, Expect = 5.5e-07, Identities = 89/377 (23%), Positives = 184/377 (48%)
  Q:     1 LKKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAII---SKLKNEMITLEKVDNSVIKVKTSTFDSN--INIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIEL-----LLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K ++K KI     K IN L   NS      + P+    LI VN+  I  T +N       +++  E +     G I +  +    I    S+L +  I+L K      K+  S  +SN  +N +  E +PN N +++  ++  IS  + KK I K  +++     +   ++G+      ++ +L  +ATDGY+L   K   TP    +V+  ++I       L ++++ +   I + + ++NI   +   I   ++IEG+YP+   I++  K++ + ++ K L ++L R +++ S +    V++  ++   +V  S++      E         E   IS+N ++++ +L    + NI + F++S   + +  E+D + L +++ +R
  S:     1 MKFNIKNKIFTQHLKKINRLITKNS------TLPILENILITVNNGIISLTATN---LETELISNIEISKTYTPGSITVSGQKLLNICRNSSELSDIKISLNKE-----KIHISLENSNYILNTLPAENFPNHN-NFDHVSEFFISSDILKKMIEKTHFSMGKQDVRY-YLNGMLLEK--NKTSLYTVATDGYRLGIAK---TPLKKDVVIFSAIIPRKGIIELHKLLNIEPQLIHVLIGKNNIKIYIEKLIFTVQLIEGEYPDYKSILSRKKQHPIILNNKILKQSLLR-VSVLSDKNFCGVEIYITNNKFQV-LSNNQHEEKAEDSFKINYYGENIEISINVYYIIEVLNVISSKNIFIFFNESNNSIHIESEEDHSLLYVIMLLR 365
>gi|46199911|ref|YP_005578.1| DNA polymerase III, beta chain [Thermus thermophilus HB27] >gi|46197538|gb|AAS81951.1| DNA polymerase III, beta chain [Thermus thermophilus HB27] (375 aa)
Score = 141, Expect = 5.9e-07, Identities = 85/371 (22%), Positives = 172/371 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITL----EKVDNSVIKVKTSTFDSNINIMDEEQYPNI-------NFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFR---IVLDVSLIELLLEIIDFD-TNIEIFLFESNIIFKV---SNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEP-TPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M I V K  L + L L   I  +  ++P++    +   +  +    +NG +     V    +A  L   R+L+  +PFF ++  L  +++ L    E      +++ +  F + +++   E YP +         ++    ++    +V  K+++ V+YA +N +E   I  G+      S +    +A+DGY+LA Y     PQ F+   +V   S+ E++  +   D    ++ L E  +   +   S   +A +++EG++P+  R+I      +V +  + L EA+ R +++ S  +   V L      + +S +  D G  +E V    +V  P   ++ N  +LL  L     D   +  S    P L+  + +  +  ++VP+R
  S:     1 MNITVPKKLLSDQLSLLERIVPSRSANPLYTYLGLYAEEGALILFGTNGEVDLE--VRLPAEAQSLP--RVLVPAQPFFQLVRSLPGDLVALGLASEPGQGGQLELSSGRFRTRLSLAPAEGYPELLVPEGEDKGAFPLRTRMPSGELV--KALTHVRYAASN-EEYRAIFRGVQLEF--SPQGFRAVASDGYRLALYDL-PLPQGFQAKAVVPARSVDEMVRVLKGADGAEADLALGEGVLALALEGGSGVRMALRLMEGEFPDYQRVIPQEFALRVQVEGEALREAVRR-VSVLSDRQNHRVDLLLEEGRILLS-AEGDYGKGQEEVP--AQVEGPGMAVAYNARYLLEALAPV-GDRAHLGISGPTSPSLIWGDGE-GYRAVVVPLR 374
>gi|108562901|ref|YP_627217.1| DNA polymerase III subunit beta [Helicobacter pylori HPAG1] >gi|107836674|gb|ABF84543.1| DNA polymerase III beta-subunit [Helicobacter pylori HPAG1] (374 aa)
Score = 141, Expect = 6.2e-07, Identities = 90/360 (25%), Positives = 164/360 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHS-IVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFK--KSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKV---SNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD 366
           MKI VSK  L NALR   +  +   +S +     +EV   ++    S+  I   S I  +S D    ++G   I  K F  IIS LK+  I LE  D+S VIK   S+F   + + D +++P         +    +P +    K I+ V    ++ +E    ++GI        +TL ++ TD  +L++ + E     ST +D   +L       LLEI+      E F F+S+ +  V         +K+I+G+YP+  +I+     +   + K+   E+++   ++SS+ K ++ K N   E L+   S +    +   +     + +   + +N  F L  L         ++ ++   P L+++  D
  S:     1 MKISVSKNDLENALRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYIFTQSSD----KEGVGTINGKKFLDIISCLKDSNIVLETKDDSLVIKQNKSSF--KLPMFDADEFPEFPVIEPKVSIEVNTPFLVDAFKKIAPVIEQTSHKRE----LAGILMQFDQKHQTLSVVGTDTKRLSYTQLEKISIHSTEEDISCILPK---RALLEILKL--FYENFSFKSDGMLAVIENETHTFFTKLIDGNYPDYQKILPKEYTSSFTLGKEEFKESIKLCSSLSSTIKLTLEKNNALFESLDSEHSET--AKTSVEIEKGLDIEKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQESLD 355
>gi|21222286|ref|NP_628065.1| DNA polymerase III subunit beta [Streptomyces coelicolor A3(2)] >gi|118804|sp|P27903|DPO3B_STRCO DNA polymerase III subunit beta >gi|153241|gb|AAA26735.1| DnaN [Streptomyces coelicolor A3(2)] >gi|8247660|emb|CAB92998.1| DNA polymerase III, beta chain [Streptomyces coelicolor A3(2)] (376 aa)
Score = 141, Expect = 6.9e-07, Identities = 80/345 (23%), Positives = 158/345 (45%)
  Q:    33 SPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL-----SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDT------NIEIFLF-------ESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD------EKDPNFLQILVPIR 377
           +PV  G L++  + ++  ++ +  +S       S +A I E+G +L+  +    I   L N  + +   D     V   +    ++ +  E+YP +        Q+     ++   VF  ++ +V  A   + + + +++G+         TL   +TD Y+ A  +F   P++     D+S + L+      DT        ++ L        E  I F+ +     ++++EGD P    +  T   +   I     VEA++R   ++  E+ + V+L+F   VL +   SSD   + E V  + + ++ + I+ N  FLL  L   D+    + F+ S KP LL        E D  +  +++P+R
  S:    27 APVLAGLLLKAEEGQLSLSSFDYEVSARV----SVEAEIEEEGTVLVSGRLLADISRALPNRPVEIS-TDGVRATVVCGSSRFTLHTLPVEEYPALP-------QMPEATGTVPGEVFASAVQQVAIAAGRD-DTLPVLTGVRIEIEGDSVTLA--STDRYRFAVREFLWKPEN----PDISAVALVPAKTLQDTAKALTSGDQVILALSGSGAGEGLIGFEGAGRRTTTRLLEGDLPKYKTLFPTEFNSVAVIETAPFVEAVKRVALVA--ERNTPVRLSFEQGVLILEAGSSDDAQAVERVDAQLEGDDIS-IAFNPTFLLDGLSAIDSPVAQLSFTTSTKPALLSGRPAVDAEADEAYKYLIMPVR 373
>gi|75812736|ref|YP_320353.1| DNA polymerase III beta subunit family protein [Anabaena variabilis ATCC 29413] >gi|75705492|gb|ABA25164.1| DNA polymerase III, beta chain [Anabaena variabilis ATCC 29413] (444 aa)
Score = 140, Expect = 7.4e-07, Identities = 85/355 (23%), Positives = 170/355 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSF--SSSDLGNSKETVSCKGKV--NEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           MK+ + ++KL   L           + P+    L+  N++ I   T   +  T   +  +  AN+   G++ +  K     I+ ++ E I+LE V+N    +  ++    +     +++P +    N   ++++S    + ++    Y  N ++ K+ +++G+ F  I + K  +  +T+G+KLA          S P DF  V   SL EL  +L      +   I L    I F + NT + S+++EG+YP ++ +I    E +  + +K    AL+R ++  +  K+ +VK+ +  E  + +    ++D+G++ ++V  K     +E   I LN  +LL  LK    D I V  +   +PV++
  S:     1 MKLNIEQSKLAEILETAYLAISPKPTDPILGNILLIANEDGIVSATGTNLNLT---IHTTTTANVETSGQVALPAKLLTDTINNVRGE-ISLE-VENQACIITHNSGKCRLIGGKPDEFPTLPKGENPI-EVNLSAKKLQTALEGTLYCTNGDETKL-VLTGVNFK-IDTNK-WQAASTNGHKLALVTGTLDSEYSDPIDF-TVPGKSLGELNKILSQSADTSVCNILLSNKTIEFSLPNTKVISRLLEGEYPKINSLIPRTFEYEFTLERKGFESALKR-VSYLAERKQKVVKILWELEATQATLYTEATDIGDAVDSVLMKPTTSHSENISIGLNIDYLLEGLKHISTDEIVVRCNKPTQPVII 355
