>gi|26553472|ref|NP_757406.1| phosphoglycerate mutase [Mycoplasma penetrans HF-2] >gi|26453478|dbj|BAC43810.1| phosphoglycerate mutase [Mycoplasma penetrans HF-2] (1011 aa)
Score = 4734, Expect = 0.0e+00, Identities = 1011/1011 (100%), Positives = 1011/1011 (100%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDPNFTKSKIEESLNDMFLIWKETISDDLIKSFEDNKLNFYSEFSKDEQFLSEKQKYVVLKEIIEVNKKVLLTPEARKKLYNVLIDYVEYNKIDFVGLDINYKKTFQTLFDKEIKMLKLSKLSNKYFDKKIWITNFVRNDEWINSIKFDLLESSKRTFDVDKNEKFSTRVYNEMIPFLFFEKIRKSEVEILKTNDAVSIAQFYELIKEEVRDIFEQYILDKLPVESEDATDEVVEEEKSPEQIATEKAVHSISVYFDYFVEVVDLIRYERDYLESFNRRYKETQEHLAKQNKIYDSTDIFNVPEIALNPLTAKIVSLIRLYKSELKSHAKTEKTENKKTIYKFDMAYSTKIDIAKQSIAYDGEFNEEVNLKKQDEFEKKFAEYVEVYKEFDNTVIEWESDEEKDDEYSMDDETIEYDENGNPIMVDKIDTKIKTRPEYDLTEVWVQKRIDEYNNVDNYKPNIAVDAIKQLDKNKQTSVAKARLRDYSKLSEVWKKTAQSETENNG 1011
           MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDPNFTKSKIEESLNDMFLIWKETISDDLIKSFEDNKLNFYSEFSKDEQFLSEKQKYVVLKEIIEVNKKVLLTPEARKKLYNVLIDYVEYNKIDFVGLDINYKKTFQTLFDKEIKMLKLSKLSNKYFDKKIWITNFVRNDEWINSIKFDLLESSKRTFDVDKNEKFSTRVYNEMIPFLFFEKIRKSEVEILKTNDAVSIAQFYELIKEEVRDIFEQYILDKLPVESEDATDEVVEEEKSPEQIATEKAVHSISVYFDYFVEVVDLIRYERDYLESFNRRYKETQEHLAKQNKIYDSTDIFNVPEIALNPLTAKIVSLIRLYKSELKSHAKTEKTENKKTIYKFDMAYSTKIDIAKQSIAYDGEFNEEVNLKKQDEFEKKFAEYVEVYKEFDNTVIEWESDEEKDDEYSMDDETIEYDENGNPIMVDKIDTKIKTRPEYDLTEVWVQKRIDEYNNVDNYKPNIAVDAIKQLDKNKQTSVAKARLRDYSKLSEVWKKTAQSETENNG
  S:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDPNFTKSKIEESLNDMFLIWKETISDDLIKSFEDNKLNFYSEFSKDEQFLSEKQKYVVLKEIIEVNKKVLLTPEARKKLYNVLIDYVEYNKIDFVGLDINYKKTFQTLFDKEIKMLKLSKLSNKYFDKKIWITNFVRNDEWINSIKFDLLESSKRTFDVDKNEKFSTRVYNEMIPFLFFEKIRKSEVEILKTNDAVSIAQFYELIKEEVRDIFEQYILDKLPVESEDATDEVVEEEKSPEQIATEKAVHSISVYFDYFVEVVDLIRYERDYLESFNRRYKETQEHLAKQNKIYDSTDIFNVPEIALNPLTAKIVSLIRLYKSELKSHAKTEKTENKKTIYKFDMAYSTKIDIAKQSIAYDGEFNEEVNLKKQDEFEKKFAEYVEVYKEFDNTVIEWESDEEKDDEYSMDDETIEYDENGNPIMVDKIDTKIKTRPEYDLTEVWVQKRIDEYNNVDNYKPNIAVDAIKQLDKNKQTSVAKARLRDYSKLSEVWKKTAQSETENNG 1011
>gi|13508367|ref|NP_110317.1| phosphoglyceromutase [Mycoplasma pneumoniae M129] >gi|2499545|sp|P75167|GPMI_MYCPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|1673879|gb|AAB95862.1| phosphoglycerate mutase [Mycoplasma pneumoniae M129] (508 aa)
Score = 284, Expect = 6.3e-23, Identities = 120/492 (24%), Positives = 221/492 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG-YFVSKD-DSVLFLNSDPDDFASLARMM------KTSPKLK---GLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           M   ++  + +G G++ K  GN +  A  P ++ LI   YP  +L    +       +   S    ++     ++Y      T L L+++ IK+ + H+ ++  + I R+   N+K+ H+  + S      +  +L+ +I  L    +K VLHL  DG+D  P +   +L  F  FL    N  I T+ GR +   +  R   D E +   +  I G  + +FT+   Y       KV D  + PA N  +D   F  KD DSV+F N  PD    ++ M+        +PK      LF  ++    G K  AV F         +    ++A N  K L +    K   +  FF  G   +  N T+ ++ S    +      ++ K + D+ ++ I ++D+  +          + +    +  +E  D  + R+I+ C+     + LT+ +G AE+M+D + N V  +  + VPFV T+ ++  ++  ++   +  +IL+ L
  S:     1 MHKKVLLAILDGYGISNKQHGNAVYHAKTPALDSLIKD-YPCVMLEASGEAVGLPQGQIGNSEVGHLNIGAGRIVY------TGLSLINQNIKTGAFHHNQVLLEAIARAKANNAKL-HLIGLFSHGGVHSHMDHLYALIK-LAAPQVKMVLHLFGDGRDVAPCTMKSDLEAFMVFLKDYHNVIIGTLGGRYYGMDRDQR--WDREEIA--YNAILGNSKASFTDPVAYVQSAYDQKVTDEFLYPAVNGNVDKEQFALKDHDSVIFFNFRPDRARQMSHMLFQTDYYDYTPKAGRKYNLFFVTMMNYEGIKPSAVVFPPETI---PNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGGVEVDLPNETKCMVPSLKVATYDLAPEMACKGITDQLLNQINQFDLTVLNFANPDMVGHTGNYAACVQGLEALDVQIQRIIDFCKANHITLFLTADHGNAEEMIDSNNNPVTKHTVNKVPFVCTDTNIDLQQDSASLANIAPTILAYL 490
>gi|66880475|ref|ZP_00405456.1| COG0696: Phosphoglyceromutase [Mycoplasma genitalium G-37] >gi|108885113|ref|NP_073101.2| phosphoglyceromutase [Mycoplasma genitalium G37] >gi|84626143|gb|AAC72451.2| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Mycoplasma genitalium G37] >gi|166078773|gb|ABY79391.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [synthetic Mycoplasma genitalium JCVI-1.0] (507 aa)
Score = 271, Expect = 2.0e-21, Identities = 123/492 (25%), Positives = 221/492 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKR-NTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSKDDSVLFLNSDPDDFASLARMMKTS------PKLK---GLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           M   ++  + +G G++    GN ++ AN P ++ LI+  YP  LL    +       +   S    ++     ++Y      T L L+++ IK +S    + F K I+   K +SKI H+  + S      + ++L  +I  L  K  K VLHL  DG+D  P S  ++L     FL    N  I T+ GR +   +  R   D E  M  ++ + G+ +  F +   Y      N++ D  I PA N  +  D + ++ +D V+F N  PD    ++ ++  S      P+LK    LF  ++    G       F  P +  + SL   ++A N+ K L +    K   +  FF  G   N  N T+ ++ S    +      +S K + D  ++ +  +D   +          + + +  +  +E  D  + R+++ C+     + LT+ +G AE M+D + N V  +  + VPFV T+     K +  N  G+ ++I  T+
  S:     1 MHKKVLLAILDGYGISNAIYGNAVQNANTPMLDELINS-YPCVLLDASGEAVGLPMGQIGNSEVGHLNIGAGRVVY------TGLSLINQHIKDRSFFANKAFLKTIEHVEKNHSKI-HLIGLFSNGGVHSHNEHLLALIE-LFSKHAKVVLHLFGDGRDVAPCSLKQDLEKLMIFLKNYPNVVIGTIGGRYYGMDRDQR--WDRE--MIAYKALLGVSKNKFNDPIGYIETQYQNQITDEFIYPAINANLNSDQFALNNNDGVIFFNFRPDRARQMSHLIFNSNYYNYQPELKRKENLFFVTMMNYEGIVPSEFAF--PPQTIKNSL-GEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSNETKTLIPSLKVATYDLAPEMSCKAITDALLEKLNNFDFTVLNFANPDMVGHTGNYQACIKALEALDVQIKRIVDFCKANQITMFLTADHGNAEVMIDNNNNPVTKHTINPVPFVCTD-----KNVNFNQTGILANIAPTI 485
>gi|38372372|sp|Q8EW33|GPMI_MYCPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (502 aa)
Score = 267, Expect = 5.8e-21, Identities = 98/392 (25%), Positives = 181/392 (46%)
  Q:    81 IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           + T L L+++ IK+K   + +   + I+ + K NS I HI  +LS      N +++F +I ++ + GLKPV+H+  DG+D  P S   +L   +  L K    I T++GR +   +  R     E     ++ + G+    F    +Y N+  +  + D  ++PA   I D   V KD D+V+  N  PD    ++ +         K    LK L+ + +    G    ++ F   V    ++    +VA +    L +    K   +  FF  G   + +N ++ ++ S    +  E  ++S+  + DK I+++ K+DVI +          +    + +  IE  D  L R+    +     + +T+ +G AE MLD   N V  + ++ V F+  N D+
  S:    75 VYTGLSLINQDIKTKKFDSNKTLLEAINHAKKNNSNI-HIMGLLSPGGVHSNEQHIFEMIRIVSENGLKPVIHVFGDGRDVAPQSIISSLERLNDVLKKYPGTIATISGRFYSMDRDKR----WERTKQAYDNLLGISNNYFDNPIDYVNKQYSENIFDEFLVPA--RINDSNVVIKDNDAVIHANFRPDRARQISHLFCGSTVYEEKNDHPLKNLYYAIMMTYEGITPTSILFPTVVV---KNTFGEVVANSGLTQLRIAETEKYAHVTFFFDGGVEVDLKNESKILVDSKKVKTYDEVPAMSAVEITDKLIENLDKFDVIVLNFANADMVGHTGKYNEAVLAIEALDSQLARIDQKIKELNGTMFITADHGNAEVMLDDDNNPVTKHTTNPVIFISNNKDV 467
>gi|26553825|ref|NP_757759.1| phosphoglyceromutase [Mycoplasma penetrans HF-2] >gi|26453832|dbj|BAC44163.1| phosphoglycerate mutase [Mycoplasma penetrans HF-2] (506 aa)
Score = 266, Expect = 6.8e-21, Identities = 98/392 (25%), Positives = 181/392 (46%)
  Q:    81 IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           + T L L+++ IK+K   + +   + I+ + K NS I HI  +LS      N +++F +I ++ + GLKPV+H+  DG+D  P S   +L   +  L K    I T++GR +   +  R     E     ++ + G+    F    +Y N+  +  + D  ++PA   I D   V KD D+V+  N  PD    ++ +         K    LK L+ + +    G    ++ F   V    ++    +VA +    L +    K   +  FF  G   + +N ++ ++ S    +  E  ++S+  + DK I+++ K+DVI +          +    + +  IE  D  L R+    +     + +T+ +G AE MLD   N V  + ++ V F+  N D+
  S:    79 VYTGLSLINQDIKTKKFDSNKTLLEAINHAKKNNSNI-HIMGLLSPGGVHSNEQHIFEMIRIVSENGLKPVIHVFGDGRDVAPQSIISSLERLNDVLKKYPGTIATISGRFYSMDRDKR----WERTKQAYDNLLGISNNYFDNPIDYVNKQYSENIFDEFLVPA--RINDSNVVIKDNDAVIHANFRPDRARQISHLFCGSTVYEEKNDHPLKNLYYAIMMTYEGITPTSILFPTVVV---KNTFGEVVANSGLTQLRIAETEKYAHVTFFFDGGVEVDLKNESKILVDSKKVKTYDEVPAMSAVEITDKLIENLDKFDVIVLNFANADMVGHTGKYNEAVLAIEALDSQLARIDQKIKELNGTMFITADHGNAEVMLDDDNNPVTKHTTNPVIFISNNKDV 471
>gi|1709673|sp|P47669|GPMI_MYCGE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (507 aa)
Score = 262, Expect = 2.0e-20, Identities = 122/492 (24%), Positives = 220/492 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKR-NTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSKDDSVLFLNSDPDDFASLARMMKTS------PKLK---GLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           M   ++  + +G G++    GN ++ AN P ++ LI+  YP  LL    +       +   S    ++     ++Y      T L L+++ IK +S    + F K I+   K +SKI H+  + S      + ++L  +I  L  K  K VLHL  DG+D  P S  ++L     FL    N  I T+ GR +   +  R   D E  M  ++ + G+ +  F +   Y      N++ D  I PA N  +  D + ++ +D V+  N  PD    ++ ++  S      P+LK    LF  ++    G       F  P +  + SL   ++A N+ K L +    K   +  FF  G   N  N T+ ++ S    +      +S K + D  ++ +  +D   +          + + +  +  +E  D  + R+++ C+     + LT+ +G AE M+D + N V  +  + VPFV T+     K +  N  G+ ++I  T+
  S:     1 MHKKVLLAILDGYGISNAIYGNAVQNANTPMLDELINS-YPCVLLDASGEAVGLPMGQIGNSEVGHLNIGAGRVVY------TGLSLINQHIKDRSFFANKAFLKTIEHVEKNHSKI-HLIGLFSNGGVHSHNEHLLALIE-LFSKHAKVVLHLFGDGRDVAPCSLKQDLEKLMIFLKNYPNVVIGTIGGRYYGMDRDQR--WDRE--MIAYKALLGVSKNKFNDPIGYIETQYQNQITDEFIYPAINANLNSDQFALNNNDGVISFNFRPDRARQMSHLIFNSNYYNYQPELKRKENLFFVTMMNYEGIVPSEFAF--PPQTIKNSL-GEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSNETKTLIPSLKVATYDLAPEMSCKAITDALLEKLNNFDFTVLNFANPDMVGHTGNYQACIKALEALDVQIKRIVDFCKANQITMFLTADHGNAEVMIDNNNNPVTKHTINPVPFVCTD-----KNVNFNQTGILANIAPTI 485
>gi|47459166|ref|YP_016028.1| phosphoglyceromutase [Mycoplasma mobile 163K] >gi|50400311|sp|Q6KHV9|GPMI_MYCMO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|47458495|gb|AAT27817.1| phosphoglycerate mutase [Mycoplasma mobile 163K] (510 aa)
Score = 259, Expect = 5.1e-20, Identities = 118/472 (25%), Positives = 216/472 (45%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHN----LEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNT--IMDGYFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           MK T+I  V +G+GL ++ +GN  KLA  PN + L +  YP +++            +   S    ++    +++Y      T L L+++ IK          +  FN  + ++N+TN+  +H+  +LS      + ++LF +I    + GLK V +H+  DG+D  P S   ++        K N  I ++ GR +   +  + F  NE  +   E + G     FT ASEY        + D   +PA N   +     +  +D+V+F N  PD    L+ ++        ++  ++K    +S+    G   +  + E  +       L N++AKN    L +    K   +  FF  G +   EN  R ++ S    S  +Y  +S+  + D  I ++GKYDVI +          + +LK  +  +E  D   G+++     T + + +T+ +G AE   D++ N    + +S V  + T+ +L
  S:     1 MKKTVILSVIDGLGLREEKQGNAFKLAKTPNFDKLFNE-YPNSVIQASGDYVGLPDDQMGNSEVGHLNIGAGQIVY------TGLSLINKDIKDNKFKQNAKFIAAFNA-VKKNNETNT--LHLMGLLSDGGVHSHEEHLFKLIEAAHENGLKNVSVHVFGDGRDVAPRSILTSIKKLEAITKKYNYAIGSIMGRFYAMDRD-QIFTRNEQAL---EVMMGKTTNYFTNASEYIKAQYQKDISDEFFIPAINKDYLAKKLNLKDNDAVIFYNFRPDRARQLSHLLIQSNLYNYQSKNQVKLSNFTSMMKYEGLDTNIAYEEMKITNP----LGNILAKNGLSQLRIAETQKYAHVTFFFDGGNDVLYENEERILIDSVKADSFADYPEMSAAGITDTLIANLGKYDVIILNYANPDMVGHTGNLKATIKALEFLDFQYGKILKAIEKTNHTLFITADHGNAEITEDENGNPATKHTTSPVMLIVTDKNL 471
>gi|15828930|ref|NP_326290.1| phosphoglyceromutase [Mycoplasma pulmonis UAB CTIP] >gi|27734325|sp|Q98QA7|GPMI_MYCPU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|14089873|emb|CAC13632.1| 2,3-BISPHOSPHOGLYCERATE-INDEPENDENT PHOSPHOGLYCERATE MUTASE (PHOSPHOGLYCEROMUTASE) (BPG-INDEPENDENT PGAM) [Mycoplasma pulmonis] (505 aa)
Score = 241, Expect = 5.3e-18, Identities = 115/489 (23%), Positives = 207/489 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLD 493
           +I +V +G+GL K+  GN  +LA  P  + +    +PW+ +    K       +   S    ++    +++Y      T L L+++ ++ K+  N + F ++I+   K NS + H+  ++S         +LF +I+V  +KGLK V +H+  DG+D  P S   +     K   K N  I +++GR   F    RD +  E     +E + G     F   SE+ N+  + ++ D   +P+ N   +  FV   DS++F N  PD    L  ++        K    +K     S+    G +    F E  +K      +  +  K   K L L    K   +  F   G +   +N  R ++ S    S  ++  +S+K + D+ I +   +D+  +          +  L   +  +E  D  L RL++  +     + +T+ +G AE   D   N  P  K +  P +    D   K        +  +IL  LD
  S:     9 VILVVIDGLGLRKEKIGNAFELAKTPFFDKMFKE-FPWSFIQASGKFVGLPEGQMGNSEVGHLNIGAGQIVY------TGLSLINKDLEEKNFINNKAFLEVIEDVKKNNSTL-HLMGLVSPGGVHSLEDHLFEIIDVAYQKGLKKVSVHVFGDGRDVAPRSIKSSFEKLEKITNKYNYDIASISGR---FYSMDRDKI-FERTEKAYEALLGNSNSKFDNWSEFLNKQYSQEISDEFFIPSINASKNVNFVKDGDSIIFFNFRPDRARQLTHLLIGSSLYDFKPKKPVKINKFCSMMKYEGIETLIAFEEMEIKNP----IGKVAEKAGLKQLRLAETQKYAHVTYFMDGGVDIEYKNSKRIMVESQKVRSYADHPEMSAKGITDELIKNAKDFDLTILNYANPDMVGHTGVLTSTIKAVEILDYELSRLVDFAQKNNITVFITADHGNAEVTEDDKGN--PQTKHTSNPVMLITSDKNLKLKDGKLANISPTILDYLD 490
>gi|167754682|ref|ZP_02426809.1| hypothetical protein CLORAM_00185 [Clostridium ramosum DSM 1402] >gi|167705514|gb|EDS20093.1| hypothetical protein CLORAM_00185 [Clostridium ramosum DSM 1402] (505 aa)
Score = 234, Expect = 3.5e-17, Identities = 120/477 (25%), Positives = 223/477 (46%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKT--------SPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN-----------GDLWPKKMQ 478
           K  ++  + +G GL+++  GN +KLAN PNI+ L   IYP       R +   +P         + +     +  G T +   L L+++ ++  + +    F K I+ + + N+K+ HI+ +LS      + ++++ ++ +  ++GL+ V +H   DG+D  P S   F K L++  K        I TV+GR +   +  R     + V   F+ I     ++F    +Y  ++ A +  D  ++P YN  +DG  V+  DSV+F N  PD    LA +M          +   K L    +     +   A+ F  P      + L + ++    K L +    K   +  FF  G +   E  TR +++SP   +      +S+  + DK I+ + K  +DV+   F  C M+     +  +   +  +   D+ +G + N     G  + +T+ +G +E +LD+  N    + ++ VP + TN           GDL P  +Q
  S:     3 KRPIVLCILDGYGLSERIDGNAVKLANTPNIDDL-EMIYP-----TTRIKASGMPVGLPDGQMGNSEVGHLNIGAGRT-VYQSLTLINKAVEDGTFYKNAEFLKAINNAKENNTKL-HIWGLLSNGGVHSSNEHIYALLKLAKQEGLEKVYVHAFLDGRDVAPDSGADFVKELAD--KIEEIGVGEIATVSGRYYAMDRDKR----FDRVELAFDAIVNHKGESFECPVQYVKDSYAKETYDEFVIPGYNKNVDGQ-VADGDSVIFANFRPDRAIQLATVMTNDGFYDHAFNNVPKNLTFVCMMKYADSVNGAIAFALP---SLTNTLGDYLSAKGMKQLRIAETEKYAHVTFFFDGGVDKEIEGATRVLVNSPKVATYDLQPEMSAYEVKDKLIEELDKDIHDVVIVNFANCDMVGH---TGIIPAAIKAVSVVDECVGEVYNKVLELGGTMLITADHGNSEMLLDEDNNPFTAHTTNEVPLIVTNSHLELKEGGKLGDLAPTILQ 488
>gi|169349896|ref|ZP_02866834.1| hypothetical protein CLOSPI_00635 [Clostridium spiroforme DSM 1552] >gi|169293464|gb|EDS75597.1| hypothetical protein CLOSPI_00635 [Clostridium spiroforme DSM 1552] (505 aa)
Score = 227, Expect = 2.3e-16, Identities = 117/477 (24%), Positives = 226/477 (47%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN-----------GDLWPKKMQ 478
           K  ++  + +G GL+++  GN +KLAN PNI+ L+  IYP       R +   +P         + +     +  G T +   L L+++ ++  S +  E F K I+   + NSK+ HI+ +LS      + ++++ ++ +  ++GL+ V +H   DG+D  P S   F K L++  K        I T++GR +   +  R     + +   F+ I     ++F    +Y  ++ A +  D  ++P YN  +DG  V  +DS++F N  PD    L+ ++         F  +  P   T +  + + + V G       +  + L + ++    K L +    K   +  FF  G +   E  TR +++SP   +      +S+  + DK I+ + K  +DV+   F  C M+     +  +   +  +   D+ +G + +     G  + +T+ +G +E +LD+  N    + ++ VP + TN           GDL P  +Q
  S:     3 KRPIVLCILDGYGLSERVDGNAVKLANTPNIDDLMM-IYP-----TTRIKASGMPVGLPDGQMGNSEVGHLNIGAGRT-VYQSLTLINKAVEDGSFYKNEEFLKAINNVKENNSKL-HIWGLLSNGGVHSSNEHIYALLKLAKQEGLEKVYVHAFLDGRDVAPDSGVDFVKELAD--KIEEIGVGEIATISGRYYAMDRDKR----FDRIELAFDAIVNHKGESFECPVQYVKDSYAKETYDEFVIPGYNKNVDGQ-VCDNDSIIFANFRPDRAIQLSTVITNDGFYDHTF--NNVPNNLTFVCMMKYADSVNGSIAFALPELTNTLGDYLSAKGLKQLRIAETEKYAHVTFFFDGGIDKEIEGATRVLVNSPKVATYDLQPEMSAYEVKDKLIEELDKDIHDVVIVNFANCDMVGH---TGVIPAAIKAVSVVDECVGAVYDKVLELGGTMLITADHGNSEMLLDEDNNPFTAHTTNEVPLILTNSHLELREGGKLGDLAPTILQ 488
>gi|31544784|ref|NP_853362.1| phosphoglyceromutase [Mycoplasma gallisepticum R] >gi|50400397|sp|Q7NAQ5|GPMI_MYCGA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|31541630|gb|AAP56930.1| GpmI [Mycoplasma gallisepticum R] (503 aa)
Score = 225, Expect = 4.4e-16, Identities = 109/493 (22%), Positives = 218/493 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNT--IMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS------PKL--KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRKILSSPACTSDKEYF---SLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLD 493
           MK  L+ ++ +G G++    GN +K A  P+++ L++   P  +L    +       +   S    ++     ++Y      T L L++++I++K     +     ID + K NSK+ HI  ++S      +  +++ ++ +  +  +  +LH+  DG+D  P     +L    K      T I T++GR +   +  R D +D    + Y   +   G ++F +   Y  ++    + D  I+PAYN     D   +  +DSV+F N  PD    L+  +  S      P+L  K L+   +    G    A+ +   +   E++ L  ++   + K L +    K   +  FF      E      +  P+    K Y     +S+  ++D+ +    KYD+  +          + + +  L  +E  D  +GRL+   +     +  T+ +G AE+M+D++   V  + +++VPF  T+ ++   K +     V  +IL  L+
  S:     1 MKKALL-MILDGYGISSTTHGNAVKNAKTPHLDNLMNN-NPTIMLQASGEAVGLPKNQIGNSEVGHLNIGAGRIIY------TGLSLINKEIENKKFFTNQALLNAIDHAKKNNSKL-HILGLVSNGGVHSHINHIYAIMELANQHNVPAILHIFGDGRDVPPTQLLADLDQLIKKAETTKTKIGTISGRFYAMDRDQRWDRID----LAYNNLLSNTG-KSFADLKTYVKDSYQQNITDEFIVPAYNNNYKSDEITIQDNDSVVFANFRPDRARQLSHYVFGSNYYDHHPQLRRKNLYFVIMMQYEGINPSAICYPPKI---EKNTLGEVLKNANKKQLRIAETEKYAHVTFFFDGGVEVEYQNEDKVLVPSRKDVKTYDLAPEMSAAAIVDQLLKVYTKYDLTVLNFANPDMVGHTGNYEATLKGLEALDHEIGRLLADAKKNNITVFFTADHGNAEEMIDENNQKVTKHTTNVVPFSITDPNVKFTKKEGILANVAPTILKYLE 490
>gi|50400338|sp|Q6Y8Q8|GPMI_MYCHO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|37727327|gb|AAO39423.1| 2,3 biphosphoglycerate-independent phosphoglycerate mutase [Mycoplasma hominis] (499 aa)
Score = 223, Expect = 7.7e-16, Identities = 114/467 (24%), Positives = 199/467 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIA--LTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +I  + +G+GL K+ +GN    A  P  +YL S + P ++L    +       +   S    ++     ++Y      T L L+++ I++ +  + EI N +ID++ K N+ + H+  +LS         +LF ++ +   KGLK V +H+  DG+D +P S   +L        K    I +++GR   F    RD + + +  + ++ I G  +       +Y        + D    PA   + DG FV   DS++F N  PD    L+ M         K   +++     SL    G      F E  V       L  ++  ND K L L    K   +  FF  G +   +N  R ++ S    S  +Y  +S+K + D  +++I K D I +          + +L   +  IE  D    R++         +   +T+ +G AE   D+  N  P  K +  P +F   D
  S:     4 IILTIIDGLGLRKERQGNAYLQAKHPCFDYLFS-MCPNSVLQASGQYVGLPEGQIGNSEVGHLNIGAGRVVY------TGLSLINKAIENNTFKDNEILNDVIDKTIKNNTTL-HVMGLLSNGGVHSLDLHLFEILKLAHSKGLKNVSVHVFGDGRDVKPQSIKNSLETLKDLCQKFGYKISSISGR---FYAMDRDSIFSRN-QEAYDAILGQSKNVIENIDDYIESQYKKGIFDEFFEPA--QLKDGVFVKNGDSIIFFNFRPDRARQLSHMFIGSNLYTYKPKNQVQIDNFVSLMKYEGINSKIAFKEMEVVNP----LGKVLESNDIKQLRLAETQKYAHVTFFFDGGVDIEYKNENRILVDSLKVDSFADYPHMSAKEITDSLLNNIEKNDFIIMNYANPDMVGHTGNLNATIEAIEFLDSQFQRILEYVSLNHENVTWFITADHGNAEITEDE--NNKPATKHTTSPVMFICTD 463
>gi|193216852|ref|YP_002000094.1| phosphoglyceromutase [Mycoplasma arthritidis 158L3-1] >gi|193002175|gb|ACF07390.1| phosphoglyceromutase [Mycoplasma arthritidis 158L3-1] (502 aa)
Score = 209, Expect = 3.2e-14, Identities = 116/492 (23%), Positives = 205/492 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIA--LTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           M   +I  V +G+GL  + +GN    A+ P  + L S   P ++L    +       +   S    ++     ++Y      T L L++  I +K+  + E+  K I +  K  +K +H+  +LS        ++LF ++++  + GLK V +H+  DG+D +P S   +L    +        I ++AGR   F    RD +   +   Y + I G          +Y  E   NK+ D   +PA   + DG FV ++DS++F N  PD    L+ M         +   K+K     SL    G   +  F E  V       L  +++KN+ + + +    K   +  F   G +       R ++ S    S  ++  +S+K + D  ++ I   D + +          + DLK  +  IE  D+   R+          +   +T+ +G AE   D++ N  P  K +  P +F   D   K        V  +IL  L
  S:     1 MNKKVILTVIDGLGLRDEVQGNAYLQASHPTFDLLFSSC-PNSVLEASGEFVGLPKGQIGNSEVGHLNIGAGRIVY------TGLSLINNAIDTKTSKDNEVLLKAI-KDTKEKNKTLHLMGLLSPGGVHSLDRHLFEILDMAYENGLKKVSVHIFGDGRDVKPQSIYDSLETLKQKTKTYGYKISSIAGR---FYAMDRDKMFERNQKSY-DAIIGKSSNVIESLDKYIEEQYQNKIYDEFFVPA--QLKDGLFVKENDSIIFFNFRPDRARQLSHMFIGSSLYDYQVESKVKIDHFVSLMKYEGINSEVAFEEMKVNMP----LGEVISKNNLRQIRIAETQKYAHVTFFMDGGIDILYPLEERVLVDSLKVDSFAKHPQMSAKEITDALLEKIDDVDFVIMNYANPDMVGHTGDLKATIKAIEILDEQFKRIQKYVSENEKNVTWFITADHGNAEITEDENGN--PATKHTTSPVMFICSDKTIKLTNGKLADVAPTILDYL 485
>gi|171920637|ref|ZP_02931877.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178851|ref|ZP_02964632.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024239|ref|ZP_02996937.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039666|ref|ZP_02998364.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 8] >gi|188518533|ref|ZP_03004000.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188592513|ref|ZP_03005845.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 10] >gi|195867757|ref|ZP_03079758.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903363|gb|EDT49652.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209487|gb|EDU06530.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018898|gb|EDU56938.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997892|gb|EDU66989.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660612|gb|EDX53868.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (502 aa)
Score = 207, Expect = 5.1e-14, Identities = 109/472 (23%), Positives = 207/472 (43%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSN---FYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRS----NKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKV-MDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPK--------LKGLFLSSLAPIYGTKLDAV-FFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           +   L  ++ +G+G+ KK   N + LAN   +NYLI                     K YP+++           E   G ++I  +L +   +I      N+  + K +D      N  N++IVH+  M S      N +++ ++I  L+K   + VLHLI+DG+D+ PY F + +   +    + N  I +++GR     +  R     +     F     + EQ+  E +    +++AN    D  + P      + Y +     V+  N   D    LA ++K + K        +K + L +L P     +DA+  FE   K    + L +++  +  K   +    K G I+ FF  G N +  + T+ ++ S    +      +S+ ++    ID    +DV  V          S ++KQ +  I + D  + +L +  +    ++ +T  +G AE M+D +  I+  +  + V F+ T+ ++
  S:     3 LNKKLALIIIDGLGIGKKDDTNAVYLANPKTLNYLI---------------------KNYPTLEISAAQQPIGLLENQAGNSEIG-HLTIGAGRIILNDNANINSYTKRLDYESLVLNDINNEIVHVVGMYSNGLVHSNYEHIHWIIKELVKNNNQVVLHLISDGRDDYPYGFAQFIEQINALKTQYNVIIKSLSGRYFAMDRDQRWERTQKAFNTMFIKQDKICEQSLLEVA----QSIANHYESDEFVEPIVFNNDEKYNLKPYQKVILTNYRSDRMRQLAHLLKPNRKFNYHNPFLIKDIHLITLVPF--PDVDAITLFE---KQNLNNTLGDVLNDHHIKQARVAETEKYGHISFFFDGGINKHYASKTQYLIPSQKVATYDLCPQMSASLITKTIIDHYFDHDVFIVNYANPDMVGHSGNMKQTIQAILSVDSEIQKLYDFFKKNNGVLMITGDHGNAETMIDANGQIITSHSINDVWFIITDNNI 462
>gi|148887378|sp|Q4A5A8|GPMI_MYCS5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|144575217|gb|AAZ44063.2| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Mycoplasma synoviae 53] (501 aa)
Score = 206, Expect = 5.8e-14, Identities = 110/468 (23%), Positives = 205/468 (43%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG-YFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAK---NDNKV-LVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           +I +V +G+GL  +  GN  ++AN P  + L S  YP  L+    +       +   S    ++     ++Y      T L L+++ +K       ++F    ++  + NS + H+  +LS         +LF ++      G++ V +H+  DG+D  P S  ++L    + + K    I T++GR   F    RD + +     Y + I G     F+ A EY +   +  + D  + PA N+ +D  YF+  +D+V+F N  PD    L+ ++        + S  +K     S+    G K +  +        EE L+ N + K   + NK  L +    K   +  F   G +   +N  R ++ S    S  +   +S++ +  + I     +D+  +          +  L+  L  +E  D+ L RL+         + +T+ +G AE MLD++   V  + SS V  V ++  L
  S:     4 VILVVIDGLGLRSEIHGNAFQMANTPFFDKLFSE-YPNTLIQASGEYVGLPDGQIGNSEVGHLNIGAGRVVY------TGLSLINKALKDDKFKENQVFLNAFNKVKENNSTL-HLMGLLSPGGVHSLEAHLFEILKQAHNSGVENVAVHVFGDGRDVAPKSIRESLEKLQELVDKYGYKIATISGR---FYSMDRDKMFDRTEKAY-KAILGKSGNEFSSALEYLDLQYSQNITDEFLEPAKNSTLDSRYFLKDNDAVIFFNFRPDRARQLSHLILNSSLYDYQPSHLVKVSDFVSMMKYEGIKCNIAY--------EEMLVNNPIGKVFEDANKTQLRVAETQKYAHVTYFMDGGVDVEYKNSKRIMVDSLKVESYADTPQMSAEEITSQVISHAKDFDLTILNYANPDMVGHTGVLESTLVALEVLDKQLSRLVKWAEKNKITVFITADHGNAEVMLDENNKPVTKHTSSPVMLVTSDKSL 467
>gi|71894666|ref|YP_278774.1| phosphoglyceromutase [Mycoplasma synoviae 53] (503 aa)
Score = 206, Expect = 6.1e-14, Identities = 110/468 (23%), Positives = 205/468 (43%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG-YFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAK---NDNKV-LVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           +I +V +G+GL  +  GN  ++AN P  + L S  YP  L+    +       +   S    ++     ++Y      T L L+++ +K       ++F    ++  + NS + H+  +LS         +LF ++      G++ V +H+  DG+D  P S  ++L    + + K    I T++GR   F    RD + +     Y + I G     F+ A EY +   +  + D  + PA N+ +D  YF+  +D+V+F N  PD    L+ ++        + S  +K     S+    G K +  +        EE L+ N + K   + NK  L +    K   +  F   G +   +N  R ++ S    S  +   +S++ +  + I     +D+  +          +  L+  L  +E  D+ L RL+         + +T+ +G AE MLD++   V  + SS V  V ++  L
  S:     6 VILVVIDGLGLRSEIHGNAFQMANTPFFDKLFSE-YPNTLIQASGEYVGLPDGQIGNSEVGHLNIGAGRVVY------TGLSLINKALKDDKFKENQVFLNAFNKVKENNSTL-HLMGLLSPGGVHSLEAHLFEILKQAHNSGVENVAVHVFGDGRDVAPKSIRESLEKLQELVDKYGYKIATISGR---FYSMDRDKMFDRTEKAY-KAILGKSGNEFSSALEYLDLQYSQNITDEFLEPAKNSTLDSRYFLKDNDAVIFFNFRPDRARQLSHLILNSSLYDYQPSHLVKVSDFVSMMKYEGIKCNIAY--------EEMLVNNPIGKVFEDANKTQLRVAETQKYAHVTYFMDGGVDVEYKNSKRIMVDSLKVESYADTPQMSAEEITSQVISHAKDFDLTILNYANPDMVGHTGVLESTLVALEVLDKQLSRLVKWAEKNKITVFITADHGNAEVMLDENNKPVTKHTSSPVMLVTSDKSL 469
>gi|148377951|ref|YP_001256827.1| phosphoglyceromutase [Mycoplasma agalactiae PG2] >gi|148291997|emb|CAL59389.1| 2, 3-bisphosphoglycerate-independentphosphoglycerate mutase [Mycoplasma agalactiae PG2] (498 aa)
Score = 203, Expect = 1.6e-13, Identities = 120/493 (24%), Positives = 209/493 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS------PK--LKGLFLSSLAPIYGTKLDAVFFENPVK---GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLD 493
           MK T I +V +G+GL ++ +GN  KLAN P  + L S  YP +++   +   +++     P+ +       +  +   T + T L L+++ IK        +FN++       N+ + H+  +LS         +LF ++ +    GLK V +H I DG+D  P S   +L        +    I T++GR   F    RD + N  V  ++E + G  E  FT   +Y  +     + D   +PA N   D  F+  +DS++F N  PD    LA +   S      PK  +     +SL    G        E  VK   GK    LAN+        L +    K   +  F   G +   +N  R ++ S    S  +   +S+K + D+ + +   YDV  +          + +L+  +  +   D  + R+I+        + +T+ +G AE   D++ N  P  K +  P +    D   K        +  +IL  ++
  S:     1 MKKT-ILIVIDGLGLREQKQGNGFKLANTPTFDMLFSQ-YPNSII---QASGEFV---GLPAGQMGNSEVGHLNIGAGTVVYTGLSLINKAIKDGEFEKNPVFNEIFKDVKDKNTTL-HLMGLLSPGGVHSLEDHLFKLLEMAHNYGLKKVSVHPIGDGRDVAPKSIIPSLEKLQALCDEYGYKIATISGR---FYGMDRDKMFNR-VEVHYEAMIGKAENKFTNVIDYIKKQYDEGISDEFFIPACNK--DAEFIKDNDSIIFFNFRPDRARQLAHLFIGSDLYDAKPKHPVHISKFASLMKYEGINTLVAIHEMEVKMPIGKVLE-LANL------SQLRVAETQKYAHVTYFMDGGVDVVFKNSKRIMVPSLKVESYADAPQMSAKEITDELLANCLNYDVTIMNYANPDMVGHTGNLESTIKAVSFLDSQIKRVIDFANKNNITVFITADHGNAEITEDENGN--PATKHTKNPVMLICSDKSIKLKDGKLANIAPTILDYIN 483
>gi|51210031|ref|YP_063695.1| phosphoglycerate mutase [Gracilaria tenuistipitata var. liui] >gi|68052103|sp|Q6B8L5|GPMI_GRATL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|50657785|gb|AAT79770.1| phosphoglycerate mutase [Gracilaria tenuistipitata var. liui] (510 aa)
Score = 201, Expect = 2.7e-13, Identities = 105/490 (21%), Positives = 213/490 (43%)
  Q:     4 TLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVF---TNGDLWPKKMQSNFLGVYSSILSTLD 493
           ++I  + +G G ++  KGN +++A+ P I+ L +  YP  LL N   R+  +P+    + +       +  +     I   L  + + I+ +S  N E  N +  + N  N+K+ H+  + S      + K+LF ++++ ++  ++  +H I DG+D  PY     +   +  + + N   I T++GR +   +  R     +      +   G  +      +EY  +N++++ +         T +    +  +D ++F N  PD    L     T    KG   +S   +       Y   LD +    P K K ++ +  ++AK   K L L    K   +  FF  G         R+++ SP   +      +S+  L +  I++I K  Y  I +          + +L   +  I+  D+ + ++   C+   + + +TS +G A+ MLD++      + ++ VPF+    TN   +  +   N   +  +IL  L+
  S:     3 SIILTILDGWGYSENKKGNAIQIADTPTIDKLWNS-YPNTLL-NASGRDVGLPEGQMGNSEVG-----HTTIGAGRIINQDLVRISKSIEDRSFFNNEAINSICQKINFYNTKL-HLIGLCSNGGVHSHIKHLFALLDIAMRYKIQICIHAITDGRDTSPYGSKIFIEEINNQIQQFNHINICTISGRYYSMDRDCRWARTEKSYNTLLKNTLGFTKDPILMINEYYKKNISDEFIPP-------TRLHKGSIENNDGIIFFNFRPDRMRQLVHAF-TKSTFKGFNTTSFHNLEILTLTQYDPSLD-IEVAFPAK-KNKNFIGEIIAKYGLKQLRLAETEKYAHVTYFFNGGIEEPFAGEDRQLIPSPKVETYDLDPEMSATKLTESAINAINKNTYKFIVINYANPDMVGHTGNLDATIHAIQKIDKCIKKIWLACQAMNSTLIITSDHGNADYMLDENNEPCTSHSTNPVPFILAEPTNIHTYHLRKNGNLADIAPTILQLLN 489
>gi|188524082|ref|ZP_03004169.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530840|ref|ZP_03005139.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568703|ref|ZP_02828725.2| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 2] >gi|195659799|gb|EDX53179.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (502 aa)
Score = 198, Expect = 5.7e-13, Identities = 107/472 (22%), Positives = 207/472 (43%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSN---FYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRS----NKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKV-MDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPK--------LKGLFLSSLAPIYGTKLDAV-FFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           +   L  ++ +G+G+ KK   N + LAN   +NYLI                     K YP+++           E   G ++I  +L +   +I      N+  + K ++      N  N++IVH+  M S      N +++ ++I  L+K   + VLHLI+DG+D+ PY F + +   +    + N  I +++GR     +  R     +     F     + EQ+  E +    +++AN    D  + P      + + +     V+  N   D    LA ++K + K        +K + L +L P     +DA+  FE   K    + L +++  +  K   +    K G I+ FF  G N +  + T+ ++ S    +      +S+ ++    ID    +DV  V          S ++KQ +  I + D  + +L +  +    ++ +T  +G AE M+D +  I+  +  + V F+ T+ ++
  S:     3 LNKKLALIIIDGLGIGKKDDTNAVYLANPKTLNYLI---------------------KNYPTLEISAAQQPIGLLENQAGNSEIG-HLTIGAGRIILNDNANINSYTKRLNYESLVLNDINNEIVHVVGMYSNGLVHSNYEHIHWIIKELVKNNNQVVLHLISDGRDDYPYGFAQFIEQINALKTQYNVIIKSLSGRYFAMDRDQRWERTQKAFNTMFIKQDKICEQSLLEVA----QSIANHYESDEFVEPIVFNNDEKHNLKPYQKVILTNYRSDRMRQLAHLLKPNRKFNYHNPFLIKDIHLITLVPF--PDVDAITLFE---KQNLNNTLGDVLNDHHIKQARVAETEKYGHISFFFDGGINKHYASKTQYLIPSQKVATYDLCPQMSASLITKTIIDHYFDHDVFIVNYANPDMVGHSGNMKQTIQAILSVDSEIQKLYDFFKKNNGVLMITGDHGNAETMIDANGQIITSHSINDVWFIITDNNI 462
>gi|171920321|ref|ZP_02931665.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902740|gb|EDT49029.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 1 str. ATCC 27813] (502 aa)
Score = 188, Expect = 8.8e-12, Identities = 101/463 (21%), Positives = 199/463 (42%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGET-DIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPK--------LKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN 469
            ++ +G+G+ K+   N + LAN P +NYLI+  +P   +S  ++    +  +   S    +      ++  +  +I  Y++ +D +  S  L N++             ++IVHI  M S      N +++ ++I  +IK   + VLHLI+DG+D+ PY F + +   +    + N  I +++GR     +  R     +     F     + E+ F E +    +++AN    D  + P      + Y +     V+  N   D    LA ++K + K        ++ + L +L P       A+F     K    + L ++  K+  K   +    K   I+ FF  G N      T+ ++ S    +      +S+ ++    ID    +DV  V          S +++Q +  I + D  + +L +       ++ +T  +G AE MLD    ++  +  + V F+ T+
  S:     9 LIIIDGLGIGKEDNTNAVHLANPPTLNYLINN-FPTLQISAAQQNIGLLENQAGNSEIGHLTIGAGRIILNDNANINNYMKSVDYE--SAVLSNIK-------------NEIVHIVGMYSNGLVHSNYEHIHWIIKQIIKNNNEVVLHLISDGRDDYPYGFAQFIEQINALKKQYNIIIKSLSGRYFAMDRDQRWERTQKAFNAMFVKQDKICEKTFLEVA----QSIANSYKSDEFVQPVVFNDDEKYNLKPHQKVILANYRSDRMRQLAHLLKPNKKFHYDNPFLVQDINLITLVPFPDVDAIALF----EKQNLNNTLGDVFNKHQIKEARIAETEKYAHISFFFDGGVNKYYSTKTQYLIPSQKVATYDLCPQMSAHLITKTIIDHYFDHDVFIVNYANPDMVGHSGNMQQTIEAILSVDHEVRKLYDFFEKNNGVLMITGDHGNAEMMLDDQKQVITSHSVNDVWFIITD 459
>gi|160932294|ref|ZP_02079685.1| hypothetical protein CLOLEP_01129 [Clostridium leptum DSM 753] >gi|156868896|gb|EDO62268.1| hypothetical protein CLOLEP_01129 [Clostridium leptum DSM 753] (504 aa)
Score = 188, Expect = 8.9e-12, Identities = 119/471 (25%), Positives = 201/471 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK--LIDRSNKT--NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARM-----MKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           MK  L+ ++ +G G     +GN +K AN PN++ L S              N   P     +   DV   D        G T+I     +  E  + +KS+   + F    L+D  N    N K +H+  +LS      +  +L+ ++ +  ++GLK V +H + DG+D  P S    +   +  L +     I TV GR +   +  R D ++      Y   + G G QA     E   ++ A +V D  ++PA      G  +   DSV+F N  PD    + R       K   + KG F   L  +  T+ DA      V  K ESL       ++K   K L +    K   +  FF  G         R ++ SP   +      +S+ ++ D+ +  I  G+YDVI   F  C M+      S     +  ++T    +G++    +    ++ +T+ +G A+KM+ +       + ++ VPF     D
  S:     1 MKKPLMLMIMDGFGFAPA-EGNAIKAANTPNLDKLFS-------------EN---PLTQIGASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQELTRITKSIQEGDFFENPALLDAVNNALNNGKALHLIGLLSDGGVHSHNTHLYAIVELAKRRGLKDVYIHALLDGRDVPPSSGKDYVQECADKLKEIGVGKIATVMGRYYAMDRDNRWDRVEKA----YAAMVYGEGVQAQCPV-EAVADSYAKEVTDEFVVPA--VCAGGAQIGAGDSVVFFNFRPDRAREITRTFVDPAFKGFERKKGFF--PLTYVCMTQYDATMPNVEVAFKPESLTNTFGEYISKLGMKQLRIAETEKYAHVTFFFNGGVEEPYPGEDRALIPSPKVATYDLQPEMSAYLVTDEVLKRIHSGEYDVIILNFANCDMVGHTGVFSAAVAAVEAVDTC---VGKVAAAIKEMDGVLLITADHGNADKMVAEDGEPFTAHTTNPVPFCVVGYD 468
>gi|13357740|ref|NP_078014.1| phosphoglyceromutase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762100|ref|YP_001752264.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508817|ref|ZP_02958271.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701900|ref|ZP_02971553.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189042205|sp|B1AIH0|GPMI_UREP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|27734395|sp|Q9PQW1|GPMI_UREPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|11270677|pir||A82925 phosphoglycerate mutase UU182 [imported] - Ureaplasma urealyticum >gi|6899145|gb|AAF30589.1|AE002117_13 phosphoglycerate mutase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827677|gb|ACA32939.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675780|gb|EDT87685.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700633|gb|EDU18915.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ureaplasma parvum serovar 6 str. ATCC 27818] (502 aa)
Score = 187, Expect = 1.1e-11, Identities = 100/463 (21%), Positives = 199/463 (42%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGET-DIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPK--------LKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN 469
            ++ +G+G+ K+   N + LAN P +NYLI+  +P   +S  ++    +  +   S    +      ++  +  +I  Y++ +D +  S  L N++             ++IVHI  M S      N +++ ++I  +IK   + VLHLI+DG+D+ PY F + +   +    + N  + +++GR     +  R     +     F     + E+ F E +    +++AN    D  + P      + Y +     V+  N   D    LA ++K + K        ++ + L +L P       A+F     K    + L ++  K+  K   +    K   I+ FF  G N      T+ ++ S    +      +S+ ++    ID    +DV  V          S +++Q +  I + D  + +L +       ++ +T  +G AE MLD    ++  +  + V F+ T+
  S:     9 LIIIDGLGIGKEDNTNAVHLANPPTLNYLINN-FPTLQISAAQQNIGLLENQAGNSEIGHLTIGAGRIILNDNANINNYMKSVDYE--SAVLSNIK-------------NEIVHIVGMYSNGLVHSNYEHIHWIIKQIIKNNNQVVLHLISDGRDDYPYGFAQFIEQINALKKQYNIIVKSLSGRYFAMDRDQRWERTQKAFNAMFVKQDKICEKTFLEVA----QSIANSYKSDEFVQPVVFNDDEKYNLKPHQKVILANYRSDRMRQLAHLLKPNKKFHYNNPFLVQDVNLITLVPFPDVDAIALF----EKQNLNNTLGDVFNKHQIKEARIAETEKYAHISFFFDGGVNKYYSTKTQYLIPSQKVATYDLCPQMSAHLITKTIIDHYFDHDVFIVNYANPDMVGHSGNMQQTIEAILSVDHEIRKLYDFFEKNNGVLMITGDHGNAEMMLDDQKQVITSHSVNDVWFIITD 459
>gi|118444017|ref|YP_877495.1| phosphoglyceromutase [Clostridium novyi NT] >gi|166991378|sp|A0PYP3|GPMI_CLONN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|118134473|gb|ABK61517.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium novyi NT] (511 aa)
Score = 182, Expect = 4.3e-11, Identities = 117/491 (23%), Positives = 213/491 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVS---KDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K  ++  + +G+GL+    GN   LA KPN++ +    YP  +L            +   S    ++     ++Y        L  + + I+   +   E   K ID + K N   +H   +LS      +  +L  +I+   K G+K V +H   DG+D  P S    + +  K + +     I TV+GR +   +  R     E + + Y   + G GE A T   E    +  +   D  +LP   T++  DG  V+    +DSV+F N  PD    + R +    +  G    +L  ++   T+ D+      V  K ES    L   V+K   K L +    K   +  FF  G    N+N  R ++ SP   +      +S+  + D+ +  I   +YD+I +          +  +   +  +ET D+ LG++++        + +T+ +G  E+M+D    N +  + ++LVPF +   D   K+++    G+ + I  T+
  S:     3 KKPVMLAILDGLGLSDHKDGNAFSLAKKPNLDKIFKE-YPHTVLGASGLSVGLPDGQMGNSEVGHLNIGAGRIVY------QALTRITKSIEDGDIFKNEALLKAIDNA-KNNDSAIHFMGLLSDGGVHSHIDHLKGLIDFAAKSGVKKVYVHAFLDGRDTAPKSALTYIEDLEKHMAEVGVGSIATVSGRYYAMDRDKR----WERIELAYNAMVLGKGEVA-TSPKEAVERSYHDNKTDEFVLP---TVIEKDGKPVATIKSNDSVVFFNFRPDRARQITRAI-NDKEFDGFKRETLNLVFVTMTEYDSTIEGVEVAFKPESYVNTLGEYVSKQGKKQLRIAETEKYAHVTFFFNGGVEEPNQNEDRALIPSPKVATYDLKPEMSAYEVTDEVLKRIDSDEYDMIILNYANPDMVGHTGVIDAAVKAVETVDECLGKVMDKILEKNGALFITADHGNCEQMIDYSTGNPMTAHTTNLVPFAYIANDAKEKELREE--GILADIAPTM 492
>gi|118725216|ref|ZP_01573859.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium cellulolyticum H10] >gi|118665448|gb|EAV72067.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium cellulolyticum H10] (511 aa)
Score = 180, Expect = 6.1e-11, Identities = 112/448 (25%), Positives = 193/448 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRD-VDSNFYEMLYGETDIK---------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG----YFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSS----LAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K  +  ++ +G G N K +GN ++ ANKPN++                    Y+ K T   V    +D    E   G +++           Y EL  + + I+       E F K I+   K NSK+ H+F +LS      +  +L+ ++ +  + GLK V +H   DG+D  P S           L +     I +V GR +   +  R     E V + Y   + G G  A   A E    + A    D  + P    I++       ++ +DSV+F N  PD    + R     P+ KG         L  +  T+ D       V  K ++L       +++   + L +    K   +  FF  G  T  E   R ++ SP   +      +S+  + ++ +  I   +YDVI   F  C M+         K   + +E  D+ +G+++N     G ++ +T+ +G AE+M+D
  S:     3 KKLVTLMILDGFGKNLKQEGNAIQAANKPNLD-------------------SYLSKCTNTVVHTSGMDVGLPEGQMGNSEVGHTNIGAGRIVYQELTRITKSIQDGDFFEKEEFLKAIENCKKNNSKL-HLFGLLSDGGVHSHNTHLYGLVEMAKRNGLKDVFIHCFYDGRDVPPDSSKVYTEELEAKLKEIGVGKIASVMGRYYSMDRDNR----WERVQLAYDVMVSGKGLTA-NSAVEAVEASFARNEFDEFVKP--TAILENGKPVATIAANDSVIFFNFRPDRAREITRTF-VDPEFKGFEREKGFFPLCYVCMTQYDKTMPNVLVAFKPQTLENTFGEYISRLGYRQLRIAETEKYAHVTFFFNGGVETQYEGEDRALIPSPKVATYDLKPEMSAYEVAEEAVKRIDSKQYDVIILNFANCDMVGHTGVFDAAK---AAVEAVDECVGKVVNAVTAQGGVVLITADHGNAEQMVD 452
>gi|167628774|ref|YP_001679273.1| phosphoglyceromutase [Heliobacterium modesticaldum Ice1] >gi|167591514|gb|ABZ83262.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Heliobacterium modesticaldum Ice1] (517 aa)
Score = 180, Expect = 7.3e-11, Identities = 114/465 (24%), Positives = 206/465 (44%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYI--PKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFL--LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-----FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG----TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTN 469
           ++ +V +G GL +  +GN LK+A+ PN   L+   YP   +   +   +Y+  PK          +S    +  G   +  Y EL  + + +++  L   ++    +DR   T+ K +H+  +LS      +  +LF ++++   +G++ + +H   DG+D  P +  + + +  K L  L R   + TV+GR +   +  R     E V   ++ +  G GE+A T            +V D  + P    I+DG       +   DSV+F N   D    L R         G     LAP       T+ DA   + PV    ++L      ++AK   + L +    K   +  FF       N+   R ++ SP   +      +S++ + D+ +  I   KYDVI +          +  L   +  +E  D+ LGR+       G  + +T+ +G  E M+D H +  PH  + + LVP +  +
  S:    10 VMLIVLDGWGLREDVEGNTLKIASLPNYQRLLE-TYPHTSI---QASGEYVGLPKGQIG------NSEVGHLNIGAGRV-VYQELTRISKAVETGELEKNQVLAAAMDRLKGTD-KGLHLMGLLSDGGVHSHIDHLFALLDMAAARGVEQIFVHAFLDGRDVPPANAQEYIDSLEKKLGQLGRGQ-LATVSGRYYAMDRDQR----WERVEKAWDAMVYGRGEKA-TLGRSAVEAAYHARVTDEFVPPT--VIVDGKGEPKGTIKDGDSVIFFNFRADRARQLTRAF-VDADFSGFDRGPLAPQVHFCCLTQYDATI-DAPVAFMPQNLENTFGEVIAKAGLRQLRIAETEKYAHVTFFFNGGVEEPNVGEERILVPSPKVATYNLQPEMSAREVTDRVLAEIEAEKYDVIILNYANPDMVGHTGMLPAAIQAVEAVDKCLGRVAAAVLAKGGALLITADHGNVEMMIDPH-DGGPHTAHTTDLVPVILVS 477
>gi|72080923|ref|YP_287981.1| phosphoglyceromutase [Mycoplasma hyopneumoniae 7448] >gi|85540985|sp|Q4A7D1|GPMI_MYCH7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|71914047|gb|AAZ53958.1| phosphoglycerate mutase [Mycoplasma hyopneumoniae 7448] (505 aa)
Score = 178, Expect = 1.0e-10, Identities = 121/507 (23%), Positives = 207/507 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS-------FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLARMM------KTSPK--LKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           MK  L+ ++ +G+GL  + +GN   LA  P  + L    YP +L++   +       +   S    ++     ++Y      T + +++  +K+      E F      S KT   +  I  + S      +  +LF +I+     G+K + LHL  DG+D  P S        N  L N+       N  I +++GR   F    RD + +   + Y   + G  E  FT+  +Y N      V D    PA N  ++   F++ D  V+F N  PD    L+ ++      +  PK  +K     S+    G      F E  V    E+ L  +++    + L L    K   +  F   G     EN  R ++ S    S  ++  +S+  + DK ++    YD I +          + DLK  +  +E  D  +GR+            +T+ +G AE   D++ N  P  K +  P +  + D   K        +  +IL  L  LD    + + SLI
  S:     1 MKKKLVLIIIDGLGLRLESQGNGFALAKTPVFDRLFQE-YPNSLIAASGQEVGLPEGQMGNSEVGHLNIGAGFVVY------TGISIINNALKTGKFFENEKFILAFRHSIKTGFPL-QIMGLFSPGGVHSHQDHLFALIDFAANFGVKKLNLHLFGDGRDVGPKSIKPWIKMLNLKLKNY------ENYKIASISGR---FYSMDRDKMFDRVELGY-NALLGKAENTFTDPIDYINFQYEKGVSDEFFEPAINLKVNKKDFLADDHPVIFFNFRPDRARQLSHLILQTDLYEQKPKNPIKTDVFVSMMKYEGINCLVAFEEMRV----ENPLGKLISMAGFRQLRLAETQKYAHVTFFVDGGVELELENSDRILIDSLKVQSYADFPQMSAVEITDKLLEVGQNYDFIIMNFANPDMVGHTGDLKATIKAVEILDFQIGRICKWAEEKNFDFFITADHGNAELTEDENGN--PSTKHTTFPVMLISSDKTIKLKSGKLANIAPTILDYL-GLDKHPDMDHDSLI 501
>gi|150391309|ref|YP_001321358.1| phosphoglyceromutase [Alkaliphilus metalliredigens QYMF] >gi|149951171|gb|ABR49699.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Alkaliphilus metalliredigens QYMF] (511 aa)
Score = 178, Expect = 1.1e-10, Identities = 115/450 (25%), Positives = 202/450 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNL-SNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDAD--ILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           MKN +  ++ +G+G  +   GN +K AN PN + L+S  YP   +            +   S    ++     ++Y E      L  +   I++      E F KL+ R  KT+ K +H+  ++S      +  ++  ++ +  ++GLK V LH   DG+D  P S   + K+L ++ ++  + R   IVT++GR +   +  R     E V   ++ +  LG+    E +  T   +A  + + D  ++P      +G F  +  DD ++F N  PD    + R +         + KG F  SL  +  T  D       V    +SL   L   ++K   K L +    K   +  FF       NI   RK++ SP   +      +S+  L ++ I  I K  YD I V          +     ++  +ET D+ LG++I+     G    +TS +G AE+M+D+
  S:     1 MKNPVALVILDGLGNREGELGNAVKKANLPNYHRLMSQ-YPHTEVEASGLAVGLPEGQMGNSEVGHLNIGAGRVVYQE------LTRISRAIETGDFFKNEHFLKLL-RKLKTSGKALHLMGLVSDGGVHSHMNHIVALLKLAKREGLKRVCLHCFLDGRDTPPQSGLDYIKSLEASIAEIGVGR---IVTISGRYYAMDRDQR----WERVQQAYDAMT-LGKGRLAEGA-ITAVEMAYSLKETDEFVIPTVIPNDEGEFELIEPDDGIIFFNFRPDRAREMTRALMDETFEGFKREKGYF--SLNFVSMTSYDKTIENAEVAYPPQSLANTLGEYISKQGIKQLRMAETEKYAHVTFFFNGGVEIANIGEQRKLVPSPKVATYDLQPEMSAYELTEELIKEIDKDQYDFIVVNFANPDMVGHTGIEIAVIKALETVDECLGKVIDKLIEKGGKAIVTSDHGNAEEMIDE 452
>gi|71893944|ref|YP_279390.1| phosphoglyceromutase [Mycoplasma hyopneumoniae J] >gi|85540986|sp|Q4A992|GPMI_MYCHJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|71852071|gb|AAZ44679.1| phosphoglycerate mutase [Mycoplasma hyopneumoniae J] (505 aa)
Score = 177, Expect = 1.4e-10, Identities = 120/507 (23%), Positives = 207/507 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS-------FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLARMM------KTSPK--LKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           MK  L+ ++ +G+GL  + +GN   LA  P  + L    YP +L++   +       +   S    ++     ++Y      T + +++  +K+      E F      S KT   +  I  + S      +  +LF +I+     G+K + LHL  DG+D  P S        N  L N+  +       I +++GR   F    RD + +   + Y   + G  E  FT+  +Y N      V D    PA N  ++   F++ D  V+F N  PD    L+ ++      +  PK  +K     S+    G      F E  V    E+ L  +++    + L L    K   +  F   G     EN  R ++ S    S  ++  +S+  + DK ++    YD I +          + DLK  +  +E  D  +GR+            +T+ +G AE   D++ N  P  K +  P +  + D   K        +  +IL  L  LD    + + SLI
  S:     1 MKKKLVLIIIDGLGLRLESQGNGFALAKTPVFDRLFQE-YPNSLIAASGQEVGLPEGQMGNSEVGHLNIGAGFVVY------TGISIINNALKTGKFFENEKFILAFRHSIKTGFPL-QIMGLFSPGGVHSHQDHLFALIDFAANFGVKKLNLHLFGDGRDVGPKSIKPWIKMLNLKLKNYEDY------KIASISGR---FYSMDRDKMFDRVELGY-NALLGKAENTFTDPIDYINFQYEKGVSDEFFEPAINLKVNKKDFLADDHPVIFFNFRPDRARQLSHLILQTDLYEQKPKNPIKTDVFVSMMKYEGINCLVAFEEMRV----ENPLGKLISMAGFRQLRLAETQKYAHVTFFVDGGVELELENSDRILIDSLKVQSYADFPQMSAVEITDKLLEVGQNYDFIIMNFANPDMVGHTGDLKATIKAVEILDFQIGRICKWAEEKNFDFFITADHGNAELTEDENGN--PSTKHTTFPVMLISSDKTIKLKSGKLANIAPTILDYL-GLDKHPDMDHDSLI 501
>gi|54020261|ref|YP_116123.1| phosphoglyceromutase [Mycoplasma hyopneumoniae 232] >gi|81603611|sp|Q5ZZU2|GPMI_MYCH2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|53987434|gb|AAV27635.1| phosphoglycerate mutase [Mycoplasma hyopneumoniae 232] (512 aa)
Score = 177, Expect = 1.7e-10, Identities = 121/507 (23%), Positives = 207/507 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS-------FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLARMM------KTSPK--LKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           +K  L+ ++ +G+GL  + +GN   LA  P  + L    YP +L++   +       +   S    ++     ++Y      T + +++  +K+      E F      S KT   +  I  + S      +  +LF +I+     G+K + LHL  DG+D  P S        N  L N+       N  I +++GR   F    RD + +   + Y   + G  E  FT+  +Y N      V D    PA N  ++   F++ D  V+F N  PD    L+ ++      +  PK  +K     S+    G      F E  V    E+ L  ++     + L L    K   +  F   G     EN  R ++ S    S  ++  +S+  + DK ++   KYD I +          + DLK  +  +E  D  +GR+            +T+ +G AE   D++ N  P  K +  P +  + D   K        +  +IL  L  LD    + + SLI
  S:     8 VKKKLVLIIIDGLGLRFESQGNGFALAKTPVFDRLFQE-YPNSLIAASGQEVGLPEGQMGNSEVGHLNIGAGFVVY------TGISIINNALKTGKFFENEKFILAFRHSIKTGFPL-QIMGLFSPGGVHSHQDHLFALIDFAANFGVKKLNLHLFGDGRDVGPKSIKPWIKMLNLKLKNY------ENYKIASISGR---FYSMDRDKMFDRVELGY-NALLGKAENTFTDPIDYVNFQYEKGVSDEFFEPAINLKVNKKDFLADDHPVIFFNFRPDRARQLSHLILQTDLYEQKPKNPIKTDVFVSMMKYEGINCLVAFEEMRV----ENPLGKLICMAGFRQLRLAETQKYAHVTFFVDGGVELELENSDRILIDSLKVQSYADFPQMSAVEITDKLLEVGQKYDFIIMNFANPDMVGHTGDLKATIKAVEILDFQIGRICKWAEEKNFDFFITADHGNAELTEDENGN--PSTKHTTFPVMLISSDKTIKLKSGKLANIAPTILDYL-GLDKHPDMDHDSLI 508
>gi|86747562|ref|YP_484058.1| phosphoglyceromutase [Rhodopseudomonas palustris HaA2] >gi|86570590|gb|ABD05147.1| phosphoglycerate mutase [Rhodopseudomonas palustris HaA2] (504 aa)
Score = 176, Expect = 2.0e-10, Identities = 92/333 (27%), Positives = 146/333 (43%)
  Q:   142 VLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA----YNTIMDGYFVSKDDSVLFLNSDPDDFAS-LARMMKTS----PKLKGLFLSSLAPI--YGTKLDAVFF-----ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPF-VFTNGDLWP 474
           +L K G+  VLH   DG+D  P S   +++   +  L  N PI TV+GR +   +  R     + V   ++ I       F +A        A+ V D  I+PA    Y  + DG      D VL  N   D     LA ++  +    P+ + L +++ A +  Y T LDA+       ++ V G     L  +VA      L +    K   +  F   GE        R ++ SP   +      +S+  L DK +++I  GKYD+I +          +  L   +  +ET D  LGR++   R +G  + +T+ +G  E M D  +   PH   +  P  V   GD  P
  S:   136 ILDKAGIPTVLHAFTDGRDTPPQSAVDDIARL-RADLPPNVPIATVSGRYYAMDRDNR----WDRVGKAYKVIAEADGPRFADADAVVAAGYASGVNDEFIVPAVVGDYQGLRDG------DGVLCFNFRADRVREILAALLDPAFAGFPRKRVLKIAAAAGMTQYSTALDALMRTIFPPQSLVNG-----LGQVVAATGRHQLRMAETEKYPHVTYFLNGGEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVEAINSGKYDLIILNFANPDMVGHTGSLPAAIKAVETVDAQLGRIVAAIRASGGALLVTADHGNCEMMRDP-VTGGPHTAHTTNPVPVLLVGDNGP 472
>gi|167037152|ref|YP_001664730.1| phosphoglyceromutase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855986|gb|ABY94394.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Thermoanaerobacter pseudethanolicus ATCC 33223] (514 aa)
Score = 175, Expect = 2.7e-10, Identities = 109/444 (24%), Positives = 188/444 (42%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASE--YTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLAR-----MMKTSPKLKG---LFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           + ++ +G GL+ K +GN +  AN PN+++     YP  +LS           +   S    ++     ++Y E      L  + + IK  +    + F   I+   K NSK+ H+F +LS      +  +LF ++ +  + GLK + +H   DG+D  P    + +  F +   +     I T++GR +   +  R +   +   D      G+   +  EA +  Y+ +     V    IL     +     V   DS++F N  PD    L R     +     + KG   +F  S+     T+ D  F    V  K E L   L   ++K   K L +    K   +  FF  G    NE   R ++ SP   +      +S+  + D  I  I   +Y  I +          +  L   +  IE  D+ LGR++N  +  G  I +T+ +G AE+M+D
  S:     7 MLVILDGFGLSDKKEGNAVYQANTPNLDFYFKN-YPHTILSASGLAVGLPEGQMGNSEVGHLNIGAGRIVYQE------LTRISKDIKEGTFFKKKEFLDAIENVKKNNSKL-HLFGLLSDGGVHSHITHLFALMKLAKEHGLKEIYIHAFLDGRDVPPACAKEYIKQFEEESNRIGIGKIATISGRYYAMDRDKR-WDRTKKAYDAIVLGKGVYANSPMEAIDIAYSKDQTDEFVEPTVILENGKPVAT---VEAGDSIIFFNFRPDRARQLTRAFIDEVFNHFEREKGYLPVFFVSM-----TQYDETFENTHVAYKPERLENTLGEYLSKKGIKQLRIAETEKYAHVTFFFNGGVEEPNEGEERILVPSPKVATYDLKPEMSAYEVTDTVIPKIMSDQYGFILLNFANPDMVGHTGVLNAAIKAIEAIDECLGRIVNAVQSVGGTIIITADHGNAEEMID 452
>gi|110004322|emb|CAK98660.1| probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase protein [Spiroplasma citri] (525 aa)
Score = 175, Expect = 2.8e-10, Identities = 92/408 (22%), Positives = 173/408 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKG-----LFLSSLAPIYGTKLDAVFFENPVKGKEESL--------LANMVAKNDNKVLVLGLNHKKGFINKFF---------GENTNNE----NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           L L+++ IK  + +        I+ + K+N    HI  + S      +  ++F    +  ++G+K + LH+  DG+D +P      L  F +   + +   I T+ GR +   +  +     + V   ++ +       F++  EY N        D  ++PAYN      ++   D V F N  PD   ++A  + T+P   G      F+  L  IY   +  + +   V  K  +         L   ++K   + L +    K   +  FF         G  T  E      +  ++ SP   +      +S+  + DK I  + +  +DVI   F  C M+     +  L   +  ++T D  LG++    +    I+ +T+ +G  E M+D+       + S LVP + T   L  ++       +  +IL  L
  S:    80 LTLINKTIKDGTFNQNPELLAAINFAKKSNGAF-HIMGLFSVGGVHSHLNHIFAAYKLAAQEGIKEIYLHIFGDGRDTKPECIKIYLEQFQQLQNQLKVGEIATIGGRYYAMDRDKK----YDRVQIAYDVLVSRKGSEFSDPIEYINREYQAGRNDEFLMPAYNINTPKGYIKSGDGVFFANFRPDRAIAIASAL-TNPNFPGNEAQTYFMPKLHDIYFVSM--MEYAETVASKHVAFKPIKVVNGLGEWLSKKGYRQLRIAETEKIAHVTFFFDGGKDYFKNGLATQAEITLTGASADLIPSPKVATYDLKPEMSAYEITDKLITELNQNEFDVIILNFANCDMVGH---TGILPAAIEAVKTIDNCLGKIYTAIQKVNGIMIITADHGNVEIMIDETGGPNKKHTSQLVPIIITKEGLQLRQDNPAIADIAPTILDLL 509
>gi|549534|sp|Q06464|GPMI_ANTSP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|288996|emb|CAA45959.1| unnamed protein product [Antithamnion sp.] (510 aa)
Score = 174, Expect = 2.9e-10, Identities = 118/477 (24%), Positives = 203/477 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK-----LIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLL-----KRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKG--------LFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFG----ENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNF 481
           +I ++ +G G +   KGN +  AN P I+ L    YP  LLS   +    +P K   + +            G T I     +  + +K SKS+ N E FN      +   S + NSK VHI  + S      +  +L  +I +  +  +   LHLI DG+D  P    K    F K ++       NT I T++GR +   +  R     +      E  C     +   +   +Y  +N++++ +    +  +N +        +DS++F N  PD    L       P  KG        L L++      T      F N  K   ++ L  +++ +  K L L    K   +  FF     E    EN  R++++SP   +      +S+  L +  I++I K  Y  I +          + ++   +  IE  DQ + ++++    T NI+ +TS +G A+ ML         +  + VPF+  N     +K Q+N 
  S:     9 IILMILDGWGHSTNAKGNAIHEANTPIIDKLWDN-YPKTLLSASGEHVG-LPHKQMGNSE-----------VGHTTIGAGRIINQDLVKISKSIKNKEFFNNYQLHNIYKYSCEKNSK-VHIVGLCSNGGVHSHINHLKALIQISKQYKVMTCLHLITDGRDTLP----KQAKLFVKEIIDIIDENYNTEICTISGRYYSMDRDCRWSRTEKAYKAMVENSCNQNSSSDILSIIDKYYEQNISDEFLPPTKISMHNIV-------HNDSLIFFNFRPDRIRQLLHSF-AKPNFKGFQRKTIKNLMLTTFTEYDSTLSIPTVFPNEPK---KNFLGQIISNSGLKQLRLAETEKYAHVTYFFNGGIEEPFPGEN--RELIASPKVETYDLPPEMSAYQLTNSLIEAINKQLYQFIVINYANPDMIGHTGNMNATIEAIEIVDQCIEKVLHTIEDTNNILIITSDHGNADYMLTDENKPCTSHSINPVPFILINNR---QKKQTNL 478
>gi|119773202|ref|YP_925942.1| phosphoglyceromutase [Shewanella amazonensis SB2B] >gi|119765702|gb|ABL98272.1| Phosphoglycerate mutase [Shewanella amazonensis SB2B] (513 aa)
Score = 174, Expect = 2.9e-10, Identities = 109/470 (23%), Positives = 195/470 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS--KDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           K  L  L+ +G G  +  + N +  AN P ++ L +  YP  L+S           +   S    ++     ++Y E      L  + + I+     +     K +D +   N   VHI  +LS      + +++  +I +  K+G   V LH   DG+D  P S   +L++F++     N   I ++ GR     +  R     + V+  ++ I  G G+ + T A +      A    D  + P      +G  VS   +D+++F+N   D    ++R   T P   G   +     +   L   A   +  +    E L+  +  V +N  K  L +    K   +  FF  G+    +   R +++SP   +      +SS  L DK +++I   KYDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D         + S LVPF++   D
  S:     4 KRPLALLILDGWGYREDQESNAIFHANTPVLDNLKAN-YPNGLISGSGHDVGLPDGQMGNSEVGHINLGSGRIVYQE------LTRISKAIEDGEFDDNPALCKAVDAAIAANGA-VHIMGLLSPGGVHSHEEHIEAMIRMAAKRGATKVYLHAFLDGRDTPPRSAKGSLAHFTELFASLNAGRIASIVGRYFAMDRDNR----WDRVVQAYDLITQGKGKHSATNAVDALEAAYARDENDEFVAPTAIVDANGDSVSLNDNDALIFMNFRADRARQISRSF-TDPAFAGFERAVTPKTHFVMLTEYAGDIQGDIAFPSEDLVNTLGEVLQNSGKTQLRISETEKYAHVTFFFNGGKEQPFDGEDRILINSPKVATYDLQPEMSSTELTDKLVEAIESAKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVDALAKVGGECLITADHGNAEQMRDPSTGQAHTAHTSELVPFIYVGRD 475
>gi|20092802|ref|NP_618877.1| phosphoglyceromutase [Methanosarcina acetivorans C2A] >gi|27734312|sp|Q8TIY2|GPMI2_METAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 (Phosphoglyceromutase 2) (BPG-independent PGAM 2) (iPGM 2) >gi|19918101|gb|AAM07357.1| phosphoglycerate mutase [Methanosarcina acetivorans C2A] (521 aa)
Score = 174, Expect = 3.8e-10, Identities = 108/463 (23%), Positives = 197/463 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNK--LIDR-SN-KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           +  L+ ++ +G G  +  +GN +  A  PN+N L++  +PW  L    +       +   S    ++     ++Y +    T + L        S+ N + F    L+D  SN K N   +H+  ++S+        +L+ +I +   KGLK V +H   DG+D  P +   ++     F  +  +  I TV GR +      RD       + Y     G+     ++A    ++  A    D  + P   T  DG     V  +DS++F N  PD            DF    R  +  PK+  + ++     Y   LD      P   + E++L  +++K     L +    K   +  F   G+    +   R ++ SP   +      +S+  + D+ I  I  GKYDVI +    +     +   +  +  +E  D  +GR+I   +  G +  +T+ +G AE+M ++H    PH   +  P
  S:    11 RRPLMLMILDGWGYREASEGNAILAAETPNLNSLLNE-FPWCFLECSGEAVGLPEGQMGNSEVGHLNIGAGRVVYQDL---TRINL--------SVRNGDFFENPVLLDAISNVKLNDSSLHLMGLVSYGGVHSYMTHLYALIKLARDKGLKKVYIHAFLDGRDVPPKAALADIRELDAFCKENGSARIATVQGRYYAMD---RDKRWERSKLAYDALTLGVAPYTTSDAETAVSDAYARGETDEFVKPTVVTGSDGKPEAVVQDNDSIIFFNFRPDRARQLTWAFENDDFDGFPR--EKRPKVHYVCMAQ----YDETLDLPIAFPP--EELENVLGEVLSKQGLVQLRIAETEKYAHVTFFLNGGQEKCYDGEDRCLIPSPKVATYDLKPEMSAYEVTDEVIRRIQSGKYDVIVLNFANMDMVGHTGIFEAAVQAVEAVDTCVGRIIEALKKAGGVALITADHGNAEQMENQHTG-EPHTAHTSNP 474
>gi|58617257|ref|YP_196456.1| phosphoglyceromutase [Ehrlichia ruminantium str. Gardel] >gi|75432679|sp|Q5FFL8|GPMI_EHRRG 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|58416869|emb|CAI27982.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ehrlichia ruminantium str. Gardel] (501 aa)
Score = 171, Expect = 7.8e-10, Identities = 94/391 (24%), Positives = 170/391 (43%)
  Q:    88 LDEQIKS--KSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI--YGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQ 478
           ++E+IK+  K+ H LE   ++     K N+ I HI  +LS      +  ++  +I+ L    ++ V+H+  DG+D  P S  K ++     +    N  I T++GR +   +  R  LD       + +I     + + E      +N    + D  I+P       G  ++  D  +  N   D    + +M+        + L +   +  Y  +L+    F N    K  + L  +++      L +    K   +  FF  G     EN  R I+ SP+ T+      +S+  + D  I  I   KY +I +          + +++     I T DQ LG+++     T  I+ +T+ +G AE+M D   N+ P+   +L  VPFV  N   +PKK++
  S:    82 INEEIKNIRKNTHLLEFTEQI-----KRNNGICHIAGLLSDGGIHSSLSHMLDIIDALSYLKIQVVIHIFLDGRDTPPISALKYINILCSHIKDLNNVSIATISGRYYSMDRDNR--LD--RTTKAYNSIAFGDGKRYEEPISAVQDNYNAGITDEFIIPCVIGNYQG--MNPTDGFIMTNFRSDRVIQILKMITEDQNTNHITLKNTIGMIKYSNELNIPCLFPNK---KISNTLGEIISNQQLHQLRIAETEKYAHVTFFFNGGREEVFENEERIIIPSPSVTTYDLVPEMSAYEITDTLIKKINLQKYSLIIINYANADMVGHTGNIEATKKAITTLDQCLGKILKCIHNTNYILVITADHGNAEEMFDVQNNM-PYTAHTLNPVPFVVCN---YPKKIK 466
>gi|170758358|ref|YP_001785560.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum A3 str. Loch Maree] >gi|169405347|gb|ACA53758.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum A3 str. Loch Maree] (509 aa)
Score = 170, Expect = 9.0e-10, Identities = 114/470 (24%), Positives = 205/470 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGD 471
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++   YP   L      +  +PK          +S    +  G   I    L  + + I           NK I+ + K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +     L G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D      +  + ++ VPF++ + D
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNILKK-YPHTQLGAS-GMDVGLPKGQMG------NSEVGHLNIGAGRIVYQALTKITKSISDGDFFENVALNKAIENAKKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMQEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVLDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLIPSPKVATYDMQPEMNAYEVTDKLLERLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLEKDGTAFITADHGNSEEMIDYSTGKPMTAHTTNPVPFMYVSND 473
>gi|167039952|ref|YP_001662937.1| phosphoglyceromutase [Thermoanaerobacter sp. X514] >gi|166854192|gb|ABY92601.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Thermoanaerobacter sp. X514] (514 aa)
Score = 169, Expect = 1.1e-09, Identities = 111/444 (25%), Positives = 186/444 (41%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFT--EASE--YTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           + ++ +G GL+ K +GN +  AN PN+++     YP   LS           +   S    ++     ++Y E      L  + + IK  +    + F   I+   K NSK+ H+F +LS      +  +LF ++ +   +GLK V +H   DG+D  P    + +  F +   +     I T++GR +      RD   +     Y   + G G  A +  EA +  Y+ +     V    IL     +     V   DS++F N  PD    L R          +   +   +F  S+     T+ D  F    V  K E L   L   ++K   K L +    K   +  FF  G    NE   R ++ SP   +      +S+  + D  I  I   +Y  I +          +  L   +  IE  D+ LGR++N  +  G  I +T+ +G AE+M+D
  S:     7 MLVILDGFGLSVKKEGNAVYQANTPNLDFYFKN-YPHTTLSASGLAVGLPEGQMGNSEVGHLNIGAGRIVYQE------LTRISKDIKEGTFFKKKEFLDAIENVKKNNSKL-HLFGLLSDGGVHSHITHLFALMKLAKDQGLKEVYIHAFLDGRDVPPACAKEYIKQFEEESNRIGIGKIATISGRYYAMD---RDKRWDRTKKAYDAIVLGKGVYAHSPMEAIDIAYSKDQTDEFVEPTVILENGKPVAT---VDAGDSIIFFNFRPDRARQLTRAFIDEVFNHFEREKRYLPVFFVSM-----TQYDETFENIHVAYKPERLENTLGEYLSKKGIKQLRIAETEKYAHVTFFFNGGVEEPNEGEERILVPSPKVATYDLKPEMSAYEVTDTVIPKIMSDQYGFILLNFANPDMVGHTGVLNAAIKAIEAIDECLGRIVNAVQSVGGTIIITADHGNAEEMID 452
>gi|91974864|ref|YP_567523.1| phosphoglyceromutase [Rhodopseudomonas palustris BisB5] >gi|91681320|gb|ABE37622.1| phosphoglycerate mutase [Rhodopseudomonas palustris BisB5] (504 aa)
Score = 169, Expect = 1.1e-09, Identities = 89/323 (27%), Positives = 139/323 (43%)
  Q:   142 VLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA----YNTIMDGYFVSKDDSVLFLNSDPDDFAS-LARMMKTS----PKLKGLFLSSLAPI--YGTKLDAVFF-----ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           +L K G+  VLH   DG+D  P S   +++   +  L  N PI TV+GR +   +  R     E V   +  I       F +A        A+ V D  I+PA    Y  + DG      D VL  N   D     LA ++  +    P+ + L +++ A +  Y T LDA+       ++ V G     L  +VA      L +    K   +  F   GE        R ++ SP   +      +S+  L DK + +I  GKYD+I +          +  L   +  +ET D  LGR++   R  G  + +T+ +G  E ML   +   PH   +  P
  S:   136 ILAKAGVPTVLHAFTDGRDTPPKSAVDDIARV-RAELPPNVPIATVSGRYYAMDRDNR----WERVSKAYGVIADADGPRFADADAVVAAGYASGVNDEFIVPAVVGDYQGMRDG------DGVLCFNFRADRVREILATLLDPTFTGFPRKRVLKIAAAAGMTQYSTALDALMRTIFPPQSLVNG-----LGQVVAATGRHQLRMAETEKYPHVTYFLNGGEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVQAIESGKYDMIILNFANPDMVGHTGSLPAAIKAVETVDTQLGRIVAAIRQAGGALLVTADHGNCE-MLRDPVTGGPHTAHTTNP 461
>gi|21227006|ref|NP_632928.1| phosphoglyceromutase [Methanosarcina mazei Go1] >gi|27734310|sp|Q8PYF8|GPMI_METMA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|20905324|gb|AAM30600.1| Phosphoglycerate mutase [Methanosarcina mazei Go1] (521 aa)
Score = 169, Expect = 1.2e-09, Identities = 98/396 (24%), Positives = 180/396 (45%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAK--NDNKVLVLGLNHKKGFINKFFGENTNNENI----TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFT-NGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K N+  +H+  ++S+     +  +L+ +I +  +KGLK V +H+  DG+D  P +   ++     F  + ++  I TV GR +      RD       + Y     G+     ++A    +E       D  I P   T  +G     +   DS++FLN  PD            DF    R  +  PK+  + ++     Y   LD      P+    E L  +++ K  +D  ++ L +   + + +  F  N   E       R ++ SP  ++      +S+  + D+ +  I  GKYDVI +    +     + D +  +  +ET D  +GR++   R  G    +T+ +G AE+M + H    PH  + S+ V  ++T NG++  K +++  L   +  L  L  +    K+   SLI
  S:   113 KLNNSSLHLMGLVSYGGVHSHMTHLYALIKLAQEKGLKKVYIHVFLDGRDVPPKAALGDVKELDAFCKENQSVKIATVQGRYYAMD---RDKRWERTKLAYDALTLGVAPYKTSDAVTAVSEAYERGETDEFIKPTIVTDSEGNPEAVIQDTDSIVFLNFRPDRARQLTWAFVKDDFEGFTR--EKRPKVHYVCMAQ----YDETLDL-----PIAFPPEEL-TDVLGKVLSDRGLIQLRIAETEKYAHVTFFLNGGQEKCYSGEDRCLIPSPKISTYDLKPEMSAYEVTDEVVKRILSGKYDVIILNFANMDMVGHTGDFEAAVKAVETVDNCVGRIVEALRTAGGAALITADHGNAEQMENSHTG-EPHTAHTSNPVKCIYTGNGEV--KALENGKLSDLAPTLLDLLEIPKPEKMTGRSLI 518
>gi|39933417|ref|NP_945693.1| phosphoglyceromutase [Rhodopseudomonas palustris CGA009] >gi|50400329|sp|Q6NCX7|GPMI_RHOPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|39647263|emb|CAE25784.1| phosphoglycerate mutase [Rhodopseudomonas palustris CGA009] (504 aa)
Score = 169, Expect = 1.4e-09, Identities = 91/333 (27%), Positives = 140/333 (42%)
  Q:   142 VLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA----YNTIMDGYFVSKDDSVLFLNSDPDDFAS-LARMMKTS------PKLKGLFLSSLAPIYGTKLDAVFF-----ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPF-VFTNGDLWP 474
           +L K G+K VLH   DG+D  P S   ++    +  L  N PI TV+GR +   +  R     E V   +  I       F +A+    +  A  V D  I+PA    Y  + DG      D VL  N   D     LA ++ ++       ++K +  ++    Y T LDA+       ++ V G     L  +VA      L +    K   +  F   GE        R ++ SP   +      +S+  L DK + +I  GKYD+I +          +  L   +  +ET D  LG ++   R  G  + +T+ +G  E M D      PH   +  P  V   GD  P
  S:   136 ILAKAGVKTVLHAFTDGRDTPPKSAVDDIVRL-RAELPPNVPIATVSGRYYAMDRDNR----WERVSKAYGVIADADGPRFADANAVIADGYAAGVNDEFIVPAVIGDYQGMRDG------DGVLCFNFRADRVREILAALLDSAFAGFPRKQVKQIAAAAGMTQYSTALDALMGTIFPPQSLVNG-----LGQVVADAGLHQLRMAETEKYPHVTYFLNGGEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVAAIESGKYDLIVLNFANPDMVGHTGSLPAAIKAVETVDTQLGHIVAAIRKAGGALLVTADHGNCEMMRDPETG-GPHTAHTTNPVPVLLVGDNGP 472
>gi|170756209|ref|YP_001779860.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum B1 str. Okra] >gi|169121421|gb|ACA45257.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum B1 str. Okra] (509 aa)
Score = 169, Expect = 1.4e-09, Identities = 115/470 (24%), Positives = 209/470 (44%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVK---RDVDSNFYEMLYGETDI--------KTYLELLDEQIKSKS----LHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGD 471
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++                     K YP  +     +D    E   G +++        +   + L +  KS S      N+ + NK I+ + K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   I G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +       G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D      +  + ++ VPF++ + D
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNIL---------------------KKYPHTQLGASGMDVGLPEGQMGNSEVGHLNIGAGRIVYQALTKITKSISDGDFFENVAL-NKAIENAKKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMQEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIILGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLIPSPKVATYDMQPEMNAYEVTDKLLERLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLEKDGTAFITADHGNSEEMIDYSTGKPMTAHTTNPVPFMYVSND 473
>gi|57239242|ref|YP_180378.1| phosphoglyceromutase [Ehrlichia ruminantium str. Welgevonden] >gi|58579204|ref|YP_197416.1| phosphoglyceromutase [Ehrlichia ruminantium str. Welgevonden] >gi|81557299|sp|Q5HB16|GPMI_EHRRW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|57161321|emb|CAH58244.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ehrlichia ruminantium str. Welgevonden] >gi|58417830|emb|CAI27034.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ehrlichia ruminantium str. Welgevonden] (501 aa)
Score = 168, Expect = 1.6e-09, Identities = 95/391 (24%), Positives = 171/391 (43%)
  Q:    88 LDEQIKS--KSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI--YGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQ 478
           ++E+IK+  K+ H LE   ++     K N+ I HI  +LS      +  ++  +I+ L    ++ V+H+  DG+D  P S  K ++     +    N  I T++GR +   +  R  LD      Y     G G++ + +      +N    + D  I+P       G  ++  D  +  N   D    + +M+        + L +   +  Y  +L+    F N    K  + L  +++      L +    K   +  FF  G     EN  R I+ SP+ T+      +S+  + D  I  I   KY +I +          + +++     I T DQ LG+++     T  I+ +T+ +G AE+M D   N+ P+   +L  VPFV  N   +PKK++
  S:    82 INEEIKNIRKNTHLLEFTEQI-----KRNNGICHIAGLLSDGGIHSSLSHMLDIIDALSYLKIQVVIHIFLDGRDTPPISALKYINILCSHIKDLSNVSIATISGRYYSMDRDNR--LDRT-TKAYNSIAFGHGKR-YEDPISAVQDNYNAGITDEFIIPCVIGNYQG--MNPTDGFIMTNFRSDRVIQILKMITEDQNTNHITLKNTIGMIKYSNELNIPCLFPNK---KISNTLGEIISNQQLHQLRIAETEKYAHVTFFFNGGREEVFENEERIIIPSPSVTTYDLVPEMSAYEITDTLIKKINLQKYSLIIINYANADMVGHTGNIEATKKAITTLDQCLGKILKCIHNTNYILVITADHGNAEEMFDVQNNM-PYTAHTLNPVPFVVCN---YPKKIK 466
>gi|182626593|ref|ZP_02954339.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens D str. JGS1721] >gi|177908073|gb|EDT70646.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens D str. JGS1721] (512 aa)
Score = 168, Expect = 1.8e-09, Identities = 114/477 (23%), Positives = 210/477 (44%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE+A + A E   ++  +   D  +LP   T++  DG+ VS+    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + ES    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I+ +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNR----WERVELAYNAMVLGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVSRIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRSESYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLDQDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWISKDAEGKSLK 480