>gi|57236916|ref|YP_178031.1| DNA polymerase III subunit beta [Campylobacter jejuni RM1221] >gi|86152375|ref|ZP_01070585.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153999|ref|ZP_01072201.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|57165720|gb|AAW34499.1| DNA polymerase III, beta subunit [Campylobacter jejuni RM1221] >gi|85840672|gb|EAQ57924.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842537|gb|EAQ59750.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni HB93-13] (355 aa)
Score = 140, Expect = 7.7e-07, Identities = 74/358 (20%), Positives = 163/358 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE 364
           MK+ ++K  L +A+ LCN+  E   SS +        +++++    S+  I  +  + K     +   G      K    +I  L NE + LE +DN +   + ST    + + + E +PN   +    NQ  I      +S+ K+  +++ N  K ++     F  I ++K +  + TD  +LA Y  E +  Q+F   +    I  + ++  F   IEIF  ++ +I K  N    +K+I   +P+  ++I    + +++ S +  +++L++   ++       +KL+F+ + +     S D   +K  +  +  V+E   +++   +LL  L + + +  T+  ++     +++ +
  S:     1 MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIRASDYEIGINYKIKK---IRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLFIRQKST-KYKLPMFNHEDFPNFPNTEGK-NQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGA--FLDIKTDK-INFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKL--FYEKIEIFYDQNMLIAKNENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEK-----MKLHFNKDKIIFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKYLLDFLTSIEEEKFTLSVNEPNSAFIVKSQ 344
>gi|6606556|gb|AAF19207.1|AF213932_1 DNA polymerase III beta subunit [Buchnera aphidicola] (366 aa)
Score = 140, Expect = 7.7e-07, Identities = 74/377 (19%), Positives = 176/377 (46%)
  Q:     1 LKKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K ++K KI +   K +N L   NS      + P+    LI VN+  I  TT+N       +++  E +     G I +  +    I             ++   + + +   +  +  +  E +PN N  ++  ++  IS  + KK I + ++++     +   ++G+      ++ +L  +ATDGY+L   K   +     F +++    I  L ++++ +   I + + ++NI   +   I   ++IEG+YP+   I+   K + + ++ K L ++L R +A+ S +    V+++ ++   +V  ++ D   ++++        +   IS+N ++++ +L    + NI +  ++S   + +  E+D + L +++ +R
  S:     1 MKFNIKNKIFIQHLKKVNRLISKNS------TLPILENILITVNNGIISLTTTN---LETELISNIETSKTHTPGSITVSGQKLLNICRNSSESSEIKISLNEDKMHIASDNSNYILTTLPSENFPNHN-KFHHISEFFISSDILKKMIEQTQFSMGKQDVRY-YLNGMLLEK--NKTSLYAVATDGYRLGITKTFLKEDVFIFSVIIPRKGIIELHKLLNIEPQLIHVLIGKNNIRIHIEKLIFTVQLIEGEYPDYKSILLRKKNHSIILNNKILKQSLLR-VAVLSDKNFCGVEIHITNNKFKVLSNNQDEEKAEDSFKIN-YCGDDIEISINVYYIIEVLSVITSKNIFMFINESNNSIHIESEEDNSSLYVIMLLR 365
>gi|153952198|ref|YP_001397275.1| DNA polymerase III subunit beta [Campylobacter jejuni subsp. doylei 269.97] >gi|152939644|gb|ABS44385.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. doylei 269.97] (355 aa)
Score = 139, Expect = 1.2e-06, Identities = 76/358 (21%), Positives = 161/358 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE 364
           MK+ ++K  L +A+ LCN+  E   SS +        +++++    S+  I  +  + K     +   G      K    +I  L NE I LE +DN +   + ST    + + + E +PN   +    NQ  I      +S+ K+  +++ N  K ++     F  I ++K +  + TD  +LA Y  E +  Q+F   +    I  + ++  F   IEIF  ++ +I K  N    +K+I   +P+  ++I    + +++ S +  +++L++   ++       +KL+F+   +     S D   +K  +  +  V+E   +++    LL  L + + +  T+  S+     +++ +
  S:     1 MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIRASDYEIGINYKIKK---IRVESSGFATANAKSITDVIKNLNNEEIVLETIDNFLFIRQKST-KYKLPMFNHEDFPNFPNTEGK-NQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGA--FLDIKTDK-INFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKL--FYEKIEIFYDQNMLIAKNENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEK-----MKLHFNKNKIIFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVSEPNSAFIVKSQ 344
>gi|111020656|ref|YP_703628.1| DNA polymerase III subunit beta [Rhodococcus sp. RHA1] >gi|110820186|gb|ABG95470.1| DNA-directed DNA polymerase III beta subunit [Rhodococcus sp. RHA1] (394 aa)
Score = 138, Expect = 1.3e-06, Identities = 78/344 (22%), Positives = 169/344 (49%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL-----SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIA-TDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEII-DFDTNIEIFLFESNII-----FKVSNT--IIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR----DEKDPN-----------FLQILVPIR 377
           PV  G L++  +  +  +  +  +S    VA    A +   G++L+  K    I   L N+ + +  ++ + + +   +   ++  M  E YP +        QL     SI   VF ++IS+V  A   + + + +++GI    +  E+   ++A TD ++LA  + E +P +      V     +L E    +  D  + +E+ L   + +       + N      +++++ ++P   +++ +       +    LVEA++R   ++  E+ + V+L FS+E L +S    D G ++E ++   +  EP  I+ N  +L+  L +  ++ +   F+   +P +LR    DE +P+           +  +L+P+R
  S:    33 PVLGGVLLDATEQGLTVSGFDYEVSAQVRVA----AEVGSAGQVLVSGKLLADITKSLPNKPVDV-TLEGTRVLITCGSAKFSLPTMPVEDYPQLP-------QLPQQTGSIPADVFSEAISQVAVAAGKD-DTLPMLTGI---RVEIERNAIVLAATDRFRLAVRELEWSPANPDTTAAVLIPAKTLSESAKTLAGDATSPVELALGSGSAVGNDGLLGIVNDGRRTTTRLLDAEFPKFRQLLPSEHTALATVEIAPLVEAIKRVALVA--ERGAQVRLQFSTEGLLLSAGGDDAGRAEEGLNAVFQ-GEPLTIAFNPGYLIDGLSSLHSEQVLFGFTTPSRPAVLRPATEDEIEPDDSGNFAAPESAYTYLLMPVR 391
>gi|71914140|gb|AAZ54042.1| DNA polymerase III, beta subunit [Thermobifida fusca YX] (372 aa)
Score = 138, Expect = 1.4e-06, Identities = 79/346 (22%), Positives = 160/346 (46%)
  Q:    32 SSPVFLGTLIEVND--NEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKV-------KYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDT--------NIEIFLF------ESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-----DEKDPNFLQILVPIR 377
           S PV  G L++ +D     + T S+      + V  S D +I E GRIL+  K    I+  L  + + +   D + + V   +    I  +  E YP           L   P +    +S                 + + +++G+      S  T+ +++TD Y+LA  +   TP+D     +VS + L+      DT         I I L       E  I F+       ++++EG++P   +++     +   + K   +EA++R   +  +E+ + ++L+F+S+ L +   + +   + E +S   + ++   I+ N+ FLL  L   ++D   ++F+ S KP ++      D    ++  +++P+R
  S:    18 SVPVLAGMLLDADDVDGHQRLTLSSFDYEVSAQV--SVDVDIDEPGRILVSGKLLAEIVRNLPPQTVEVS-TDGAKVVVSCGSAKFTILTLPVEDYPT----------LPAMPALTGSVLSDTFAAAVSQVAVAAGRDDTLPMLTGVRIEIEGS--TVTLVSTDRYRLAVRELTWTPED----PNVSAVALVPAKTLADTAKSLTGGAQISIALSTAENGGEGMIGFEGGGRRTTTRLLEGEFPKYRKLLPESFNSVAEVQKNEFIEAVKRVSLV--AERNTPLRLSFTSDRLVLEAGTGEEAQAVEELSATLEGDD-IQIAFNSTFLLDGLNAIESDVAHLQFTTSTKPAIITGKPADDGTASDYRYLIMPVR 369