>gi|110801419|ref|YP_695951.1| phosphoglyceromutase [Clostridium perfringens ATCC 13124] >gi|122958895|sp|Q0TQY9|GPMI_CLOP1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|110676066|gb|ABG85053.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens ATCC 13124] (512 aa)
Score = 167, Expect = 2.0e-09, Identities = 113/477 (23%), Positives = 210/477 (44%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE+A + A E   ++  +   D  +LP   T++  DG+ V++    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + ES    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I+ +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFAK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNR----WERVELAYNAMVLGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVARIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLDQDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWVSKDAEGKSLK 480
>gi|42520703|ref|NP_966618.1| phosphoglyceromutase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|99036101|ref|ZP_01315134.1| hypothetical protein Wendoof_01000024 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|50400361|sp|Q73GR4|GPMI_WOLPM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|42410443|gb|AAS14552.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Wolbachia endosymbiont of Drosophila melanogaster] (506 aa)
Score = 167, Expect = 2.1e-09, Identities = 85/361 (23%), Positives = 153/361 (42%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNI-IALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDL 472
           K+ + + HI  ++S      + K++  + N + + G+K V+H   DG+D  P S  K +  F+K +   +T I TV+GR +   +  R     +  ++ +E I          A      N  N + D  I PA   I D   +  +D VL  N   D    LA ++  KT       F S L+ + Y   L   +   P    +   L   +  N  + L +    K   +  FF  G+        R ++ SP   +      +S+  L +K ++ I   ++ +I V          + ++K     +   D  L +++N  + + N  + +T+ +G  E M D+  N  PH   +L  VPF+ +  +L
  S:   104 KSKNGVCHIMGLVSDGGVHSHQKHISTLANKISQHGIKVVIHAFLDGRDTLPNSGKKCIQEFTKSIKGNDTRIATVSGRYYAMDRDNR----WKRTIEAYEAIAFAKAPCHDNAVSLIENNYQNNITDEFIRPA--VIGDYQGIKPEDGVLLANFRADRMIQLASILLGKTDYAKVAKFSSILSMMKYKEDLKIPYIFPPTSFADT--LGQTIEDNKLRQLRIAETEKYAHVTFFFNCGKEEPFSGEERILIPSPKVQTYDLQPEMSAFELTEKLVEKIHSQEFALIVVNYANPDMVGHTGNIKAAEKAVLAVDDCLAKVLNAVKKSSNTALIVTADHGNVECMFDEE-NNTPHTAHTLNKVPFIVSCDNL 465
>gi|163764586|ref|ZP_02171642.1| metal dependent phosphohydrolase [Bacillus selenitireducens MLS10] >gi|160354964|gb|EDP81621.1| metal dependent phosphohydrolase [Bacillus selenitireducens MLS10] (512 aa)
Score = 167, Expect = 2.2e-09, Identities = 97/384 (25%), Positives = 177/384 (46%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG----YFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKG----------LFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN-----------GDLWPKKMQSNFLGV 484
           ++FN+ I      +S + H+F +LS      + K+LF ++ +  KK LK V +H   DG+D  P +    ++   + + +     I T+ GR +   +  R D ++      Y   + G GE  F +A      + A+ V D  +LP   T  DG      +  +D+V+F N  PD    L+++  T+ +  G          LF +SL   Y   ++      P     + +L  +VA      L +    K   +  FF  G     +  TR ++ SP   +      +S+  + D  +  I K  +D+I +          S  L+  +  +ET D+ LG++++L    G    +T+ +G A+ ++D+    +  + ++ VP + T            GDL P  ++   LGV
  S:    95 DVFNQAIQHVEDKDSAL-HLFGLLSDGGVHSHIKHLFALLEMAKKKDLKKVYVHAFLDGRDVGPTTGKTYVAQLEEKMKELGVGEIATLQGRYYAMDRDKRWDRVEKS----YRSMVYGDGEM-FPDALSALESSYASDVHDEFVLPTVMTKEDGKTPVATLEDNDAVIFFNFRPDRAIQLSQVF-TTDEFDGFDRGDKFPRDLFFASLTK-YSDAVNTHIAYPPTS--LDKVLGEVVADAGLNQLRIAETEKYPHVTFFFSGGREQEFKGETRVLIDSPKVATYDLKPEMSAYEVTDALLSEINKDQHDMIILNFANPDMVGHSGMLEPTVKAVETVDECLGKIVDLIHEKGGEAIITADHGNADMLVDEEGGPMTAHTTNPVPVIVTKDGITLREDGVLGDLAPTMLE--LLGV 498
>gi|119473218|ref|ZP_01614904.1| phosphoglyceromutase [Alteromonadales bacterium TW-7] >gi|119444549|gb|EAW25865.1| phosphoglyceromutase [Alteromonadales bacterium TW-7] (514 aa)
Score = 167, Expect = 2.3e-09, Identities = 91/361 (25%), Positives = 149/361 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM----DGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDA--VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD-KHLNIVPHNKSSLVPFVFTNGDLWPKK 476
           K VH+  +LS      +  ++   I +  K+G K V  H   DG+D  P S  +++        K     + T+ GR +   +  R    N     Y     G+GE  F  +   T  N A +  + D   A  TI     +   ++  D+V+F N   D    + R            K SP L    + +    Y   +DA   F   P+     ++L   + K     L +    K   +  FF  G     E  TR+++ SP   +      ++S+ML DK +++I  GKYD I    P       S      +   E  D  +GR+++     G    +T+ +G AE+M + K       + S  VPF++   D  P +
  S:   111 KAVHVMGLLSPGGVHSHEDHIVASIELAAKRGAKEVYFHAFLDGRDTPPRSAKESIERIEALFAKLECGRLATLVGRYYAMDRDNRW---NRVEKAYDVMTSGIGE--FNYSDGVTALNAAYERDENDEFVAPTTITPAGREAAQINDGDTVIFANFRADRAREITRAFVEPEFDGFTKKKSPALSAFVMMTE---YAADIDAPVAFGPTPLT----NVLGEWLEKQGKTQLRISETEKYAHVTFFFSGGREDEFEGETRELIPSPQVATYDLQPEMNSEMLTDKLVEAIKSGKYDAIICNYPNGDMVGHSGVFDAAVKACEAVDTCIGRVVDALNEFGGEALITADHGNAEQMANLKTGQAHTAHTSEPVPFIYVGRDATPSE 482
>gi|110668681|ref|YP_658492.1| phosphoglyceromutase [Haloquadratum walsbyi DSM 16790] >gi|121687191|sp|Q18GK9|GPMI_HALWD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|109626428|emb|CAJ52888.1| phosphoglycerate mutase,2,3-biphosphateglycerate-independent type [Haloquadratum walsbyi DSM 16790] (504 aa)
Score = 166, Expect = 2.6e-09, Identities = 92/391 (23%), Positives = 161/391 (41%)
  Q:    81 IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK---GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKY--DVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +K     +++ I + S       N   + +  TN + VH   +LS        ++L  +I +   + +  + H+  DG+D  P+S  + L+   + +    T  I TV+GR +      RD       M Y   +    E   + A E  +E+      D  I P   T++D     +D D+V   N  PD    L RM+         +T P      L+++A    T      F  PV     ++   L  ++A      L +  + K   +  F   G     E+  R+I+ SP  ++  +  S+SS  + D  I+ I     DV+ +          + D    +  IE+ D  L RL+      G  + +T+ +G A+ M     N    + ++ VP V+T  D
  S:    72 VKQAYTRVEDAIDNGSFQTNAAINAAFNHAVATNGR-VHFMGLLSDGGVHSEQEHLHALIELAGDRNIDAITHVFTDGRDTNPHSSEQYLTTLEEVIHTHGTGDIATVSGRYYAM---DRDKNWTRTRMSYDAIVNRTAEHTTSTALEAVSESYDRGDTDEFIEP---TLIDNTPAVEDGDAVFVFNFRPDRVRQLVRMLADIDPAWSFETDPPTTE--LATMAQYDET------FSLPVAFPPNEQHDTLGEVIATAGLTQLRIAESEKYAHVTYFLNGGREIAFEDERREIIKSPDVSTYDQQPSMSSNEVTDTAIEQINTTDPDVLILNYANPDMVGHTGDFTAAIEAIESVDTQLDRLLETIYAAGGHVIVTADHGNADNM-GTAANPHTAHTTNPVPIVYTRPD 464
>gi|85710826|ref|ZP_01041887.1| Phosphoglyceromutase [Idiomarina baltica OS145] >gi|85695230|gb|EAQ33167.1| Phosphoglyceromutase [Idiomarina baltica OS145] (510 aa)
Score = 166, Expect = 2.6e-09, Identities = 87/405 (21%), Positives = 167/405 (41%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA------DILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           + + IK+    +  +  + ++++   N   VHI  +LS      + ++L  ++ +  KKG + + +H   DG+D  P S   ++  F     +       +++GR +   +  R           +E I G     +   +E+   N  N + DA      D   +   I +   +   D+V F+N   D    + R                +L G  + +    Y  + D      PV+   +++L   +AK+D   L +    K   +  FF  G     +   RK++ SP   +      +SSK L D  ++++   +YDVI    P       + +    +   E  D  +GR++   +  G    +T+ +G AE+M D         + S LVPF++      P+       G+ S +  T+
  S:    84 ISQSIKTGEFFDNPVLTENVEQAVAKNGA-VHIMGLLSAGGVHSHEEHLMAMVELAHKKGAQRIYVHGFLDGRDTPPKSAGPSIEKFEALFERLGVGRFASLSGRFYAMDRDNR-----------WERIEGAFNAVYHGRAEHRANNAHNALADAYERGESDEFVSPVVIGEPAAIEDGDAVFFMNFRADRAREMTRAFIDNELDTFERGIRKQLSGFVMLTQ---YADEFDTPCAFPPVR--LDNVLGEWLAKHDKTQLRISETEKYAHVTFFFSGGREQAFDGEQRKLIPSPKVKTYDLQPEMSSKQLTDAIVEAVDNQEYDVIICNYPNGDMVGHTGNFDAAVKACEAVDHSVGRVVEALQKVGGECLITADHGNAEQMSDPSTGQAHTAHTSELVPFIYVGRHATPRN------GILSDVAPTM 488
>gi|164686789|ref|ZP_02210817.1| hypothetical protein CLOBAR_00384 [Clostridium bartlettii DSM 16795] >gi|164604179|gb|EDQ97644.1| hypothetical protein CLOBAR_00384 [Clostridium bartlettii DSM 16795] (508 aa)
Score = 166, Expect = 2.8e-09, Identities = 118/492 (23%), Positives = 205/492 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNKLIDRSNKTNSK--IVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMD-YFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           MK  +  ++ +G G +    GN +K AN PN++  I   YP  L+                +   DV   D        G T+I     +  +  + +KS+ + + F   +      N+K   +HI  +LS      +  +L  +I +  +KG++ V +H   DG+D  P S           + +       TV GR +   +  R     E V   Y   +CG GE + T ASE   E+      D  I+P    + D   V K    DSV+F N  PD    ++R +    +  G   + +   +   T+ D       +    +SL   L   ++K     L      K   +  FF  G    N+   R+++ SP   +      +S+  L+ K ++ I   KYD I V          +  ++  +  +ET D  +G+L++     G    +T+ +G AE M+D     ++  +  + VPF+    D   K++ ++  G  S I  T+
  S:     1 MKKPVALIIMDGFGESNSTVGNAVKAANTPNLDR-IEKTYPTTLIK---------------ASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIQDGDFFTNEVLNGAMENAKEHALHIMGLLSDGGVHSHIDHLKALIKMAKEKGVERVYVHAFTDGRDTDPQSGLSYAKEIEACMAETGVGQFATVNGRYYAMDRDKR----WERVEKAYKAMVCGEGETS-TSASEAIEESYKKGATDEFIVPTV-IVKDNQPVGKISDGDSVIFFNFRPDRAREISRAI-VDTEFTGFERADIKTFFVCLTEYDVTLPNVKIAFGPQSLSNTLGEYLSKLGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEDRELIPSPKVATYDLQPEMSAPELLAKVMEKIEEDKYDFIVVNFANPDMVGHTGVMEAAVKAVETVDNCVGKLVDKIVEIGGSAIITADHGNAELMVDPETEKVITSHSVNPVPFIVAGKDFLGKELLTD--GRLSDIAPTV 489
>gi|153955988|ref|YP_001396753.1| phosphoglyceromutase [Clostridium kluyveri DSM 555] >gi|189042189|sp|A5N2N6|GPMI_CLOK5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|146348846|gb|EDK35382.1| Hypothetical protein CKL_3379 [Clostridium kluyveri DSM 555] (509 aa)
Score = 166, Expect = 2.8e-09, Identities = 112/468 (23%), Positives = 202/468 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAY--------NTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS-------PKLKGLFLSSLAPIYGTKLDAVF--FENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTN 469
           K  ++ ++ +G G++K   GN +K A KPN++      YP   L            +   S    ++     ++Y        L  + + I        E+ N  +D + K NS + H+  ++S      +  +L  ++ +  +KG   V +H   DG+D  P S    + +  K++ K     I TV+GR +   +  R     E V + Y   + G G +A   ASE    +  N   D  I+P           TI +G      DSV+F N  PD    L R +  +        KL   F++     Y   L+ V+  F N V    ++ L   V+K +   L +    K   +  FF  G    N N  R+++ SP   +      +S++ +    +D +   KYD+I +          +   +     IE  D+ LGR+++        + +T+ +G +E+M+D    N +  + ++ VPF++ +
  S:     3 KKPVMLMILDGFGISKIDNGNAVKAAYKPNLDKYFKK-YPHTELGASGLSVGLPEGQMGNSEVGHLNIGAGRIVY------QALTRITKSINEGQFFKNEVLNSAVDNAVKNNSDL-HLLGLVSPGGVHSHTNHLKGLLQLAKQKGASRVYIHAFTDGRDVPPSSAYMYIDDMEKYIQKIGIGKIATVSGRYYAMDRDKR----WERVELAYNALVYGRGNKA-ASASEAVTNSYDNGKTDEFIVPTVIEEDNKPVTTIKNG------DSVIFFNFRPDRARQLTRALNDNIFKGFKREKLDLKFVTMTE--YDATLENVYVAFNNEVY---KNTLGEYVSKMEKSQLRIAETEKYAHVTFFFNGGVEAPNRNEDRELIPSPKVATYDLKPEMSAREVTSTVLDRLDQDKYDMIILNFANPDMVGHTGIFQAAKKAIEVVDECLGRIVSKILEKNGTVFITADHGNSEQMVDYSTGNPMTAHTTNSVPFLYVS 471
>gi|169343212|ref|ZP_02864227.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens C str. JGS1495] >gi|169298671|gb|EDS80750.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens C str. JGS1495] (512 aa)
Score = 166, Expect = 2.9e-09, Identities = 115/477 (24%), Positives = 209/477 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   I G GE+A + A E   ++  +   D  +LP   T++  DG+ VS+    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + ES    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I  +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNR----WERVELAYNAMILGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVSRIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLDEDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWISKDAEGKSLK 480
>gi|78777811|ref|YP_394126.1| phosphoglyceromutase [Sulfurimonas denitrificans DSM 1251] >gi|123549864|sp|Q30Q40|GPMI_SULDN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|78498351|gb|ABB44891.1| phosphoglycerate mutase [Sulfurimonas denitrificans DSM 1251] (491 aa)
Score = 166, Expect = 3.1e-09, Identities = 113/463 (24%), Positives = 196/463 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSS-------LAPIYGTKLDAVFFENPVKGKEES---LLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLV 463
           M    I ++T+GIG +   + N    A KP  + L S   P + +            +   S    +      +LY +  +K  L L + + +       E F +L+ +S++     +H+  ++S      +  +   + ++  K+G +  LHLI DG+D  P S  K L+   K  L  N  I TV+GR +   +  R     E V   +E I     +     SEY + + A    D  I P      DGY  +S +DSVL +N   D      RM + +  +     SS       L     T+ D   F  PV  K++S    L+ +++    + L      K   +  FF  G +   EN TR ++ SP   +  E   +S+K + +  +  + + YD I V          + +L+     + T D  LG+++   +     + +TS +G  E+M D   NI+ ++ +  V
  S:     1 MAKKAILVITDGIGYSSGMEYNAFYNAQKPTYDKLFSNT-PHSFIETHGLSVGLPEGQMGNSEVGHMSMGSGRVLYQDL-VKISLSLSENRFRDN-----EAFRELLAKSSR-----LHLIGLMSDGGVHSHIDHFMGIADIAAKEGKEVFLHLITDGRDVSPTSAKKYLAQVEKH-LGANIKIATVSGRFYSMDRDNR----WERVQKGYEAIVKAEPKTTLNPSEYIDASYAKNETDEFIEP---IAFDGYDGMSDNDSVLMINFRSD------RMREITTAIGESNFSSFEKSDIKLHVATITEYDKN-FSYPVLFKKDSPKNTLSEVISSAGLRQLHTAETEKYAHVTFFFNGGIDEPYENETRVLIPSPNVRTYDEKPQMSAKEVGEVVLKGMDEAYDFIVVNFANGDMVGHTGNLEAAKIAVNTVDSELGKILQKAKEMDYSVLITSDHGNCEEMRDDDGNILTNHTAGKV 450
>gi|187777183|ref|ZP_02993656.1| hypothetical protein CLOSPO_00729 [Clostridium sporogenes ATCC 15579] >gi|187774111|gb|EDU37913.1| hypothetical protein CLOSPO_00729 [Clostridium sporogenes ATCC 15579] (509 aa)
Score = 165, Expect = 3.5e-09, Identities = 109/470 (23%), Positives = 202/470 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGD 471
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++   YP+  L            +   S    ++     ++Y        L  + + I           NK I+ + K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+    A E   ++  +   D  +LPA   + +G   +K    DSV+F N  PD    L R +       G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D      +  + ++ VPF++ + +
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNILKK-YPYTQLGASGMEVGLPEGQMGNSEVGHLNIGAGRIVY------QALTKITKSISDGDFFENAALNKAIENARKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMKEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEV-NSAVEGLEKSYRDNKTDEFVLPAV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNSKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLVPSPKVATYDMQPEMNAYEVTDKLLEKLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKILEKDGTAFITADHGNSEEMIDYSTGKPMTAHTTNPVPFMYVSNN 473
>gi|167461758|ref|ZP_02326847.1| phosphoglyceromutase [Paenibacillus larvae subsp. larvae BRL-230010] (512 aa)
Score = 165, Expect = 3.9e-09, Identities = 96/375 (25%), Positives = 169/375 (45%)
  Q:    94 SKSLHNLEIFNKLIDRSN----KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-----PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-----FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG----KEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           +KS+   E F+    R+     K + K +H++ +LS      +  ++F ++ +  K+GLK V  H   DG+D  P S  K    + + LL + T      + TV GR +   +  R     E V   Y   + G G + +T+  E   E+    V D  ++P    I+D        V   DSV+F N  PD    L+++ K     +G      AP     +    F   V G    K + L   L  +V++N  K L +    K   +  FF  G +      TR ++ SP   +      +S+  +    +  I   K+D+I +          S  L+  +  IE  D+ LG+++      G +  +T+ +G A+ ++D +   +  + ++ VPF+ T
  S:    84 TKSIREGEFFHNDTLRAAVLHAKEHGKKLHVYGLLSDGGVHSHISHMFAMLEMAKKEGLKDVYFHAFLDGRDVAPDSAGK----YMEMLLNKITETGLGKVATVQGRYYAMDRDKR----WERVEKSYRAMVYGEGPK-YTDPMEAIKESYLKSVYDEFVMPT--VIVDEAGKPVGLVEDGDSVVFCNFRPDRAIQLSQVFKNK-DFRGFDRGDKAPKNLHFVCLTLFSETVDGYVAYKPKDLDNTLGEVVSQNGLKQLRIAETEKYPHVTFFFSGGRDIELPGETRVLIPSPKVATYDLKPEMSAYEVAAAAVKEINEDKHDMIILNFANPDMVGHSGMLEPTVKAIEATDECLGQVVEAILAKGGVACITADHGNADIVIDDNERPMTAHTTNPVPFIVT 473
>gi|147679055|ref|YP_001213270.1| phosphoglyceromutase [Pelotomaculum thermopropionicum SI] >gi|146275152|dbj|BAF60901.1| phosphoglyceromutase [Pelotomaculum thermopropionicum SI] (545 aa)
Score = 165, Expect = 4.0e-09, Identities = 108/467 (23%), Positives = 200/467 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-----FVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           L+ +V +G GL+   +GN + LA+ PN    ++G YP   LS   +       +   S    ++     ++Y E      L  +   IK  +    E+  + + R  + N+K +H+  +LS      +  +LF ++++  ++ ++ V +H   DG+D  P +  +      K L +     + TV GR +      RD   +     Y   + G G QA T   E  +        D  I P    +++G       + K D+V+F N  PD            DF   AR  +  P +    ++    +Y   + A     PV  + + L   L  +++++    L L    K   +  FF  G         R ++ SP   +      +S+  +    ++ +  GKYDVI +          + D+K  +  IET D+ LG++          + +T+ +G A++M+D+       + +S VPF+    D
  S:    19 LVLVVLDGWGLSSNVRGNAIALASTPNFKSFLAG-YPHCALSCSGEDVGLPEGQMGNSEVGHLNIGAGRVVYQE------LTRISRAIKDGTFFKNEVLLEAV-RYARENNKALHLMGLLSDGGVHSHISHLFALLDLAARENMRNVFVHAFLDGRDVPPANAKEYFEQLRKKLGELGFGAVATVMGRYYAM---DRDRRWDRTERAYNAMVLGEGIQA-TSPLEAVDLGYGRDETDEFIQP--TVVVNGSGGPAAKIMKGDAVIFFNFRPDRARQITRAFVDEDFTGFAR-KQGYPAVHFTCMT----LYDKTIKA-----PVAFQPQELRNTLGEVLSRHGMTQLRLAETEKYAHVTFFFNGGLEKPYPGEDRILVPSPRVATYDLKPEMSANEVTGTFLERLASGKYDVIIMNYANPDMVGHTGDMKATVKAIETIDRCLGKVARAVLEKDGTLLITADHGNADEMVDEEGQPHTAHTTSPVPFILIGRD 487
>gi|153938319|ref|YP_001389592.1| phosphoglyceromutase [Clostridium botulinum F str. Langeland] >gi|166991377|sp|A7G9Y2|GPMI_CLOBL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|152934215|gb|ABS39713.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum F str. Langeland] (509 aa)
Score = 165, Expect = 4.0e-09, Identities = 114/470 (24%), Positives = 209/470 (44%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVK---RDVDSNFYEMLYGETDI--------KTYLELLDEQIKSKS----LHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGD 471
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++                     K YP  +     +D    E   G +++        +   + L +  KS S      N+ + NK I+ + K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +       G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D      +  + ++ VPF++ + D
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNIL---------------------KKYPHTQLGASGMDVGLPEGQMGNSEVGHLNIGAGRIVYQALTKITKSISDGDFFENVAL-NKAIENAKKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIEIYMQEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLIPSPKVATYDMQPEMNAYEVTDKLLERLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLEKDGTAFITADHGNSEEMIDYSTGKPMTAHTTNPVPFMYVSND 473
>gi|153951697|ref|YP_001398523.1| phosphoglyceromutase [Campylobacter jejuni subsp. doylei 269.97] >gi|166991374|sp|A7H4U3|GPMI_CAMJD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|152939143|gb|ABS43884.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. doylei 269.97] (492 aa)
Score = 164, Expect = 4.5e-09, Identities = 118/493 (23%), Positives = 198/493 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPK-KMQSNFLGVYSSILSTLD 493
           MK   + ++T+GIG NK  K N  + A KP+   L   + P +LL         +P+          +S    M  G   I    L  +++ IK+K L   E   KL+ +  +     VHI  + S         +   ++ +  K G +   H I DG+D  P S    + +   F         T+ GR +   +  R     + V +Y+E + G   +      EY  ++    + D  I    N    G  + ++D ++F+N   D    L  ++ +      + + +F + L   +Y  K    V FE   K K E+ LA +++K     L      K   +  FF  G+    EN TR ++SSP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG ++   +       +TS +G  E M D+  N++  N ++   FVF       K K       + +S+L  LD
  S:     1 MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRIIYQNLVRINKAIKNKELEKNENLQKLLAKCKR-----VHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVSPKSGLNFIKDLKGFCENLGVHFATLCGRFYSMDRDKR----WDRVKEYYECLLGKAYKV-PNLLEYLQKSYDENITDEFIKATQNENYKG--MREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKVFENLLTMSVYDDKFKLPVLFE---KEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENETRVLISSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIVECAKKHDYAFIITSDHGNCEAMQDEKGNLLT-NHTTFDVFVFVQASGVSKIKANMGLSNIAASVLKILD 480
>gi|192288774|ref|YP_001989379.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Rhodopseudomonas palustris TIE-1] >gi|192282523|gb|ACE98903.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Rhodopseudomonas palustris TIE-1] (504 aa)
Score = 164, Expect = 4.8e-09, Identities = 91/333 (27%), Positives = 132/333 (39%)
  Q:   142 VLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA----YNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI--------YGTKLDAVFF-----ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPF-VFTNGDLWP 474
           +L K G+K VLH   DG+D  P S   ++    +  L  N PI TV+GR +   +  R     E V   +  I       F  A     +  A  V D  I+PA    Y  + DG      D VL  N   D    +   +   P   G     +  I        Y T LDA+       ++ V G     L  +VA      L +    K   +  F   GE        R ++ SP   +      +S+  L DK + +I  GKYD+I +          +  L   +  +ET D  LG ++   R  G  + +T+ +G  E M D      PH   +  P  V   GD  P
  S:   136 ILTKAGVKTVLHAFTDGRDTPPKSAVDDIVRL-RAELPPNVPIATVSGRYYAMDRDNR----WERVSKAYGVIADADGPRFANADAVIADGYAAGVNDEFIVPAVVGDYQGMRDG------DGVLCFNFRADRVREILAAL-LDPAFAGFPRKQVKQIAAAAGMTQYSTALDALMGTIFPPQSLVNG-----LGQVVADAGLHQLRMAETEKYPHVTYFLNGGEEVPYPGEDRIMVPSPKVATYDLQPEMSAPELGDKAVAAIESGKYDLIVLNFANPDMVGHTGSLPAAIKAVETVDTQLGHIVAAIRKAGGALLVTADHGNCEMMRDPETG-GPHTAHTTNPVPVLLVGDNGP 472
>gi|88858429|ref|ZP_01133071.1| phosphoglycerate mutase III, cofactor-independent [Pseudoalteromonas tunicata D2] >gi|88820046|gb|EAR29859.1| phosphoglycerate mutase III, cofactor-independent [Pseudoalteromonas tunicata D2] (514 aa)
Score = 164, Expect = 4.8e-09, Identities = 95/365 (26%), Positives = 158/365 (43%)
  Q:   103 FNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTE-----------ASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEE-------SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           F   ID++ K N+K VH+  +LS      +  ++   I +  K+G K V LH   DG+D  P S  +++      F++    R   I ++ GR +         +D ++  D  E    L  QA  E           A+   NEN    V    I PA     D   ++  D+VLFLN   D    ++R+        G F+   AP     +    +   +            ++L   +AK++   L +    K   +  FF  G     E   R ++ SP   +      ++S+ML DK +++I  G++DVI    P       S      +   E  D  +GR+I     TG    +T+ +G AE+M ++        + S  VPF++
  S:    99 FVNAIDQAVK-NNKAVHLMGLLSPGGVHSHVDHILATIELAAKRGAKAVYLHAFLDGRDTAPRSAQESIDLVDKKFNELQCGR---IASLIGRYYA--------MDRDNRWDRVEKAYNLMTQASAEYHFNDATSALKAAYNRNEN-DEFVAATSITPAKQ---DTAQINDGDAVLFLNFRADRARQMSRVF-VDKNFDG-FVKQKAPELAAFVTMTEYAKDIPAPSAFPSVALTNVLGEWLAKHNKTQLRISETEKYAHVTFFFSGGREALFEGEDRILIPSPQVATYDLQPEMNSEMLTDKLVEAIHAGQHDVIICNYPNGDMVGHSGVFSAAVKACEAVDHCIGRVIEALTQTGGEALITADHGNAEQMQNEETGQAHTAHTSEPVPFIY 473
>gi|158520110|ref|YP_001527980.1| phosphoglyceromutase [Desulfococcus oleovorans Hxd3] >gi|158508936|gb|ABW65903.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Desulfococcus oleovorans Hxd3] (511 aa)
Score = 164, Expect = 5.1e-09, Identities = 103/464 (22%), Positives = 195/464 (42%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKR-NTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAY--NTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLS-----SLAPIYGTKLDAVFFENPVKGKEES---LLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG------KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN 469
           + ++ +G GLN + KGN +  A  P+++ L S  YP   L    +     P     S    ++     ++Y E      L  ++  I+  S     +  +L+D+  K   ++ H+  +LS      +  +L  ++ +   K L  ++H I DG+D  P S    +++  +FL    +  + TV GR   F    RD   +     Y     G G +     +   N  L  +  D  + P    +   DG  V+ +D +LF N   D    + R   T P     F +     ++AP     L    F  PV    E+    L  ++++     L +    K   +  FF  G  T      RK++ SP    +   + +  +M   +  +++       KYD I V    +     +      ++  ET D  +G++I L   +G ++ +T+ +G +E+M D++ +    + ++ VP +  +
  S:     9 MLMILDGWGLNPETKGNAVAAARTPHLDRLFSE-YPHTRLVCSGEAVGLPPGYMGNSEVGHLNIGAGRVVYQE------LMRINVAIQDGSFFKNTVIVQLMDQVTKKQGRL-HLIGLLSDGGVHSHLDHLKALVRMASNKNLPVLIHTILDGRDTPPDSGKTYMADLCEFLADYPSASVATVCGR---FYAMDRDTRWDRTKKAYDLYTLGEGTRESDPVTAVKNAYLRGET-DEFVTPVIIASGSQDGGTVADNDGILFFNFRADRMREIVRAF-TDPDFS--FFNRKKTPAVAPPVCMTLYDKTFPLPVAFPPENPPNTLGEVISRQGYSQLRIAETEKYAHVTYFFNGGVETPFTGEDRKLIPSP---REVATYDMKPEMSAPQVANTLAEEIIKQKYDFIVVNFANMDMVGHTGIFAAAVAACETVDACIGKIIPLFLKSGGVVLVTADHGNSEQMEDQNGHPFTAHTTNPVPLILVD 473
>gi|168185506|ref|ZP_02620141.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum C str. Eklund] >gi|169296488|gb|EDS78621.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum C str. Eklund] (511 aa)
Score = 163, Expect = 5.6e-09, Identities = 115/491 (23%), Positives = 214/491 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVS---KDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD-KHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K  ++  + +G+GL+    GN   LA KPN++ +    YP  +L            +   S    ++     ++Y        L  + + I+   +   E   K I  + K N   +H   +LS      + ++L  +I+   K G+K V +H   DG+D  P S    + +  K + +     I TV+GR +   +  R     E + + Y   + G GE A T   E   ++  +   D  +LP   T++  DG  V+    +DSV+F N  PD    + R +       G    +L  ++   T+ D+      V  K ES    L   V+    K L +    K   +  FF  G    N+N  R ++ SP   +      +S+  + D+ +  I   +YD+I +          +  ++  +  +ET D+ LG++++        + +T+ +G  E+M+D  + N +  + ++LVPF +   D   K+++    G+ + I  T+
  S:     3 KKPVMLAILDGLGLSDHKDGNAFSLAKKPNLDKIFKE-YPHTVLGASGLSVGLPDGQMGNSEVGHLNIGAGRVVY------QALTRITKAIEDGDILKNEALIKAIGNA-KNNDSALHFMGLLSDGGVHSHIEHLKGLIDFAAKSGVKKVYIHAFLDGRDTAPKSALTYIEDLEKHMKEIGVGSIATVSGRYYAMDRDKR----WERIELAYNAMVLGKGEVA-TSPKEAVEKSYHDNKTDEFVLP---TVIEKDGKPVATIKNNDSVVFFNFRPDRARQITRAI-NDKVFDGFKRETLNLVFVTMTEYDSTIEGVEVAFKPESYVNTLGEYVSAQGKKQLRIAETEKYAHVTFFFNGGVEEPNKNEDRALIPSPKVATYDLKPEMSAYEVTDEVLKRIDSDEYDMIILNYANPDMVGHTGVVEAAVKAVETVDECLGKVMDKILEKNGALFITADHGNCEQMIDYSNGNPMTAHTTNLVPFAYIANDAKEKELREE--GILADIAPTM 492
>gi|160892542|ref|ZP_02073332.1| hypothetical protein CLOL250_00071 [Clostridium sp. L2-50] >gi|156865583|gb|EDO59014.1| hypothetical protein CLOL250_00071 [Clostridium sp. L2-50] (514 aa)
Score = 163, Expect = 5.9e-09, Identities = 113/470 (24%), Positives = 201/470 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFN-----KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMMKTSP-----KLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGD 471
           K  ++ +V +G G++ K +GN + LAN P ++ L                     K  YP VK           D        G  +I     +  E  + +KS+ + E F+     + I+   K NS + H++ +LS      +  +L+ ++ +  K+  + V +H   DG+D  P S    L      + K     + +++GR +   +  R D ++    + Y   + G G QA  +       +   +V D  ILP   T  +G     V  +DSV+F N  PD    + R           +  G F   L  +     D       V  K+E +       +A N    + L    K   +  FF  G    N+   R ++ SPA  +      +S+  + +K +D+IG  KYDVI +          +  +   +  +ET D  +G+ +   +    ++ + + +G AE+M++      PH  + ++ VPFV  N D
  S:     3 KKPVVLMVLDGYGISDKTEGNAIALANTPVMDKL---------------------KAEYPYVKGAASGLAVGLPDGQMGNSEVGHMNIGAGRIIYQELTRITKSIQDGEFFDNAEMLEAIENCKKNNSDL-HVWGLLSSGGVHSHNTHLYAILELCKKQNFENVYVHPFFDGRDTAPASGKGFLEELIAEMKKIGVGKVASLSGRYYAMDRDNRWDRVE----LAYKSLVTGEGVQA-EDPVAAVQASYDKEVYDEFILPTVIT-ENGKPVSLVKPNDSVIFFNFRPDRAREITRAFCCDDFDGFNRPNGRF--PLVYVCFKDYDESIPNKIVAFKKEEIDNTFGEYLAANGKTQVRLAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPAVATYDLQPEMSAPEVCEKLVDAIGSDKYDVIIINFANPDMVGHTGVIPAAIKAVETVDACVGKAVEAVKKADGVLFICADHGNAEQMINYETG-EPHTAHTTNPVPFVLVNYD 475
>gi|168211755|ref|ZP_02637380.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens B str. ATCC 3626] >gi|168215119|ref|ZP_02640744.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens CPE str. F4969] >gi|168218202|ref|ZP_02643827.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens NCTC 8239] >gi|170710287|gb|EDT22469.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens B str. ATCC 3626] >gi|170713458|gb|EDT25640.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens CPE str. F4969] >gi|182379791|gb|EDT77270.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens NCTC 8239] (512 aa)
Score = 163, Expect = 6.0e-09, Identities = 113/477 (23%), Positives = 209/477 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE+A + A E   ++  +   D  +LP   T++  DG+ V++    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + ES    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I  +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNR----WERVELAYNAMVLGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVARIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVAAKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLDQDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWISKDAEGKSLK 480
>gi|58698327|ref|ZP_00373243.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535151|gb|EAL59234.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Wolbachia endosymbiont of Drosophila ananassae] (506 aa)
Score = 163, Expect = 6.0e-09, Identities = 85/361 (23%), Positives = 153/361 (42%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNI-IALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDL 472
           K+ + + HI  ++S      + K++  + N + + G+K V+H   DG+D  P S  K +  F K +   +  I TV+GR +   +  R     E  ++ +E I          A    +EN  N + D  I PA   I D   +  +D VL  N   D    LA ++  KT       F S L+ + Y   L   +   P    +   L   +  N  + L +    K   +  FF  G+        R ++ SP   +      +S+  L +K ++ I   ++ +I V          + ++K     +   D  L ++++  + + N  + +T+ +G  E M D+  N  PH   +L  VPF+ +  +L
  S:   104 KSKNGVCHIMGLVSDGGVHSHQKHISTLANKISQHGIKVVIHAFLDGRDTLPNSGKKCIQEFIKSIKGNDIRIATVSGRYYAMDRDNR----WERTIEAYEAIAFAKAPRHDNAVSLIDENYQNNITDEFIRPA--VIGDYQGIKPEDGVLLANFRADRMIQLASILLGKTDYAKVAKFSSILSMMKYKKDLQIPYIFPPTSFADT--LGQTIEDNKLQQLRIAETEKYAHVTFFFNCGKEEPFSGEERILIPSPKVQTYDLQPEMSAFELTEKLVEKIHSQEFALIVVNYANPDMVGHTGNIKAAEKAVLAVDDCLAKVLSAVKKSSNTALIVTADHGNVECMFDEE-NNTPHTAHTLNKVPFIVSCDNL 465
>gi|158320008|ref|YP_001512515.1| phosphoglyceromutase [Alkaliphilus oremlandii OhILAs] >gi|158140207|gb|ABW18519.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Alkaliphilus oremlandii OhILAs] (511 aa)
Score = 163, Expect = 7.1e-09, Identities = 114/472 (24%), Positives = 201/472 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAY--NTIMDGYFVSKDDSVLFLNSDPDDFASLARMM-----KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKH--LNIVPHNKSSLVPFVFTNGDL 472
           MK  +  ++ +G G+ +   GN +K AN PN N  I   YP   ++         P +   S    ++     ++Y E      L  +  +I+  + +   +F ++I  S K   K +H+  +LS      + ++LF +I +  ++GL+ V +H   DG+D  P S  + +S+    + +     I TV+GR +   +  R     E V + Y   + G G  A ++  +          MD  +LP    N   D   +  +D V+F N  PD    + R +     +   + KG F   L  +  T  D    +N     E  LL N     ++K     L +    K   +  FF  G    N N  R ++ SP   +      +S+  L ++ I+ I   +YD+I V          +  L  ++  +ET D  L  ++N     G    +TS +G +E M+++     I  H  + +   V   GD+
  S:     1 MKKPVALIILDGFGIRENQFGNAIKTANLPNYNSYIEN-YPNTQIAASGLDVGLPPGQMGNSEVGHLNIGAGRVVYQE------LTRITREIELGNFYKNPVFLEIIS-SVKKKGKKLHLMGLLSDGGVHSHMEHLFALIEIAKQEGLEEVYIHCFLDGRDTPPKSAMQYISDLQDKINEIGVGRIATVSGRYYAMDRDKR----WERVKLAYDALVLGKGLVA-SDPLDAVVSAYNRDEMDEFVLPTVIPNEKGDSDRIEAEDGVIFFNFRPDRARQITRALVDQDFQGFEREKGYF--PLDYVTMTVYDNA-IQNVKVAYEPHLLRNTLGEYISKKGLNQLRIAETEKYAHVTFFFNGGIEVPNVNEQRLLIPSPQVATYDLQPEMSAYELTNQLIEKIDEDQYDLIIVNYANPDMVGHTGKLDAVVKALETVDTCLATVVNKLVSKGGSAIITSDHGNSEDMINEENGTAITAHTTNPVPLIVIGQGDI 476
>gi|57237489|ref|YP_178503.1| phosphoglyceromutase [Campylobacter jejuni RM1221] >gi|81557570|sp|Q5HW32|GPMI_CAMJR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|57166293|gb|AAW35072.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni RM1221] (492 aa)
Score = 162, Expect = 7.3e-09, Identities = 121/498 (24%), Positives = 202/498 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTE 498
           MK   + ++T+GIG NK  K N  + A KP+   L   + P +LL         +P+          +S    M  G   I    L  +++ I++K L   E   KL+ +  +     VHI  + S         +   ++ +  K G +   H I DG+D  P S    + +   F         T+ GR +   +  R     + V +Y+E + G   +      EY  ++    V D  I  A N    G  + ++D ++F+N   D    L  ++ +      + + +F + L   +Y  K    V FE   K K E+ LA +++K     L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG +I   +       +TS +G  E M D+  N++  N ++   FVF        K++ N +G+ +   S L  LD E
  S:     1 MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLQKLLAKCKR-----VHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVSPKSGLNFIKDLKGFCENLGVHFATLCGRFYAMDRDKR----WDRVKEYYECLLGKAYKV-PNLLEYLQKSYDENVTDEFIKAAQNENYKG--MREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSVYDDKFKLPVLFE---KEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENETRVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIIECAKKHDYAFIITSDHGNCEAMQDEKGNLLT-NHTTFDVFVFVQAK-GVSKIKDN-MGLSNIAASVLKILDLE 482
>gi|148925817|ref|ZP_01809504.1| phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni CG8486] >gi|145844803|gb|EDK21907.1| phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni CG8486] (492 aa)
Score = 162, Expect = 7.8e-09, Identities = 121/498 (24%), Positives = 203/498 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTE 498
           MK   + ++T+GIG NK  K N  + A KP+   L   + P +LL         +P+          +S    M  G   I    L  +++ I++K L   E   KL+ +  +     VHI  + S         +   ++ +  K G +   H I DG+D  P S    + +  +F         T+ GR +   +  R     + V +Y+E + G   +      EY  ++    V D  I  A N    G  + ++D ++F+N   D    L  ++ +      + + +F + L   +Y  K    V FE   K K E+ LA +++K     L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG +I   +       +TS +G  E M D+  N++  N ++   FVF        K++ N +G+ +   S L  LD E
  S:     1 MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLQKLLAKCKR-----VHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVSPKSGLNFIKDLKEFCENLGVHFATLCGRFYAMDRDKR----WDRVKEYYECLLGKAYKV-PNLLEYLQKSYDENVTDEFIKAAQNENYKG--MREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSVYDDKFKLPVLFE---KEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENETRVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIAVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIIECAKKHDYAFIITSDHGNCEAMQDEKGNLLT-NHTTFDVFVFVQAK-GVSKIKDN-MGLSNIAASVLKILDLE 482
>gi|157414729|ref|YP_001481985.1| phosphoglyceromutase [Campylobacter jejuni subsp. jejuni 81116] >gi|172047065|sp|A8FKM1|GPMI_CAMJ8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|157385693|gb|ABV52008.1| phosphoglyceromutase [Campylobacter jejuni subsp. jejuni 81116] (492 aa)
Score = 162, Expect = 8.5e-09, Identities = 120/498 (24%), Positives = 203/498 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTE 498
           MK   + ++T+GIG NK  K N  + A KP+   L   + P +LL         +P+          +S    M  G   I    L  +++ I++K L   E   KL+ +  +     VHI  + S         +   ++ +  K G +   H I DG+D  P S    + +  +F         T+ GR +   +  R     + V +Y+E + G   +      EY  ++    V D  I  A N    G  + ++D ++F+N   D    L  ++ +      + + +F + L   +Y  K    V FE   K K E+ LA +++K     L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG ++   +       +TS +G  E M D+  N++  N ++   FVF        K++ N +G+ +   S L  LD E
  S:     1 MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLQKLLAKCKR-----VHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVSPKSGLNFIKDLKEFCENLGVHFATLCGRFYAMDRDKR----WDRVKEYYECLLGKAYKV-PNLLEYLQKSYDENVTDEFIKAAQNENYKG--MREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSVYDDKFKLPVLFE---KEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENETRVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIVECAKKHDYAFIITSDHGNCEAMQDEKGNLLT-NHTTFDVFVFVQAK-GVSKIKDN-MGLSNIAASVLKILDLE 482
>gi|187251745|ref|YP_001876227.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Elusimicrobium minutum Pei191] >gi|186971905|gb|ACC98890.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Elusimicrobium minutum Pei191] (518 aa)
Score = 162, Expect = 8.7e-09, Identities = 125/499 (25%), Positives = 213/499 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNEN----LANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTS--PKLKGLFLSSLAPIYGTKLDAVFFENPVK----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGEN-----TNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNI-VPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILST-LDSLDTEH 499
           MK  ++ +V +G G  ++ K N ++ A  PNI   +   YP   L         +P     S     +     M  G   ++  L+ L + I+  SL N + F   ID + + NS + H+  ++       +  +LF +I    KKG+K + +H  ADG+D  P S   F + L   +K        I TV GR +   +     L ++      E       ++  EA + + +        ++ D  + PA   +++GY  +KD DSV+F N   D    L R    +  P  +  F+  +        DA  F         G   +LL  ++A N    L +    K   +  FF           + I  K    PA  +  E+  + + ++ D+T+  I   KYD I   F  C M+     + ++K ++  +E  D+  G++       G  + +T+ +G AE M D   N+    +  SLV  ++ + D    K++   LG    I  T LD L  E 
  S:     1 MKKKVMLVVRDGWGKREEVKYNAVRQAKTPNITSYLEN-YPSTFLEAAGVMVG-LPAGYMGSS----EVGHLNMGAGRIVVQE-LKRLKDTIEDGSLFNAKPFKACIDNAAQNNSAL-HLMGLVQDEGVHAHQDHLFAIIEHAAKKGVKTIYVHFFADGRDTPPRSSIGFVRELE--AKIKEYGAGQIATVMGRYYAMDRSEDWNLTDKAYALITEGKAVRSAKSAEEAVQISYDTDKTPDGTEMTDEYVAPA---VINGYKGAKDGDSVIFFNFRQDRAIQLTRAFIDADYPGKREKFVKVVFCGLTKYYDAFEFNALPSMTDGGSMNNLLGQVLADNGKTQLRIAETQKFKHVTSFFNGKLIKPFKGEDRIELKGRFDPATFA--EHPEMEAYLVADETVKQINSDKYDFILVNFANCDMVGH---TGNMKSVIKAVEVVDECTGKITKAALDKGYTVLITADHGNAETMWDVKTNMPKTAHTCSLVELIYVSKDAENIKLEE--LGCLGDIAPTILDILGVEQ 506
>gi|167626394|ref|YP_001676894.1| phosphoglyceromutase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189042196|sp|B0TYM8|GPMI_FRAP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|167596395|gb|ABZ86393.1| Phosphoglycerate mutase [Francisella philomiragia subsp. philomiragia ATCC 25017] (512 aa)
Score = 161, Expect = 9.8e-09, Identities = 119/467 (25%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLDA-VFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G ++    N +K AN P  + +    +P  L+S           +   S    V+     ++Y E      L  +D+ I+ K+  N +     ID   + +S + H+  +LS      + +++F +I +  +KG+K V LH   DG+D  P S   ++      L K N   I +V+GR +   +  R D ++      Y   +    E     A E   E+ A    D  ++P      DG    V  +DSV+F+N   D    ++           PK + L ++ +    Y +KL   V F  E PV     + L  ++ KN    L +    K   +  FF  G+    E   R ++ SP   +      +S+  + DK +D+I  GKYD I            + + +  +  IE  D+ L RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPFV+
  S:     1 MKKTTLLVILDGWGYSESDYFNAIKNANTPTWDSIWQD-FPRTLISASSLEVGLPRGQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGNNKAICDAIDNVIQKDSNL-HLMGLLSPGGVHSHEEHIFEMIKIAKQKGVKRVYLHAFLDGRDTPPRSAESSIKKTDDLLQKLNLGYIASVSGRYYAMDRDNRWDRVEKA----YNAIVNADAEFVCNSALEALEESYARDQSDEFVIPTC-IQKDGKLIKVEDNDSVIFMNFRADRAREISHAFTDENFDHFPKDRHLNINFTTLTEYDSKLKCNVAFPPEQPV-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGKEDQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVDAINNGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCLARLKDAILEHDGNMF-ITADHGNADMMVNPKTQ-KPHTAHTTNLVPFVY 468
>gi|119513494|ref|ZP_01632517.1| phosphoglyceromutase [Nodularia spumigena CCY9414] >gi|119461853|gb|EAW42867.1| phosphoglyceromutase [Nodularia spumigena CCY9414] (532 aa)
Score = 161, Expect = 9.8e-09, Identities = 87/367 (23%), Positives = 157/367 (42%)
  Q:   105 KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFT----EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEES-----LLANMVAKNDNKVLVLGLNHKKGFINKFFG----ENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K+       N K+ H+  + S      +  +LF ++++  ++ +  V +H I DG+D  P    K +      + ++    IVT++GR +         +D +H  D  +    +  Q       +A E    + A  V D  I P    I  G  +   D V+F N  PD    L +    SP+  G     + P+          E PV    E+     +L  ++A N  +        K   +  FF     E    E+  R+++SSP   +  +  ++S++ + D  I +I  G Y ++ +          +  ++  ++ IET D  LGRL+      G    +T+ +G AE MLD+  N    + ++ VPF+   G+
  S:   102 KICQEVRSGNGKL-HLVGLCSEGGVHSHLTHLFGLLDLAKEQEISQVCIHAITDGRDTAPTEGIKAIKLLQGQIDQKGIGRIVTLSGRYYA--------MDRDHRWDRVKRAYDVMTQDTAVDGRQAGEILEASYAEGVKDEFINPV--RIAPGA-IEPGDGVIFFNFRPDRARQLTQAF-VSPQFTGFERKQIQPLSFATFTQYDSELPVDVAFEAQNLSNILGEVIANNGLQQFRTAETEKYAHVTYFFNGGLEEPLAGED--RELVSSPMVATYDKAPTMSAEAVTDVAIAAIKKGVYTLVVINYANPDMVGHTGQIEATVTAIETVDHCLGRLLTSISKAGGTAMITADHGNAEYMLDEEGNPWTAHTTNPVPFILVEGE 470
>gi|110803633|ref|YP_698620.1| phosphoglyceromutase [Clostridium perfringens SM101] >gi|123047400|sp|Q0STD7|GPMI_CLOPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|110684134|gb|ABG87504.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens SM101] (512 aa)
Score = 161, Expect = 1.0e-08, Identities = 113/477 (23%), Positives = 209/477 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE+A + A E   ++  +   D  +LP   T++  DG+ VS+    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + E+    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I  +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNR----WERVELAYNAMVLGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVSRIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPENYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLDEDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWISKDAEGKSLK 480
>gi|75763413|ref|ZP_00743142.1| Phosphoglycerate mutase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489098|gb|EAO52585.1| Phosphoglycerate mutase [Bacillus thuringiensis serovar israelensis ATCC 35646] (478 aa)
Score = 161, Expect = 1.0e-08, Identities = 104/474 (21%), Positives = 198/474 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWP 474
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +   +V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+ P
  S:     1 MRKPTALIILDGFGLREETHGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEEVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDQNETFQNAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPQTAKGYIDAANEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYSAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVNGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADQELTADGEPMTAHXTNPVPFIVTKNDVEP 477
>gi|18310283|ref|NP_562217.1| phosphoglyceromutase [Clostridium perfringens str. 13] >gi|27734316|sp|Q8XKU2|GPMI_CLOPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|18144963|dbj|BAB81007.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium perfringens str. 13] (512 aa)
Score = 161, Expect = 1.1e-08, Identities = 117/477 (24%), Positives = 210/477 (44%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S   F   L N  K +      I T++GR +   +  R     E V + Y     G GE+A + A E   ++  +   D  +LP   T++  DG+ V++    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + ES    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I+ +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKDFIVELENAMKEI--GVGEIATISGRYYAMDRDNR----WERVELAYNAMALGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVARIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLDQDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWVSKDAEGKSLK 480
>gi|192359602|ref|YP_001984006.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Cellvibrio japonicus Ueda107] >gi|190685767|gb|ACE83445.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Cellvibrio japonicus Ueda107] (516 aa)
Score = 161, Expect = 1.1e-08, Identities = 100/391 (25%), Positives = 164/391 (41%)
  Q:   103 FNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR---------DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI----TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTLD 493
           + K ID S   N + VHI  +LS      +  +L+ +IN+ +++G K V LH   DG+D  P S   +L        K  T  + ++ GR     +  R           +  E   D    + GL  +A  E  E  N+      +         TI DG      DSV+F+N  PD    + R +     +   +G    ++A    T   A   + P+    E L       +A      L +    K   +  FF  N  NE +     R ++ SP   +      +S+  + DK +++I  GKYD I   +  C M+     S      +  +E  D  LGR++   +       +T+ +G  E+M D+     PH + S   VPF+F +          +   V  +IL+ +D
  S:    98 YVKAID-SAIANDRAVHILGLLSEGGVHSHQDHLYAMINMAVERGAKQVYLHAFLDGRDTPPRSAEASLQKAQDVFAKLGTGRVASIVGRYFALDRDNRWDRVKTAYDVMVTGEAEFDALTAVDGL--KAAYERGE--NDEFVKATVICGEDEEVATINDG------DSVIFMNFRPDRAREITRALIDENFTGFDRGETHPAIAHFVQTTEYASDIKAPIAFPPEDLSNSFGEYIAGLGKTQLRIAETEKYAHVTFFF--NGGNEVVYPGEDRILVPSPKVATYDLQPEMSAPEVTDKLVEAIESGKYDAIICNYANCDMVGH---SGLFDAAVKAVEAVDVALGRVLAAVKKVDGEALITADHGNVEEMFDEETG-QPHTQHSTLPVPFIFVSSRKGKLASGGSLADVAPTILALMD 499
>gi|57242188|ref|ZP_00370127.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Campylobacter upsaliensis RM3195] >gi|57016868|gb|EAL53650.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Campylobacter upsaliensis RM3195] (492 aa)
Score = 160, Expect = 1.2e-08, Identities = 121/498 (24%), Positives = 206/498 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFN-----ENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMK----TSPKLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTE 498
           MK   I ++T+GIG N     N    A KP  + L   + P +LL         +P+          +S    M  G   I  Y  L  +++ I+   L N      L+ +  +     VHI  + S          FNA     ++ +   +G +   H I+DG+D  P S  K + +   F   +     ++AGR +   +  R     E V  Y++ + G   +   + S Y  EN    + D  I P  +   +G  ++++D ++F+N   D    L  ++     T  K K  F   L   +Y  K +  V FE   K + ++ L  +++      L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + +   + I K  D I V          + D    +S +E  D  LG +I   R       +TS +G  E M D+  N++  N ++   FVF    +  K+++ N +G+ +   S L  L+ E
  S:     1 MKQKCILIITDGIGYNPNTAFNAFNAAKKPTYDKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRI-IYQNLVKINQAIEKNMLKNNANLKALLQKCKR-----VHIIGLYSDGGVHSLHTHFNA-----LLTICKDEGKEVFAHAISDGRDVSPKSGLKLIRDLESFCEAKKIHFASLAGRFYAMDRDKR----WERVEAYYKALLGEA-KGVKKMSAYVEENYQKNIFDEFIEPVISEEFEG--LNEEDGLIFINFRNDRMKQLVELLSAENFTPLKQKKRFEKLLTMSVYDDKFNIPVLFE---KEELQNTLTEVISNAGLSQLHTAETEKYAHVTFFFNGGKEDLLENETRVLIPSPKIKTYDEKPQMSAFEVCEVVKEGIKKGEDFIVVNFANGDMVGHTGDFNAAVSAVEAVDTCLGEIIKEARRQNYAFIITSDHGNCEAMQDEKGNLLT-NHTTFNVFVFIEAQIC-KQIKPN-MGLSNVAASVLKILNLE 482
>gi|190571074|ref|YP_001975432.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Wolbachia pipientis] >gi|190357346|emb|CAQ54777.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Wolbachia pipientis] (502 aa)
Score = 160, Expect = 1.4e-08, Identities = 82/361 (22%), Positives = 157/361 (43%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNI-IALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDL 472
           K+ + I HI  ++S      + K++  + N + ++G+K V+H   DG+D  P S  + +  F++ + + +  I TV+GR +   +  R     E  ++ +E I       + +A    +EN  N + D  I PA   I D   +  +D +L  N   D    LA ++  KT       F S L+ + Y   L   +   P      + L  ++  N  + L +    K   +  FF  G         R ++ SP   +      +S+  L ++ +  I   ++ +I V          + ++K     +   D  L +++++ +  GN  + +T+ +G  E M D+  N  P    +L  VPF+ +  +L
  S:   104 KSKNGICHIMGLISDGGVHSHQKHISALANKISQRGIKVVIHAFLDGRDTLPNSGKRCIQEFTESIKENDIRIATVSGRYYAMDRDNR----WERTIEAYEAIAFAKAPRYDDAVSLIDENYQNNITDEFIRPA--IIGDYQGIKPEDGLLLANFRADRMIQLASILLGKTDYAKVAKFSSILSMMQYKADLKIPYLFPP--ESFANTLGQIIEDNKLRQLRIAETEKYAHVTFFFNCGREEPFSGEERILIPSPKVKTYDLQPEMSAFELTEELVKKIHSQEFALIVVNYANPDMVGHTGNIKAAEQAVLAVDDCLAKVLSVVKEVGNTALIVTADHGNVECMFDEE-NNTPQTAHTLNKVPFIISCENL 465
>gi|149114044|ref|ZP_01840800.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella baltica OS223] >gi|146866402|gb|EDK51642.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella baltica OS223] (514 aa)
Score = 160, Expect = 1.4e-08, Identities = 93/354 (26%), Positives = 153/354 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFT--------EASEYTNEN----LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   +    GR F +D ++  D       L   G+  F         EA+   NEN     ++ + DAD   A  T+ DG      D+++F+N   D    + R    +P   G   + +  ++   L   A   + P+    E+L   L  ++ K     L +    K   +  FF  G+    E   R +++SP   +      +SS  L DK + +I   KYDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D+        + S LVPFVF   D
  S:   113 VHIMGLLSAGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKGSLSHFDDLF--------TTLGHGRIASMIGRYFAMDRDNRWDRVSQAYDLITQGKSKFQYDNAVTALEAAYERNENDEFVSSSAITDADGQVA--TLQDG------DALIFMNFRADRARQITRSF-INPDFDGFERAVVPKMHFVTLTEYAGDIKAPIAYPSENLVNTLGEVLQKQGRTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILINSPKVATYDLQPEMSSAELTDKLVAAIESTKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVFVGRD 476
>gi|15791801|ref|NP_281624.1| phosphoglyceromutase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149029|ref|ZP_01067261.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597081|ref|ZP_01100317.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni 84-25] >gi|27734394|sp|Q9PI71|GPMI_CAMJE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|85840387|gb|EAQ57644.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88190770|gb|EAQ94743.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359798|emb|CAL34584.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni NCTC 11168] (492 aa)
Score = 160, Expect = 1.5e-08, Identities = 120/498 (24%), Positives = 203/498 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTE 498
           MK   + ++T+GIG NK  K N  + A KP+   L   + P +LL         +P+          +S    M  G   I    L  +++ I++K L   E   KL+ +  +     VHI  + S         +   ++ +  K G +   H I DG+D  P S    + +  +F         T+ GR +   +  R     + V +Y+E + G   +      EY  ++    V D  I  A N    G  + ++D ++F+N   D    L  ++ +      + + +F + L   +Y  K    V FE   K K E+ LA +++K     L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG ++   +       +TS +G  E M D+  N++  N ++   FVF        K++ N +G+ +   S L  LD E
  S:     1 MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLKKLLAKCKR-----VHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVSPKSGLNFIKDLKEFCENLGVHFATLCGRFYAMDRDKR----WDRVKEYYECLLGKAYKV-PNLLEYLQKSYDENVTDEFIKAAQNENYKG--MREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSVYDDKFKLPVLFE---KEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENETRVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNATIKAVEAVDTCLGEILECAKKHDYAFIITSDHGNCEAMQDEKGNLLT-NHTTFDVFVFVQAR-GVSKIKDN-MGLSNIAASVLKILDLE 482
>gi|134300820|ref|YP_001114316.1| phosphoglyceromutase [Desulfotomaculum reducens MI-1] >gi|134053520|gb|ABO51491.1| phosphoglycerate mutase [Desulfotomaculum reducens MI-1] (516 aa)
Score = 159, Expect = 1.6e-08, Identities = 121/491 (24%), Positives = 208/491 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSL-HNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVL-HLIADGQDERPYSFNKNL-SNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFT------------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           +  L  ++ +G GL++   GN +  A+ PN+N +++      L  +       +P+          +S    +  G   +  Y EL  + + IK      N E+   + +   K ++  +HI  +LS      + K++F V+ +  ++GL  V  H   DG+D  P S    + +  +K   ++   + TV+GR +      RD       + Y   +   G QA +            E  E+    +   V D    P          +S+ DSV+F+N  PD            DFA   R  K  P++  + ++    +Y   ++A     PV      L   L   ++K   K L L    K   +  FF  G    N N  R ++ SP   +      +S+  + D  ++ I K  +DVI            + DL      IET DQ LG+++      G  + +T+ +G AEKMLD+       + +  VPFV         K++ +  G  S I  T+
  S:     5 RKPLALVILDGWGLSQDKNGNAIAQASTPNMNQILANSSHTTLACSGEAVG--LPEGQMG------NSEVGHLNMGAGRV-VYQELTRITKSIKDGDFFENPELLRAVQNVKEKDSA--LHIMGLLSDGGVHSHIKHIFAVLKLAAQQGLSKVYYHAFLDGRDVPPSSAKLYMRALLAKMKEEQVGQVATVSGRYYAMD---RDCRWERTELAYRALVYSEGLQANSPLEAIDVAYERGETDEFVKPTI---VTDDKKQPLAK-------ISQGDSVIFINFRPDRARQITRAFVDDDFAGFDRGTK-HPQVYFVCMT----VYDKTIEA-----PVAFPTHKLVNTLGEWLSKQGLKQLRLAETEKYAHVTFFFNGGVEAPNPNEERVLIPSPKVATYDLKPDMSAYEVADAFVEQINKETFDVIITNFANPDMVGHTGDLAATQVAIETVDQCLGKVVAAVLEKGGTVLVTADHGNAEKMLDEKGGPFTAHTTDPVPFVLIGNQYKGAKLRED--GSLSDIAPTM 495
>gi|125972664|ref|YP_001036574.1| phosphoglyceromutase [Clostridium thermocellum ATCC 27405] >gi|166991379|sp|A3DBQ2|GPMI_CLOTH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|125712889|gb|ABN51381.1| phosphoglycerate mutase [Clostridium thermocellum ATCC 27405] (511 aa)
Score = 159, Expect = 1.8e-08, Identities = 117/449 (26%), Positives = 197/449 (43%)
  Q:     1 MKNTLIFLVT-EGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK-----LIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG----YFVSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLSSLAPIY---GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           MK+ L+ L+  +G G+N + +GN ++ ANKPNI               DR   +Y P     +   DV   D        G T+I     +  E  + +KS+ + + F K       +   K NSK+ H+F +LS      +  +L+ ++    ++ LK V +H   DG+D  P S    +      + +     I TV GR +   +  R     E V + Y   + G G QA   A E   E+   +  D  + P    IM        V ++DS++F N  PD    + R           + KG F     P++    T+ D  F    V  K ESL       ++K   + L +    K   +  FF  G     E   R +++SP   +      +S+  + DK ++ I K  YDVI +          +   +   + IE  D+ LG+++        ++ +T+ +G +E+M+D
  S:     1 MKDKLVMLIILDGYGINPRKEGNAIEAANKPNI---------------DRFMREY-PNTIVRTSGMDVGLPDGQMGNSEVGHTNIGAGRIVYQELTRITKSIQDGDFFEKKEFLDAAENCRKHNSKL-HLFGLLSDGGVHSHNTHLYGLLEFAKRQNLKDVYVHCFFDGRDVPPDSAMGYVEELENKIREIGVGEIATVMGRYYAMDRDNR----WERVKLAYDAMVLGRGNQA-QSAKEAVAESYKRQEFDEFVKP--TVIMKNGSPVATVGENDSIIFFNFRPDRAREITRAFTEVNFSGFEREKGYF-----PVFFVCMTQYDKTFENVVVAFKPESLENTFGEYISKKGLRQLRIAETEKYAHVTFFFNGGVEAVYEGEDRILINSPKVATYDLKPEMSAYEVTDKVLECINKKEYDVIILNYANPDMVGHTGVFEAAKAAIEAIDECLGKVVPAVLEQNGVVLITADHGNSEQMID 452
>gi|111075004|gb|ABH04858.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Heliobacillus mobilis] (538 aa)
Score = 159, Expect = 1.8e-08, Identities = 105/448 (23%), Positives = 189/448 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIK------------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL-KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAY---------NTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS--------PKLKGLFLSSLAPIYGTKLDA-VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           +  ++ +V +G GL    +GN LKLAN PN + L      W               +TYP         +  +  G+                 Y EL  + + +++  L    +    +DR + T  K +H+  +LS      +  +LF ++++ +  G+ K  +H   DG+D  P +  + +    K L +     + T++GR +   +  R     E V   ++ I  G GE+A    S         ++ D  +LP            T+ DG      DSV+F N   D    L+ +            PKL  +    +   Y   LDA V F   +    E+    +V++   + L +    K   +  FF  G    NE   R ++ SP   +      +S+  + D+ ++ I   +Y VI +          +  L   +  +ET D  LGR++        ++ +T+ +G  E+M+D
  S:     5 QTPVMLIVLDGWGLRDDMEGNALKLANLPNFHRL------W---------------ETYPHTSIQASGEYVGLPKGQIGNSEVGHLNIGAGRVVYQELTRISKAVETGELEKNPVLAAAMDRLSGT-GKALHLMGLLSDGGVHSHIDHLFALLDMAVAHGVDKIFVHAFLDGRDVPPANAKEYVEALDKKLAQIGVGQLATISGRYYAMDRDKR----WERVKRAWDAIVYGEGEKA-PLGSAAVETAYHARLTDEFVLPTVIIDEKGEPRGTVADG------DSVIFFNFRADRARQLSHVFTDQNFDGFDRGPKLPQVHFVCMTQ-YDITLDAPVAF---LPQNLENTFGEVVSRAGMRQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLVPSPKVATYNLQPEMSANEVTDRVVEKINSKEYPVIVLNLANPDMVGHTGILPAAIQAVETVDGCLGRIVPAVLDQDGVVIITADHGNVEQMID 454
>gi|168207664|ref|ZP_02633669.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens E str. JGS1987] >gi|170661010|gb|EDT13693.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium perfringens E str. JGS1987] (512 aa)
Score = 159, Expect = 1.8e-08, Identities = 112/477 (23%), Positives = 209/477 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQ 478
           K  ++ ++ +G G++   +GN +  ANKPN + L +  YP   L            +   S    ++     ++Y E      L  + ++IK  +    +   K +D + + N+ + H+  +LS      +  +L  ++ +  KKGL+ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + +   + G GE+A + A E   ++  +   D  +LP   T++  DG+ V++    DSV+F N  PD    + R +   P+ KG     L    +  T+ D       V  + ES    L   VA      L +    K   +  FF  G    N N  R +++SP   +      +S+  + D+ I  +   KYD+I +          +   +  +  IE  D+ LG++ +        + +T+ +G AE M+D      +  + S  VPF++ + D   K ++
  S:     3 KKPVMLMILDGFGISPNKEGNAVAAANKPNYDRLFNK-YPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQE------LTRITKEIKEGTFFTNKALVKAMDEAKENNTSL-HLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVHAFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNR----WERVELAHNAMVLGEGEKA-SSAVEAIEKSYHDNKTDEFVLP---TVIEEDGHPVARIKDGDSVIFFNFRPDRAREITRAI-VDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVAAKGLNQLRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLDQDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNAEVMIDYSTGKPMTAHTSDPVPFLWVSKDAEGKSLK 480
>gi|58697282|ref|ZP_00372655.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Wolbachia endosymbiont of Drosophila simulans] >gi|58536364|gb|EAL59827.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Wolbachia endosymbiont of Drosophila simulans] (439 aa)
Score = 159, Expect = 2.0e-08, Identities = 85/361 (23%), Positives = 153/361 (42%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNI-IALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDL 472
           K+ + + HI  ++S      + K++  + N + + G+K V+H   DG+D  P S  K +  F K +   +  I TV+GR +   +  R     E  ++ +E I          A    +EN  N + D  I PA   I D   +  +D VL  N   D    LA ++  KT       F S L+ + Y   L   +   P    +   L   +  N  + L +    K   +  FF  G+        R ++ SP   +      +S+  L +K ++ I   ++ +I V          + ++K     +   D  L ++++  + + N  + +T+ +G  E M D+  N  PH   +L  VPF+ +  +L
  S:    37 KSKNGVCHIMGLVSDGGVHSHQKHISTLANKISQHGIKVVIHAFLDGRDTLPNSGKKCIQEFIKSIKGNDIRIATVSGRYYAMDRDNR----WERTIEAYEAIAFAKAPRHDNAVSLIDENYQNNITDEFIRPA--VIGDYQGIKPEDGVLLANFRADRMIQLASILLGKTDYAKVAKFSSILSMMKYKKDLQIPYIFPPTSFADT--LGQTIEDNKLQQLRIAETEKYAHVTFFFNCGKEEPFSGEERILIPSPKVQTYDLQPEMSAFELTEKLVEKIHSQEFALIVVNYANPDMVGHTGNIKAAEKAVLAVDDCLAKVLSAVKKSSNTALIVTADHGNVECMFDEE-NNTPHTAHTLNKVPFIVSCDNL 398
>gi|152994757|ref|YP_001339592.1| phosphoglyceromutase [Marinomonas sp. MWYL1] >gi|150835681|gb|ABR69657.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Marinomonas sp. MWYL1] (509 aa)
Score = 159, Expect = 2.1e-08, Identities = 88/361 (24%), Positives = 155/361 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGE------QAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEE-------SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML 448
           + + I+  S    E   + +D++  +  K VHI  +LS      + + +  +  +  K+G K V +H   DG+D  P S     +     L +     I T+ GR +   +  R     + V   ++ I  G GE      +A  +A+   +EN  ++ + A I+     + DG      D+++F N  PD    L R   T     G F  S+ P   + +    F + +K           + L  ++AK+  K L +    K   +  FF  GE    +   R+++ SP   +      +S+  + DK ++ I  GKYD I            S   +  +  +E  D  LGR+I   +  G    +T+ +G  E+ML
  S:    82 IGKAIEDGSFFENEALVRAVDKA-VSAGKAVHILGLLSDGGVHSHHEQIMAMCELAAKRGAKAVYVHGFTDGRDTPPRSAKTPTAELEAKLAELGVGKIATLTGRYYAMDRDNR----WDRVQTAYDAIVLGKGEFQSDTAEAAIQAAYDRDEN--DEFVKATIVGESAPVQDG------DAIIFANFRPDRARQLTRAF-TDADFDG-FTRSVYPKLASFVTFTEFASDIKADVAFPPVALTNTLGEVLAKHGKKQLRIAETEKYAHVTFFFNGGEEALFDGEERELIPSPNVATYDLKPEMSAPEVTDKLVEVIEAGKYDTIICNFANGDMVGHSGIFEAAVKAVEAVDACLGRIIEALKVNGGQCLITADHGNVEQML 447
>gi|83589134|ref|YP_429143.1| phosphoglyceromutase [Moorella thermoacetica ATCC 39073] >gi|83572048|gb|ABC18600.1| phosphoglycerate mutase [Moorella thermoacetica ATCC 39073] (513 aa)
Score = 158, Expect = 2.4e-08, Identities = 108/465 (23%), Positives = 195/465 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVF---------FENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTN 469
           L+ ++ +G GL  + +GN +     PN   L++G YP   L    +       +   S    ++     ++Y E      L  + + I+  S  +       + R+ + +   +H+  ++S      +  +L+ ++++  ++GL+ V +H   DG+D  P S    L        ++    I T+ GR +      RD         Y   + G G QA +  SE    +    + D  + PA  T  DG     V + DSV+F N   D    L R           F +   P  G +LD  F            PV    + L   L  ++A    K L +    K   +  FF  G         R ++ SP   +  +  S+S++ + D  ++ + KYD I +          + DL   ++ +ET D+ +GR++         + LT+ +G AE+M  +  +  PH  + S+LVPF+  +
  S:     9 LMLMILDGFGLGPEGEGNAISQGRLPNYRRLLAG-YPHTRLRASGEAVGLPAGQMGNSEVGHLNIGAGRIVYQE------LTRISKAIRDGSFFSNAALVGAV-RAAREHGGALHLMGLVSDGGVHSHLDHLYALLDLAKREGLERVYIHAFLDGRDVPPASAAGYLEQVEDECRQKGIGAIATIMGRYYAMD---RDRRWERTARAYRALVAGEGHQA-SSPSEAIRASYERDITDEFVEPAVIT-RDGRPLATVREGDSVVFFNFRADRARQLTRAFVDRD-----FDAFERP--GGRLDIQFVCLTQYDVTIPAPVAFPPQVLQNVLGEVIAGAGLKQLRIAETEKYAHVTFFFNGGVEEPFPGEDRLLIPSPKVATYDQKPSMSAREVTDAVLERLDKYDFIVLNFANPDMVGHTGDLAAAIAAVETVDECIGRIVQAMAERRAPLLLTADHGNAEEM--REPDGEPHTAHTSNLVPFILVD 472
>gi|73667141|ref|YP_303157.1| phosphoglyceromutase [Ehrlichia canis str. Jake] >gi|85540984|sp|Q3YRU6|GPMI_EHRCJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|72394282|gb|AAZ68559.1| phosphoglycerate mutase [Ehrlichia canis str. Jake] (501 aa)
Score = 157, Expect = 3.0e-08, Identities = 98/394 (24%), Positives = 167/394 (42%)
  Q:   100 LEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANK------VMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKG-LFLSSLAPI--YGTKLD--AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTLD 493
           LE  NK+     K N+ I HI  +LS      +  ++  +IN L    ++  +H+  DG+D  P S  K +S   + +    N  I T++GR +   +  R  LD         T       AF  A  Y +   A +      + D  ILP       G  +   D  +  N   D    + +M+    K    + L +   +  Y  K++   +F  N +     + L  ++A N    L +    K   +  FF  G+    EN  R I+ SP+  +      +S++ + D  I+ I   KY +I V          + ++      I T DQ L +++N  + T  ++ +TS +G AE+M D   N+ P+   +L  VPF+  N +   +        V  +IL  L+
  S:    96 LEFINKI-----KKNNGICHIAGLLSDGGVHSSYTHILDIINTLSDFQIQVAVHIFLDGRDTPPISATKYISILCEHIKHLNNINIATLSGRYYAMDRDNR--LD--------RTTKAYNAIAFANAKRYEDPLTAVQDSYNLGITDEFILPCIIGNYQG--MKPQDGFIMTNFRSDRVIQIIKMIIGDIKTDNHITLDNTIGMVKYSDKINIPCLFPNNNIT----NTLGEVIANNQLHQLRIAETEKYAHVTFFFNGGKEDMFENEDRIIIPSPSVATYNLTPEMSAEKVTDTIIEKIKLQKYSLIIVNYANADMVGHTGNIDATKQAITTIDQCLSKILNCIQNTNYVLVITSDHGNAEEMFDVKNNM-PYTAHTLNPVPFIICNYNKKIRLKNGRLCDVAPTILEILN 485
>gi|11465845|ref|NP_053989.1| phosphoglycerate mutase [Porphyra purpurea] >gi|1709674|sp|P51379|GPMI_PORPU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|1276845|gb|AAC08265.1| phosphoglycerate mutase [Porphyra purpurea] (534 aa)
Score = 157, Expect = 3.0e-08, Identities = 105/467 (22%), Positives = 200/467 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIV-TVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLA---------NKVMDADILPA----YNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++  + +G G +   +GN +K+A  P I+ L+   YP  LL    +      +   P  +       +  + G   ++  L  +   I++KS  N    N   D +  T + + H+  + S      +  +L  +I+V   K +  + +HLI DG+D    S    +   +  + K++  I+ T++GR +      RDF  +     Y  T+        ++ S+ TN+ L          NK +  + +P       +I DG      D+++F N  PD    L + +   P        SL+ +       Y + L+      P      + L   ++K   K   +    K   +  FF  G         R+++SSP+ T+      +S++++  K+I +I K  Y  I +          +  LK+ + +IET D  +  L +    +   + +T+ +G AE ML         + ++LVPF+   G+
  S:     9 IVLAILDGWGHSNSHQGNAIKIAKTPTIDSLLE-TYPNTLLVASGE------EVGLPKGQMGNSEVGHTTIGGGRVVEQELVKIGNSIENKSFFNNVQLNCACDHAISTQTSL-HLIGLCSNGGVHSHLDHLLALIHVAESKKVPNLYIHLITDGRDTNSNSAKSFIKLIADHIEKKSFVIISTISGRYYAMD---RDFRWSRTKAAY--TVLT------SDNSDITNQPLNYNDLIDHYYNKGISDEFIPPSRINTGSIKDG------DAIIFFNFRPDRMRQLVQALVQKP-FNCFLTKSLSHLHVLTFTNYDSSLNTALAFPP--NTLNNFLGETISKYGLKQFRVAETEKYAHVTYFFNGGAEEPFSGEDRELVSSPSVTTYDLSPDMSAELVTQKSISAINKGIYSCIVINYANADMLGHTGKLKETIRSIETVDNCIALLFDAVSQSNGTLIITADHGNAECMLTNEGTSCTSHTTNLVPFILIEGE 473
>gi|168177562|ref|ZP_02612226.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum NCTC 2916] >gi|182670736|gb|EDT82710.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum NCTC 2916] (509 aa)
Score = 157, Expect = 3.2e-08, Identities = 113/470 (24%), Positives = 211/470 (44%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVK---RDVDSNFYEMLYGETDIKTYLELLDEQIK-------SKSLHNLEIF-----NKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGD 471
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++                     K YP  +     +D    E   G +++  +L +   +I        +KS+ + + F     NK I+   K NS + H+  +LS      + ++L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +       G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D      +  + ++ VPF++ + +
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNIL---------------------KKYPHTQLGASGMDVGLPEGQMGNSEVG-HLNIGAGRIVYQALTKITKSIFDGDFFENVALNKAIENVKKNNSTL-HLLGLLSPGGVHSHIEHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMNEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLIPSPKVATYDMQPEMNAYEVTDKLLERLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKILEKDGTAFITADHGNSEEMIDYSTGKPMTAHTTNPVPFMYVSNN 473
>gi|168182161|ref|ZP_02616825.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum Bf] >gi|182674703|gb|EDT86664.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum Bf] (509 aa)
Score = 157, Expect = 3.3e-08, Identities = 107/470 (22%), Positives = 203/470 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGD 471
           K  ++ ++ +G GL  K  GN +  A+KPN++ ++   YP+  L            +   S    ++     ++Y        L  + + I           NK I+ + K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +       G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + +K ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D      +  + ++ VPF++ + +
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAADKPNLDNILKK-YPYTQLGASGMEVGLPEGQMGNSEVGHLNIGAGRIVY------QALTKITKSISDGDFFQNVALNKAIENARKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMQEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLVPSPKVATYDMQPEMNAYEVTEKLLEKLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKILEKDGTAFITADHGNSEEMIDYSTGKPMTAHTTNPVPFMYVSNN 473
>gi|54293490|ref|YP_125905.1| phosphoglyceromutase [Legionella pneumophila str. Lens] >gi|81601519|sp|Q5WZ43|GPMI_LEGPL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|53753322|emb|CAH14769.1| hypothetical protein [Legionella pneumophila str. Lens] (514 aa)