>gi|21234115|ref|NP_639692.1| DNA polymerase III subunit beta [Streptomyces coelicolor A3(2)] >gi|13620601|emb|CAC36640.1| putative DNA-polymerase III, beta chain [Streptomyces coelicolor A3(2)] (372 aa)
Score = 137, Expect = 2.1e-06, Identities = 59/233 (25%), Positives = 112/233 (48%)
  Q:   145 FKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA----HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESN---IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR--DEKDPNFLQILVPIR 377
           F +++++V  AV+  +E +  ++GI  +  S   TL + ATD Y+ A     +K  + P    ++   +L +      D DT +++ L   +      +   T  A + +EG+ P    +  T   +   +    L  A +R +A+ S++K + +KL F+++  L +   + D   + ++V       E T I+ N  FLL  L     +++  +F    KP +LR  D  D     +L+PIR
  S:   131 FAEAVAQVACAVSR-EESLPTLTGIGLHHDSEAATLTLYATDRYRFAVRTLSWKDANLPDTSAVIPGRALSDAAKATAD-DTTVDLALPTGDAGLFTLRSDLTTTAIRALEGELPKYDALFPTEFAHTATVEIAPLKAAAQR-VALVSAKKDAPIKLTFTADSTLVLEGGTGDDAQAVDSVDTSLTGGELT-IAFNPAFLLDGLNALMAESVQFDFISPTKPAVLRAHDGDDQALRYLLMPIR 369
>gi|15611519|ref|NP_223170.1| DNA polymerase III subunit beta [Helicobacter pylori J99] >gi|11132657|sp|Q9ZLX4|DPO3B_HELPJ DNA polymerase III subunit beta >gi|4154988|gb|AAD06030.1| DNA POLYMERASE III, BETA CHAIN [Helicobacter pylori J99] (374 aa)
Score = 136, Expect = 2.4e-06, Identities = 86/360 (23%), Positives = 160/360 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVA-KSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNS-VIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKV---SNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD 366
           MKI VSK  L N LR   +  +   +S +     +EV   ++    S+  I   S ++ +S D    ++G   I  K F  IIS LK+  I LE  D+S VIK   S+F   + + D +++P      +    L I+      +  K+   +     K   ++G+        +TL ++ TD  +L++ + E     ST +D   +L       LLEI+      E F F+S+ +  V         +K+I+G+YP+  +I+     +   + K+   E ++   ++SS+ K ++ K N   E L+   S +    +   +     + +   + +N  F L  L         ++ ++   P L+++  D
  S:     1 MKISVSKNDLENTLRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYISTQSTD----KEGVGTINGKKFLDIISCLKDSNIVLETKDDSLVIKQNKSSF--KLPMFDADEFPEFPV-IDPKVSLEINAPFLVDAFKKIAPVIEQTSHKRE-LAGVLMQFNQKHQTLSVVGTDTKRLSYTQLEKISIHSTEEDISCILPK---RALLEILKL--FYENFSFKSDGMLAVVENETHAFFTKLIDGNYPDYQKILPKEYTSSFTLGKEEFKEGIKLCSSLSSTIKLTLEKNNALFESLDSEHSET--AKTSVEIEKGLDIEKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLD 355
>gi|19703952|ref|NP_603514.1| DNA polymerase III, beta chain [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714128|gb|AAL94813.1| DNA polymerase III, beta chain [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (364 aa)
Score = 136, Expect = 2.4e-06, Identities = 79/370 (21%), Positives = 172/370 (46%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIV--------FKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRII-ATPKENKVNISKKTLVEALERGLAIS--SSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MK  +++ K I  +   ++I ++    P   G  I+  +N++ F  +N  I     + +  +  I  +G++LIK       I  L+ E I  EK D  +I       ++  +I+D+  YP +           I PIV        F  S+ KVK+  N++     + + I    I  +  LE+++TD ++L + K E +   +  +++    I +L +I  D D    +   +  +I    +     K++   +P+   +I  T  + +   ++  L  AL++ ++++  SS+ K++   NF    L +S  S++   +++      K  E   + +N  ++   +   D  NI ++ ++S   +   +E + N++ +++P+
  S:     1 MKFSINRQKTIEIIGEYSNILKDNPVKPSLAGLFIQAKNNQVVFKGANTEIE----LIRYANCEIESEGQVLIKPALLLEYIKLLEGENINFEKKDGYLI-----VNNAEFSILDDNTYPELT---------EIIPIVIASENTVKFTMSLEKVKFLTNSSASTDTLFNSI--KMIFKDNVLELVSTDSFRLIYMKKELNNMINKDVLVPGDSIAVLYKIFKDLDEEFSLAASDDKLIVTWKDAYFTCKLLSLSFPDFRPLINNTNHDKRFEFNRDELNLALKKVISVTKNSSDSKNVATFNFKGNQLLISGVSANAKINQKVNMI--KTGEDLKLGMNCKYIKDFIDNVDK-NIIIDATNSSSMLRFMEEGNENYIYLIMPV 360
>gi|154249882|ref|YP_001410707.1| DNA polymerase III, beta subunit [Fervidobacterium nodosum Rt17-B1] >gi|154153818|gb|ABS61050.1| DNA polymerase III, beta subunit [Fervidobacterium nodosum Rt17-B1] (367 aa)
Score = 136, Expect = 2.5e-06, Identities = 47/198 (23%), Positives = 97/198 (48%)
  Q:   180 LEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTN--IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           L ++A+DGY+L   + + +   +F  ++ +  I+ L +++   T   I I    S + F   +     + +E  +P+  R++    + +V ++     EAL+R + IS    +  V+L  + +++E++  SSD G + E++    K  E   ++ N  FL   LK  D   I   F D+  P+ +       ++ I++P+R
  S:   168 LRLVASDGYRLGLAEQKLNLENEFDFIIALKSIKELEKLLSSTTEPVINITYDHSLVSFNAGDVTTIVRTVEETFPDYKRVLPKAFKTRVILNLDDFSEALKRVMVISKRGNEK-VQLKITDDLMELTSQSSDFGEAVESIPIT-KDGEDLIVNFNPKFLNEPLKHIDEKEIEFNFVDNLSPLQINPRNVGGYIYIVLPVR 366
>gi|117927213|ref|YP_871764.1| DNA polymerase III, beta subunit [Acidothermus cellulolyticus 11B] >gi|117647676|gb|ABK51778.1| DNA polymerase III, beta subunit [Acidothermus cellulolyticus 11B] (387 aa)
Score = 135, Expect = 2.9e-06, Identities = 81/346 (23%), Positives = 158/346 (45%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLI--ELLLEIID-FDTNIEIFLFESNIIFKVSNTI------------IASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKV---NEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDP---------NFLQILVPIR 377
           S PV  G LIE  D E++  + +  +S     + S DA I E GR L+  +    I   L  + + +E +D S + +        + ++  E+YPN+          +I   +F  ++S+V  A   + + + +++G+          + + ATD Y+LA   F   P    +    +LI    L E+     T  E+ +F S       N I              +++I+G+Y     ++         ++   L+EA+ R   ++   + S V+L F+ + L +   + D   + E +  + +    ++   I+ N  +LL  L   +++  T+ F+   KP +LR  KD          ++  +L+P+R
  S:    26 SMPVLGGLLIEAMD-ELRIASFDYEVSA----SASIDATIAETGRALVSGRLLAEISRNLPAQPVDVE-LDGSRLVIACGASRFTLPLLPIEEYPNLPPLPTLAG--TIGADLFATAVSQVVVAAGRD-DTLPVLTGVRMEI--DRDVMTLAATDRYRLAVRDFHWQPARGDLTA-AALIPARTLGEVAKALTTGAEVTIFLSTESTSNENLIGFSGRGTSGERQTTTRLIDGEYVKYRSLLPAEAAATAQVATAALIEAVRRVSLVAP--RTSPVRLTFNPDRLTLEAGTGDDAQASEWIDARFESSTGDDEFVIAFNPAYLLDGLGAVESETTTLSFTSPNKPAVLRAGKDADTSADAGSDDYRYLLMPVR 384
>gi|15791401|ref|NP_281224.1| DNA polymerase III subunit beta [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|88597670|ref|ZP_01100903.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|88189974|gb|EAQ93950.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359401|emb|CAL34183.1| DNA polymerase III, beta chain [Campylobacter jejuni subsp. jejuni NCTC 11168] (355 aa)
Score = 135, Expect = 2.9e-06, Identities = 73/358 (20%), Positives = 162/358 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE 364