Score = 157, Expect = 3.3e-08, Identities = 97/405 (23%), Positives = 178/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTV---AGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAY----NTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS---PKLKGLFLSSLAP----IYGTKLDAVFFEN----PVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           ++E I +       +F+++ID+  KT  K +HI  +LS      + ++LF ++ +  +K  + V LHL  DG+D  P S   +L   ++ L K   P+ T+    GR +   +  R +   E V +      G  E+ F +A    +    NK+ D  + P      ++I DG      D+VLF N   D     AR + ++   P  KG    +L      +  T+ D   F      PV     + L  +++ +    L +    K   +  FF  G  +   N  R ++ SP   +      +S+  L    I +I   D   ++C          + + +  +  IE  DQ + ++    +  G  + +T+ +G AE+M  +  N     + S  VPF++  G       + + + +  S+L+ L
  S:    83 INEAINNGKFAKNAVFHEVIDQLKKT-EKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALDSLKCLNEELAKH--PVATINSICGRYYAMDRDKR-WQRVEPVYNLLTQ--GKSERQFPDAETAIHFYYKNKISDEFVPPTLIGKEHSIQDG------DAVLFFNFRADR----ARQLTSTFLDPSFKGFERKTLPKLSYFVSMTQYDKNLFTTTAFPPVP--LNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGGCESVFTNEERIMVPSPQVATYDLQPEMSAHELTKTLIAAINSQDYHVIICNYANADMVGHTGNFEATVQAIECLDQCMQQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTAHTSEPVPFLYVGGGWHFTHSEGSLIDIAPSLLALL 493
>gi|177664028|ref|ZP_02939831.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 8801] >gi|196246518|ref|ZP_03145237.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 8802] >gi|172076709|gb|EDT62120.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 8801] >gi|196205749|gb|EDY00549.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 8802] (532 aa)
Score = 157, Expect = 3.3e-08, Identities = 80/320 (25%), Positives = 140/320 (43%)
  Q:   152 LHLIADGQD----ERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEE-----SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +H+I DG+D    E   +  K  S+  +  + R   IVTV+GR +   +  R D +   + + Y +   G G  A    +E   +   N + D  I P    I  G  +   D V+F N  PD    L   + T P   G     + P+          + PVK   E     ++L  +VA+   K        K   +  FF     N  E   R+++ SP   +  +  ++S++ + D   ++I  G Y ++ +          + +L+  +  IET D  LGRL+      G  + +T+ +G AE M+D++ N    + ++ VP +   G+
  S:   149 IHVITDGRDTNTNEGINAVAKLESSIKEIGVGR---IVTVSGRYYAMDRDRRWDRIQKAYDV-YTQDRPGDGRSA----TEVIKDFYKNSITDEFIEPT--RIAPGA-IKSGDGVIFFNFRPDRARQLCYAL-TMPNFDGFERELIQPLSFVTFTQYDPKLPVKVAFEPQNLNNILGEVVAREGLKQFRTAETEKYPHVTYFFNGGLENPFEGEDRELIQSPMVATYDQAPAMSAETVTDTACNAIEKGIYSLVVINYANPDMVGHTGNLEAAIQAIETVDNCLGRLLTSISKMGGTVLITADHGNAELMVDENGNPWTAHSTNPVPLIIVEGE 470
>gi|168143017|ref|ZP_02586246.1| phosphoglyceromutase [Bacillus cereus G9842] (509 aa)
Score = 157, Expect = 3.4e-08, Identities = 103/472 (21%), Positives = 197/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +   +V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETHGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEEVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDQNETFQNAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPQTAKGYIDAANEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYSAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVNGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADQELTADGEPMTAHTTNPVPFIVTKNDV 475
>gi|148360885|ref|YP_001252092.1| phosphoglyceromutase [Legionella pneumophila str. Corby] >gi|166991391|sp|A5IH96|GPMI_LEGPC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|148282658|gb|ABQ56746.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate independent [Legionella pneumophila str. Corby] (514 aa)
Score = 157, Expect = 3.5e-08, Identities = 97/405 (23%), Positives = 174/405 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTV---AGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAY----NTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           ++E I +       +F+++ID+  KT  K +HI  +LS      + ++LF ++ +  +K  + V LHL  DG+D  P S   +L   ++ L+K   P+ T+    GR +   +  R     E V   +  +  G  E  F +A    +    NK+ D  + P      ++I DG      D+VLF N   D    L              KT PKL   +  S+   Y   L       PV     + L  +++ +    L +    K   +  FF  G  +   N  R ++ SP   +      +S+  L    I +I   D   ++C          + + +  +  IE  DQ + ++    +  G  + +T+ +G AE+M  +  N     + S  VPF++  G       + + + +  S+L+ L
  S:    83 INEAINNGKFAKNAVFHEVIDQLKKT-EKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALDSLKCLNEELVKH--PVATINSICGRYYAMDRDKR----WERVEPVYNLLTQGKSEHQFPDAETAIHFYYKNKISDEFVPPTLIGKEHSIQDG------DAVLFFNFRADRARQLTSTFLDPLFKGFERKTLPKLS--YFVSMTQ-YDKNLITTIAFPPVP--LNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGGCESVFTNEERIMVPSPQVATYDLQPEMSAPELTKTLIAAINSRDYHVIICNYANADMVGHTGNFEATVQAIECLDQCMHQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTAHTSEPVPFLYVGGGWHFTHAEGSLIDIAPSLLALL 493
>gi|87120390|ref|ZP_01076285.1| phosphoglyceromutase [Marinomonas sp. MED121] >gi|86164493|gb|EAQ65763.1| phosphoglyceromutase [Marinomonas sp. MED121] (509 aa)
Score = 157, Expect = 3.5e-08, Identities = 110/470 (23%), Positives = 191/470 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLA--NKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTID--SIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML-DKHLNIVPHNKSSLVPFVFTNGD 471
           K T    + +G G ++  K N +  AN PN + L      W    +   +   +          + +     +  G T  + +  +  + I+  S  + E     +D + K + K VHI  +LS      + + +  +  + +K+G K V +H   DG+D  P S    +++    L    T  I T+ GR     +  R     E V   ++ I  LG QA   A+      LA  ++  + + +PA   I D   + + D+++F N  PD            DF+   R  K +PKL G F++     Y + + A     PV     + L  ++AK     L +    K   +  FF  GE    E   R+++ SP   +      +S+  + DK ++  S G YD I            S      +  +E  D  +GR++           +T+ +G  E+ML D     +  +    VP V  + D
  S:     3 KKTTALFILDGWGYSETSKSNAIAAANTPNWDKL------WQTRPHSLIQTSGMAVGLPEGQMGNSEVGHMNLGAGRTVYQNFTRI-GKAIEDGSFFDNEALVNAVDTAVKAD-KAVHILGLLSAGGVHSHHEQIMAMSEMAVKRGAKKVYIHGFTDGRDTPPRSAQAPIADLEAKLAALGTGRIATLTGRYFAMDRDNR----WERVETAYDAI-ALG-QAECHAATAEQAILAAYDRDQNDEFVPA-TVIGDAVTLEEGDAIVFANFRPDRARQLTRAFTDADFSGFTR--KATPKL-GAFVTFTE--YASDIKASVAFPPVA--LSNTLGEVLAKLGKTQLRIAETEKYAHVTFFFNGGEEALFEGEERELIPSPDVATYDLKPEMSAPEVTDKLVEVISAGTYDTIICNFANGDMVGHSGVFDAAVKAVEAVDACIGRVLAALELNAGSCLITADHGNVEQMLSDDGTQPLTSHTIEPVPLVLVSPD 471
>gi|126176513|ref|YP_001052662.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella baltica OS155] >gi|166991461|sp|A3DAN0|GPMI_SHEB5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|125999718|gb|ABN63793.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella baltica OS155] (514 aa)
Score = 157, Expect = 3.5e-08, Identities = 92/350 (26%), Positives = 152/350 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFT--------EASEYTNEN----LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   +    GR F +D ++  D       L   G+  F         EA+   NEN     ++ + DAD   A  T+ DG      D+++F+N   D    + R    +P   G   + +  ++   L   A   + P+    E+L   L  ++ K     L +    K   +  FF  G+    E   R +++SP   +      +SS  L DK + +I   KYDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D+        + S LVPFVF
  S:   113 VHIMGLLSAGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKSSLSHFDDLF--------TTLGHGRIASIIGRYFAMDRDNRWDRVSQAYDLITQGKSKFQYDNAVTALEAAYERNENDEFVSSSAITDADGQVA--TLQDG------DALIFMNFRADRARQITRSF-INPDFDGFERAVVPKMHFVTLTEYAGDIKAPIAYPSENLVNTLGEVLQKQGRTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILINSPKVATYDLQPEMSSAELTDKLVAAIESTKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVF 472
>gi|152998598|ref|YP_001364279.1| phosphoglyceromutase [Shewanella baltica OS185] >gi|166991462|sp|A6WHC7|GPMI_SHEB8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|151363216|gb|ABS06216.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella baltica OS185] (514 aa)
Score = 156, Expect = 4.0e-08, Identities = 92/350 (26%), Positives = 152/350 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFT--------EASEYTNEN----LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   +    GR F +D ++  D       L   G+  F         EA+   NEN     ++ + DAD   A  T+ DG      D+++F+N   D    + R    +P   G   + +  ++   L   A   + P+    E+L   L  ++ K     L +    K   +  FF  G+    E   R +++SP   +      +SS  L DK + +I   KYDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D+        + S LVPFVF
  S:   113 VHIMGLLSAGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKTSLSHFDDLF--------TTLGHGRIASIIGRYFAMDRDNRWDRVSQAYDLITQGKSKFQYDNAVTALEAAYERNENDEFVSSSAITDADGQVA--TLQDG------DALIFMNFRADRARQITRSF-INPDFDGFERAVVPKMHFVTLTEYAGDIKAPIAYPSENLVNTLGEVLQKQGRTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILINSPKVATYDLQPEMSSAELTDKLVAAIESTKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVF 472
>gi|126724474|ref|ZP_01740317.1| phosphoglyceromutase [Rhodobacterales bacterium HTCC2150] >gi|126705638|gb|EBA04728.1| phosphoglyceromutase [Rhodobacterales bacterium HTCC2150] (503 aa)
Score = 156, Expect = 4.0e-08, Identities = 90/361 (24%), Positives = 153/361 (42%)
  Q:   110 SNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMD---ADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNG 470
           S K+     H+ ++LS      +  +LF  ++ L+  G+  VLH I DG+D  P S  K L+   +F L     I TV GR     +  R     E V   ++ I  G GE A    +       A+K  +   A ++  Y+ I DG      D +  LN   D            DF +    +   PKL  L  + S +  +   +  V+ +  +    ++ L   V+K   +   L    K   +  F   G     E   R + +SP   +      +S+  + D+ + +I   YD+I V          + DL   +++ E  D  LG  +      G  + +T+ +G  E+M+D  +   PH  + ++LVP +   G
  S:   102 SIKSAGGRAHLMTVLSDGGVHGHINHLFATVSALVALGVPIVLHAITDGRDVAPVSAEKYLAQLLEF-LPEGIEIGTVTGRYFALDRDNR----WERVSTAYDAIVHGQGEHATDAGAAIKGGYAADKTDEFILATVIGTYSGISDG------DGLFCLNFRADRAREILAAIGQPDFDAFD--IGDRPKLSALMGMVSYSDAHDAYMSTVYKKRDI----QNALGAWVSKAGKRQFRLAETEKYPHVTFFLNGGVEVPEEGEDRFMPASPKVATYDLQPEMSAPEVADRMVGAILDGYDLIVVNFANPDMVGHTGDLAAAIASCEAVDHGLGLAVEALEKMGGSMIVTADHGNCEQMIDP-VTGEPHTAHTTNLVPVILVGG 466
>gi|54296532|ref|YP_122901.1| phosphoglyceromutase [Legionella pneumophila str. Paris] >gi|81601998|sp|Q5X7P2|GPMI_LEGPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|53750317|emb|CAH11711.1| hypothetical protein [Legionella pneumophila str. Paris] (514 aa)
Score = 156, Expect = 4.0e-08, Identities = 97/405 (23%), Positives = 178/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTV---AGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAY----NTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS---PKLKGLFLSSLAP----IYGTKLDAVFFEN----PVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           ++E I +       +F+++ID+  KT  K +HI  +LS      + ++LF ++ +  +K  + V LHL  DG+D  P S   +L   ++ L K   P+ T+    GR +   +  R     E V   +  +  G  E+ F +A    +    NK+ D  + P      ++I DG      D+VLF N   D     AR + ++   P  KG    +L      +  T+ D   F      PV     + L  +++ +    L +    K   +  FF  G  +   N  R ++ SP   +      +S+  L    I +I   D   ++C          + + +  +  IE  DQ + ++    +  G  + +T+ +G AE+M  +  N     + S  VPF++  G       + + + +  S+L+ L
  S:    83 INEAINNGKFAKNAVFHEVIDQLKKT-EKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALDSLKCLNEELAKH--PVATINSICGRYYAMDRDKR----WERVEPVYNLLTQGKSERQFPDAETAIHFYYKNKISDEFVPPTLIGKEHSIQDG------DAVLFFNFRADR----ARQLTSTFLDPLFKGFERKTLPKLSCFVSMTQYDKNLFTTTAFPPVP--LNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGGCESVFTNEERIMVPSPQVATYDLQPEMSAHELTKTLIAAINSRDYHVIICNYANADMVGHTGNFEATVQAIECLDQCMQQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTAHTSEPVPFLYVGGGWHFTHSEGSLIDIAPSLLALL 493
>gi|153933967|ref|YP_001382633.1| phosphoglyceromutase [Clostridium botulinum A str. ATCC 19397] >gi|153936169|ref|YP_001386185.1| phosphoglyceromutase [Clostridium botulinum A str. Hall] >gi|166991376|sp|A7FQN9|GPMI_CLOB1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|152930011|gb|ABS35511.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum A str. ATCC 19397] >gi|152932083|gb|ABS37582.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum A str. Hall] (509 aa)
Score = 156, Expect = 4.2e-08, Identities = 110/448 (24%), Positives = 197/448 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVK---RDVDSNFYEMLYGETDI--------KTYLELLDEQIKSKS----LHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGT--KLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++                     K YP  +     +D    E   G +++        +   + L +  KS S      N+ + NK I+   K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +       G    +L   Y T  + D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNIL---------------------KKYPHTQLGASGMDVGLPEGQMGNSEVGHLNIGAGRIVYQALTKITKSISDGDFFENVAL-NKAIENVKKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMNEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTVTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLIPSPKVATYDMQPEMNAYEVTDKLLERLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLEKDGTAFITADHGNSEEMID 450
>gi|15611975|ref|NP_223626.1| phosphoglyceromutase [Helicobacter pylori J99] >gi|11134273|sp|Q9ZKM7|GPMI_HELPJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|4155489|gb|AAD06490.1| 2,3-BISPHOSPHOGLYCERATE-INDEPENDENT PHOSPHOGLYCERATE MUTASE [Helicobacter pylori J99] (491 aa)
Score = 156, Expect = 4.3e-08, Identities = 111/470 (23%), Positives = 199/470 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG-KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN-IVPHNKSSLVPFVFTNG 470
           M    + ++T+GIG  K    N    A KP  + +   + P++L+ +    +  +PK          +S    M  G   +  Y +L+     S SL N E+ N     +    S +VH+  ++S      + ++   +     K   K  LHLI DG+D  P S   + K + N    +   N  I T++GR +   +  R     E +   + ++ GL     +  SEY        + D  I+PA      G  +  D+S +F+N   D            +F S  R        K L ++++ P   +      F  PV   +ES+   LA +V++++     +    K   +  F   G  T  +N  R ++ SP  T+      +S+K +    ++ +    D+I V          + + +  +  +E  D  LG +++L +     + LTS +G  E+M D++ N +  H   S+  FV  NG
  S:     1 MAQKTLLIITDGIGYRKDSDHNAFFHAKKPTYDLMFKTL-PYSLI-DTHGLSVGLPKGQMG------NSEVGHMCIGAGRV-LYQDLVR---ISLSLQNDELKNNPAFLNTIQKSHVVHLMGLMSDGGVHSHIEHFIALALECEKSHKKVCLHLITDGRDVAPKSALTYLKQMQN----ICNENIQIATISGRFYAMDRDNR----FERIELAYNSLMGLNHTPLS-PSEYIQSQYDKNITDEFIIPACFKNYCG--MQDDESFIFINFRNDRAREIVSALGQKEFNSFKRQ-----AFKKLHIATMTPYDNS------FPYPVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVETPFKNENRVLIQSPKVTTYDLKPEMSAKGVTLAVLEQMRLGTDLIIVNFANGDMVGHTGNFEASIKAVEAVDACLGEILSLAKELDYAMLLTSDHGNCERMKDENQNPLTNHTAGSVYCFVLGNG 458
>gi|16331205|ref|NP_441933.1| phosphoglyceromutase [Synechocystis sp. PCC 6803] >gi|3914388|sp|P74507|GPMI_SYNY3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|1653699|dbj|BAA18611.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Synechocystis sp. PCC 6803] (532 aa)
Score = 156, Expect = 4.6e-08, Identities = 104/467 (22%), Positives = 202/467 (43%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHN---LEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQD----ERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH-VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++ ++ +G G     + N +  AN P ++ LI+  YP  L+ N   ++  +PK        + +     +  G    +  + + D         N   +E+  ++ DR  K     +H+  + S      +  +L  +I++   +G+  + +H I DG+D    E  +   +  ++  K  L R   IV+V+GR +   +  R D ++  + VM    T  G+G+     A++   +  A+ + D  I P   T +    ++  D V+F N  PD    L   +  +P   G     + P+       Y   L  V    P      ++L  ++++   K        K   +  FF  G         R+++ SP  ++  +   +S+K + D    ++  G Y ++ V          +  LK+ +  IET D +LGRL+      G  + +T+ +G AE M D+  N    + ++ VPF+   G+
  S:     9 VVLVILDGWGYRPDTRANAIAQANTPIMDSLIAA-YPNTLV-NTSGKDVGLPKGQMG----NSEVGHLNLGAGRVVPQELVRISDAIEDGTFFDNQALIEVCQRVRDRRGK-----LHLIGLCSDGGVHSHIDHLLGLIDLAKLQGISQLCIHAITDGRDTPTNEGAHFVQQIQAHLEKIGLGR---IVSVSGRYYALDRDRRWDRVEKAYRVM----TEDGVGDG--RSAAQVIKDYYASDITDEFIPP---TRIGAGAIASGDGVIFYNFRPDRARQLCYAL-VNPSFDGFPRERIQPLDFVTFTQYDPALPVVVAFEP--QNLNNILGEIISRQGMKQFRTAETEKYPHVTYFFNGGLEQPFAGEDRELIQSPMVSTYDKAPQMSAKAVTDAVCRAMEKGIYSLVVVNYANPDMVGHTGKLKEAIQAIETVDLNLGRLLASAAKVGGTVLITADHGNAEYMSDESGNPWTAHTTNPVPFILVEGE 470
>gi|154484686|ref|ZP_02027134.1| hypothetical protein EUBVEN_02403 [Eubacterium ventriosum ATCC 27560] >gi|149734534|gb|EDM50451.1| hypothetical protein EUBVEN_02403 [Eubacterium ventriosum ATCC 27560] (513 aa)
Score = 155, Expect = 4.8e-08, Identities = 118/494 (23%), Positives = 213/494 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA--------YNTIMDGYFVSKDDSVLFLNSDP------------DDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKE---ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN--IVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           K   + L+ +G GLN K +GN + LAN P ++ L++  YP+               +   S    ++     ++Y E      L  + ++I+  +    E   K ++ + K NS + HIF +LS      +  +++  + +  K GL+ V +H   DG+D  P S  + +      + +     + T++GR +      RD   +     Y     G G +  T+  +    + A  V D  +LP           TI DG      DSV+F N  P            DDF   AR  K            L  +  T+ D       +  K+   ++     +A ++ K   +    K   +  FF  G    NE   R ++ SP    T D++   +S+  + +K +++I  GKYDVI            +  ++  +  +ET D+ +G++++  +     + + + +G AE+++D         H  +  VPF+  N D   K  +    GV + I+ TL  L
  S:     3 KKPTVLLILDGYGLNDKKEGNAVALANTPVMDKLMAE-YPFVKGQASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQE------LTRITKEIEDGTFFENEELVKAMENAKKNNSAL-HIFGLLSDGGVHSHITHMYGTLEMAKKFGLEKVYVHAFLDGRDTPPASAAEYMQQMVDKMAEIGVGEVATISGRYYAM---DRDNNWDREEKAYVAMTKGEGVEE-TDPVQAIKNSYAKDVTDEFVLPTVIKKDGQPVATITDG------DSVVFCNFRPDRARQITRAFCADDFDGFAREKKL----------DLTFVCFTEYDVTIPNKLIAFKKVEVKNTFGEYLAAHNMKQARIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDQKP-EMSAPKVCEKMVEAIKSGKYDVIITNFANPDMVGHTGIVEAAVKAVETIDECVGKVVDAIKEVDGQMFICADHGNAEQLIDYETGEPFTAHTTNP-VPFILVNADPSYKLREG---GVLADIVPTLIEL 496
>gi|163942820|ref|YP_001647704.1| phosphoglyceromutase [Bacillus weihenstephanensis KBAB4] >gi|163865017|gb|ABY46076.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus weihenstephanensis KBAB4] (509 aa)
Score = 155, Expect = 5.0e-08, Identities = 103/472 (21%), Positives = 197/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS---KDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +   +V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTASGEEVGLPAGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDQNETFQNAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPQTAKGYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIHDEFVLPSVIVNEDDTPVATINNDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNDIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADQELTAEGGPMTAHTTNPVPFIVTKNDV 475
>gi|167751306|ref|ZP_02423433.1| hypothetical protein EUBSIR_02292 [Eubacterium siraeum DSM 15702] >gi|167655813|gb|EDR99942.1| hypothetical protein EUBSIR_02292 [Eubacterium siraeum DSM 15702] (533 aa)
Score = 155, Expect = 5.5e-08, Identities = 118/451 (26%), Positives = 199/451 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI---KTYLE---LLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQD----------ERPYSFNKNLSNFSKF----------------LLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKT--------SPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRKILSSPACTSDKEYFS----LSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKH 451
           M   ++ +V +G+G +K   G+ + LAN P ++ L+            R+      K    +V    D +      G   +   + Y +   L++E I+S  ++  E + +L+D   K N+  +H   +LS      N K+LF ++     +G+K   +H++ DG+D          E+  SF K L+    F                  + + P+V +  + HV G+ GR F      M+  ET              Y  EN  + ++D D LPA+    +G  V K    DSV+  N   D    L+               K    F   L      KL A F  NP +    +L   +VA   N+  V     K G +  F+  N +++  + ++ +     SD   F     + S  + D  I+ I   KYD I    P       +  L   +  +E  D  L RLI +C   G  + +T+ +G A++ML+K+
  S:     1 MAKPVLLVVMDGVGFSKTGLGDAVTLANTPTLDRLL------------RECPNTRLKAHGDAVGLPTDDDMGNSEVGHNALGCGQIYSQGAKLVNESIESGKMYQSEAWKELVDNC-KANNSTLHFIGLLSDGNVHSNIKHLFKMLTEAKNEGIKKARVHILLDGRDVPATSAPIYIEQLESFLKELNADGAFDGKIASGGGRMKVTMDRYQADWPMVELGWKTHVKGE-GRQFAS---AMEAVET--------------YRKEN--DGIIDQD-LPAFVIAENGEPVGKIVDKDSVILFNFRGDRAIELSMAFDDDDFTAFDRGAKPDVCFAGMLQYDGDLKLPARFLVNPPE-ITNTLTEVLVAAGLNEYAV-SETQKYGHVTYFWNGNKSDK-FSEELETYKEIPSDNVSFDQRPWMKSAEITDDLIEVIKSKKYDFIRCNYPNGDMVGHTGSLDSTIIGVEAVDLGLSRLIKVCDEYGVTLVVTADHGNADEMLEKN 464
>gi|192807559|ref|ZP_03036236.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacillus sp. Y412MC10] >gi|192802979|gb|EDV79482.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacillus sp. Y412MC10] (514 aa)
Score = 154, Expect = 6.0e-08, Identities = 109/463 (23%), Positives = 207/463 (44%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK--LID--RSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAV---FFENPVKG----KEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN 469
            ++ +G GL     GN +  ANKPN                DR   +Y P  T  +    V   +        G  +I     +  +  + +KS+   E F    L++  R+ K N+K +H++ ++S      + +++F ++++  K+    V +H   DG+D  P S   F K+L   +K        I T++GR +   +  R D ++      Y   + G G + +T+  +   E+    V D  + P       G     V   DSV+FLN  PD    L+++  T+   +G       P +   L  V    F   V+G    K + L   L  ++ +++ K L +    K   +  FF  G +      TR +++SP   +      +S+  + D  +  I   K+D I +          S  L+  +  +ET D+ +G++++     G ++ +T+ +G A+ + D++      + ++ VPF+ T+
  S:     9 LIIMDGFGLRNTEVGNAVAQANKPNY---------------DRYLKQY-PNTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRITKSIREGEFFENETLVEAVRAAKNNNKKLHLYGLVSDGGVHSHIEHMFAMLDLCKKEDFHDVYIHGFMDGRDVAPDSGKQFVKDL--IAKIEEVGVGQIATLSGRYYAMDRDKRWDRVEKA----YRAMVYGEGPK-YTDPLKAITESYEKSVYDEFVEPTVMVNGAGEPVSLVESGDSVIFLNYRPDRAIQLSQVF-TNKDFRGF---DRGPKFPQSLHFVCLTLFSETVEGFVAYKPKDLDNTLGEVLVQHNKKQLRIAETEKYPHVTFFFSGGRDVELPGETRVLINSPKVATYDLKPEMSAYEVADACVREIEADKHDAIILNFANPDMVGHSGMLEPTVKAVETTDECVGKVVDAVLAKGGVVIITADHGNADMVFDENGRPFTAHTTNPVPFIVTD 474
>gi|52840746|ref|YP_094545.1| phosphoglyceromutase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|81603523|sp|Q5ZY71|GPMI_LEGPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|52627857|gb|AAU26598.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate independent [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (514 aa)
Score = 154, Expect = 6.0e-08, Identities = 97/405 (23%), Positives = 174/405 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTV---AGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAY----NTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           ++E I +       +F+++ID+  KT  K +HI  +LS      + ++LF ++ +  +K  + V LHL  DG+D  P S   +L   ++ L K   P+ T+    GR +   +  R     E V   +  +  G  E+ F +A    +    NK+ D  + P      ++I DG      D+VLF N   D    L              KT PKL   +  S+       L    F  PV     + L  +++ +    L +    K   +  FF  G  +   N  R ++ SP   +      +S+  L    I +I   D   ++C          + + +  +  IE  DQ + ++    +  G  + +T+ +G AE+M  +  N     + S  VPF++  G       + + + +  S+L+ L
  S:    83 INEAINNGKFAKNAVFHEVIDQLKKT-EKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALDSLKCLNEELAKH--PVATINSICGRYYAMDRDKR----WERVEPVYNLLTQGKSERQFPDAETAIHFYYKNKISDEFVPPTLIGKEHSIQDG------DAVLFFNFRADRARQLTSTFLDPSFKGFERKTLPKLS--YFVSMTQYDKNLLTTTAFP-PVP--LNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGGCESVFTNEERIMVPSPQVATYDLQPEMSAHELTKTLIAAINSQDYHVIICNYANADMVGHTGNFEATVQAIECLDQCMQQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTAHTSEPVPFLYVGGGWHFTHSEGSLIDIAPSLLALL 493
>gi|134298014|ref|YP_001111510.1| phosphoglyceromutase [Desulfotomaculum reducens MI-1] >gi|134050714|gb|ABO48685.1| phosphoglycerate mutase [Desulfotomaculum reducens MI-1] (516 aa)
Score = 154, Expect = 6.2e-08, Identities = 108/467 (23%), Positives = 200/467 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS----FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEY------TNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTID--SIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           L  ++ +G GL++  KGN +  AN P +  L+   YP   L+   +       +   S    ++     ++Y E      L  + + IK       +   ++I  + K+NS + HI  +LS      + +++F  + +  ++GL  V +H   DG+D  P S     N  L+   +  + +   + TV+GR +   +  R +   E          GL   +  EA +       T+E +   V+  D       + DG      DS++F+N  PD            DF+   R     PK+  + L+    +Y   +     + PV      L   L   + K   K L L    K   +  FF  G    N N  R ++ SP   +  +   +S++ + +  I   +  +YDV             + ++      +ET D+ +G++++        + +T+ +G AEKMLD++      + ++ VPF+   GD
  S:     8 LALIILDGWGLHRDEKGNAIACANIPYVKGLLKR-YPSTSLACSGEAVGLPAGQMGNSEVGHLNMGAGRVVYQE------LTRITKAIKDGDFFQNQELLRVIQGAKKSNSAL-HIMGLLSDGGVHSHIRHIFAALELAARQGLSKVYVHAFLDGRDVPPSSAKGYMNALLAKMKELGVGQ---VATVSGRYYAMDRDSR-WERTELAYRAMVFAEGLQANSPVEAIDVGYQRGETDEFIKPTVITDDCKQPIARVADG------DSIIFMNFRPDRARQITRSFVDDDFSGFQRGTG-GPKVHFVCLT----VYDKTI-----KTPVAFPPTQLVHTLGEWLDKQGLKQLRLAETEKYAHVTFFFNGGVEAPNPNEERVLIPSPKVATYDQKPEMSAQEVAEAFIKKFNTAQYDVYITNFANPDMVGHTGNMAATRIAVETVDKCVGKIVSTVLEKAGTVIITADHGNAEKMLDENGGAYTAHTTNPVPFILV-GD 475
>gi|118480173|ref|YP_897324.1| phosphoglyceromutase [Bacillus thuringiensis str. Al Hakam] >gi|196045615|ref|ZP_03112845.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus 03BB108] >gi|166991371|sp|A0RKS4|GPMI_BACAH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|118419398|gb|ABK87817.1| phosphoglycerate mutase [Bacillus thuringiensis str. Al Hakam] >gi|196023446|gb|EDX62123.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus 03BB108] (509 aa)
Score = 154, Expect = 6.3e-08, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVMKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSEGEPMTAHTTNPVPFIVTKNDV 475
>gi|56708385|ref|YP_170281.1| phosphoglyceromutase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670856|ref|YP_667413.1| phosphoglyceromutase [Francisella tularensis subsp. tularensis FSC198] >gi|123359411|sp|Q14GR4|GPMI_FRAT1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81597255|sp|Q5NFB1|GPMI_FRATT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|54113847|gb|AAV29557.1| NT02FT0426 [synthetic construct] >gi|56604877|emb|CAG45962.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321189|emb|CAL09345.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. tularensis FSC 198] >gi|151569250|gb|EDN34904.1| hypothetical protein FTBG_01631 [Francisella tularensis subsp. tularensis FSC033] (512 aa)
Score = 154, Expect = 6.4e-08, Identities = 113/467 (24%), Positives = 208/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID + K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPF++
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNAIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFIY 468
>gi|73668755|ref|YP_304770.1| phosphoglyceromutase [Methanosarcina barkeri str. Fusaro] >gi|85540980|sp|Q46D52|GPMI1_METBF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (iPGM 1) >gi|72395917|gb|AAZ70190.1| phosphoglycerate mutase [Methanosarcina barkeri str. Fusaro] (517 aa)
Score = 154, Expect = 6.7e-08, Identities = 95/446 (21%), Positives = 187/446 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKR-NTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKM 447
           K  L+ ++ +G G  +  +GN +  A  PN+++LI   YPW  L    +       +   S    ++     ++Y +      L  ++  I+         F   I  + K N   +H+  ++S+        ++  +I +  ++G+K V +H   DG+D  P +  K++     F  +  N  I T++GR +      RD   +   + Y     G+      +A    +E       D  + P   T  +G     +  +DS++F N  PD            DF +  R  +  PK+  + ++     Y   LD      P   + E++L  +++K     L +    K   +  F   G+    E   R ++ SP   +      +S+  + ++ I  I  GKYDVI +    +     +   +  +  +E  D  +G++  + +  G +  +T+ +G AE+M
  S:     8 KKPLMLIILDGWGYREAREGNAILAARTPNLDHLIEE-YPWCFLEASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQD------LTRINFSIRKGDFFKNPAFLGAISNA-KANDSSLHLMGLVSYGGVHSYMAHIHALIKLAQQEGVKKVYIHAFLDGRDVPPKAALKDIEELDAFCKENGNAKIATISGRYYAMD---RDKRWDRTKLAYDALTMGVAPYKTPDAETAVSEAYKRGETDEFVKPTVITDSEGKPEAVIKDNDSIIFFNFRPDRARQLTWAFVNKDFENFPR--EKHPKVYYVCMAQ----YDETLDLPIAFPP--EELENVLGEVLSKQGLAQLRIAETEKYAHVTFFLNGGQEKCYEGEDRCLIPSPKIATYDLKPEMSAYEVTEEVIGRIRSGKYDVIVLNFANMDMVGHTGIFEAAVKAVEAVDSCVGKIATVLKEVGGVAIITADHGNAEQM 455
>gi|90020143|ref|YP_525970.1| phosphoglyceromutase [Saccharophagus degradans 2-40] >gi|123277870|sp|Q21NH1|GPMI_SACD2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|89949743|gb|ABD79758.1| phosphoglycerate mutase [Saccharophagus degradans 2-40] (516 aa)
Score = 154, Expect = 7.1e-08, Identities = 96/380 (25%), Positives = 167/380 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFT--------EASEYTNEN----LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLL---ANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           +++ I     +   ++ K +D + ++  K VH+  +LS      +  ++  ++ + +K+G + V +H   DG+D  P S        +K  L++    +   G   +    GR F LD ++  D  +    L   G+ AFT        EA+   +EN     A  ++DAD  P   TI DG      D+V+F+N  PD            +F   AR     P L    +++    Y   +D      P     E L+     ++AKN  K L +    K   +  FF  G+ +  E   R ++ SP   +  E   +S+  +  K +D+I  G YD I        +   + D    +  +E  D  L  +       G    +T+ +G  E M D     +    ++L VP V+
  S:    84 INKAIADGDFYTNPVYTKAVDDA-QSQGKAVHVIGLLSDGGVHSHEDHMIAMMELAVKRGAEKVYMHAFLDGRDTPPRS--------AKAPLQKTEEKLKALGGGKIASIIGRFFALDRDNRWDRVQQAFDLMVDGKAAFTAQSATAGLEAAYERDENDEFVKATAIVDADGKPV--TIEDG------DAVIFMNFRPDRARQLTNAFVDKNFDGFAR--ARVPALSDFVMTTE---YSADIDTSCAYPP-----EDLVNSFGEVMAKNGKKQLRIAETEKYAHVTFFFSGGQESLYEGEDRILVPSPQVETYDEQPEMSAPEVTAKLVDAIENGGYDAIICNYANCDQVGHTGDFDASVKAVEAVDAALAEVFAALERVGGEALITADHGNVELMYDDEAQQLHTQHTTLPVPLVY 473
>gi|148378232|ref|YP_001252773.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum A str. ATCC 3502] >gi|148287716|emb|CAL81781.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum A str. ATCC 3502] (509 aa)
Score = 154, Expect = 7.2e-08, Identities = 110/448 (24%), Positives = 196/448 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVK---RDVDSNFYEMLYGETDI--------KTYLELLDEQIKSKS----LHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K  ++ ++ +G GL  K  GN +  ANKPN++ ++                     K YP  +     +D    E   G +++        +   + L +  KS S      N+ + NK I    K NS + H+  +LS      +  +L  +I +  +K +K V +H   DG+D  P S  + + +   ++ +     I T++GR +   +  R     E V + Y   + G GE+A   A E   ++  +   D  +LP+   + +G   +K    DSV+F N  PD    L R +       G    +L   Y   T+ D+      V    E L   L   V+KN  K L +    K   +  FF  G    NE   R ++ SP   +      +++  + DK ++ +   KYD++ +          +   +     IET D+ +G+++N          +T+ +G +E+M+D
  S:     3 KKPVVLMILDGFGLTNKVDGNAVSAANKPNLDNIL---------------------KKYPHTQLGASGMDVGLPEGQMGNSEVGHLNIGAGRIVYQALTKITKSISDGDFFENVAL-NKAIKNVKKNNSTL-HLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKKVYIHAFLDGRDVAPSSAKEYIEDIENYMNEIGVGEIATISGRYYAMDRDKR----WERVQLCYNAIVLGKGEEA-NSAVEGLEKSYRDNKTDEFVLPSV-VLKEGKPKAKIENKDSVVFFNFRPDRARELTRAI-NDKVFDGFERETLDLTYVTMTEYDSTLENVEVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGGVEEPNEGEDRVLIPSPKVATYDMQPEMNAYEVTDKLLERLDEDKYDMVILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLEKDGTAFITADHGNSEEMID 450
>gi|118497245|ref|YP_898295.1| phosphoglyceromutase [Francisella tularensis subsp. novicida U112] >gi|194323547|ref|ZP_03057324.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. novicida FTE] >gi|166991387|sp|A0Q5M6|GPMI_FRATN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|118423151|gb|ABK89541.1| phosphoglycerate mutase, cofactor independent [Francisella tularensis subsp. novicida U112] >gi|194322402|gb|EDX19883.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. novicida FTE] (512 aa)
Score = 154, Expect = 7.2e-08, Identities = 114/467 (24%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPFV+
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRGQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAIGAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFVY 468
>gi|151570345|gb|EDN35999.1| phosphoglycerate mutase [Francisella tularensis subsp. novicida GA99-3549] (512 aa)
Score = 153, Expect = 8.4e-08, Identities = 114/467 (24%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPFV+
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRGQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNLF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFVY 468
>gi|196039493|ref|ZP_03106798.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus NVH0597-99] >gi|196029653|gb|EDX68255.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus NVH0597-99] (509 aa)
Score = 153, Expect = 8.7e-08, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSEGEPMTAHTTNPVPFIVTKNDV 475
>gi|151571800|gb|EDN37454.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. novicida GA99-3548] (512 aa)
Score = 153, Expect = 9.4e-08, Identities = 114/467 (24%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPFV+
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRGQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFVY 468
>gi|166983008|ref|ZP_02254432.1| phosphoglyceromutase [Bacillus cereus AH187] >gi|168162038|ref|ZP_02597271.1| phosphoglyceromutase [Bacillus cereus H3081.97] (509 aa)
Score = 153, Expect = 9.5e-08, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSDGEPMTAHTTNPVPFIVTKNDV 475
>gi|42784285|ref|NP_981532.1| phosphoglyceromutase [Bacillus cereus ATCC 10987] >gi|50400353|sp|Q72XY4|GPMI_BACC1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|42740216|gb|AAS44140.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus ATCC 10987] (509 aa)