           MK+ ++K  L +A+ LCN+  E   SS +        +++++    S+  I  +  + K     +   G      K    +I  L NE + LE +DN +   + ST    + + + E +PN   +    NQ  I      +S+ K+  +++ N  K ++     F  I ++K +  + TD  +LA Y  E +  Q+F   +    I  + ++  F   IEIF  ++ +I K  N    +K+I   +P+  ++I    + +++ S +  +++L++   ++       ++L+F+ + +     S D   +K  +  +  V+E   +++    LL  L + + +  T+  ++     +++ +
  S:     1 MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIKASDYEIGINYKIKK---IRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLFVRQKST-KYKLPMFNHEDFPNFPNTEGK-NQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGA--FLDIKTDK-INFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKL--FYEKIEIFYDQNMLIAKNENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEK-----MRLHFNKDKIIFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVNEPNSAFIVKSQ 344
>gi|145588191|ref|YP_001154788.1| DNA polymerase III subunit beta [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145046597|gb|ABP33224.1| DNA polymerase III, beta subunit [Polynucleobacter sp. QLW-P1DMWA-1] (371 aa)
Score = 135, Expect = 3.1e-06, Identities = 73/366 (19%), Positives = 165/366 (45%)
  Q:    12 SKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN---GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-------STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S+  L+  L++ + I E   + P+    L + N  ++ F +++    I +  +    SED       R L+       I+  L    ++L   DN ++ V++     ++  +   ++P +          S++   F++ IS+V +++     +   ++G+    +   K +  +ATDG++LA  + E       S  +   I+   +++E    + D D ++EI L  + + F   +  + SK++EG +P+  R+I    +N + + +  L  AL+R   +++ + K  V+ + S   + +  S++      +         +   I  N  +LL +L    N+ I +   D+    ++      NF  +++P+R
  S:     7 SRDSLLKPLQVVSGIVERRHTLPILANLLFKKNGEKVSFISTDIEIQITTNANFGVGSEDVTTTVAARKLLD------ILRALPEGEVSLNLKDNRMV-VQSGKSRFSLQTLSATEFPVMQSVGEVTAAWSMTQKSFRQLISQVHFSMAQQDIRY-YLNGMLL--VVEGKEVVAVATDGHRLAFSRVELTEAPSGSGQRQEIIIPRKTILECQHLLEDSDESLEISLTANQVKFSFGDIELISKLVEGKFPDFQRVIPKGHKNTLVVGRDALQAALQRAAILTTDKFKG-VRFSLSPNRITIQ-STNAEQEEAQEEIETEYSGDAVEIGFNVSYLLDVLSNLKNEKIQISLGDANSSAVVTLPGSENFKYVVMPMR 370
>gi|88854500|ref|ZP_01129167.1| DNA polymerase III subunit beta [marine actinobacterium PHSC20C1] >gi|88816308|gb|EAR26163.1| DNA polymerase III subunit beta [marine actinobacterium PHSC20C1] (381 aa)
Score = 134, Expect = 3.8e-06, Identities = 77/352 (21%), Positives = 161/352 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLI--ELLLEI-IDFDTNIEIFLFESN------IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKP 358
           MK  V++     A+     +     + P+  G LIE  D  +  ++ +  +S  + +     A + E GR+L+  K    I S+L N  +     DN  I V   T    ++ M  E+YP +    +    L     +F  +I++V  A + + +   +++G+      S+  + ++ATD Y++A    E       +    +L+  + L+E+   F  + EI +  ++      I F   N  + S +I+G++P V R+     +N   ++   L+EA+ R   +   E+++ ++  F++E + +    S+   + ET+       + T +SL   FL+  L +  ++ + + F+ +  P
  S:     1 MKFQVNRDVFSEAVSFAVKLLPQRTTLPILSGVLIEATDEGLTLSSFDYEVSARTQI----KAEVDEPGRVLVSGKLLAEIASRLPNAPVRFSTEDNK-ITVACGTGHFTLSSMPVEEYPTLPQISDQVGTLKAD--LFSAAIAQVAVAASRD-DVTPVITGVQLEV--SQNNISLVATDRYRVAVRDIEWDAGASGVESATALVPAKTLVEVGKTFGNSGEISVAITSTDERELIAFHADNKTVTSLLIKGNFPPVRRLFPETVDNFAVMNTAELIEAVRRVSLV--LEREAALRFTFTTEGVTLEAIGSEQAQASETIDAF-LTGDDTVVSLKPQFLIDGLSSVHSEFVRISFTKTENP 348
>gi|53802864|ref|YP_115419.1| DNA polymerase III, beta subunit [Methylococcus capsulatus str. Bath] >gi|53756625|gb|AAU90916.1| DNA polymerase III, beta subunit [Methylococcus capsulatus str. Bath] (366 aa)
Score = 134, Expect = 3.8e-06, Identities = 80/371 (21%), Positives = 162/371 (43%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKN--EMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQL-SISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFR--IVLDVSLIEL--LLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           MK  + +  L+  L+    + E   + P+    LIEV    ++   ++  +    +VA + D    E GR  +  +    I   L    E+    K +   ++   S F   +  +  E YPN  F + D   +      + +++I K  +A+     +   ++G+       +  +  +A+DG++LA ++   +  P   R  I+    ++EL  LL  ++   ++ I      I+F   +   A K++EG YP+  R+I       V + +  L  AL R +A+ S+EK   V L     ++ +   + +   +++ V       E   +  N  +LL  +    +D + + F+D+    L+ D  D  +  I++P+R
  S:     1 MKFRILREDLLLPLQQVIGVIERRQTLPILSNVLIEVEAGRMELAGTDLEVQ---LVANT-DMEGKESGRFTVPARKLMDICRLLPEGGELAFDVKPERVSLQCGKSRFI--LGALPAENYPN--FEHGDPEAVFDCEAQLLRRAIEKTAFAMAQQDVRY-YLNGLLLEI--RQGRIRAVASDGHRLALFEDAVDGMPDVARQIIIPRKGVLELGRLLARVEGSASVRISANNVRILFGTFS--FAVKLVEGRYPDYERVIPKTACRVVVVDRHELRGALTR-VAVLSNEKFKGVSLEIGEGLIRLRAQNPEHEEAEDEVPADVS-GEAFAVGFNASYLLDAINAVASDAVRMSFTDANGSCLIEDLSDSRYRFIVMPMR 365
>gi|21672305|ref|NP_660372.1| DNA polymerase III beta chain [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|232008|sp|P29439|DPO3B_BUCAP DNA polymerase III subunit beta >gi|144150|gb|AAA73150.1| dnaN >gi|2827015|gb|AAC38107.1| DNA polymerase III beta subunit [Buchnera aphidicola] >gi|21622904|gb|AAM67583.1| DNA polymerase III beta chain [Buchnera aphidicola str. Sg (Schizaphis graminum)] (366 aa)
Score = 134, Expect = 3.9e-06, Identities = 78/360 (21%), Positives = 162/360 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPN-INFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNII-FKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD 366
           MK  +    L   L+    +     S P+    LI+V D  +  TT+N  I    +++K E       G+  I  +    I   L  +     ++ N  + + +   +  ++ +  + +PN  NF Y   ++  IS  + K+ I K ++++     +   ++G+       +K L  +ATDGY+LA  + + +     F I++    +  LL++++    +   L  SN I     N I  +++IEG+YP+   ++   K+N +  +   L ++L R +AI + EK   +++   +   +V  S +    + E +       E   IS+N ++LL ++    ++NI +  + S   + +  E +
  S:     1 MKFTIQNDILTKNLKKITRVLVKNISFPILENILIQVEDGTLSLTTTNLEIE---LISKIEIITKYIPGKTTISGRKILNICRTLSEKSKIKMQLKNKKMYISSENSNYILSTLSADTFPNHQNFDY--ISKFDISSNILKEMIEKTEFSMGKQDVRY-YLNGMLLEK--KDKFLRSVATDGYRLAISYTQLKKDINFFSIIIPNKAVMELLKLLNTQPQLLNILIGSNSIRIYTKNLIFTTQLIEGEYPDYKSVLFKEKKNPIITNSILLKKSLLR-VAILAHEKFCGIEIKIENGKFKV-LSDNQEEETAEDLFEIDYFGEKIEISINVYYLLDVINNIKSENIALFLNKSKSSIQIEAENN 354
>gi|77358984|ref|YP_338559.1| DNA polymerase III subunit beta [Pseudoalteromonas haloplanktis TAC125] >gi|76873895|emb|CAI85116.1| DNA polymerase III, beta-subunit; processivity clamp of DNA polymerase III [Pseudoalteromonas haloplanktis TAC125] (367 aa)