Score = 153, Expect = 9.5e-08, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSDGEPMTAHTTNPVPFIVTKNDV 475
>gi|30265162|ref|NP_847539.1| phosphoglyceromutase [Bacillus anthracis str. Ames] >gi|47530675|ref|YP_022024.1| phosphoglyceromutase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187972|ref|YP_031225.1| phosphoglyceromutase [Bacillus anthracis str. Sterne] >gi|65317108|ref|ZP_00390067.1| COG0696: Phosphoglyceromutase [Bacillus anthracis str. A2012] >gi|165870080|ref|ZP_02214737.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0488] >gi|167641992|ref|ZP_02400225.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0193] >gi|170707741|ref|ZP_02898192.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0389] >gi|177653007|ref|ZP_02935334.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0174] >gi|190567707|ref|ZP_03020619.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis Tsiankovskii-I] >gi|38372319|sp|Q81X77|GPMI_BACAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|30259839|gb|AAP29025.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. Ames] >gi|47505823|gb|AAT34499.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181899|gb|AAT57275.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. Sterne] >gi|164714403|gb|EDR19923.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0488] >gi|167510042|gb|EDR85455.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0193] >gi|170127298|gb|EDS96174.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0389] >gi|172081782|gb|EDT66852.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0174] >gi|190561123|gb|EDV15096.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis Tsiankovskii-I] (509 aa)
Score = 153, Expect = 9.5e-08, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNGDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSEGEPMTAHTTNPVPFIVTKNDV 475
>gi|188586626|ref|YP_001918171.1| phosphoglycerate mutase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351313|gb|ACB85583.1| phosphoglycerate mutase [Natranaerobius thermophilus JW/NM-WN-LF] (515 aa)
Score = 153, Expect = 9.7e-08, Identities = 117/508 (23%), Positives = 212/508 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMD-----GYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI---------YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGD-LWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           +K  L+ ++ +G+G++ + +GN    A+ P     +  I+    ++  R    ++     P  +       +  L     +   L  +++ I++  + + E+ N L D+    +S + H++ +LS      + +++  ++ +  +KG+  V LH + DG+D  P    K +S     + +     I TV GR +      RD   +     Y   + G G Q  T A +   +    K  D  I P    I+D        V   D VL  N  PD     AR +  +  L         P+         Y  +L       P   K  + L   +A +  + L +    K   +  FF  G    N+N  R ++ SP  ++  +   +S+  +  +    + K  YD I +          + DL   +  + T D+ LG L+      G I  +TS +G AEKM+D   N  PH  + S ++PFV  + D  +P +       V  ++L  +  L    ++   SLID
  S:     6 VKRPLVLIIMDGLGISGEHEGNAYYQADTP----FLDNIFKKHGMTTLRADGLHV---GLPEGQMGNSEVGHLNLGAGRVVYQELTRINKDIETGQIASNEVLNALGDKVKARDSSL-HLWGLLSDGGVHSHIEHIKALLRLAKEKGVTKVYLHAVTDGRDVPPKVAKKYISEIEDEMKQLGVGQIATVMGRYYAMD---RDKRYDRTEKAYNCLVHGKGHQE-TTAEDAVEQAYERKETDEFITPT--RIIDPNQDPDSLVKDGDGVLCFNFRPDR----ARQLTWAFILPEFEEFDRTPVDVSYVCMTQYDAELSLPIAYPPHAPK--NTLGEYLANHGKEQLRIAETEKYAHVTFFFNGGIEEANQNEERILIPSPKVSTYDQQPEMSAAEVTHRMDSELKKKDYDFILLNYANPDMVGHTGDLDAAVKAVATLDRCLGELVPKILEQGGIAVITSDHGNAEKMVDTEEN-SPHTAHTSHVIPFVIVDNDNRYPLRSGGKLADVAPTVLELM-GLPLPQEMSGKSLID 514
>gi|22297695|ref|NP_680942.1| phosphoglyceromutase [Thermosynechococcus elongatus BP-1] >gi|27734304|sp|P59177|GPMI_SYNEL 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|22293872|dbj|BAC07704.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Thermosynechococcus elongatus BP-1] (531 aa)
Score = 153, Expect = 9.9e-08, Identities = 104/467 (22%), Positives = 188/467 (40%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR---------DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP---IYGTKLDAVF---FENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++ ++ +G G  ++  GN +  A  P I+ L    YP  L+    K    +PK          +S    +  G   I    L  + + ++  SL +  +  +L     + N K+ H   + S      +  +L+ ++ +  + GL   +H+I DG+D  P      L    + L       IVTV+GR +   +  R             NEH+                 A +   ++ A  + D  I+P   T +    V   D V+F N  PD    L +     P   G   + + P   +  T+ DA F      P +     +L  ++A++  K L      K   +  FF  G         R ++ SP  T+  +  ++S+  +      +I K  Y ++ V          +  L   +  IET D+ +G L+      G  + +T+ +G AE M+D+  N    + ++ VPF+   G+
  S:     9 VVLVILDGWGYREETYGNAIASAYTPVIDSLWQA-YPHTLIHTSGKAVG-LPKGQMG------NSEVGHLNIGAGRIVPQELVRISDAVEEGSLFSNPVLVRLCQTVKERNGKL-HFIGLCSAGGVHSHIDHLYGLVELAKRHGLPACIHVITDGRDTPPRDAAGVLEELEQRLKTSGCGRIVTVSGRYYAMDRDRRWERTEAAYRVMTSNEHIQPL-------------RAVDVARQSYAQDIGDEFIVP---TRIAAGAVEPGDGVVFFNFRPDRARQLTQAF-IDPNFSGFERALITPLDFVTFTQYDASFNCGVAFPPQNLSH-ILGEVIAEHGLKQLRAAETEKYAHVTYFFNGGLEEPFPGEDRILIPSPMVTTYDQAPAMSALAVTQAVKKAIEKQEYALVVVNFANSDMVGHTGKLAATIQAIETVDRCVGVLVEAATKVGGTLLITADHGNAEYMIDEDGNPWTAHTTNPVPFILVEGE 469
>gi|20091494|ref|NP_617569.1| phosphoglyceromutase [Methanosarcina acetivorans C2A] >gi|27734313|sp|Q8TMI6|GPMI1_METAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 (Phosphoglyceromutase 1) (BPG-independent PGAM 1) (iPGM 1) >gi|19916643|gb|AAM06049.1| phosphoglycerate mutase [Methanosarcina acetivorans C2A] (515 aa)
Score = 153, Expect = 1.0e-07, Identities = 108/471 (22%), Positives = 194/471 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLN--SD----------PDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP---FVFTNGDL 472
           +  L+ ++ +G G  +  +GN +  A  PN++ L+   YPW LL                S    ++     ++Y        L  ++  I++       +F   I +  K N   +H+  ++S         +L  +I +  +KGLK V +H   DG+D  P +   ++   ++F  +     I TV+GR +      RD   +   + Y     G  +     A    +E       D  + P   T  +   V+     DSV+F N  +D           DDF    R  +  PK+  + ++     Y   LD      PV    E L   L  +++K     L +    K   +  F   GE    E   R ++ SP   +      +S+  + D+ +  I  GKYDVI +    +     +   +  +  +E  D+ +GR++   +  G +  +T+ +G AE+M+D      PH   +  P     F NG++
  S:     5 RRPLMLIILDGWGYREVEEGNAVLSAGTPNLDRLVKD-YPWCLLEASGGAVGLPEGMMGNSEDGHLNIGAGRIVYQN------LTRINISIRNGDFFKNPVFLNAISKV-KANDSSLHLIGLVSCGGVHSYTPHLHALIKLAKEKGLKKVYIHAFLDGRDVPPKTALGDIKKLNEFCKEHGGAKIATVSGRYYAMD---RDKRWDRTKLAYDVLTLGASQYKAPNAETAVSEAYGRGETDEFVKPTVITDHEEKPVATIRDKDSVIFFNFRADRARQLTWAFVKDDFDGFVR--EKRPKIYFVCMAR----YDEDLDL-----PVAFPHEELKNVLGEVLSKQGLTQLRIAETEKYAHVTFFLNGGEEKRYEGEDRCLIPSPKIATYDLKPEMSAYKITDEVVRRIQSGKYDVIVLNFANMDMVGHTGIFEAAVKAVEAVDKCIGRIVEALKEIGGVALITADHGNAEQMIDSKTG-EPHTAHTSNPVRCIYFGNGEV 479
>gi|166996681|ref|ZP_02263141.1| phosphoglyceromutase [Bacillus cereus AH820] (509 aa)
Score = 152, Expect = 1.1e-07, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVMKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSEGEPMTAHTTNPVPFIVTKNDV 475
>gi|30023173|ref|NP_834804.1| phosphoglyceromutase [Bacillus cereus ATCC 14579] >gi|47567342|ref|ZP_00238055.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus G9241] >gi|49478892|ref|YP_039124.1| phosphoglyceromutase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140433|ref|YP_086396.1| phosphoglyceromutase [Bacillus cereus E33L] >gi|167635238|ref|ZP_02393553.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0442] >gi|168136187|ref|ZP_02579416.1| phosphoglyceromutase [Bacillus cereus B4264] >gi|170687969|ref|ZP_02879182.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0465] >gi|196033251|ref|ZP_03100664.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus W] >gi|38372298|sp|Q815K7|GPMI_BACCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81613498|sp|Q6HBF2|GPMI_BACHK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81685511|sp|Q631M1|GPMI_BACCZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|29898733|gb|AAP12005.1| Phosphoglycerate mutase [Bacillus cereus ATCC 14579] >gi|47555963|gb|EAL14301.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus G9241] >gi|49330448|gb|AAT61094.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973902|gb|AAU15452.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus cereus E33L] >gi|167529281|gb|EDR92033.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0442] >gi|170668078|gb|EDT18828.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus anthracis str. A0465] >gi|195994680|gb|EDX58635.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus W] (509 aa)
Score = 152, Expect = 1.3e-07, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSEGEPMTAHTTNPVPFIVTKNDV 475
>gi|186684471|ref|YP_001867667.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Nostoc punctiforme PCC 73102] >gi|186466923|gb|ACC82724.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Nostoc punctiforme PCC 73102] (532 aa)
Score = 152, Expect = 1.3e-07, Identities = 88/367 (23%), Positives = 157/367 (42%)
  Q:   105 KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFE------TICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K+       NSK+ H+  + S      +  +LF ++++   + +  V +H I DG+D  P    + ++    ++ +     IVT++GR +         +D +H  D  +      T  G+G+     A E    + A  V D  + P    I  G  +   D V+F N  PD    L + +  SP   G     + P+       Y + L  AV FE        ++L  ++A +           K   +  FF  G         R+++SSP   +     ++S+  + D  I +I  G Y ++ +          +  +   ++ IET D+ LGRL+      G    +T+ +G AE MLD   N    + ++ VPF+   G+
  S:   102 KICQEVRSRNSKL-HLVGLCSEGGVHSHITHLFGLLDLAKNQQIPEVCIHAITDGRDTAPTDGVRAITMLQNYIDRTGIGRIVTLSGRYYA--------MDRDHRWDRVKRAYDVMTQDGVGDN--RTAVEILQASYAEGVKDEFVNPI--RIAPGA-IEPGDGVIFFNFRPDRSRQLTQAL-VSPTFNGFERQQITPLSFVTFTQYDSDLPVAVAFE---PQNLSNILGEVIANHGLNQFRTAETEKYAHVTYFFNGGLEEPFAGEDRELVSSPMVATYDHAPAMSAVAVTDVAIAAIQKGTYSLVVINYANPDMVGHTGQIDATITAIETVDRCLGRLLESVIKAGGTTIITADHGNAEYMLDDGGNPWTAHTTNPVPFILVEGE 470
>gi|115315170|ref|YP_763893.1| phosphoglyceromutase [Francisella tularensis subsp. holarctica OSU18] >gi|169656687|ref|YP_001429006.2| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|115130069|gb|ABI83256.1| phosphoglycerate mutase [Francisella tularensis subsp. holarctica OSU18] >gi|164551755|gb|ABU62050.2| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. holarctica FTNF002-00] (516 aa)
Score = 151, Expect = 1.3e-07, Identities = 113/467 (24%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPF++
  S:     5 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFIY 472
>gi|89256779|ref|YP_514141.1| phosphoglyceromutase [Francisella tularensis subsp. holarctica] >gi|167010730|ref|ZP_02275661.1| phosphoglyceromutase [Francisella tularensis subsp. holarctica FSC200] >gi|122500429|sp|Q2A2B1|GPMI_FRATH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|166991386|sp|A7NDJ7|GPMI_FRATF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|89144610|emb|CAJ79929.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Francisella tularensis subsp. holarctica LVS] >gi|157122629|gb|EDO66758.1| hypothetical protein FTAG_00988 [Francisella tularensis subsp. holarctica FSC022] (512 aa)
Score = 151, Expect = 1.4e-07, Identities = 113/467 (24%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPF++
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFIY 468
>gi|167939618|ref|ZP_02526693.1| phosphoglyceromutase [Bacillus cereus AH1134] (509 aa)
Score = 151, Expect = 1.5e-07, Identities = 103/472 (21%), Positives = 196/472 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRVVYQSLTRVNVAIREGEFDKNETFQNAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPQTAKGYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYSAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFTGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADQELTADGGPMTAHTTNPVPFIVTKNDV 475
>gi|86606763|ref|YP_475526.1| phosphoglyceromutase [Synechococcus sp. JA-3-3Ab] >gi|123505612|sp|Q2JSV1|GPMI_SYNJA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|86555305|gb|ABD00263.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Synechococcus sp. JA-3-3Ab] (530 aa)
Score = 151, Expect = 1.5e-07, Identities = 98/467 (20%), Positives = 189/467 (40%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIV-TVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++ ++ +G G  +  +GN +  A  P ++ L +  YP  LL    +          PS +       +  L     +   L  + + I++ SL +  +  ++  R  +   +  H   + S      +  +L+ ++ +  + G+   +H I DG+D  P    + L+   K L    + ++ T++GR +   +  R     E     +E +   G      A+E   +  A  + D  I P   T +    V   D+V+F N  PD    L +     P   G     +  L  I  T+ D      PV+        + LL  +V++   K L +    K   +  FF  G         R ++ SP   +  +   +S+  + DK I++I +  Y ++ +          + + K  +  +ET D+ LGRL+      G    + + +G AE M D+  N    + ++ VP +   G+
  S:     9 VVLVILDGWGYREAPEGNAVLAARTPVVDSLWA-TYPHTLLQASGR------AVGLPSGQMGNSEVGHLTLGAGRVVPQELVRISDAIETGSLFHEPLLVEVCHRLKEQGGRF-HFIGLCSEGGVHSHIDHLYGLLKLAAQAGIPAYVHAITDGRDTLPRDGARVLAALEKELQWLGSGVIATLSGRYYAMDRDRR----WERTQKAYEILTEDGPGCGRSAAEVMEDFYAQDITDEFIPP---TRLAPGAVQSGDAVIFFNFRPDRARQLTQAF-VCPDFSGFQRRLIPDLTFITMTQYDPTL---PVQVLFKPQNLDHLLGQVVSEAGLKQLRIAETEKYAHVTYFFNGGIEQPFPGEDRILVQSPLVATYDQMPEMSAVEVTDKAIEAIARREYSLVVLNYANPDMVGHTGNFKATVRALETVDRCLGRLLAAVVDVGGTTLIVADHGNAELMWDEQGNPWTAHTNNPVPCILVEGE 469
>gi|71279623|ref|YP_271040.1| phosphoglyceromutase [Colwellia psychrerythraea 34H] >gi|85540983|sp|Q47VY2|GPMI_COLP3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|71145363|gb|AAZ25836.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Colwellia psychrerythraea 34H] (520 aa)
Score = 151, Expect = 1.5e-07, Identities = 85/337 (25%), Positives = 146/337 (43%)
  Q:   113 TNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNT---PIVTVAGRNHVFGKKGR---------DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI--------YGTKLDA--VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           +N+K VHIF +LS      + +++F ++ +  K+G + V LH   DG+D  P S   +L      FSK   + +T    I +V GR +   +  R           ++ E +  Y   +  L       A+   NEN       A   P+   I     V+  D+++F+N   D     +R   T     G     +  I        Y   +DA   F   P+     +++   +AK++   L +    K   +  FF  G+        R ++ SP   +      ++S +L DK + +I  GKYD I    P       +      +   E  D  +GR++   +  G    +T+ +G AE+M D
  S:   107 SNNKAVHIFGLLSPGGVHSHEEHIFAMMELAKKRGAQKVYLHAFLDGRDTPPRSAQASLEKAQQKFSKLFTETDTGEGQIASVIGRYYAMDRDQRWDRVEAAYNLMVNGEGLHQYNSALDALA------AAYERNENDEFVGASAITSPSGKAIK----VNDGDALIFMNFRADRARQFSRCF-TDTNFNGFERKRIPAISNFVMLTQYAADIDAPSAFAPTPLT----NVMGEWLAKHNKTQLRISETEKYAHVTFFFSGGKEDMFTGEERILVPSPDVATYDLQPEMNSTLLTDKLVGAIESGKYDFIVCNYPNGDMVGHTGSFDAAVKACEAVDTCVGRVVKAAQDNGGECLITADHGNAEQMQD 459
>gi|154495833|ref|ZP_02034529.1| hypothetical protein BACCAP_00113 [Bacteroides capillosus ATCC 29799] >gi|150275031|gb|EDN02079.1| hypothetical protein BACCAP_00113 [Bacteroides capillosus ATCC 29799] (506 aa)
Score = 151, Expect = 1.5e-07, Identities = 120/471 (25%), Positives = 207/471 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLI----------SGI---YPWALLSNDRKRNKYIPK-----KTYPSVKRDV-DSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD------DSVLFLNSDPDDFASLARMMKTSPKL------KGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI----TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIA-----EAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGDL 472
           K     ++ +G GL  + +GN +  A KP ++ L           SG+    P   + N    +  I       +  P + + + D +F++          YL  + E  K +  H L +   L D     +S I HIF++L   +                ++G+K V +H   DG+D  P S    +   + K     N  I  ++GR +   +  R     E ++  ++ +  LGE  F EA   T      K  DA +   +   ++     KD      DSV+F+N  PD    + R +   P+       KG F   L  +  T+ DA      V      L       +++     L +    K   +  FF  N   E +     R ++ SP   +      +S++ + D+ +  I  G YDV+   F  C M+      EAAR +        +ET D+ +GR++   R  G +  +T+ +G A++MLD    + P+  + +SLVPF     ++
  S:     3 KTPTTLIIMDGYGLRSETEGNAIANARKPVLDKLFAENPVSKLSASGLDVGLPEGQMGNSEVGHTNIGAGRVVFQDLPRISKSIKDGDFFQN-------PEYLRAM-ENAKQEG-HALHVMGLLSD--GGVHSHITHIFALLDMAK----------------QQGVKDVYVHAFLDGRDVPPASGKGYVEQLAEKCAQVGNAHIGVISGRFYAMDRDKR----WERLVKAYDALV-LGEAPF-EADPVT---AVQKSYDAGVTDEF---VEPVICCKDAVIKSGDSVVFMNFRPDRAREITRSL-VDPEFDGFERKKGFF--PLTYVCTTEYDATMPNVTVAFPHHELKNIFGEYISRLGLTQLRIAETEKYAHVTFFF--NGGAEQVFPGEDRCLIPSPKVPTYDLKPDMSAREVTDEAVKRIESGNYDVVILNFANCDMVGHTGVYEAARLA--------VETVDECVGRVVEATRKMGGVALITADHGNADRMLDDD-GVTPYTAHTTSLVPFCIVGANV 472
>gi|75906946|ref|YP_321242.1| phosphoglyceromutase [Anabaena variabilis ATCC 29413] >gi|123758906|sp|Q3MF89|GPMI_ANAVT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|75700671|gb|ABA20347.1| phosphoglycerate mutase [Anabaena variabilis ATCC 29413] (533 aa)
Score = 151, Expect = 1.6e-07, Identities = 85/367 (23%), Positives = 154/367 (41%)
  Q:   105 KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K+       N K+ H+  + S      +  +LF ++++  ++ +  V +H I DG+D  P      +S    ++       IVTV+GR +   +  R     + +   ++ +   G     +A +    + A  V D  I+P    I  G  V   D V+F N  PD    L +    SP+  G     + P+       Y + L  +V FE        ++L  ++A             K   +  FF  G         R+++SSP   +  +  ++S+  + D  I +I  G Y +I +          +  ++  +  IET D+ LGRL+      G    +T+ +G AE MLD+  N    + ++ VP +   G+
  S:   102 KICQEVRNRNGKL-HLVGLCSEGGVHSHITHLFGLLDLAKEQRISEVCIHAITDGRDTAPTDGINAISALEDYINHVGIGRIVTVSGRYYAMDRDRR----WDRIQRAYDVMTQDGAGDGRKAVDVLQASYAEGVNDEFIVPV--RIAPGT-VESGDGVIFFNFRPDRSRQLTQAF-VSPEFTGFARQQIKPLSFVTFTQYDSDLSVSVAFE---PQNLTNILGEVIANQGLNQFRTAETEKYAHVTYFFNGGLEEPFAGEDRELVSSPMVATYDKAPAMSATAVTDTAIAAIQKGIYSLIVINYANPDMVGHTGQIEPTIQAIETVDRCLGRLLEGVSKAGGTTIITADHGNAEYMLDEAGNSWTAHTTNPVPLILVEGE 470
>gi|187931979|ref|YP_001891964.1| phosphoglycerate mutase, cofactor independent [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712888|gb|ACD31185.1| phosphoglycerate mutase, cofactor independent [Francisella tularensis subsp. mediasiatica FSC147] (512 aa)
Score = 151, Expect = 1.7e-07, Identities = 111/467 (23%), Positives = 205/467 (43%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLDAVFF---ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  V     E P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPF++
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCVVAFPPEQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFIY 468
>gi|15645589|ref|NP_207765.1| phosphoglyceromutase [Helicobacter pylori 26695] >gi|2829465|sp|P56196|GPMI_HELPY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|2314116|gb|AAD08020.1| phosphoglycerate mutase (pgm) [Helicobacter pylori 26695] (491 aa)
Score = 151, Expect = 1.7e-07, Identities = 109/470 (23%), Positives = 199/470 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG-KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN-IVPHNKSSLVPFVFTNG 470
           M    + ++T+GIG  K    N    A KP  + +   + P++L+ +    +  +PK          +S    M  G   +     L  + +K S SL N E+ N     +    S +VH+  ++S      + ++   +     K   K  LHLI DG+D  P S   + K + N    +   +  I T++GR +   +  R     E +   + ++ GL     +  SEY        + D  I+PA      G  +  D+S +F+N   D             F+   R +      K L ++++ P   T      F  PV   +ES+   LA +V++++     +    K   +  F   G  T  +N  R ++ SP  T+      +S+K +    ++ +    D+I V          + + +  +  +E  D  LG +++L +     + LTS +G  E+M D++ N +  H   S+  FV  +G
  S:     1 MAQKTLLIITDGIGYRKDSDHNAFFHAKKPTYDLMFKTL-PYSLI-DTHGLSVGLPKGQMG------NSEVGHMCIGAGRV-----LYQDLVKISLSLQNDELKNNPAFLNTIQKSPVVHLMGLMSDGGVHSHIEHFIALALECEKSHKKVCLHLITDGRDVAPKSALTYLKQMQN----ICNESIQIATISGRFYAMDRDKR----FERIELAYHSLMGLNHTPLS-PSEYIQSQYDKNITDEFIMPACFKNYCG--MQDDESFIFINFRNDRAREIVSALGQKQFSGFKRQV-----FKKLHIATMTPYDNT------FPYPVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVETPFKNENRVLIQSPKVTTYDLKPEMSAKEVTLAVLEQMKLGTDLIIVNFANGDMVGHTGNFEASVKAVEAVDACLGEILSLAKKLDYAMLLTSDHGNCERMKDENQNPLTNHTAGSVYCFVLGDG 458
>gi|153855254|ref|ZP_01996420.1| hypothetical protein DORLON_02434 [Dorea longicatena DSM 13814] >gi|149752253|gb|EDM62184.1| hypothetical protein DORLON_02434 [Dorea longicatena DSM 13814] (512 aa)
Score = 150, Expect = 1.8e-07, Identities = 116/506 (22%), Positives = 214/506 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIF-NKLI---DRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS---KDDSVLFLNSDPDDFASLARM--------MKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN--IVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K   + ++ +G GLN+K +GN + +A  P ++ L+S                      YP VK +         D        G  ++     +  E  K +K++ +   F NK +     + K N   +H+  ++S      +  ++F ++ +  ++GL+ V +H   DG+D  P S  + +      + +     + +V+GR +   +  R D ++      Y     G GE A   A+E    +    V D  ++P +    DG  V+   ++DSV+F N  PD    L R              ++K  F+        T+ DA      V   +E +       +AKN  K   +    K   +  FF  G    NE   R ++ SP   +      +S+  + DK + +I   KYDVI +          +  ++  +  IE  D+ +G+     +     + + + +G AE M+D+        H  ++ VPF+  N D   K  +   L   +  L  L  ++   ++  TSL+
  S:     3 KKPTVLMILDGYGLNEKTEGNAIAMAKTPVMDKLMS---------------------EYPCVKGNASGLAVGLPDGQMGNSEVGHMNMGAGRIIYQELTKITKAIEDGVFFENKALLAACENAKKNDSALHLMGLVSDGGVHSHIGHIFGLLELAKRQGLEKVYVHCFLDGRDTPPASGKEYVEQLEAKMKEIGVGEVASVSGRYYAMDRDNRWDRVEKA----YKALSAGEGETA-ASATEGIQASYDADVTDEFVVP-FVVTKDGAPVATIKENDSVVFFNFRPDRARELTRTFCDDSFDGFDRGDRIKTTFVCF------TEYDATIENKQVAFVKEEITNTFGEFLAKNGKKQARIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVAAIKSDKYDVIVINFANPDMVGHTGVIEAAVKAIEAVDECVGKAYEALKEADGQMFICADHGNAEYMIDEETKEPFTAHT-TNPVPFILVNADPAYKLKEDGCLADIAPTLIELMGMEQPAEMTGTSLL 510
>gi|17231674|ref|NP_488222.1| phosphoglyceromutase [Nostoc sp. PCC 7120] >gi|27734318|sp|Q8YPL2|GPMI_ANASP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|17133317|dbj|BAB75881.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Nostoc sp. PCC 7120] (533 aa)
Score = 150, Expect = 2.2e-07, Identities = 86/367 (23%), Positives = 154/367 (41%)
  Q:   105 KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K+       N K+ H+  + S      +  +LF ++++  ++ +  V +H I DG+D  P      +S    ++       IVTV+GR +   +  R     + V   ++ +   G     +A +    + A  V D  I+P    I  G  V   D V+F N  PD    L +    SP+  G     + P+       Y + L  +V FE        ++L  ++A             K   +  FF  G         R+++SSP   +  +  ++S+  + D  I +I  G Y +I +          +  ++  +  IET D+ LGRL+      G    +T+ +G AE MLD+  N    + ++ VP +   G+
  S:   102 KICQEVRNRNGKL-HLVGLCSEGGVHSHITHLFGLLDLAKEQRISEVCIHAITDGRDTAPTDGINAISALEDYINHVGIGRIVTVSGRYYAMDRDRR----WDRVQRAYDVMTQDGVGDGRKAVDVLQASYAEGVNDEFIVPV--RIAPGT-VEPGDGVIFFNFRPDRSRQLTQAF-VSPEFTGFARQQIKPLSFVTFTQYDSDLSVSVAFE---PQNLTNILGEVIANQGLNQFRTAETEKYAHVTYFFNGGLEEPFAGEDRELVSSPMVATYDKAPAMSATAVTDTAIAAIQKGIYSLIVINYANPDMVGHTGQIEPTIKAIETVDRCLGRLLEGVSKAGGTTIITADHGNAEYMLDEAGNSWTAHTTNPVPLILVEGE 470
>gi|86151664|ref|ZP_01069878.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153863|ref|ZP_01072066.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121612982|ref|YP_001000142.1| phosphoglyceromutase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005100|ref|ZP_02270858.1| phosphoglyceromutase [Campylobacter jejuni subsp. jejuni 81-176] >gi|166991375|sp|A1VYF1|GPMI_CAMJJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|85841293|gb|EAQ58541.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842824|gb|EAQ60036.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250317|gb|EAQ73275.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter jejuni subsp. jejuni 81-176] (492 aa)
Score = 150, Expect = 2.3e-07, Identities = 118/498 (23%), Positives = 201/498 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTE 498
           MK   + ++T+GIG NK  K N  + A KP+   L   + P +LL         +P+          +S    M  G   I    L  +++ I++K L   E   KL+ +  +     VHI  + S         +   ++ +  K G +   H I DG+D  P S    + +  +F         T+ GR +   +  R     + V + +E + G   +      EY  ++    V D  I    N    G  + ++D ++F+N   D    L  ++ +      + + +F + L   +Y  K    V FE   K K E+ LA +++K     L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG ++   +       +TS +G  E M D+  N++  N ++   FVF        K++ N +G+ +   S L  LD E
  S:     1 MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEV-PNSLLKTS-GLAVGLPEGQMG------NSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLQKLLAKCKR-----VHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVNPKSGLNFIKDLKEFCENLGVHFATLCGRFYAMDRDKR----WDRVKECYECLLGKAYKV-PNLLEYLQKSYDENVTDEFIKAVQNENYKG--MREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSVYDDKFKLPVLFE---KEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENETRVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIVECAKKHDYAFIITSDHGNCEAMQDEKGNLLT-NHTTFDVFVFVQAK-GVSKIKDN-MGLSNIAASVLKILDLE 482
>gi|74318412|ref|YP_316152.1| phosphoglyceromutase [Thiobacillus denitrificans ATCC 25259] >gi|85541659|sp|Q3SGA3|GPMI_THIDA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|74057907|gb|AAZ98347.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Thiobacillus denitrificans ATCC 25259] (513 aa)
Score = 149, Expect = 2.6e-07, Identities = 95/356 (26%), Positives = 158/356 (44%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQAFTEASE----------YTNENLANKVMDADILPAYNTIMDGYFVSKDD--SVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           + N K +H+  +LS      +  +   ++++  ++GL  V LH+  DG+D  P S        ++  L+R T  +  AG  HV    GR F +D +      ++   L  Q   E S           Y        V    I+PA     DG  V+ +D  SV+FLN   D            DF+   R  + +P+L     ++   + G   D   F+  V    E +   L   VA    + L +    K   +  FF  GE  +     R ++SSP   +      +S+  + +K + +IG  +YD+I            + +L+  +  IET D  LGR++      G  + +T+ +G AE MLD         +  +LVP +F
  S:   105 RDNGKTLHVLGLLSDGGVHSHELHFHALLDLAAREGLSKVCLHVFLDGRDTPPKS--------AELYLRRLTDKIAQAGVGHVASMIGRYFAMDRDRRWQRVKSAYDLLTQGAAEFSAGSAQAGLEAAYARGETDEFVKATAIVPA-----DGRPVTMEDGDSVIFLNFRSDRARQLSRPFIEPDFSEFER--ERTPRL-----ATYCTLTGYSDD---FDVSVAFPPERIKNGLGEYVANLGLRQLRIAETEKYPHVTFFFNGGEEVSFPGEDRILVSSPDVATYDLKPEMSAFEVTEKLLAAIGSKQYDLIVCNYANPDMVGHTGNLEAAIKAIETVDTCLGRVVEAQLARGGEVLITADHGNAELMLDAETGQAHTAHTMNLVPVIF 471
>gi|118138363|pdb|2IFY|A Chain A, Structure Of Bacillus Anthracis Cofactor-Independent Phosphoglucerate Mutase (508 aa)
Score = 149, Expect = 2.9e-07, Identities = 102/466 (21%), Positives = 194/466 (41%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
            ++ +G GL ++  GN +  A KPN                D   NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +S K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +    +   ++ + +       T++GR +   +  R     + V   +  +       +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +VA+   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     6 LIILDGFGLREETYGNAVAQAKKPNF---------------DGYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQSAI-KSVKEKGTALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEKVYIHAFLDGRDVGPKTAQSYIDATNEVIKETGVGQFATISGRYYSMDRDKR----WDRVEKCYRAMVNGEGPTYKSAEECVEDSYANGIYDEFVLPSVIVNEDNTPVATINDDDAVIFYNFRPDRAIQIARVF-TNGDFREFDRGEKVPHIPEFVCMTHFSETVDGYVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVALITADHGNADEELTSEGEPMTAHTTNPVPFIVTKNDV 474
>gi|196162926|ref|ZP_03123457.1| phosphoglyceromutase [Clostridium difficile QCD-23m63] (509 aa)
Score = 149, Expect = 2.9e-07, Identities = 113/466 (24%), Positives = 195/466 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT----YLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFV 466
           MK  +  ++ +G G NK  KGN +  +  PN+               DR + +Y P     +   DV   D        G T+I      Y +L  + + IK       ++  + +D + K NS  +H+  +LS      +  +L  +I +   KG++ V +H   DG+D  P S  +        + +       TV+GR +   +  R     E V + Y   + G+GE+A T   E    +  +   D  I+P      D     + ++DS++F N  PD    + R +    +  G     +   +   T+ D       +    +SL   L   +AKN    L      K   +  FF  G    N+   R ++ SP   +      +S+  L DK +D +G  K+D I +          +  ++  +  +ET D  +G+LI+     G    +T+ +G AE MLD      V  +  + VPF+
  S:     1 MKKPVALIIMDGFGYNKDVKGNAIAESKTPNL---------------DRIKKEY-PNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDGDFFTNKVLCEAMDNA-KENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVHAFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKR----WERVELAYNAMVRGIGEKA-TSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQITRAL-VCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGEDKFDFIVLNFANPDMVGHTGSIEAAVKAVETVDTCVGKLIDKIVELGGSAIITADHGNAEYMLDPETGKTVTAHSINPVPFI 465
>gi|77163578|ref|YP_342103.1| phosphoglyceromutase [Nitrosococcus oceani ATCC 19707] >gi|85540989|sp|Q3JF23|GPMI_NITOC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|76881892|gb|ABA56573.1| phosphoglycerate mutase [Nitrosococcus oceani ATCC 19707] (517 aa)
Score = 149, Expect = 3.0e-07, Identities = 92/382 (24%), Positives = 162/382 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKN-LSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA-------DILPAYNTIMDGYF---VSKDDSVLFLNSDPDDFASLARMMKTSPKLKG---LFLSSLAPIYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSS--LVPFVFTN 469
           ++  +++ S        + +DR+ K++ K +HI  +LS +    +  ++  ++ + IK+  + V LH   DG+D  P S   + L+  +KF         T  G+       GR + +D +H     +    L     T  +EY  E+    +  A       + + A   +  G     V   D ++F+N   D    + R     P   G   L+   LA        +  F+ PV     K ++    ++AK     L +    K   +  FF  G     E   R ++ SP   +  +   +S+  + D  + +I   KYDVI            + D    +  IET DQ LGR+    +  G  + +T+ +G AEKM +      PH   +   VPF+F +
  S:    84 VNRALRTGSFFTNHTLTEAVDRAVKSD-KAIHILGLLSPSGIHCHEDHIHAMVELAIKRRCQEVYLHAFLDGRDTAPKSAQASILAMQAKF---------TELGKGRFASLIGRYYGMDRDHRWPRIQAAYNL---IATGQAEYEAESAKQALAMAYERGETDEFVQATRIVPSGKAPVQVKDGDVIIFMNFRSDRARQITRAF-IEPDFTGFERLYWPKLAQFVSLTEYSKEFDIPVAFPSEKPQNTFGQVLAKLGLHQLRIAETEKYAHVTFFFNGGREQPFEGEDRILIPSPQVDTYDQKPEMSAVEVTDNIVKAIESDKYDVIICNYANPDMVGHTGDFNATVKAIETIDQCLGRVWAALQSAGGELIITADHGNAEKMYNAQYQ-QPHTAHTHNAVPFIFVS 475
>gi|58260376|ref|XP_567598.1| phosphoglycerate mutase [Cryptococcus neoformans var. neoformans JEC21] >gi|134117433|ref|XP_772610.1| hypothetical protein CNBK3140 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50255227|gb|EAL17963.1| hypothetical protein CNBK3140 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57229679|gb|AAW46081.1| phosphoglycerate mutase, putative [Cryptococcus neoformans var. neoformans JEC21] (532 aa)
Score = 148, Expect = 3.0e-07, Identities = 88/381 (23%), Positives = 160/381 (41%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANK-VMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFT 468
           +D+ IK     +       +  + +T+ ++ H+  ++S      + ++LF ++ V    G+  V +H   DG+D  P S  K +     ++ +     I TV GR +         +D +   D  +      + G GE+   E    T E+   K V D  I P  +   D   + K DS+   N   D    LA+++    K   + +     I       + F  PV    +++   LA  +AK   K   +    K   +  FF  G     EN  R+++ SP   +  +   +S + + DK  +++      FVMC          + D    +  I   D  +  + + C   G ++ +T+ +G AE+MLD      PH  + ++ VPF+ T
  S:   103 IDQSIKKDEFKDQPAIVDAMKHAKETSGRL-HLLGLISDGGVHSHIQHLFALLRVAKSYGIANVYIHFFGDGRDTAPKSATKYIKQLQDYIKEVGVGEISTVIGRYYA--------MDRDKRWDRIKIAVDGLVKGEGEKTDQEGLIKTVEDGYEKDVTDEFIKPIISGSEDSR-IKKGDSLYLFNYRSDRMRELAQVLGLPDKPMEVDVPEDLHITTMSRYNIEFPFPVAFPPQAMTNVLAEWLAKQGVKQCHIAETEKYAHVTFFFNGGVEKQFENEKREMIPSPKVATYDKQPEMSVQGVADKVAETVKSDKYEFVMCNFAPPDMVGHTGDYDAAVKAITATDAAVKTVYDACEEAGYVLCVTADHGNAEQMLDPETG-NPHTAHTTNHVPFIVT 489
>gi|116753488|ref|YP_842606.1| phosphoglyceromutase [Methanosaeta thermophila PT] >gi|116664939|gb|ABK13966.1| phosphoglycerate mutase [Methanosaeta thermophila PT] (505 aa)
Score = 148, Expect = 3.1e-07, Identities = 113/467 (24%), Positives = 200/467 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVK---------RDVDSNFYEM-LYGETD-IKTYLELLDEQIKSK-SLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEY--------TNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI------YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGD 471
           ++ ++ +G GL+++ +GN +  A+KPN++ L S  YP   L      +  +P+    + +         R V  ++  + L  E D +K   +L+D  +K++ S  NL +   L D     +S I H+F++L   + +  AK ++              +H I DG+D  P S    ++   + L +     I T++GR +   +  R   D      Y     GLG  A T             T+E L   V+D + L           V + DS++F N  PD    + R     P         L P       Y   +DA     P   KE   L  +++K     L +    K   +  FF  G         R ++ SP   +      +S+  +    ++ I  GKYDV+ +          +   +  +  +E  D+ +G +++       I  +T+ +G AEKM+D+     PH  + ++ VPF+    D
  S:     4 VVLIIMDGYGLSEETEGNAVAGAHKPNLDRLKSQ-YPHTSLGAS-GLDVGLPRGQMGNSEVGHLNLGAGRIVYQDYTRISLAIEQDRLKDAKQLVDAMVKARDSGRNLHLMGLLSD--GGVHSHITHLFALLDMAK-ELGAKKVY--------------VHPILDGRDVPPRSALTYVTQLEEKLTRIGIGRIATISGRYYAMDRDKR--WDRTEAA-YRAMTEGLGIHAATAVEAVRLGYDRGETDEFLTPTVIDPNGL-----------VREGDSIIFFNFRPDRARQITRAF-VQPDFNEFERRYLRPFFVCMTQYDESIDAPVAFPPEYLKET--LGEILSKAGLTQLRIAETEKYAHVTYFFNGGREEPFPGEDRILIPSPKIPTYDLKPEMSAPEVTSTVVERIKSGKYDVVIMNYANPDMVGHTGIYEAAVRAVEAVDRGVGMVVDEVLSRRGIALITADHGNAEKMVDRSTG-EPHTAHTTNRVPFILVGCD 466