Score = 134, Expect = 4.3e-06, Identities = 64/371 (17%), Positives = 170/371 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE---STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVS-NTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           M+I +S+ + +  L   +   E   + P+    L+ V + ++  T ++  I   + V   +D   +   ++ +  K    I   L +       +    + + +     ++  +  E +PN+   ++   +  ++ +  +K +    +++ N   +   ++G+ F   +++  ++ +ATDG++LA  + +   S     ++++    ++ ++ ++  D  +    F +N I  +       SK+++G +P+  R++    +  +  +++ L  A +R ++I S+EK   V+LN S+ +L+++ +++      E V   G       I  N  ++L +L T   +++    +DS    L+    D   + +++P+R
  S:     1 MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLAVENGQLSMTGTDLEIELVASVFVGDD---IADTKLTLPAKKLLDICKSLPDGSDLTLSLQEHQLLLTSGKSRFSLTTLAAEDFPNLE-QWDGEVEFQLTRLELRKLLESTHFSMANQDVRY-YLNGMSFEVDNTD--IKTVATDGHRLAIAQKQLKQSLNTQRQLIIPRKGVQEIMRLMVADEELVTIQFGANHIRIIDIEFTFTSKLVDGRFPDYRRVLPRGGDKVITANREWLRSAFQR-VSILSNEKFRGVRLNLSNGLLKIT-ANNPEQEQAEEVVEVGYEGADLEIGFNVSYVLDVLNTLKTEDVLFTLADSNSSALIEGAGDEEAMYVVMPMR 366
>gi|15645127|ref|NP_207297.1| DNA polymerase III subunit beta [Helicobacter pylori 26695] >gi|3913505|sp|O25242|DPO3B_HELPY DNA polymerase III subunit beta >gi|2313610|gb|AAD07565.1| DNA polymerase III beta-subunit (dnaN) [Helicobacter pylori 26695] (374 aa)
Score = 134, Expect = 4.4e-06, Identities = 81/360 (22%), Positives = 161/360 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHS-IVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSV-IKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLD----VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD 366
           MKI VSK  L NALR   +  +   +S +     +EV   ++    S+  I   S I  +S D    ++G   I  K F  IIS LK+  I LE  D+S+ IK   S+F   + + D +++P      +    + ++      +  K+   +     K   ++GI        +TL ++ TD  +L++ + E     ST +D   +L     + +++L  E   F ++  + + E+ +          +K+I+G+YP+  +I+     +   + K+   E+++   ++SS+ K ++ K N   E L+   S +    +   +     + +   + +N  F L  L         +  ++   P L+++  D
  S:     1 MKISVSKNDLENALRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYIFTQSSD----KEGVGTINGKKFLDIISCLKDSNIILETKDDSLAIKQNKSSF--KLPMFDADEFPEFPV-IDPKVSIEVNAPFLVDAFKKIAPVIEQTSHKRE-LAGILMQFDQKHQTLSVVGTDTKRLSYTQLEKISIHSTEEDISCILPKRALLEILKLFYENFSFKSDGMLAVIENEM------HTFFTKLIDGNYPDYQKILPKEYISSFTLGKEEFKESIKLCSSLSSTIKLTLEKNNALFESLDSEHSET--AKTSVEIEKGLDIEKAFHLGVNAKFFLEALNALGTTQFVLRCNEPSSPFLIQESLD 355
>gi|121612492|ref|YP_999721.1| DNA polymerase III subunit beta [Campylobacter jejuni subsp. jejuni 81-176] >gi|167004698|ref|ZP_02270456.1| DNA polymerase III subunit beta [Campylobacter jejuni subsp. jejuni 81-176] >gi|87249053|gb|EAQ72015.1| DNA polymerase III, beta subunit [Campylobacter jejuni subsp. jejuni 81-176] (355 aa)
Score = 134, Expect = 4.5e-06, Identities = 72/358 (20%), Positives = 161/358 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE 364
           MK+ ++K  L +A+ LCN+  E   SS +        +++++    S+  I  +  + K     +   G      K    +I  L NE + LE +DN +  V+       + + + E +PN   +    NQ  I      +S+ K+  +++ N  K ++     F  I ++K +  + TD  +LA Y  E +  Q+F   +    I  + ++  F   IEIF  ++ +I K  N    +K+I   +P+  ++I    + +++ S +  +++L++   ++       ++L+F+ + +     S D   +K  +  +  V+E   +++    LL  L + + +  T+  ++     +++ +
  S:     1 MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIKASDYEIGINYKIKK---IRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLF-VRQKNTKYKLPMFNHEDFPNFPNTEGK-NQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGA--FLDIKTDK-INFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKL--FYEKIEIFYDQNMLIAKNENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEK-----MRLHFNKDKIIFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVNEPNSAFIVKSQ 344
>gi|32266625|ref|NP_860657.1| DNA polymerase III subunit beta [Helicobacter hepaticus ATCC 51449] >gi|32262676|gb|AAP77723.1| DNA polymerase III [Helicobacter hepaticus ATCC 51449] (353 aa)
Score = 133, Expect = 5.6e-06, Identities = 76/370 (20%), Positives = 170/370 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFES-TPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPI 376
           MKI + K+ L   L  C +  +    S +      E  D+++    ++  I   S +     A    +G   +  K    II +LK++ +T+E   +S + +      + + + + +++P     Y+   Q++I    F  SI K+  AV+ N  K  +   +       + +   +ATD  +LA  ++++ +     +V+    I  + ++  F   +EI+   +++I K ++    +K+I G YP+  +II    ++K+ + K   V+AL+   +++++     +K+  S    EV F S +  + + +   + + N E   + +N+ ++L  L   D +  T+  ++   P ++  E   NF  +++P+
  S:     1 MKISLPKSSLETILTNCQNFLDKRDRSQITSHIYFEAQDDKLLLKATDYEIWLESYINIPCQA----QGNATVNGKQILDIIKRLKDDNVTIETKQDS-LHISQGKARTKLPMFNADEFPKFP-EYDANAQINIESDKFLNSIKKINPAVDTNNPKYELNGSLL---DIKDYSFNFVATDTRRLALIEYKNPSINALSLVIPKKAINEIQKL--FVDTLEIYHNPTHLILKNNDYTFYTKLISGKYPDYEKIIPKEFKHKIVLPKDKFVDALQFVKSLANN-----IKITLSPN--EVLFESLNEESGEASTQIEVQTNIENLTLGINSKYILDFLSQIDANEFTLCINEPNTPFVVMSE---NFSTVIMPV 351
>gi|15606912|ref|NP_214293.1| DNA polymerase III beta chain [Aquifex aeolicus VF5] >gi|3913514|sp|O67725|DPO3B_AQUAE DNA polymerase III subunit beta >gi|2984154|gb|AAC07688.1| DNA polymerase III beta chain [Aquifex aeolicus VF5] (363 aa)
Score = 133, Expect = 6.0e-06, Identities = 59/229 (25%), Positives = 114/229 (49%)
  Q:   149 ISKVKYAVNNNKEKINI-MSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD---EKDPNFLQILVPIR 377
           I KV+YA+   KE+ NI + G+       E  +  + +DG++LA Y+   E + +       + +++ L+  I+ D NIE    ES   F      +A +++EG++P+   +I      +V    + +++ L+R  A+S   K   VK+  S  +    F+  + G ++E +  +    EP  I  N  +L+  L  +D++ +  +F+      LL     EK+P +  I++P+R
  S:   136 IEKVEYAIA--KEEANIALQGMYLRGY--EDRIHFVGSDGHRLALYEPLGEFSKELLIPRKSLKVLKKLITGIE-DVNIEKSEDESFAYFSTPEWKLAVRLLEGEFPDYMSVIPEEFSAEVLFETEEVLKVLKRLKALSEG-KVFPVKITLSENLAIFEFADPEFGEAREEIEVE-YTGEPFEIGFNGKYLMEALDAYDSERVWFKFTTPDTATLLEAEDYEKEP-YKCIIMPMR 362
>gi|6007546|gb|AAF00953.1|AF183408_1 DNA polymerase III beta subunit [Microcystis aeruginosa PCC 7806] (139 aa)
Score = 132, Expect = 7.7e-06, Identities = 35/120 (29%), Positives = 71/120 (59%)
  Q:   242 IASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE--VLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLL 361
           + S+ +EG YP  +++I    +  + + +K L+  LE  +A+ S +K ++VK +  SE   L ++  S DLG++KE+++ + +  E   I+ N  +L+  LK   N++I ++ + S +PV+ 
  S:     1 VTSRKLEGAYPTYNQLIPKSFDRSLVLDRKQLIRCLEL-VAVLSDQKNNLVKFSLDSENDRLSLAVESPDLGSAKESMAAEIQ-GESGDIAFNVKYLMDGLKALPNNDIQMQLNASTQPVIF 120
>gi|20799549|gb|AAM28542.1|AF494512_1 DNA polymerase III beta subunit [Tomato big bud phytoplasma] (273 aa)
Score = 131, Expect = 8.3e-06, Identities = 52/249 (20%), Positives = 123/249 (49%)
  Q:    65 KSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDF--DTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKK---SIVKLNFS-SEVLEVSFSSSDLGNS 313
           K  D    + G ++I  K    II K+ +  + +  V++ ++ + +   +  + ++D + +P ++F +      +I   + KK I +V  A + +K++  +M     N I     L ++ATD +++A  +   +    DF I +    +E L +++++  D  + I + +  +I +  N +  + ++EG YP    I  +     V +++   ++ LER   + + E+    +I+ L      ++E+S +S ++G +
  S:    20 KDTDLVAKQNGSLVIIGKHLXDIIKKIDSCSLEMTLVEDYLLFINSKNSEYKLKVIDLQLFPPVSFDFQSDKFFAIKNEILKKIIKEVNVAASRDKQQKTLMG---VNFIYENSLLRVLATDTFRIAQKEISLDXNYFDFNITVSYKNLEELYKLLEYQKDELVHISINQQKMILRCDNLLFQTTLLEGKYPAWPIIKVSSFPFFVKMNRLDCLKTLERVSLVLTKEENIFSNIISLYIRLDNIIEISANSDEIGQA 273
>gi|145592569|ref|YP_001156866.1| DNA polymerase III, beta subunit [Salinispora tropica CNB-440] >gi|145301906|gb|ABP52488.1| DNA polymerase III, beta subunit [Salinispora tropica CNB-440] (377 aa)
Score = 130, Expect = 1.1e-05, Identities = 80/371 (21%), Positives = 154/371 (41%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISP----IVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDV-----SLIELLLEIIDFDTNIEIFLF-----ESNIIFKVSNTIIASKIIEG-DYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR-----DEKDPNFLQILVPIR 377
           MK  V +  L  A+        N  S PV  G L+ V D  ++ +  +  +S+   V    DA+    G  L+  +    I   L  + + +  V  + +++   +    +  M  E YP +        ++ +S          +            E + +M+G+      S  TL ++ATD Y+LA  + E  P+D  I L+      +L +    +      + + L      E  I F        S++++G +YP V  +    +  +  +    L+E ++R   ++  E+ + V L+FS + L V    ++   + E +       +P  I  N  +L+  L         + F D+FKP ++       E  P +  +++PIR
  S:     1 MKFRVERDALAEAVAWTAKSLPNRPSVPVLAGVLLRVTDGNLQVSGFDYEVSSQVTVEVQGDAD----GATLVSGRLLAEITKALPAKPVDIAAV-GAHLELVCGSARFTLPTMPVEDYPTLP-------EMPVSAGTIDAAAFAAAVAQVAVAAGRDETLPMMTGVRLEL--SGGTLAMLATDRYRLALREIEWNPEDPEISLNALVPARTLHDTAKALGPLGGQVTMALSQGAAGEGMIGFVGGPRRTTSRLLDGANYPPVRSLFPATQNAQAQVPVSALIEVVKRVALVA--ERTTPVLLSFSDDGLVVEAGGTEEARASEAMEATFS-GDPLTIGFNPQYLIDGLSNMGTQFAVLSFVDAFKPAVISPVGEDGEVVPGYRYLIMPIR 374
>gi|91203533|emb|CAJ71186.1| similar to DNA polymerase III beta subunit [Candidatus Kuenenia stuttgartiensis] (366 aa)
Score = 130, Expect = 1.1e-05, Identities = 77/348 (22%), Positives = 164/348 (47%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSN-GIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-STPQDFRI--VLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSD 354
           MKI+ S   L     L  S+  +     +  G  +EV DN  + T ++  ++  + I AK+ +    E G +L  ++          NE I++  +  +  ++ K  +F   I   D  Q+PNI  + +  + + I   +  K + KV YAV++ K  ++I SGI         T+ ++ +D  +LA  K +   P++  +  ++ V  +  L   + +    + + + ES I F      + S++IEG YPN   +I    + K+ +++  L+  +     +++ E + +V+ + +   L +  S++++G +   ++ +    + T  + N  ++L  L+  D + IT+E  +
  S:     1 MKILFSGDALHKGFSLTASVVPSSAMKQILQGVKLEVADNCAELTATDLEVLVKYRIPAKACEG---EGGIVLPASRANNIFREWAGNEEISVTVEAGHCTLQSKGGSF--KILGDDCLQFPNITKT-DVTSFVEIDGEILGKMVEKVAYAVSSIK-ALSIYSGISVKIFGD--TIIMVGSDMNRLAVVKRKVRNPENVSMSGIVGVKCLAFLQRFVSECKGTLMVGMGESQIHFIGEKGEVISQLIEGKYPNYDEVIPKNNDKKIEVNRDELLSIVRMASFVTNDEYR-VVEFSLTKNKLSIFSSAANVGEAALEIAAQYDGPDYTN-TFNPDYILDFLRASDCETITIELGE 343
>gi|109947376|ref|YP_664604.1| DNA polymerase III subunit beta [Helicobacter acinonychis str. Sheeba] >gi|109714597|emb|CAJ99605.1| DNA polymerase III, beta chain [Helicobacter acinonychis str. Sheeba] (374 aa)
Score = 130, Expect = 1.2e-05, Identities = 88/360 (24%), Positives = 164/360 (45%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHS-IVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFK--KSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFE-----STPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFESNIIFKV---SNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKD 366
           MKI VSK  L NALR   +  +   +S +     +EV   ++    S+  I   S I  +S D    ++G   I  K F  IIS LK+  ITLE K D+ VIK   S+F   + + D +++P         +    +P +    K I+ V    ++ +E    ++G+      + +TL ++ TD  +L++ + E     ST +    +L       LLEI+      E F F+S+ +  V         +K+I+G+YP+  +I+     +   ++K+   E+++   ++S + K ++ K N   E L+   S +    +   +    ++ +   + +N  F L  L         +  +    P L+++  D
  S:     1 MKISVSKNDLENALRYLQAFLDKKDASSIASHIHLEVIQEKLFLKASDSDIGLKSYISTQSTD----KEGVGTINGKKFLDIISCLKDSNITLETKEDSLVIKQNKSSF--KLPMFDADEFPEFPVIEPKVSLEVNAPFLVDAFKKIAPVIEQTSHKRE----LAGVLMQFDKTHQTLSVVGTDTKRLSYTQLENISVNSTEEYISCILPK---RALLEILKL--FYESFSFKSDGMLAVIENETHTFFTKLIDGNYPDYQKILPKEYASSFTLNKEGFKESIKLSSSLSPTIKLTLEKNNALFESLDSEHSET--AKTSIEIEKDLEIEKAFHLGVNAKFFLEALNALGTTQFVLHCNAPSAPFLIQEPLD 355
>gi|11320919|gb|AAG33955.1|AF197895_1 DNA polymerase III beta subunit [Buchnera aphidicola] (366 aa)
Score = 130, Expect = 1.4e-05, Identities = 69/346 (19%), Positives = 165/346 (47%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-----EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S P+    LI + +  +  T +N  I   +++  S +      G   I  +    I     N      +++N+ + + +      +  +  + +P ++  ++  ++  I   + KK I K+++++      I  ++GI      ++++L  +ATDGY+L   KF  +     F IV+    +  L  +++     I++ + ++NI   + + I  +++IEG YP+   ++   K N + ++ K L ++L R  AI S EK   V+++  +   +V      L +++E    + + N         IS+N ++++ +L +  ++NI +  +++   + +  E D + L +++ ++
  S:    26 SLPILDNVLINIKNGMLSLTGTNLEIELVAMIQLSTEH---ISGTATISGRKLLDICRNSLNSSNIEMQLNNNKMHIISGNSRYILTTLPYDSFP-VHHDFHHISEFFIPSDILKKMIEKIQFSMGKQDVPI-YLNGILLEK--TDRSLYAVATDGYRLGISKFFLKENIIPFSIVIPRKGVIELYRLLNIPKQPIKVLVGKNNIRVHIEDLIFTTQLIEGQYPDYKSVLLENKNNFITLNSKLLKQSLLRA-AILSHEKFCGVEIHIRNGQFKV------LSDNQEEEIAEDRFNINYTGNTVKISINVYYIIEILNSITSENIFLFLNNANNSIQIEAENDASILYVVMLLK 365
>gi|11320913|gb|AAG33952.1|AF197892_1 DNA polymerase III beta subunit [Buchnera aphidicola] (367 aa)
Score = 129, Expect = 1.4e-05, Identities = 55/201 (27%), Positives = 111/201 (55%)
  Q:   177 EKTLEIIATDGYKLAHYKF---ESTPQDFRIVLDVSLIELLLEIIDFDT-NIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTP---ISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           + +L ++ATDGY+LA  K    +   Q F IV+    I  L ++++    +I+I + ++NI   + N I  +++IEG +PN + +    K N + ++ K L  +L R  AI S EK   V+++ ++   +V   + +    +ET   K +++   P   IS+N +++L +L T  ++NI +  + S   + +  E D + + I++ ++