>gi|70733875|ref|YP_257515.1| phosphoglyceromutase [Pseudomonas fluorescens Pf-5] >gi|85540993|sp|Q4KJR8|GPMI_PSEF5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|68348174|gb|AAY95780.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Pseudomonas fluorescens Pf-5] (513 aa)
Score = 148, Expect = 3.2e-07, Identities = 83/352 (23%), Positives = 143/352 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           K VHI  +LS      +  +L  +  +  K+G + + LH   DG+D  P S   ++    +             G+  +    GR F +D ++  D       L   G+  F  A+       A    ++D      TI +   V   D+V+F+N   D    L R+              PKL G  + +    Y   + A     P  G  E++L + +AKN    L +    K   +  FF  G         R ++ SP   +      +S+  + DK +D+I   +YDVI V          S   +  +  +E  D  +GR+++     G    +T+ +G  E+M D+        + +  VPF++
  S:   111 KAVHILGLLSDGGVHSHQDHLIAMAELAFKRGAEKIYLHAFLDGRDTPPKSAQSSIELLDE--------TFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGQGQFNAATAQEGLQAAYAREESDEFVKATTIGEPVKVEDGDAVVFMNFRADRARELTRVFVEDDFKDFERPRQPKLAGFVMLTQ---YAASIPAPSAFAP--GSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDKIVDAIEHQRYDVIIVNYANGDMVGHSGVFEAAVKAVECLDLCVGRIVDALEKVGGEALITADHGNVEQMSDESTGQAHTAHTTEPVPFIY 469
>gi|114328376|ref|YP_745533.1| phosphoglyceromutase [Granulibacter bethesdensis CGDNIH1] >gi|114316550|gb|ABI62610.1| phosphoglycerate mutase [Granulibacter bethesdensis CGDNIH1] (530 aa)
Score = 148, Expect = 3.3e-07, Identities = 87/380 (22%), Positives = 168/380 (44%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGL-------FLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVP 464
           L  +D  ++  S+++L      I  + + +    H+F ++S      +  +   +  +L + G++  +H   DG+D  P S  + L+ F   L +  T + T+ GR +   +  R D ++  + M     +   GE+ +++  +   +  A +  D  I PA   +   Y   KD D +L  N   D    L   +   P  +G        F  +L    Y T+L+++        +  +LL ++V+    + L +    K   +  F   GE    EN  R ++ SP   +      +S+  L +K + +IG  +YD+I +          +  L+  +  +ET D  LGR+++     G  + +T+ +G  E M D      PH  + ++LVP
  S:   101 LPRIDAALQDGSVNDLPALRDFIT-ALRQSGGTCHLFGLVSDGGVHAHQDHGAALAQILTRAGIRVAVHAFTDGRDTPPASARRFLTKFLPALPEGAT-LATLCGRFYAMDRDNRWDRVEKAYRM----MVDAEGER-YSDPCDAITDAYAREFSDEFIRPA---VFGDYAGMKDGDGLLCFNFRSDRVRELLTAL-LDPAFQGFERPRFLHFSGALGMTRYSTELESLMQTLFPFQEMTNLLGHVVSAAGKRQLRMAETEKYPHVTYFLNGGEEEVLENEDRIMVPSPKVATYDLKPEMSAPELTEKAVTAIGSGQYDLIVLNFANPDMVGHTGSLEAAIRAVETVDTGLGRIVDAITAVGGALFVTADHGNCELMRDPDTG-GPHTAHTTNLVP 484
>gi|88657673|ref|YP_507320.1| phosphoglyceromutase [Ehrlichia chaffeensis str. Arkansas] >gi|123493446|sp|Q2GGW3|GPMI_EHRCR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|88599130|gb|ABD44599.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Ehrlichia chaffeensis str. Arkansas] (501 aa)
Score = 148, Expect = 3.4e-07, Identities = 84/358 (23%), Positives = 156/358 (43%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANK------VMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLF-----LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTN 469
           K N+ I HI  +LS         ++  +I+ L    ++  +H+  DG+D  P S  K ++   + +    N  I T++GR +         +D ++ +D   T       AF +A  YT+ +LA +      + D  ILP    I D   ++  D  +  N   D    + +M+    K          +  +       +  +F  N +     + L  ++A +    L +    K   +  FF  G     EN  R I+ SP+ T+      +S+K + +  I+ I   KY +I +          + +++     I   DQ L +++N  + T  ++ +T+ +G AE+M D   N+ P+   +L  VPF+  N
  S:   103 KQNNGICHIAGLLSDGGVHSLHTHMLDIIDTLSNFQIQIAVHIFLDGRDTPPISAIKYINILREHIKHLNNVNIATISGRYYS--------MDRDNKLDRTRT--AYKAMAFADAKRYTDPSLAIQDSYNAGITDEFILPC--VIGDYNGMNPQDGFIMTNFRSDRAIQIIKMIIGDIKTDNHITLENTIGMVKYSESINIPCLFPNNNIT----NTLGEVIANHKLHQLRIAETEKYAHVTFFFNGGREDTFENEDRIIIPSPSVTTYNLMPEMSAKEVTNTVIERIKLQKYSLIILNYANADMVGHTGNIEATKQAITALDQCLNKILNCIQGTNYVLVITADHGNAEEMFDVKNNM-PYTAHTLNPVPFIICN 461
>gi|148266137|ref|YP_001232843.1| phosphoglyceromutase [Geobacter uraniireducens Rf4] >gi|146399637|gb|ABQ28270.1| phosphoglycerate mutase [Geobacter uraniireducens Rf4] (512 aa)
Score = 148, Expect = 3.6e-07, Identities = 116/491 (23%), Positives = 214/491 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK--LIDRSNKTNSK--IVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMD-YFETICGLGEQAFTEASEYTNENLANKVMDADILPAY--------NTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL----FLSSLAPIYGTKLDAVFFENPVKGKE--ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKE----YFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLG-VYSSILSTL 492
           K  L+ ++ +G G+N   + N +  AN PN++ L S  YP+  +      +  +P+    + +            G  +I     +  +  + SK++ + + F    L+D   KT +    +H+  +LS      +  +L+ ++ +  ++G+K V +H + DG+D  P S    L+     +++     I TV GR +   +  R     E V   Y   +CG GE  F  A+   +++  N V D  +LP+          T+ DG      D  +F N   D    + R + T     G     F    + +  T  D  F      G E  +++   ++ +   + L +    K   +  FF  G         R ++ SP    T DK+     + ++ ++L  K +D    YDVI +          +  +   +  +E  D  +GRL+   R  G  + +T+ +G AE M+D+  N  PH   +   VPF+  +      K++   L  +  +IL  L
  S:     3 KQPLLLMILDGWGINPHQENNAIARANTPNMDRL-STSYPYVEMGTS-GLSVGLPEGQMGNSE-----------VGHLNIGAGRVVYQDLTRISKAIDDGDFFENPVLLDCIAKTKAAGGRLHLAGLLSDGGVHSHNTHLYALLQLAKREGVKDVFVHCLLDGRDTPPQSGVDYLARLEAEIVRIGAGRIATVIGRFYAMDRDNR----WERVEKAYRAMVCGEGE-GFASAAAVIDQSYQNGVNDEFVLPSVITANGAPVGTVRDG------DGFIFFNFRSDRAREITRSL-TDAGFTGFERPQFPRLASYVCMTTYDETFGLPVAFGPEALKNIFGEVLGRLGLRQLRIAETEKYAHVTFFFNGGSEVPFPGEDRALIPSPKEVATYDKKPEMSVYPVTEELL--KRLDE-DLYDVIILNFANADMVGHTGIMAAAIRAVEAVDDCVGRLVAKVRSLGGRVLITADHGNAEIMVDE--NGGPHTAHTCDRVPFILVDDTRKDAKLRPGILADIAPTILDLL 496
>gi|153827149|ref|ZP_01979816.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MZO-2] >gi|149738977|gb|EDM53293.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MZO-2] (460 aa)
Score = 148, Expect = 3.6e-07, Identities = 92/367 (25%), Positives = 153/367 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           EI    ID++     K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:    46 EILVAAIDKAVAA-GKAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLQCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 420
>gi|108563380|ref|YP_627696.1| phosphoglyceromutase [Helicobacter pylori HPAG1] >gi|123373726|sp|Q1CSQ0|GPMI_HELPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|107837153|gb|ABF85022.1| phosphoglycerate mutase [Helicobacter pylori HPAG1] (491 aa)
Score = 148, Expect = 3.7e-07, Identities = 108/470 (22%), Positives = 198/470 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG-KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN-IVPHNKSSLVPFVFTNG 470
           M    + ++T+GIG  K    N    A KP  + +   + P++L+ +    +  +P+          +S    M  G   +     L  + +K S SL N ++ N     +    S +VH+  ++S      + ++   +     K   K  LHLI DG+D  P S   + K + N    +   N  I T++GR +   +  R     E +   + ++ GL     +  SEY        + D  I PA     + Y +  D+S +F+N   D            +F+   R        K L ++++ P   T      F  PV   +ES+   LA +V++++     +    K   +  F   G  T  +N  R ++ SP  T+      +S+K +    ++ +    D+I V          + + +  +  +E  D  LG +++L +     + LTS +G  E M D++ N +  H   S+  FV  +G
  S:     1 MAQKTLLIITDGIGYRKDSDHNAFFHAKKPTYDLMFKTL-PYSLI-DTHGLSVGLPEGQMG------NSEVGHMCIGAGRV-----LYQDLVKISLSLQNDDLKNNPAFLNTIHKSPVVHLMGLMSDGGVHSHIEHFIALALECEKSHKKVCLHLITDGRDVAPKSALTYLKQMQN----ICNENIQIATISGRFYAMDRDKR----FERIELAYHSLMGLNHTPLS-PSEYIQSQYDKNITDEFITPA--CFKNYYGMQDDESFIFINFRNDRAREIVSALGQKEFSGFKRQ-----AFKKLHIATMTPYDNT------FPYPVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVETPFKNENRVLIPSPKVTTYDLKPEMSAKEVTLAVLEQMKLGTDLIIVNFANGDMVGHTGNFEASVKAVEAVDACLGEILSLAKKLDYAMLLTSDHGNCEHMKDENQNPLTNHTAGSVYCFVLGDG 458
>gi|153216337|ref|ZP_01950415.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae 1587] >gi|124114332|gb|EAY33152.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae 1587] (510 aa)
Score = 147, Expect = 4.2e-07, Identities = 91/367 (24%), Positives = 153/367 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           E+    ID++     K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:    96 EVLVAAIDKAVAA-GKAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLQCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 470
>gi|187605455|ref|ZP_02991650.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Exiguobacterium sp. AT1b] >gi|187482465|gb|EDU20474.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Exiguobacterium sp. AT1b] (512 aa)
Score = 147, Expect = 4.5e-07, Identities = 106/468 (22%), Positives = 196/468 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM--DGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP-----IYGTKL------DAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFIN-----KFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           M   +  ++ +G G+  +  GN +  ANKPN +      YP  LL+    + +Y+     P  +       +  +     +   L  ++  IK +SL + +  N L     K +S + HI  ++S      +  ++F ++      G++ V +H   DG+D  P S    L    + L +     + +V+GR +   +  R     E V   ++ +     +  T+  E   ++  N + D  +LP   T++  DG  V+    +D+++F N  PD    LA++ K     KG  LSS  P     +  TK       D VF    +K      L+    K           H   F+N      F GE+       R ++ SP   +      +S+  L D  ++ I   +YD   +          S  L+     IE  D+ LG++++     G    +T+ +G A+ + +   + +  + +  VP + T
  S:     1 MARPVALIILDGFGMRDESFGNAVMAANKPNFDRYWEQ-YPHTLLN---AKGEYV---GLPEGQMGNSEVGHLNIGAGRVVYQSLSRVNNAIKDRSLFDRQAMNHLAGHVKKHDSSL-HIMGLVSDGGIHSHINHMFAIVEFAKLHGIEKVYIHAFTDGRDCDPKSGAGFLKETEEKLAELGVGQVASVSGRYYAMDRDNR----WERVEKVYDVLVNGKGEVGTDPVEVLKKSYENDLTDEFVLP---TVIEKDGKPVATIQDNDAIMFFNFRPDRAIQLAKVFKEKVGFKGFELSSKHPENILLVSMTKFSDEVDTDIVFPPEDLKNTLGETLSAQGYKQLRAAETEKYPHVTFFLNGQKEQPFEGED-------RLLVPSPKVATYDLQPEMSAYELTDGLLERIESDEYDAYIINFANPDMVGHSGKLEPTKKAIEAVDECLGKVVDALLAKGGAAIITADHGNADIVTNPDGSPMTAHTTEPVPCIVT 471
>gi|153830720|ref|ZP_01983387.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae 623-39] >gi|125620465|gb|EAZ48838.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae V51] >gi|148873800|gb|EDL71935.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae 623-39] (510 aa)
Score = 147, Expect = 4.5e-07, Identities = 91/367 (24%), Positives = 153/367 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           E+    ID++     K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:    96 EVLVAAIDKAVAA-GKAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLKCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 470
>gi|152977354|ref|YP_001376871.1| phosphoglyceromutase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189042187|sp|A7GUR8|GPMI_BACCN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|152026106|gb|ABS23876.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Bacillus cereus subsp. cytotoxis NVH 391-98] (509 aa)
Score = 147, Expect = 4.6e-07, Identities = 108/472 (22%), Positives = 200/472 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN--TPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           M+     ++ +G GL ++  GN +  A KPN                DR  NK+ P  T  +    V     +M   E           +   L  ++  I+       E F   I +  K     +H+F +LS      +  ++F ++ +  K+G++ V +H   DG+D  P +  K   + +  ++K        T+AGR +   +  R D ++      Y   + G G   +  A E   ++ AN + D  +LP+     D   V+    DD+V+F N  PD    +AR+  T+   +        P     +    F   V G         ++ L  +V++   K L +    K   +  FF  G         R +++SP   +    + L  +M I +  D++       K+DVI   F  C M+     S  ++  +  +E  D+ LG+++        +  +T+ +G A++ L      +  + ++ VPF+ T  D+
  S:     1 MRKPTALIILDGFGLREETYGNAVAQAKKPNF---------------DRYWNKF-PHTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFDKNETFQNAI-KHVKEKGTALHLFGLLSDGGVHSHIDHMFALLRLAAKEGVEKVYIHAFLDGRDVGPQT-AKGYIDATNAVIKETGVGQFATIAGRYYSMDRDKRWDRVEK----CYRAMVYGEGP-TYKNAYECVEDSYANGIYDEFVLPSVIVNEDETPVATINDDDAVIFYNFRPDRAIQIARVF-TNEDFREFDRGEKVPHIPEFVCMTHFSETVNGYVAFKPVNLDNTLGEVVSQAGLKQLRIAETEKYPHVTFFFSGGREAEFPGEERILINSPKVAT----YDLKPEMSIYEVTDALVNEIENDKHDVIILNFANCDMVGH---SGMMEPTIKAVEATDECLGKVVEAILAKDGVAIITADHGNADEELTPDGAPMTAHTTNPVPFIVTKKDV 475
>gi|88606919|ref|YP_504994.1| phosphoglyceromutase [Anaplasma phagocytophilum HZ] >gi|123495476|sp|Q2GKV7|GPMI_ANAPZ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|88597982|gb|ABD43452.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Anaplasma phagocytophilum HZ] (496 aa)
Score = 147, Expect = 4.7e-07, Identities = 94/373 (25%), Positives = 156/373 (41%)
  Q:    99 NLEIFN-----KLID--RSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARM-MKTSPKLKGLFLSSLAPIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGD 471
           NLEI       KL+D  R  +    + H+  +LS         ++  +I V+   G+K  +H+I DG+D  P S  K +   +  +   N  I TVAGR +   +  R  LD       ++ I          A E   ++  + V D  ++P      DG  +  +D VLF N   D    L  M +   P++  +        Y  K+  A  F  P +    S L  ++++   K L +    K   +  FF  G         R I+ SP  ++      +S+  + D  ++ I   +Y +  V          + +++     + T D  L R+       G ++ +T+ +G AEKM D   N  P   + SS+VPFV  N D
  S:    83 NLEINEVHKNPKLLDFVRDIQAKGGVCHMIGLLSDGGVHSLQAHMETIIEVITGFGIKVFIHVILDGRDVPPRSAEKYIGMLNAKIEHLNAEIATVAGRYYAMDRDNR--LD--RTCKAYDAIAYATGPRSGSAMEALEKSYNSGVTDEFMVPTVIGDYDG--MGAEDGVLFTNFRNDRVLQLLGMLLHRFPEVSNVLGMRQ---YSEKMRIASLF--PPREIHRS-LGEVISERGLKQLRIAETEKFAHVTFFFNGGREEPFTGEDRIIIPSPDVSTYDLKPEMSAVEITDSLVERINSQQYALTVVNYANADMVGHTGNMEAAKKAVTTVDSCLQRVFYAAVNAGAVMLITADHGNAEKMFDVQ-NDSPFTAHTSSMVPFVVCNAD 457
>gi|188527793|ref|YP_001910480.1| phosphoglyceromutase [Helicobacter pylori Shi470] >gi|188144033|gb|ACD48450.1| phosphoglyceromutase [Helicobacter pylori Shi470] (491 aa)
Score = 147, Expect = 4.8e-07, Identities = 109/470 (23%), Positives = 195/470 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA----YNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS-------PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG-KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN-IVPHNKSSLVPFVFTNG 470
           M    + ++T+GIG  K    N    A KP  + +   + P++L+ +    +  +P           +S    M  G   +     L  + +K S SL N  + N     +    SK+VH+  ++S      + ++   +     K   K  LHLI DG+D  P S   + K + N    +   N  I T++GR +   +  R     E +   + ++ GL     +  SEY          D  I+PA    Y  + DG      +S +F+N   D    +   +             K L ++++ P   T      F  PV   +ES+   LA +V++++     +    K   +  F   G     +N  R ++ SP  T+      +S+K +    +D +    D+I V          + + +  +  +E  D  LG +++L +     + LTS +G  E+M D++ N +  H   S+  FV  NG
  S:     1 MAQKTLLIITDGIGYRKDSDYNAFFHAKKPTYDLMFKTL-PYSLI-DTHGLSVGLPNGQMG------NSEVGHMCIGAGRV-----LYQDLVKISLSLQNDGLKNNPAFLNTIHKSKVVHLMGLMSDGGVHSHIEHFIALALECEKSHKKVCLHLITDGRDVAPKSALTYLKQMQN----ICNENIQIATISGRFYAMDRDKR----FERIKLAYHSLMGLNHTPLS-PSEYIQSQYDKNTTDEFIMPACFKDYCGMQDG------ESFIFINFRNDRAREIVSALGQKEFNGFKRETFKKLHIATMTPYDNT------FPYPVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVEAPFKNENRVLIQSPKVTTYDLKPEMSAKEVTLAVLDQMELGTDLIIVNFANGDMVGHTGNFEASIKAVEEVDACLGEILSLAKKLDYAMLLTSDHGNCERMKDENQNPLTNHTAGSVYCFVLGNG 458
>gi|134302371|ref|YP_001122340.1| phosphoglyceromutase [Francisella tularensis subsp. tularensis WY96-3418] >gi|166991388|sp|A4IZ68|GPMI_FRATW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|134050148|gb|ABO47219.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Francisella tularensis subsp. tularensis WY96-3418] (512 aa)
Score = 147, Expect = 4.9e-07, Identities = 112/467 (23%), Positives = 207/467 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLS-SLAPIYGTKLD-AVFF--ENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           MK T + ++ +G G +     N +K AN P  + +    +P  L++           +   S    V+     ++Y E      L  +D+ I+ K+  + +     ID   K +S + H+  +LS      + +++F +I +  +KG+K + LH   DG+D  P S  K++    K L   N   I +V GR +   +  R D ++      Y   +    +  +  A E   ++ A    D  ++P      DG+   V  +DSV+F+N   D    ++           P+ K L ++ +    Y +KL  AV F  + P+     + L  ++ KN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + DK + +I  GKYD I            + + +  +  IE  D+ + RL + +    GN+  +T+ +G A+ M++      PH  + ++LVPF++
  S:     1 MKKTTLLVILDGWGYSDSDYFNAIKNANTPTWDSIWQE-FPKTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQE------LTKIDKAIEEKTFGDNKAICAAIDNVIKNDSNL-HLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKRLYLHAFLDGRDTPPRSAEKSIKKADKLLQDLNLGYIASVCGRYYAMDRDNRWDRVEKA----YNAIVNANADFIYDSALEALEQSYARDQSDEFVIPTC-IKKDGHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDHFPRKKHLNINFTTLTEYDSKLKCAVAFPPKQPI-----NTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGGREEQFEGEDRILIPSPKVATYDLQPEMSAPEVTDKLVAAINSGKYDCIVCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILEHDGNMF-ITADHGNADMMVNPETQ-KPHTAHTTNLVPFIY 468
>gi|27735194|sp|P35167|GPMI_BACME 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|4589056|gb|AAD26327.1|AF120090_1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus megaterium] (511 aa)
Score = 147, Expect = 4.9e-07, Identities = 101/471 (21%), Positives = 198/471 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           K  +  ++ +G  L  + KGN +  A KPN +   +  YP A L    +       +   S    ++     ++Y        L  ++  I+       E     +  + +  + + H+F +LS      + ++L+ ++ +   +GL+ V +H   DG+D  P S    L   ++ + +     I T++GR +   +  R     E V   +  +      ++T A E   ++  N + D  +LP+  T  DG  V+    +D+V+F N  PD            DF S  R  K    L  + L+     +   +D      P+    ++ L  ++++N+ K L +    K   +  F   G        TR ++ SP   +      +S+  + D  +  I   K D I +          S  L+  +  IET D+ LG++++     G    +T+ +G A++++    N +  + ++ VP + T   L
  S:     3 KKPVALIILDGFALRDEDKGNAVTHAKKPNFDRFWNE-YPHATLQASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQS------LTRVNVAIREGEFEQNETLLAAVKHAKEKGTNL-HLFGLLSDGGVHSHIEHLYALLRLAKSEGLEKVYIHGFLDGRDVAPQSAETYLKELNEKIEEYGVGEIATLSGRYYSMDRDKR----WERVEKSYRAMVYGEGPSYTSAEECVKDSYDNGIYDEFVLPSVITKEDGSPVATIQDEDAVIFYNFRPDRAIQISNTFANEDFRSFDRGEKHPKHLHFVCLTH----FSETVDGYVAFKPIN--LDNTLGEVLSQNNLKQLRIAETEKYPHVTFFMSGGREAEFPGETRILIDSPKVATYDLKPEMSAYEVTDALLAEIEGDKQDAILLNFANPDMVGHSGMLEPTVKAIETVDECLGKIVDAILAKGGTAIITADHGNADEVITLEGNPMTAHTTNPVPVIVTKQGL 476
>gi|168266701|ref|ZP_02688666.1| phosphoglyceromutase [Listeria monocytogenes FSL J2-071] (510 aa)
Score = 146, Expect = 5.2e-07, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGADHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|47097453|ref|ZP_00234998.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes str. 1/2a F6854] >gi|153180554|ref|ZP_01933597.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes F6900] >gi|153184966|ref|ZP_01935614.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes J0161] >gi|153192116|ref|ZP_01939161.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes J2818] >gi|47014167|gb|EAL05155.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes str. 1/2a F6854] >gi|126942478|gb|EBA20217.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes J0161] >gi|127764444|gb|EBA24976.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes J2818] >gi|133731947|gb|EBA33645.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes F6900] (510 aa)
Score = 146, Expect = 5.2e-07, Identities = 106/463 (22%), Positives = 190/463 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E    +R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGADHPKNIKFVTMT-LYNPSVDAEVAFKPIEMK--NVIGEVLSNEGLAQLRIAETEKYPHVTFFMNGGRNEEFPGESRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|153175708|ref|ZP_01931012.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes FSL N3-165] >gi|153197238|ref|ZP_01941508.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes 10403S] >gi|167405286|ref|ZP_02310045.1| phosphoglyceromutase [Listeria monocytogenes FSL J2-003] >gi|127633289|gb|EBA22706.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes 10403S] >gi|133729133|gb|EBA30831.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes FSL N3-165] (510 aa)
Score = 146, Expect = 5.4e-07, Identities = 106/463 (22%), Positives = 190/463 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E    +R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGADHPKNIKFVTMT-LYNPSVDAEVAFEPIEMK--NVIGEVLSNEGLAQLRIAETEKYPHVTFFMNGGRNEEFPGESRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|67924782|ref|ZP_00518183.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Crocosphaera watsonii WH 8501] >gi|67853377|gb|EAM48735.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Crocosphaera watsonii WH 8501] (532 aa)
Score = 146, Expect = 5.5e-07, Identities = 80/354 (22%), Positives = 149/354 (42%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEE-----SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +H+  + S      +  +LF ++N+  K+ L+ V +H I DG+D       K ++     + K     I TV+GR +   +  R     + V   ++ I   G+     A E   +  +    D  I P    I  G  +   D V+F N  PD    L   + T P   G     + P+          + PVK   E     ++L  +VA+   K   +    K   +  FF  G     E   R+++ SP   +     ++S++ +     +++ K  Y ++ +          + + +  +  IET D  LG+L++     G  + +T+ +G AE M D++ N    + ++ VP +F  G+
  S:   114 LHLIGLCSEGGVHSHLDHLFGLLNLAQKQNLQDVCVHAITDGRDTNTTDGVKAIARIEDHIEKLGIGRIATVSGRYYAMDRDRR----WDRVKLAYDVITQDGDGDGRSALELLKDFYSQDKTDEFIPPT--RIAPGA-IEAGDGVIFFNFRPDRARQLCSAL-TVPNFDGFERELITPLSFVTFTQYDPKLPVKVAFEPQNLNNILGEVVAREGLKQFRVAETEKYPHVTYFFNGGLEEPLEGEDRELIQSPMVATYDLSPAMSAEAVTKAACNAVDKAVYSLVVINYANPDMVGHTGNTEAAIEAIETVDNCLGKLLSSVSKLGGTVIITADHGNAETMKDENGNPWTAHTTNPVPLIFVEGE 470
>gi|15640363|ref|NP_229990.1| phosphoglyceromutase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591000|ref|ZP_01678318.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae 2740-80] >gi|121728882|ref|ZP_01681891.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae V52] >gi|147675493|ref|YP_001218604.1| phosphoglyceromutase [Vibrio cholerae O395] >gi|153224504|ref|ZP_01954478.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MAK 757] >gi|153823146|ref|ZP_01975813.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae B33] >gi|194531397|ref|YP_002066854.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MO10] >gi|170676095|sp|A5F3N4|GPMI_VIBC3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|27734392|sp|Q9KV22|GPMI_VIBCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|9654751|gb|AAF93509.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547141|gb|EAX57271.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae 2740-80] >gi|121628850|gb|EAX61310.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae V52] >gi|124117596|gb|EAY36339.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MAK 757] >gi|125617325|gb|EAZ45896.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MO10] >gi|126519333|gb|EAZ76556.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae B33] >gi|146317376|gb|ABQ21915.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae O395] (510 aa)
Score = 146, Expect = 5.6e-07, Identities = 88/352 (25%), Positives = 147/352 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:   110 KAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLQCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 470
>gi|153168534|ref|ZP_01928377.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes FSL N1-017] >gi|153204029|ref|ZP_01944895.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes HPB2262] >gi|167015557|ref|ZP_02278090.1| phosphoglyceromutase [Listeria monocytogenes FSL J1-194] >gi|167218261|ref|ZP_02287897.1| phosphoglyceromutase [Listeria monocytogenes FSL J1-175] >gi|167454931|ref|ZP_02321154.1| phosphoglyceromutase [Listeria monocytogenes FSL J2-064] >gi|133726305|gb|EBA28003.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes FSL N1-017] >gi|133734441|gb|EBA36139.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes HPB2262] (510 aa)
Score = 146, Expect = 6.0e-07, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGANHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|78486295|ref|YP_392220.1| phosphoglyceromutase [Thiomicrospira crunogena XCL-2] >gi|123555001|sp|Q31E77|GPMI_THICR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|78364581|gb|ABB42546.1| phosphoglycerate mutase [Thiomicrospira crunogena XCL-2] (521 aa)
Score = 146, Expect = 6.0e-07, Identities = 101/404 (25%), Positives = 170/404 (42%)
  Q:   105 KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKR-NTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETI-CGLGEQAFTEASEYTNENLA----NKVMDADILPAYN----TIMDGYFVSKDDSVLFLN--SDP----------DDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           K ID ++  + K VHI  +LS      +  ++   I +   +G K  +H+  DG+D  P S  + +     F+ +     I +V GR     +  R     E V   ++ I CG  E    +A E      A    ++ + A ++P  N     + DG      DSV+F+N  SD           DDFA   R        K   LS+   +   K +   F   V  +  SL       V+K   K L +    K   +  FF  G    N+N  R +++SP   +      +S   L +K ID+I  G+YD              + D    +   E  D+ LG ++   +       +T+ +G  E + ++       + ++  VPFV+     +P K       V  ++L  +  ++   ++  TSLID
  S:   105 KAIDAASNRDHK-VHILGLLSDGGVHSHISHIKASIKMAHDRGAKVYVHIFTDGRDTAPQSALQYIEELETFMKELGGGRIASVTGRYFALDRDNR----WERVKKAYDAIACGSAEFEAKDAKEAVELAYARGENDEFIQATVIPRNNGKPARVKDG------DSVIFMNFRSDRARQLTEAFIMDDFADFHR-------CKTPVLSAFVTLTEYKKNFEKFGALVAYRPTSLRNTFGEYVSKKGLKQLRIAETEKYAHVTFFFNGGVEEPNDNEVRILINSPQVATYDLQPEMSLPELKEKLIDAIKSGEYDTFICNIANPDMVGHTGDFNACVQAAEAVDEALGEILATIKAVDGEAIVTADHGNMEMLFNEETGKPLTSHTTFPVPFVYFGKKGYPLKDGGALCDVIPTLLDMM-GIEKPEEMTGTSLID 519
>gi|150422039|gb|EDN14009.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae AM-19226] (510 aa)
Score = 146, Expect = 6.1e-07, Identities = 91/367 (24%), Positives = 153/367 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           E+    ID++     K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:    96 EVLVAAIDKAVAA-GKAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLKCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 470
>gi|145300952|ref|YP_001143793.1| phosphoglyceromutase [Aeromonas salmonicida subsp. salmonicida A449] >gi|166991368|sp|A4ST23|GPMI_AERS4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|142853724|gb|ABO92045.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Aeromonas salmonicida subsp. salmonicida A449] (509 aa)
Score = 146, Expect = 6.1e-07, Identities = 111/466 (23%), Positives = 190/466 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSL-HNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYT--------NENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           K  L+ ++ +G G + K + N +  A  PN++ L    Y   L+S           +   S    V+     ++Y E      L  + ++IK      N+E+   L   S  T  K VHI  ++S      + +++  +I +  K+G + +  H   DG+D  P S   ++  F     +         G+       GR F +D ++  D  +    L   G+  FT  S           +EN  ++ + A  + A   + DG      D+++F+N   D            DF   AR    +P L  + L+     Y   +       P      + L   +AK     L +    K   +  FF  GE +      R+I++SP   +      +SS+ L DK + +I  GKYD I    P       +      +   E  D  +GR+       G    +T+ +G AEKMLD+         ++L VP ++
  S:     5 KKPLVLVIMDGWGYSTKQEHNAVAAAKTPNLDRLARD-YTSTLISGSGLDVGLPDGQMGNSEVGHVNIGAGRIVYQE------LTRISKEIKDGDFFQNVELAKAL--DSAVTKGKAVHIMGLMSPGGVHSHEEHIMGMIEMAAKRGAEQIYFHAFLDGRDVPPRSAQSSIEQFDALFAR--------LGKGRFASMIGRYFAMDRDNRWDRVQQAYDLMTQGKGEFTADSASEALAAAYARDEN--DEFVKATRIGAAAPMQDG------DALIFMNFRADRAREITRAFVDSDFTGFAR--AATPALNFVMLTE----YAADIKTACAYPPTA--LVNTLGEWLAKQGKTQLRISETEKYAHVTFFFNGGEESCFTGEDREIVASPKVATYDLQPEMSSEELTDKLVAAIKSGKYDTIICNYPNGDMVGHTGVFDAAVKACEAVDHCVGRVTEALAEVGGECLITADHGNAEKMLDEETGQAHTAHTNLPVPLIY 468
>gi|167344569|ref|ZP_02290410.1| phosphoglyceromutase [Listeria monocytogenes FSL J1-208] (504 aa)
Score = 146, Expect = 6.5e-07, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGADHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLKPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|196127534|ref|ZP_03119283.1| phosphoglyceromutase [Clostridium difficile ATCC 43255] (509 aa)
Score = 146, Expect = 6.6e-07, Identities = 115/466 (24%), Positives = 199/466 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT----YLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFV 466
           MK  +  ++ +G G NK  KGN +  +  PN+               DR + +Y P     +   DV   D        G T+I      Y +L  + + IK   L   ++  + +D + K NS  +H+  +LS      +  +L  +I +   KG++ V +H   DG+D  P S  +        + +       TV+GR +   +  R     E V + Y   + G+GE+A    EA + + ++  N   D  I+P      D     + ++DS++F N  PD    + R +    +  G     +   +   T+ D       +    +SL   L   +AKN    L      K   +  FF  G    N+   R ++ SP   +      +S+  L DK +D +G  K+D I +          +  ++  +  +ET D  +G+LI+     G    +T+ +G AE MLD      V  +  + VPF+
  S:     1 MKKPVALIIMDGFGYNKDVKGNAIAESKTPNL---------------DRIKKEY-PNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDGDLFTNKVLCEAMDNA-KENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVHAFTDGRDTDPQSALEYAKEVQVSMDEIGVGEFATVSGRYYAMDRDKR----WERVELAYNAMVRGIGEKANSIEEAIQNSYDDGKN---DEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQITRAL-VCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGLQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGEDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAEYMLDPETGKTVTAHSINPVPFI 465
>gi|16804494|ref|NP_465979.1| phosphoglyceromutase [Listeria monocytogenes EGD-e] >gi|167213115|ref|ZP_02283422.1| phosphoglyceromutase [Listeria monocytogenes LO28] >gi|27734317|sp|Q8Y4I4|GPMI_LISMO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|16411944|emb|CAD00534.1| pgm [Listeria monocytogenes] (510 aa)
Score = 145, Expect = 6.8e-07, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WADF----------PHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGADHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|46908629|ref|YP_015018.1| phosphoglyceromutase [Listeria monocytogenes str. 4b F2365] >gi|47094181|ref|ZP_00231898.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes str. 4b H7858] >gi|50400341|sp|Q71WX0|GPMI_LISMF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|46881901|gb|AAT05195.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes str. 4b F2365] >gi|47017443|gb|EAL08259.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Listeria monocytogenes str. 4b H7858] (510 aa)
Score = 145, Expect = 6.8e-07, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVNAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGANHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|126700791|ref|YP_001089688.1| phosphoglyceromutase [Clostridium difficile 630] >gi|123362967|sp|Q181T7|GPMI_CLOD6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|115252228|emb|CAJ70068.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium difficile 630] (510 aa)
Score = 145, Expect = 7.0e-07, Identities = 114/466 (24%), Positives = 198/466 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT----YLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFV 466
           MK  +  ++ +G G NK  KGN +  +  PN+               DR + +Y P     +   DV   D        G T+I      Y +L  + + IK       ++  + +D + K NS  +H+  +LS      +  +L  +I +   KG++ V +H   DG+D  P S  +        + +       TV+GR +   +  R     E V + Y   + G+GE+A    EA + + ++  N   D  I+P      D     + ++DS++F N  PD    + R +    +  G     +   +   T+ D       +    +SL   L   +AKN    L      K   +  FF  G    N+   R ++ SP   +      +S+  L DK +D +G  K+D I +          +  ++  +  +ET D  +G+LI+     G    +T+ +G AE MLD      V  +  + VPF+
  S:     2 MKKPVALIIMDGFGYNKDVKGNAIAESKTPNL---------------DRIKKEY-PNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDGDFFTNKVLCEAMDNA-KENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVHAFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKR----WERVELAYNAMVRGIGEKANSIEEAIQNSYDDGKN---DEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQITRAL-VCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGEDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAEYMLDPETGKTVTAHSINPVPFI 466
>gi|196178481|gb|EDX73480.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Microcoleus chthonoplastes PCC 7420] (531 aa)
Score = 145, Expect = 7.1e-07, Identities = 98/467 (20%), Positives = 187/467 (40%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDY----FETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLDAVFFENPVKGKEE-----SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++ ++ +G G  +   GN + +A  P ++ L++                  P  T  +  +DV     +M   E           +   L  + + ++  S+       KL         K+ H+  + S      +  +L  +++    +G   V +H + DG+D  P S    L    + + K     I T++GR +         +D +H  D     ++ +   G      A E    +    + D  ILP   T +    +   D ++F N  PD    L + + T P+  G     +  LA +  T+ D  F   PV    E     ++L  +V++N  +        K   +  FF  G     E   R+++ SP   +     ++S+  + D  + +I K  Y ++ +          + ++   +  IET D  LG+LI      G    + + +G AE M D+  N    + ++ VPF+   G+