  S:   164 DNSLHMVATDGYRLALAKTLLNQIKKQSFAIVIARQGIIELYKLLNVSKQSIKILIGKNNIRIFIKNLIFTAQLIEGTFPNYTSVFLKKKNNGIILNCKLLKRSLLR-TAILSHEKFCGVEIHINNNEFKVLSDNQE----EETAEDKFQIDYNNPSIEISINVYYILDILNTISSENILLFVNHSNNSIQIEAENDASTIYIVMLLK 366
>gi|29653366|ref|NP_819058.1| DNA polymerase III, beta subunit [Coxiella burnetii RSA 493] >gi|153209960|ref|ZP_01947547.1| DNA polymerase III, beta subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|165924212|ref|ZP_02220044.1| DNA polymerase III, beta subunit [Coxiella burnetii RSA 334] >gi|29540628|gb|AAO89572.1| DNA polymerase III, beta subunit [Coxiella burnetii RSA 493] >gi|120575206|gb|EAX31830.1| DNA polymerase III, beta subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|165916346|gb|EDR34950.1| DNA polymerase III, beta subunit [Coxiella burnetii RSA 334] (369 aa)
Score = 129, Expect = 1.6e-05, Identities = 72/362 (19%), Positives = 162/362 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN 368
           MK+ + +  L+  L+L   + E   + P+    L+ +  +++  T ++  +    I     D N  E  R+ +  +    I   L +        D   I +++      ++ +  E +P +    +   +L++    F+  + +  +A+     +   ++G+   +  ++  L  IATDG++LA        +T    +I++    +IELL  + + +    I +  ++I    ++    SK+IEG +P+  R+I    + +  I +  L +AL R  AI  +EK   V+      +L +  ++ +   ++E ++      E   I  N  ++L +L   ++ NI + FS +   VL+ + ++P+
  S:     1 MKLNLIRETLLKPLQLVIGVVERKQTLPILSNVLLSIETDQLSITGTD--LEVELIGQTKLDKNSTESSRLTLPGRKLMDICRALPDNAPIELYRDKEKIILRSGRSRFMLSTLPSEDFPAVERRESQL-ELALPQSTFRHLLYRTHFAMAQQDVRY-YLNGLLLETYPNK--LRAIATDGHRLAANTLLVQTNTEHRLQIIIPRKGIIELLRLLEEDEALATIRIGNNHIGVSTNDFTFTSKLIEGRFPDCERVIPKGGDKQFVIDRDILKQALSR-TAILCNEKFKGVRFELRQGLLRILATNPEQEAAEEEINID-YTGENLDIGFNVGYVLDILNVVNSGNIRLTFSTADSSVLINEVENPS 358
>gi|161831398|ref|YP_001595902.1| DNA polymerase III, beta subunit [Coxiella burnetii RSA 331] >gi|161763265|gb|ABX78907.1| DNA polymerase III, beta subunit [Coxiella burnetii RSA 331] (369 aa)
Score = 129, Expect = 1.6e-05, Identities = 72/362 (19%), Positives = 162/362 (44%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF---ESTPQDFRIVLD-VSLIELLLEIIDFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPN 368
           MK+ + +  L+  L+L   + E   + P+    L+ +  +++  T ++  +    I     D N  E  R+ +  +    I   L +        D   I +++      ++ +  E +P +    +   +L++    F+  + +  +A+     +   ++G+   +  ++  L  IATDG++LA        +T    +I++    +IELL  + + +    I +  ++I    ++    SK+IEG +P+  R+I    + +  I +  L +AL R  AI  +EK   V+      +L +  ++ +   ++E ++      E   I  N  ++L +L   ++ NI + FS +   VL+ + ++P+
  S:     1 MKLNLIRETLLKPLQLVIGVVERKQTLPILSNVLLSIETDQLSITGTD--LEVELIGQTKLDKNSTESSRLTLPGRKLMDICRALPDNAPIELYRDKEKIILRSGRSRFMLSTLPSEDFPAVERRESQL-ELALPQSTFRHLLYRTHFAMAQQDVRY-YLNGLLLETYPNK--LRAIATDGHRLAANTLLVQTNTEHRLQIIIPRKGIIELLRLLEEDEALAAIRIGNNHIGVSTNDFTFTSKLIEGRFPDCERVIPKGGDKQFVIDRDILKQALSR-TAILCNEKFKGVRFELRQGLLRILATNPEQEAAEEEINID-YTGENLDIGFNVGYVLDILNVVNSGNIRLTFSTADSSVLINEVENPS 358
>gi|29830860|ref|NP_825494.1| DNA polymerase III subunit beta [Streptomyces avermitilis MA-4680] >gi|29607973|dbj|BAC72029.1| putative DNA polymerase III beta subunit [Streptomyces avermitilis MA-4680] (376 aa)
Score = 129, Expect = 1.8e-05, Identities = 81/345 (23%), Positives = 156/345 (45%)
  Q:    33 SPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSE-KTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIIDFDT--------NIEIFLFESN-----IIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRD------EKDPNFLQILVPIR 377
           +PV  G L+   D  +  ++ +  +S       S +A + E G +L+  +    I   L N  + +   D     V   +    ++ +  E+YP +    N     ++   VF  + ++V  A   + + + +++G+    I  E  T+ + +TD Y+ A  +F   P++     D S + L+      DT        ++ + L  S      I F+ +     ++++EGD P    +  T   +   I     VEA++R   ++  E+ + V+L+F   VL +   SSD   + E V  +   ++ + I+ N  FLL  L   D+    + F+ S KP LL        E D  +  +++P+R
  S:    27 APVLAGLLLRAEDGALSLSSFDYEVSARV----SVEAEVEEDGTVLVSGRLLADICRALPNRPVEIS-TDGVRATVVCGSSRFTLHTLPVEEYPALPQMPNATG--TVPGEVFASAAAQVAIAAGRD-DTLPVLTGV---RIEIEGDTVTLASTDRYRFAVREFLWKPEN----PDASAVALVPAKTLLDTAKALTSGDSVTLALSGSGSGEGLIGFEGAGRRTTTRLLEGDLPKYRTLFPTEFNSIAVIETAPFVEAVKRVALVA--ERNTPVRLSFEQGVLILEAGSSDDAQAVERVDAQLDGDDIS-IAFNPTFLLDGLSAIDSPVAQLSFTTSTKPALLSGKPAVDAEADEAYKYLIMPVR 373
>gi|19551252|ref|NP_599254.1| DNA polymerase III subunit beta [Corynebacterium glutamicum ATCC 13032] >gi|62388895|ref|YP_224297.1| DNA polymerase III subunit beta [Corynebacterium glutamicum ATCC 13032] >gi|145294045|ref|YP_001136866.1| DNA polymerase III subunit beta [Corynebacterium glutamicum R] >gi|21322767|dbj|BAB97396.1| DNA polymerase III beta subunit [Corynebacterium glutamicum ATCC 13032] >gi|41324228|emb|CAF18568.1| DNA POLYMERASE III, BETA SUBUNIT [Corynebacterium glutamicum ATCC 13032] >gi|140843965|dbj|BAF52964.1| hypothetical protein [Corynebacterium glutamicum R] (394 aa)
Score = 128, Expect = 2.3e-05, Identities = 74/346 (21%), Positives = 167/346 (48%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTPQDFRIVLDVSLIELLLEIID--------FDTNIEIFLFESNIIFK-------VSNTIIASKIIEGDYPNVSRIIATPKENKV--NISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDE---------------KDPNFLQILVPIR 377
           + PV    LI  +D  ++    +  +ST   ++    A + + GRI +  K    I   L N+ +   ++D S   V   +    + ++  + YP +          SI+  +F +++S+V  A   + + + +++G+    + ++  + + ATD ++LA   FE    D    L+V L+     ++D         + +I+I +   + + +         N    +++++ D+PN++ ++  PKE+    ++    LV+A+ R   ++  E+ + + L+FS   + ++  +++ G+++ET+ C     E T I+ N  +L   L           F++  +P ++  E                D  F  +L+P+R
  S:    31 TQPVLRAMLITADDEGLELAGYDYDVSTRVRLS----AEVSQPGRIAVAGKLLSEITGSLPNKPVDF-RIDGSKAFVTCGSSRFELPLIPLDDYPML--PKLPAGTGSINAKLFTEAVSQVASAAGKD-DSLPMLTGVSMEIVGNQ--INLAATDRFRLALRTFEWEANDPE--LNVKLLIPARTLLDNARSLDSGLNDSIDIAVGTGDQVGREGLFGVHTDNRETTTRLLDADFPNIAPLL--PKEHTAIASVEIAPLVDAIRRVSLVA--ERNAQIVLHFSEGQVILTAGATEAGHAEETLPCAFTGKELT-IAFNPGYLKDGLSVVPTSRAVFGFTEPSRPAIMIPEPEEMPSANENGIFQTPDTYFTYLLMPVR 391
>gi|6606560|gb|AAF19209.1|AF213934_1 DNA polymerase III beta subunit [Buchnera aphidicola] (366 aa)
Score = 127, Expect = 3.1e-05, Identities = 81/377 (21%), Positives = 183/377 (48%)
  Q:     1 LKKDLKMKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSN--INIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYK--FESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +K ++K KI     K IN L     IS+N  + P+    LI VN++ +  T +N       +++  + +N    G I +  +    I     +  ++  K+  +  K+   + DSN  +  +  + +PN N +++  ++  IS  V KK I K ++++     +   ++GI      ++K+L  +ATDGY+L   K   +     F +++    I  L ++++     I + + ++NI   +   I   ++IEG+YP+   I+   K++ + ++ K L ++L R +++ S +    ++++ ++   +V  S++      E         +   IS+N ++++ +L    + NI +  ++S   + +  E+D + L +++ +R
  S:     1 MKFNIKNKIFTQHLKKINRL-----ISKN-NTLPILENILITVNNDIVSLTATN---LETELISSIKTSNTHTPGSITVSGQKLLNIXQN--SSELSEIKISLNEDKMHIVSDDSNYILTTLPSDNFPNHN-NFHHISEFFISSDVLKKMIEKTQFSMGKQDVRY-YLNGILLEK--NKKSLYAVATDGYRLGISKTALKENVCIFSVIIPRRGIIELHKLLNIKPQLIHVLIGKNNIRIHIEKLIFTVQLIEGEYPDYKSILLRKKKHPIVLNNKILKQSLLR-VSVLSXKNFCGIEIHITNNKFKV-LSNNQYEEKAEDSFKINYCGDDIEISINVYYIIEVLNVITSKNIFIFVNESNNSIHIESEEDNSSLYVIMLLR 365
>gi|27262250|gb|AAN87406.1| DNA polymerase III, beta chain [Heliobacillus mobilis] (298 aa)
Score = 127, Expect = 3.1e-05, Identities = 56/289 (19%), Positives = 141/289 (48%)
  Q:     7 MKIIVSKTKLINALRLCNSISENIFSSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLE-KVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP----QDFRIVLDVSLIELLLEII-DFDTNIEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERG-LAISSSEKKSIVKLN 295
           M+   S+ +L+ A+   +    +  + P+  G  +E  D+ ++   ++  +     +        ++ G  ++  + F  +  +L    IT     +   +KV+    +  +N M+ +++P +  +  D + L ++   FK+    V +A + ++ +    +G+ ++ IS E+ +  +ATD ++LA    ++T     Q+ +++L    +  +  ++ D + +++I +  S  + +     +  +IIEG YP   ++I    + ++ +S K L ++++R  LA    E  +I+KL+
  S:     1 MEFSCSRGELLEAVNAVSRAVSSRATIPILSGIYMEALDDVLRLVATDMELGIEYTIP----VKTVQTGSTVVNARIFNEMARRLPEGPITFYISGETPALKVRYHGSELTLNTMNPQEFPLLP-AILDGDHLILTQGQFKEMTRLVCFAASTDESR-PWFTGVLWD-ISPEE-VRWVATDTHRLALLSGQATESVIQQNRQVILHAKTLSDVARLLSDDEASLQITITRSQALLETDRMRVILRIIEGQYPKYQQVIPRDYKTRMTVSVKALADSVDRASLAAIGKEGSNIIKLS 288
>gi|15826867|ref|NP_301130.1| DNA polymerase III subunit beta [Mycobacterium leprae TN] >gi|1169395|sp|P46387|DPO3B_MYCLE DNA polymerase III subunit beta >gi|886326|gb|AAB53142.1| DNA polymerase III beta subunit >gi|1262353|emb|CAA94709.1| DnaN [Mycobacterium leprae] >gi|13092414|emb|CAC29510.1| putative DNA polymerase III, [beta] subunit [Mycobacterium leprae] (399 aa)
Score = 126, Expect = 3.3e-05, Identities = 76/344 (22%), Positives = 161/344 (46%)
  Q:    34 PVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLA--HYKFESTPQDFRIVLDVSLIELLLEIIDFDTNIEIFLFE--------SNIIFKVSN--TIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLR----DEKDP-----------NFLQILVPIR 377
           PV  G L+  +D+ +  +  +  +S    VA    A I   G +L+  +    I   L N+ +    VD + + +   +   ++  M  E YP +    ++   L     VF ++I +V  A   +   + +++GI    IS + T+ + ATD ++LA    K+     DF   + V   + L+E+    T+                + +F +S       +++++ ++P   +++         I    L EA++  L    +++ + V++ F   +L +S  + D+G ++E ++      EP  I+ N ++L   L +  ++ ++  F+   KP LLR    D+  P           +++ +L+P+R
  S:    40 PVLSGVLLTGSDSGLTISGFDYEVSAEVQVA----AEIASSGSVLVSGRLLSDITRALPNKPVHF-YVDGNRVALTCGSARFSLPTMAVEDYPTLPTLPDETGTLPSD--VFAEAIGQVAIAAGRDY-TLPMLTGIRI-EISGD-TVVLAATDRFRLAVRELKWSVLSSDFEASVLVP-AKTLVEVAKAGTDGSGVCLSLGAGVGVGKDGLFGISGGGKRSTTRLLDAEFPKFRQLLPAEHTAVATIDVAELTEAIK--LVALVADRGAQVRMEFGDGILRLSAGADDVGRAEEDLAV-AFTGEPLTIAFNPNYLTDGLASVHSERVSFGFTTPSKPALLRPTSNDDVHPTHDGPFPALPTDYVYLLMPVR 396
>gi|15616641|ref|NP_239853.1| DNA polymerase III beta chain [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11132241|sp|P57127|DPO3B_BUCAI DNA polymerase III subunit beta >gi|25288588|pir||C84931 DNA-directed DNA polymerase (EC 2.7.7.7) beta chain [imported] - Buchnera sp. (strain APS) >gi|10038704|dbj|BAB12739.1| DNA polymerase III beta chain [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (366 aa)
Score = 126, Expect = 3.3e-05, Identities = 68/346 (19%), Positives = 165/346 (47%)
  Q:    32 SSPVFLGTLIEVNDNEIKFTTSNGIISTHSIVAKSEDANILEKGRILIKTKPFFAIISKLKNEMITLEKVDNSVIKVKTSTFDSNINIMDEEQYPNINFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKINIMSGICFNSISSEKTLEIIATDGYKLAHYKF--ESTPQDFRIVLDVSLIELLLEIIDFDTN-IEIFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSEVLEVSFSSSDLGNSKETVSCKGKVN-----EPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           S P+    LI + +  +  T +N  I   +++  S +      G   I  +    I     N      +++N+ + + +      +  +  + +P ++  ++  ++  I   + KK I K+++++     +   ++GI      ++++L  +ATDGY+L   KF  +     F IV+    +  L  +++     I++ + ++NI   + + I  +++IEG YP+   ++   K N + ++ K L ++L R  AI S EK   V+++  +   +V      L +++E    + + N         IS+N ++++ +L +  ++NI +  +++   + +  E D + L +++ ++
  S:    26 SLPILDNVLINIKNGMLSLTGTNLEIELVAMIQLSTEH---ISGTATISGRKLLDICRNSLNSSNIEMQLNNNKMHIISGNSRYILTTLPYDSFP-VHHDFHHISEFFIPSDILKKMIEKIQFSMAKQDVRY-YLNGILLEK--TDRSLYAVATDGYRLGISKFFLKENIIPFSIVIPRKGVIELYRLLNIPKQPIKVLVGKNNIRVHIEDLIFTTQLIEGQYPDYKSVLLENKNNFITLNSKLLKQSLLRA-AILSHEKFCGVEIHIRNGQFKV------LSDNQEEEIAEDRFNINYTGNTVKISINVYYIIEILNSITSENIFLFLNNANNSIQIEAENDASILYVVMLLK 365
>gi|89097418|ref|ZP_01170307.1| DNA polymerase III subunit beta [Bacillus sp. NRRL B-14911] >gi|89087714|gb|EAR66826.1| DNA polymerase III subunit beta [Bacillus sp. NRRL B-14911] (392 aa)
Score = 125, Expect = 4.3e-05, Identities = 71/338 (21%), Positives = 153/338 (45%)
  Q:    40 LIEVNDNEIKFTTSNG---IISTHSIV-AKSEDANILEKGRILIKTKPFFAIISKLKNEM-ITLEKVDNSVIKVKTSTFDSNINIMDEEQYPN---INFSYNDWNQLSISPIVFKKSISKVKYAVNNNKEKIN--IMSGICFNSISSEKTLEIIATDGYKLAHYKFESTP---QDFRIVLDVSLIELLLEIIDFDTNIE--IFLFESNIIFKVSNTIIASKIIEGDYPNVSRIIATPKENKVNISKKTLVEALERGLAISSSEKKSIVKLNFSSE-VLEVSFSSSDLG---NSKETVSCKGKVNEPTPISLNNHFLLSLLKTFDNDNITVEFSDSFKPVLLRDEKDPNFLQILVPIR 377
           +IE +   +  ++ NG   +I  H ++  +    +ILE G++    +    +I K+   + I        +I        + I     +Q+P+   + F Y       I P+      + ++    +  +  +  I+ GI  N    E  L   ATD  +LA +K + +    Q F   L       LL++I    + E  I++ +S  +F  S     S ++ G +P+  ++     + ++ I++K L++ ++R +  +  ++ S+V +    E  + +S   S++G     +E  S +G+      I  N  +L   L   +++ I +    + KP+L+    + N+  ++ P+R
  S:    33 MIEAHSGGLSVSSGNGDRSVIFEHPLINCRDSGLDILEYGKLAADGRMLSEVIRKIPGRLSIKASTSHKILINSMDKQISAAIAGFPLDQFPDRAHVEFPY-------IYPLEASDLAAGLRNTAASAAKTSSRPILEGI--NLAFDENGLTFTATDSSRLAMWKADGSAGFSQSF--TLPARNAAELLKLIGKSPSGEAAIYISDSQAVFATSTFRFCSSLLTGRFPSSEKLKPEGCKTELVINRKHLLQGVKRTMIFAGEKRSSLVSIQAKDENSITISSPMSEMGMIEEVQELQSIRGETEASAVI--NGSYLADALIGTESEYIKIRLYGTMKPILISSPGEANYFHLISPVR 376