  S:     8 VVLVILDGWGYREARDGNAIAMARTPVMDSLLTAY----------------PSTTIRTSGKDVGLPEGQMGNSEVGHLNIGAGRVVPQELVRISDAVEDGSIRENAALQKLSQELKHQGGKL-HLIGLCSDGGVHSHINHLLGLLDFAKSQGFSDVCVHALMDGRDTNPNSGISYLQTIQEHIDKIGMGRIATISGRYYA--------MDRDHRWDRTQKAYDMLTQDGNGDGRSAVEVMQASYEADITDEFILP---TRITSGALEPGDGIIFFNFRPDRARQLTQAL-TDPEFDGFERELIKPLAFVTFTQYDPHF---PVLVAFEPQNLNNILGEVVSRNGLRQFRTAETEKYAHVTYFFNGGLELPFEGEDRELIPSPMVATYDRAPAMSAVDVTDVAVKAISKMIYSLVVINYANPDMVGHTGNIDACVKAIETVDHCLGKLIESINKVGGTAIIIADHGNAEYMRDEQGNAWTAHTTNPVPFILIEGE 469
>gi|115372568|ref|ZP_01459876.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Stigmatella aurantiaca DW4/3-1] >gi|115370530|gb|EAU69457.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Stigmatella aurantiaca DW4/3-1] (519 aa)
Score = 145, Expect = 7.4e-07, Identities = 100/405 (24%), Positives = 176/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLK-----GLFLSSLAPIYGTKLDAVFFENPVK---GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKML-------IDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           ++   +S  L N  +    +D++ K++ K  H+  ++S      +  +LF ++    ++GL  V +H   DG+D  P S    +    +FL + N+  I TV GR   +    RD   +   + Y   +   G +A  +A      + A KV D  ++P   +  DG  V +    D VLF N   D    +   +   P  K     GL L     +  T+ D   F+ PV     + + +   ++++   +        K   +  FF  G         R ++ SP    D + + L  +M        + K +DS G YD   V          S  L   +  ++  D+ LG L ++CR  G ++A+++ +G  E M D  +   PH   +L  VPF   + D   +K++    GV + I  +L
  S:    89 INRAAESGELGNNPVIRAAMDQA-KSDGKAFHLVGLVSPGGVHSSMDHLFALLKAGRERGLPQVYVHAFLDGRDTPPQSGLGYVEQLERFLKETNSGRIATVGGR---YYGMDRDKRWDRVKLAYDALVLAQGPKA-PDALSAIRASYAEKVTDEFVVPTVISQGDGSPVGRIRNGDVVLFFNFRADRAREITSAL-AFPTFKEFDRAGLQLGRYVCM--TQYDET-FDLPVAYGPDQPQDIFPEVLSRAGLRQFRTAETEKYAHVTFFFNGGREVVFPGEERHLVPSP---RDVKTYDLKPEMSAREVTSELVKRVDS-GAYDFALVNLANPDMVGHSGRLDAAIQAVKVVDECLGHLGDVCRRNGWVLAISADHGNCEMMRDP-ITGEPHTSHTLNPVPFHLIHPDFRGQKLRP---GVLADIAPSL 500
>gi|154251927|ref|YP_001412751.1| phosphoglyceromutase [Parvibaculum lavamentivorans DS-1] >gi|154155877|gb|ABS63094.1| Phosphoglycerate mutase [Parvibaculum lavamentivorans DS-1] (540 aa)
Score = 145, Expect = 7.9e-07, Identities = 82/332 (24%), Positives = 145/332 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTE-ASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASL---------ARMMKTSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLG--------LNHKKGFINKFF-GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           VH+   ++ +    + + L  +  +L  +G+K  +H + DGQD R  S  ++LS F        N  + +V GR+  F     D L +   +          E  +TE  + Y ++     V D  I P+  +   G  + +DD++L +N   D    L           +   +P L G++ L  LA   G +++ +F     KG     LA  +A+     L L          N  +G     F GE       T  +  +P     ++   L+S  + ++ + ++  G++DVI       A   R+ +++  +  IE  D+ LG++       G  + L   YG AE MLD
  S:   136 VHLIGTMTPSGISGHQRYLAVLAALLSHEGVKVWVHAVMDGQDTRAQSGIEHLSEFLDDIAGAENAELGSVMGRSFGF-----DDLSDPAAIAAAWRALANAEAPYTEYPTAYLDQCYRKGVNDDRIPPSIASSYRG--IRQDDAILLVNLQADQAHGLLGALIDPAATGLAAKAPSLSGVYSLVRLASPLGAEVEPLFEAMSFKGS----LAETIAQAGLSQLTLTETAAEASLWNFARGGAKALFPGE-------TVLVTDTPPLAQAEKKPELASAAITEELLAALKKGEHDVITANFSNAAILGRTGNIRATVEAIEAIDKCLGKIAAQVDKRGGTLVLCGMYGKAEMMLD 472
>gi|114565171|ref|YP_752685.1| phosphoglyceromutase [Shewanella frigidimarina NCIMB 400] >gi|114336464|gb|ABI73846.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella frigidimarina NCIMB 400] (513 aa)
Score = 145, Expect = 8.1e-07, Identities = 116/470 (24%), Positives = 197/470 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI--------KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKT--NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSK-FLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY----FVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLD-KHLNIVPHNKSSLVPFVFTNGD 471
           K  L  L+ +G G ++  + N +  AN P ++ L +  YP +L+S                    +D    +   G +++        +   + L    K+ + H  E    L D  +K    +  VHI  +LS      + +++  +  + +++G   V LH   DG+D  P S   +L +F + F    +    ++ GR     +  R     + V   +E I    +  FT AS       A    + D   A + I+D       +S +DS++F+N   D            DF    R    +PK+  + L+     Y   ++A     PV      L   L   +   D   L +    K   +  FF  G+    E   R ++ SP   +      +SS  L DK + +I   KYDVI    P       S +    +   E  D  +GR++  L +  G  + +T+ +G AEKM D  +      + S+LVPFV+   D
  S:     4 KRPLALLILDGWGYSEDTQDNAVFHANTPVLDKL-NAQYPHSLISGS-----------------GIDVGLPDGQMGNSEVGHINIGSGRIVYQELTRISKAIADHEFEQNAALCDAVDKAIAANGAVHIMGLLSAGGVHSHEEHIEAMCRMAVERGATKVYLHAFLDGRDTPPRSAKNSLVHFDELFASLGHGRTASIIGRYFAMDRDNR----WDRVSQAYELITE-AKGKFTYASAPEALEAAYARDENDEFVAASAIVDAQGEAAVLSDNDSLIFMNFRADRARQITRTFVNPDFDGFKR--NKTPKINFVMLTD----YAADINA-----PVAYPSSDLVNTLGETLQNLDKTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILIQSPKVATYDLQPEMSSTELTDKLVAAIESTKYDVIICNYPNGDMVGHSGNFDAAVKACEAVDACIGRVVEALAKVDGECL-ITADHGNAEKMKDPSNGQAFTAHTSNLVPFVYVGRD 475
>gi|145953668|ref|ZP_01802676.1| hypothetical protein CdifQ_04003672 [Clostridium difficile QCD-32g58] (510 aa)
Score = 144, Expect = 8.8e-07, Identities = 112/466 (24%), Positives = 197/466 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIF-NK-LIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFV 466
           MK  +  ++ +G G NK  KGN +  +  PN+               DR + +Y P     +   DV   D        G T+I     +  +  + +KS+ + + F NK L +  +      +H+  +LS      +  +L  +I +   KG++ V +H   DG+D  P S  +        + +       TV+GR +   +  R     E V + Y   + G+GE+A    EA + + ++  N   D  I+P      D     + ++DS++F N  PD    + R +    +  G     +   +   T+ D       +    +SL   L   +AKN    L      K   +  FF  G    N+   R ++ SP   +      +S+  L DK +D +G  K+D I +          +  ++  +  +ET D  +G+LI+     G    +T+ +G AE MLD      V  +  + VPF+
  S:     2 MKKPVALIIMDGFGYNKDVKGNAIAESKTPNL---------------DRIKKEY-PNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDGDFFANKVLCEAMDNAKENSLHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVHAFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKR----WERVELAYNAMVRGIGEKANSIEEAIQNSYDDGKN---DEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQITRAL-VCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGEDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAEYMLDPETGKTVTAHSINPVPFI 466
>gi|91776540|ref|YP_546296.1| phosphoglyceromutase [Methylobacillus flagellatus KT] >gi|123254049|sp|Q1GZ82|GPMI_METFK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|91710527|gb|ABE50455.1| phosphoglycerate mutase [Methylobacillus flagellatus KT] (517 aa)
Score = 144, Expect = 8.8e-07, Identities = 109/462 (23%), Positives = 197/462 (42%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKR----DVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLK-RNTPIVTVAGRNHVFGKKGR---------DFLDNEHVMDYFETICGLGEQAFT--EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNK--SSLVPFVF 467
           + ++ +G G  +    N + LAN PNI+   +  YP  L++           +T+  + R    + +     +  G    + + E +++ I S+   +  +  + ++++ K   K VHI  +LS      +  ++   I + +  G++ V +H   DG+D  P S    L    +         I ++ GR +   +  R            D +        + GL E A+   E  E+     A  +  A   P   T+ DG      D V+F+N   D            DF    R  +  PKL G +  +L     T+   +F   PV+ +  +     VA++  K L +    K   +  FF  GE        R ++ SP   +      +S+  + D+   +I   KYD I   +  C M+     S DL   +  +ET D  + R++      G  + +T+ +G  E+M D + N  PH +  ++ VP  F
  S:     7 LLVILDGFGYREDSHDNAIALANTPNIDRFWTQ-YPHTLIN---------ASETFVGLPRGQMGNSEVGHLNIGAGRVVFQDF-ERINQAIASREFFSNPVLIEAVNKA-KAGHKAVHILGLLSDGGVHSHQDHIHATIEMAVNAGVEKVYVHAFLDGRDTPPISAKPYLEKLEQACASIGGGKIASICGRFYAMDRDKRWPRVEAAYNLITDGQGEFASASALQGL-EAAYARDEKDEFVK---ATAIAAAGEQPV--TMEDG------DVVIFVNFRSDRARQLTHALLDPDFEGFNR--RRQPKLAGFYTLTLYDKAETRAKPIF--APVEIR--NTFGEYVAQHGLKQLRIAETEKYPHVTFFFNGGEEQVFAGEDRILVPSPKVATYDLQPEMSAYEVTDRLEAAILSRKYDAIICNYANCDMVGH---SGDLSASIKAVETIDTCIARIVKAMESIGGQMIITADHGNVEQMRD-YENNQPHTQHTTNQVPLFF 472
>gi|168697728|ref|ZP_02730005.1| phosphoglyceromutase [Clostridium difficile QCD-37x79] >gi|168725748|ref|ZP_02758025.1| phosphoglyceromutase [Clostridium difficile QCD-76w55] >gi|168731906|ref|ZP_02764183.1| phosphoglyceromutase [Clostridium difficile QCD-97b34] >gi|196161331|ref|ZP_03121892.1| phosphoglyceromutase [Clostridium difficile CIP 107932] (509 aa)
Score = 144, Expect = 8.9e-07, Identities = 112/466 (24%), Positives = 197/466 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIF-NK-LIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFV 466
           MK  +  ++ +G G NK  KGN +  +  PN+               DR + +Y P     +   DV   D        G T+I     +  +  + +KS+ + + F NK L +  +      +H+  +LS      +  +L  +I +   KG++ V +H   DG+D  P S  +        + +       TV+GR +   +  R     E V + Y   + G+GE+A    EA + + ++  N   D  I+P      D     + ++DS++F N  PD    + R +    +  G     +   +   T+ D       +    +SL   L   +AKN    L      K   +  FF  G    N+   R ++ SP   +      +S+  L DK +D +G  K+D I +          +  ++  +  +ET D  +G+LI+     G    +T+ +G AE MLD      V  +  + VPF+
  S:     1 MKKPVALIIMDGFGYNKDVKGNAIAESKTPNL---------------DRIKKEY-PNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDGDFFANKVLCEAMDNAKENSLHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVHAFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKR----WERVELAYNAMVRGIGEKANSIEEAIQNSYDDGKN---DEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQITRAL-VCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGEDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAEYMLDPETGKTVTAHSINPVPFI 465
>gi|161505761|ref|YP_001572873.1| phosphoglyceromutase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867108|gb|ABX23731.1| hypothetical protein SARI_03937 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (507 aa)
Score = 144, Expect = 8.9e-07, Identities = 89/365 (24%), Positives = 156/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +  V    P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    74 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTVVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVESVGGQLLITADHGNAEQMRD 446
>gi|62182197|ref|YP_218614.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|75479916|sp|Q57IC9|GPMI_SALCH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|62129830|gb|AAX67533.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (514 aa)
Score = 144, Expect = 9.0e-07, Identities = 88/365 (24%), Positives = 156/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF  +    + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAAQGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTTVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|194534525|ref|YP_002069739.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae RC385] >gi|150419241|gb|EDN11657.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae RC385] (416 aa)
Score = 144, Expect = 9.2e-07, Identities = 91/367 (24%), Positives = 153/367 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           E+    ID++     K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:     2 EVLVTAIDKAVAA-GKAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLKCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 376
>gi|168714211|ref|ZP_02746488.1| phosphoglyceromutase [Clostridium difficile QCD-63q42] (509 aa)
Score = 144, Expect = 1.1e-06, Identities = 114/466 (24%), Positives = 198/466 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT----YLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG--TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFV 466
           MK  +  ++ +G G NK  KGN +  +  PN+               DR + +Y P     +   DV   D        G T+I      Y +L  + + IK       ++  + +D + K NS  +H+  +LS      +  +L  +I +   KG++ V +H   DG+D  P S  +        + +       TV+GR +   +  R     E V + Y   + G+GE+A    EA + + ++  N   D  I+P      D     + ++DS++F N  PD    + R +    +  G     +   +   T+ D       +    +SL   L   +AKN    L      K   +  FF  G    N+   R ++ SP   +      +S+  L DK +D +G  K+D I +          +  ++  +  +ET D  +G+LI+     G    +T+ +G AE MLD      V  +  + VPF+
  S:     1 MKKPVALIIMDGFGYNKDVKGNAIAESKTPNL---------------DRIKKEY-PNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDGDFFTNKVLCEAMDNA-KENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVHAFTDGRDTDPQSALEYAKEVQVSMDEIGVGEFATVSGRYYAMDRDKR----WERVELAYNAMVRGIGEKANSIEEAIQNSYDDGKN---DEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQITRAL-VCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGEDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAEYMLDPETGKTVTAHSINPVPFI 465
>gi|168464989|ref|ZP_02698881.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195632492|gb|EDX50976.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (514 aa)
Score = 143, Expect = 1.2e-06, Identities = 88/365 (24%), Positives = 156/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF  +    + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAAQGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|16801612|ref|NP_471880.1| phosphoglyceromutase [Listeria innocua Clip11262] >gi|27734322|sp|Q928I2|GPMI_LISIN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|16415072|emb|CAC97777.1| pgm [Listeria innocua] (510 aa)
Score = 143, Expect = 1.2e-06, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WA----------NFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGANHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLKPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|56698621|ref|YP_168998.1| phosphoglyceromutase [Silicibacter pomeroyi DSS-3] >gi|81558241|sp|Q5LLW1|GPMI_SILPO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|56680358|gb|AAV97024.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Silicibacter pomeroyi DSS-3] (505 aa)
Score = 143, Expect = 1.2e-06, Identities = 87/377 (23%), Positives = 153/377 (40%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERP---YSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFT--EASEYT-NENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMK----------TSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           +D  I+  S  +       I R+ +      H+  ++S      +  ++      +   G+  V+H I DG+D  P   Y F   L +     L +   IVTV GR     +  R     E V + ++ +  G G +  T   A +Y  N++ +++ + A +L  Y+ + DG      DS+  LN   D    + R +             P L  L  +   +  +   +  VF +  +     + L   VA++  +   L    K   +  F   G+        R +  SP   +      +S+  + DK +++IG  YD+I            + DLK  +   E  DQ L R+I      G  + +T+ +G  E M+D      PH   +L P
  S:    83 IDLAIEDGSFFDNAALRDFIART-RAAGGTAHLMGLVSDGGVHGHLNHIIAAAQAITNAGVPVVMHAITDGRDVAPKSAYGFMAELED----RLPKGARIVTVTGRYFALDRDNR----WERVQEAYDAMVRGEGRRVSTAHSAIDYAYNQSESDEFITASVLTGYDGMRDG------DSLFCLNFRADRAREILRAIGEPGFADFDTGARPALSALLGMVEYSDAHNAYMTTVFPKRDIV----NTLGAWVARHGLRQFRLAETEKYPHVTFFLNGGKEEAEPGEDRFMPKSPKVATYDMQPEMSAPEVTDKFVEAIGAGYDLIVTNYANPDMVGHTGDLKAAIKACEAVDQGLSRVIAALEQAGGAMIVTADHGNCEMMIDPETG-GPHTAHTLNP 460
>gi|119492780|ref|ZP_01623866.1| phosphoglyceromutase [Lyngbya sp. PCC 8106] >gi|119452933|gb|EAW34105.1| phosphoglyceromutase [Lyngbya sp. PCC 8106] (521 aa)
Score = 143, Expect = 1.5e-06, Identities = 77/326 (23%), Positives = 135/326 (41%)
  Q:   146 KGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-YGT--KLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           KG+  V +H I DG+D  P    K L      + +     IVT++GR +   +  R     + +   +  +   GE     A E    +    + D  ++P   T +    V   D V+F N  PD    L ++    P         + P+ +GT  + DA F   PV          ++L  +++ +  K        K   +  FF  G     E   R+++ SPA  +  +   +S+  + D  I+++  G Y ++ +          +  ++     +ET DQ LGRLI      G    + + +G AE M D+  N    +  + VPF+   G+
  S:   142 KGVSQVCIHAITDGRDTNPKDGIKALQQIQDHINQIGLGQIVTLSGRYYAMDRDNR----WDRIQKAYFNMTVDGEGTELSAVEVLQRSYNEGITDEFVIP---TRLKPGTVEAGDGVIFFNFRPDRARQLTQVF-VDPNFNSFEREIIQPLAFGTFTQYDANF---PVLVAFKPQNLNNILGEVISAHGLKQFRTAETEKYAHVTYFFNGGLEQPFEGEDRELIPSPAVATYDQDPEMSADEVTDVAIEAVEKGIYSLMVINYANADMVGHTGMIEAATKAVETVDQCLGRLIESINKAGGTAIIIADHGNAEYMRDEQGNPWTAHTINPVPFILIEGE 470
>gi|57168571|ref|ZP_00367704.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Campylobacter coli RM2228] >gi|57020076|gb|EAL56753.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Campylobacter coli RM2228] (492 aa)
Score = 142, Expect = 1.6e-06, Identities = 111/467 (23%), Positives = 191/467 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFN-----ENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLA-PIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVF 467
           M+   I ++T+GIG NK+   N  + A KPN   L   + P +L+         +P+          +S    M  G   I    L  +++ I+S  L       KL+ +  +     VH+  + S       +  FNA     ++ +  K G +   H I DG+D  P S  + +        +      T+ GR +   +  R     E V +Y++ + G   +  +   +Y  E   N+  D  I  A N    G  + +DD ++F+N   D    L  ++ +      + + +F + L   +Y  K +  V FE   K + ++ L+  ++K     L      K   +  FF  G+    EN TR ++ SP   +  E   +S+  + D     I K  D I V          + D    +  +E  D  LG ++   R       +TS +G  E M DK  N++  N ++   FVF
  S:     1 MRQKCILVITDGIGFNKEKDFNAFEAAKKPNYERLFREV-PNSLIKTS-GLAVGLPEGQMG------NSEVGHMCIGSGQIIYQNLVRINKAIESCELEKNANLKKLLQKCKR-----VHVIGLYSDGGVHSMDTHFNA-----LLEICAKNGNEVFAHAITDGRDVSPTSGLEFIRKLKNHCEEIGVHFATLCGRFYAMDRDKR----WERVKEYYDCLLG-KSKGVSNWVDYIEECYQNETTDEFIQAAKNENYKG--MQEDDGLIFVNFRNDRMKQLIEVLNSQNFKEFEREKVFENLLTMSVYDDKFNIPVLFE---KEEIKNTLSETISKAGLTQLHTAETEKYAHVTFFFNGGKEELLENETRVLIPSPKVKTYDEKPEMSAFEVCDVVKKGIEKGEDFIVVNFANGDMVGHTGDFNAAVKAVEAVDVCLGEVVECARKHDYAFIITSDHGNCEAMQDKKGNLLT-NHTTFDVFVF 453
>gi|37520325|ref|NP_923702.1| phosphoglyceromutase [Gloeobacter violaceus PCC 7421] >gi|50400402|sp|Q7NMK9|GPMI_GLOVI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|35211318|dbj|BAC88697.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Gloeobacter violaceus PCC 7421] (536 aa)
Score = 142, Expect = 1.7e-06, Identities = 79/338 (23%), Positives = 143/338 (42%)
  Q:   134 KNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP----IVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++LF ++++  ++G + + +H ++DG+D  P S    ++ F K   +        I T+ GR   FG       D    M  +  +   G      ASE   E+ A    D  +LP     +    V   D V++ N  PD    L R         G    +L  LA +  T+ DA     PV         ++LL  ++A +  +   +    K   +  FF  G  T      R ++ SP   +      ++++ + D  + +I   +Y +I +          + +    +  +ET D  +GRL+  C   G  + LT+ +G AE M D+  N    + ++ VPF+    +
  S:   134 EHLFGLLDLAKREGFETLFIHGMSDGRDTPPTS---GVAYFEKLEARIAETGFGTIATLGGR--YFGMDRDRRWDRTEAM--YRVMTETGPGTGKRASETLRESHAAGKTDEFVLPVR---LAAGAVEPGDGVIYFNFRPDRARQLTRAF-VQADFDGFVRPYLDPLAFLTFTQYDATL---PVAVAFAPQSLDNLLGQVIAHHGLRQFRIAETEKYAHVTYFFNGGIETPLPGEERSMIQSPLVPTYDLKPEMAAREVTDHAVAAIETRQYSLIVINYANPDMVGHTGNFDATVKAVETVDACIGRLVEACVRAGGTMLLTADHGNAELMWDEQGNPWTAHTTNPVPFILIESE 474
>gi|146296956|ref|YP_001180727.1| phosphoglyceromutase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410532|gb|ABP67536.1| phosphoglycerate mutase [Caldicellulosiruptor saccharolyticus DSM 8903] (511 aa)
Score = 142, Expect = 1.7e-06, Identities = 103/449 (22%), Positives = 187/449 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMD-YFETICGLGEQAFT--EASE--YTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARM-----MKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           MK  ++ ++ +G G N K +GN + L   PN++Y     YP+ L+ +          +   S    ++     ++Y E         + + IK       E F   I+   K NS + H+  +LS      +  +L+ ++ +  +  L+ V +H   DG+D  P S    +    + + +     I TV GR +   +  R     E V   Y   + G GE A +  EA E  Y   N    V+   +L     +     +++ DS++F N  PD    L R           + KG F   +  +  T+ D       V  K E+L   L    +K   K L +    K   +  FF       N+   R ++ SP   +      +S+  + +  ++ I +  YDVI            +  L+  +  +E  D+ +G+++N     G ++ +T+ +G  E+M+D
  S:     1 MKKPVVLIIMDGWGYNPKQEGNAVALGKTPNLDYYEKN-YPYTLIGSSGMDVGLPEGQMGNSEVGHLNLGAGRIVYQE------FTRITKSIKDGDFFEKEEFLMAIENCKKYNSSL-HLMGLLSDGGVHSHNTHLYALLKLAKRHNLEKVYVHCFLDGRDVPPSSAKIYIEELEQKIKEIGCGKIATVMGRYYAMDRDKR----WERVEKAYNAMVFGEGEYASSGLEAVEKSYKKGNTDEFVIPTVVLENGKPVAT---INEHDSIIFFNFRPDRARQLTRAFCDVEFDGFERKKGYF--EVFFVCMTQYDVTIKNCHVAFKPENLTNTLGEYFSKLGLKQLRIAETEKYAHVTFFFNGGVEVPNVGEDRVLVPSPKVATYDLKPEMSAYEVTEALLERIERDEYDVIICNYANGDMVGHTGVLEAAIKAVEAVDECIGKVVNKVLEKGGVVIITADHGNCEQMID 451
>gi|51891386|ref|YP_074077.1| phosphoglyceromutase [Symbiobacterium thermophilum IAM 14863] >gi|81610709|sp|Q67SW0|GPMI_SYMTH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|51855075|dbj|BAD39233.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Symbiobacterium thermophilum IAM 14863] (517 aa)
Score = 142, Expect = 1.7e-06, Identities = 107/491 (21%), Positives = 206/491 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLD--EQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-----KLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           +  +  +V +G GLN   + N + +A  PN + L++  YP   L+   +    +P +         DSN   +  G   I  Y  L+     I+  S + L ++  ++DR+ K   K +H+  ++S      +  +L  +I++  ++ ++ V +H   DG+D  P S    L      L +     I T++GR +   +  R D  +      +     G+G  A + A E      A    D  + P     +DG  V + D V+F N  PD    L R +  +      + +G     L  +  T+ D  F + PV    + +   +  +VA+   + L +    K   +  FF  GE        R ++ SP   +      +S+  +  + +  I   + D I +          +  L+  +  +E  D+ LG++++     G    + + +G  ++M+D      PH   +L  VP +  +      K++    GV +++  TL
  S:     5 RRPVALIVLDGWGLNPDPRANAVAMARHPNFDRLMAR-YPHTTLTASGEAVGLLPGQMG-------DSNVGHLNLGAGRI-VYQTLVRIWRSIQDGSFYTLPVWRPVLDRA-KQPGKALHLMGLVSDGGVHSHIDHLLALIDLAKRENVERVYVHAFLDGRDVPPQSALPYLERVEAKLKETGIGAIATISGRYYAMDRDKRWDRTEKA----FLAITQGIGHTAGSVA-EAVERAYARGETDEFVQPTVIEGVDGR-VREGDGVIFFNFRPDRARQLVRALHETAFDGFKRPEGYRPVELVTM--TQYDQTFTDIPVAFGPQFVDVPMGQVVAEAGLRQLRIAETEKYAHVTYFFNGGEERVFPGEERVLVPSPKVATYDLKPEMSAYEVAREAVKWIEEDRTDFIVLNFANPDMVGHTGVLEAAIRAVEAVDECLGQVVDALLAKGGAAVIIADHGNCDQMVDYETG-APHTNHTLNPVPCILVDDQRLDAKLKP---GVLANVAPTL 492
>gi|157149230|ref|YP_001456549.1| phosphoglyceromutase [Citrobacter koseri ATCC BAA-895] >gi|157086435|gb|ABV16113.1| hypothetical protein CKO_05070 [Citrobacter koseri ATCC BAA-895] (507 aa)
Score = 142, Expect = 1.7e-06, Identities = 86/365 (23%), Positives = 149/365 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR----------------DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R                +F  +  V              F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    74 LTRLDVEIKERTFFANPVLTAAVDQA-KNTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEDKFAALGKGRVASIIGRYYAMDRDNRWDRVEQAYDLMTLAQGEFQADTAVAGLLAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIGSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEQVAKAVESVGGQLLITADHGNAEQMRD 446
>gi|91795043|ref|YP_564694.1| phosphoglyceromutase [Shewanella denitrificans OS217] >gi|123356352|sp|Q12HV5|GPMI_SHEDO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|91717045|gb|ABE56971.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella denitrificans OS217] (514 aa)
Score = 142, Expect = 1.8e-06, Identities = 101/388 (26%), Positives = 175/388 (45%)
  Q:    84 YLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSK-FLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFT------EASEYTNEN----LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKV----LVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           Y EL  + + I+        +  K ID + K N   VHI  +LS      + +++  +  + +K+G K V LH   DG+D  P S   +L++F   F       I +V GR +   +  R     + V   +E I  G G+ +++      EA+   +EN     A+ + DA    A  ++ DG      DS++F+N   D            DF    R +  +PK+  + L+     Y   + A       K    S L N + +    +    L +    K   +  FF  G+    +   R ++ SP   +      ++S  L DK +++I   KYDV+    P       + +    +   E  D  +GR++  L +  G  + +T+ +G AE+M D+        + S LVPF++   D
  S:    78 YQELTRVSKAIEEGEFEENTVLCKTIDDAIKANGA-VHIMGLLSPGGVHSHEEHIEAMCRMAVKRGAKQVYLHAFLDGRDTPPRSAKGSLAHFGDLFTTLGQGRIASVIGRYYAMDRDNR----WDRVSQAYELITQGKGKFSYSNAVDALEAAYSRDENDEFVAASSITDAQGQTA--SLNDG------DSLIFMNFRADRARQITRSVINADFDGFERAV--TPKINFVTLTE----YAADISAP------KAFSSSDLVNTLGETLQNLGKTQLRISETEKYAHVTFFFNGGKEDPFKGEDRIMIPSPKVATYDLQPEMNSTELTDKLVEAIESAKYDVVICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVAALAKVNGECL-ITADHGNAEQMTDESTGQAHTAHTSELVPFIYVGRD 476
>gi|109899912|ref|YP_663167.1| phosphoglyceromutase [Pseudoalteromonas atlantica T6c] >gi|123360337|sp|Q15PS5|GPMI_PSEA6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|109702193|gb|ABG42113.1| phosphoglycerate mutase [Pseudoalteromonas atlantica T6c] (511 aa)
Score = 142, Expect = 1.8e-06, Identities = 89/365 (24%), Positives = 153/365 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVM--DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLSSLAPI--YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPF 465
           E+    +D++ K + K VHI  +LS      +  ++F +I +  K+G K + LH   DG+D  P S    L    K   +       T+ GR +   +  R     + V   ++ I   GE AF  A     E L N     + D       I D   +   D+++F+N   D    ++R           K + + LS+   +  Y   +DA     PV     +++   +A +    L +    K   +  F+  G+    E   R ++ SP   +      ++S  L DK +++I  GK+D I    P       + +    +   E  D  +GR++   +  G    +T+ +G AEKM D+        + S LVPF
  S:    97 EVLVSNVDKAIKQD-KAVHIMGLLSPGGVHSHQDHIFAMIKLAAKRGAKKIFLHAFLDGRDTPPRSAKAPLEAADKVFEELGVGKTATLVGRYYAMDRDSR----WDRVEKAYKVIAK-GEGAFNVACAI--EGLENSYSRDENDEFMQPTVIGDAAPIEDGDALVFMNFRADRAREISRPFVEKDFSDFEKGEHIDLSAFVMLTQYAESIDAPAAYPPVA--LVNVMGEWLANHGKTQLRISETEKFAHVTFFYSGGKEDLYEGEERILIPSPKVATYDLQPEMNSTELTDKLVEAIESGKFDAIICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEAIKKVGGDCLITADHGNAEKMADETTGQAHTAHTSELVPF 467
>gi|167555540|ref|ZP_02348558.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (514 aa)
Score = 142, Expect = 1.9e-06, Identities = 88/365 (24%), Positives = 156/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+   +E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRSEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|34558324|ref|NP_908139.1| phosphoglyceromutase [Wolinella succinogenes DSM 1740] >gi|50400386|sp|Q7M7W9|GPMI_WOLSU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|34484043|emb|CAE11039.1| PHOSPHOGLYCERATE MUTASE [Wolinella succinogenes] (492 aa)
Score = 142, Expect = 1.9e-06, Identities = 107/470 (22%), Positives = 192/470 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP---IYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVP-HNKSSLVPFVFTNG 470
           M    + ++T+GIG       N    A KP  + L +   P ALLS     +  +P+          +S    M  G   I  Y +L+   +  K   +LE    L+  S++  +K +H+  + S      + ++L  +  +  + G + +LHLI DG+D  P S +K     +  L      I T++GR +   +  R     + +   F  I            EY        + D  I PA      G+     D  +F N   D    +   +  +   +G    +  P   +  T  D  F   P+   K K E  LA ++++     L +    K   +  FF  G  T  EN +R ++ SP+  +      +S+  + + T+  + + YD I V          + + +  +S +E+ D+ LGRL+   + +G  + LTS +G  E+M D+  +++  H    +  F+   G
  S:     1 MAQKTLLIITDGIGHKPSSPHNAFTQAKKPTYDSLFASA-PHALLST-HGLSVGLPEGQMG------NSEVGHMCIGAGRI-LYQDLVKISLALKD-GSLEKNPTLLGFSSR--AKRIHLAGLASDGGVHSHMEHLLGLAQIFSRLGHEVLLHLITDGRDVSPTS-SKEFIAQALALESDLIKIATISGRYYAMDRDKR----WDRIKRAFGVIARGDSPTSLTPQEYIQAQYQAGITDEFIEPAALGGYQGF--EPSDGFVFANFRSDRAREIVSALGGA-SFEGFDRGAYQPPKTLAMTSYDDSF-PFPILFPKEKVEPTLAQVISEAGLSQLHVAETEKYAHVTFFFNGGIETPWENESRVLIPSPSVATYDLKPEMSAPEVAEATLSGMRQGYDFIVVNFANGDMVGHTGNTEAAISAVESVDRELGRLLEEAKKSGYAVILTSDHGNCEEMRDERGSMLTNHTVGEVWCFILAQG 459
>gi|168235308|ref|ZP_02660366.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194733987|ref|YP_002116639.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194709489|gb|ACF88710.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (514 aa)
Score = 141, Expect = 2.2e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANSVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|169190777|ref|ZP_02850685.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Paenibacillus sp. JDR-2] >gi|169002598|gb|EDS49480.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Paenibacillus sp. JDR-2] (511 aa)
Score = 141, Expect = 2.3e-06, Identities = 87/375 (23%), Positives = 162/375 (43%)
  Q:    94 SKSLHNLEIFNK--LID--RSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY------FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           SKS+ + E F+   L+   R  K N K +H++ +LS      +  +LF ++ +  K+ L  V +H   DG+D  P S    L      + +     I TV GR +      RD         Y   + G G + +T+  +   E+    V D  ++P   T++ G        V  +DS++F N  PD    L ++  T+   +G       P     +    F   + G         ++ L  ++ +N+ K L +    K   +  FF  G +      TR ++SSP   +      +S+  +    +  I   K+D I +          S  L+  +  +E  D+ LG+++      G +  +T+ +G A+ + D++      + ++ VP + T
  S:    83 SKSIRDGEFFDNETLLGAVRHAKANGKKLHLYGLLSDGGVHSHIAHLFALLELAKKEELNEVFIHAFLDGRDVAPDSAKGYLEQLQAKIEEVGVGQIATVQGRYYAMD---RDKRWERTEKSYRAMVYGDGPK-YTDPIKAVVESYEKSVYDEFVMP---TVIVGENDKPVGLVESEDSIVFFNFRPDRAIQLGQVF-TNEDFRGFDRGEKCPKNLHFVCLTLFSETIGGYVAYSPKNLDNTLGEVLVQNNKKQLRIAETEKYPHVTFFFSGGRDVELPGETRVLISSPKVATYDLQPEMSAYEVAAAAVREIEADKHDAIILNFANPDMVGHSGMLEPTIKAVEATDECLGQVVEAVLAKGGVAIITADHGNADMVFDENGRPFTAHTTNPVPCIVT 472
>gi|127514734|ref|YP_001095931.1| phosphoglyceromutase [Shewanella loihica PV-4] >gi|166991463|sp|A3QJM4|GPMI_SHELP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|126640029|gb|ABO25672.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella loihica PV-4] (514 aa)
Score = 141, Expect = 2.3e-06, Identities = 90/388 (23%), Positives = 166/388 (42%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLA-----PIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFT--NGDLWPKKMQSNFLGVYSSIL-STLDSLDTEHKLFYTS 505
           VHI  +LS      +  ++  +  + + +G K V LH   DG+D  P S   +L  F++   +  T  I ++ GR +   +  R     + V   +E I  G     + +A E  +        D  +  +  T  DG    ++ +D+++F+N   D    + R              +PK+  + L+  A     P+    +D V           + L  ++  N    L +    K   +  FF  G+    E   R ++ SP   +      +SS  L DK +++I   +YDVI    P       + +    +   E  D  +GR++  L +  G  + +T+ +G AE+M D+        + S LVP ++    G++ P    S+      +++  T+ S  T H +   S
  S:   113 VHIMGLLSPGGVHSHESHIQAMCKMAVARGAKQVYLHAFLDGRDTPPRSAKGSLQAFNELFAELGTGRIASLIGRYYAMDRDNR----WDRVSQAYELITQGKALHLYQDAVEALDAAYGRDENDEFVASSAITDADGQVATLNDNDALIFMNFRADRARQITRSFVDPGFDGFERAVTPKINFVMLTEYAADIKAPVAYPSVDLV-----------NTLGEVLQNNGKTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILIQSPKVATYDLQPEMSSTELTDKLVEAIESTQYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVEALAKVDGECL-ITADHGNAEQMTDEQTGQAHTAHTSELVPLIYVGRKGEIAPNGRLSDLAPTMLTLMGQTVPSEMTGHSIITLS 513
>gi|116873820|ref|YP_850601.1| phosphoglyceromutase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466584|sp|A0ALE0|GPMI_LISW6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|116742698|emb|CAK21822.1| pgm [Listeria welshimeri serovar 6b str. SLCC5334] (510 aa)
Score = 141, Expect = 2.3e-06, Identities = 106/463 (22%), Positives = 189/463 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K+ +  ++ +G G   +  GN +  ANKPN +        WA            P     +   DV   +        G T+I         L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:     3 KSPVAIIILDGFGKRAETVGNAVAQANKPNFDRY------WADF----------PHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLQKAMNDLNYGEIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGANHPKNIKFVTMT-LYNPSVDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 465
>gi|160880999|ref|YP_001559967.1| phosphoglyceromutase [Clostridium phytofermentans ISDg] >gi|189042190|sp|A9KPF4|GPMI_CLOPH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|160429665|gb|ABX43228.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium phytofermentans ISDg] (514 aa)
Score = 141, Expect = 2.3e-06, Identities = 110/470 (23%), Positives = 201/470 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDS---NFYEMLYGETDIK---------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS---KDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSS----LAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGD 471
           K   + ++ +G GLN+K +GN + LA KP ++ L+                     K YP VK +         E   G +++           Y EL  + ++I+           K ++   K N+ + H+F +LS      +  +L+ ++ +  + GL+ V +H   DG+D  P S    +      + +     I +V GR +V  +  R D ++      Y   + G G +A   A E    + A  V D  +LP    + DG  ++    +DS++F N  PD    + R   T     G    S    L  +  ++ D       V  ++ S+       +A++      +    K   +  FF  G    NE   R +++SP   +      +S+  + DK +++I   KYDVI V          +      +  +E  D  +GR  +        + + + +G AE+++D + N  P   + ++ VPF+  N D
  S:     3 KKPTVLMILDGYGLNEKTEGNAIALAKKPVLDKLM---------------------KDYPFVKGNASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKEIQDGDFFENTQLIKAVENCKKNNTAL-HLFGLLSDGGVHSHITHLYGLLELAKRHGLENVYVHAFLDGRDTAPTSGKSFMEALEAKMAELGVGRIASVTGRYYVMDRDNRWDRVEKA----YAALVDGEGVEA-ANAVEAVAASYAEGVNDEFVLPTV-VVKDGKAIAPIKANDSIIFFNFRPDRAREITRAFCTD-DFDGFVRKSGRLPLTYVCFSEYDVTIPNKSVAFEKVSITNTFGEYLAEHGKTQARIAETEKYAHVTFFFNGGVEAPNEGEDRILVNSPKVATYDLQPEMSANAVADKLVEAITSLKYDVIIVNFANPDMVGHTGISDAAIKAVEAVDACVGRAYDALLSVDGQMFICADHGNAEQLVD-YTNGEPFTAHTTNPVPFILINYD 475
>gi|77958474|ref|ZP_00822507.1| COG0696: Phosphoglyceromutase [Yersinia bercovieri ATCC 43970] (515 aa)
Score = 141, Expect = 2.4e-06, Identities = 89/383 (23%), Positives = 159/383 (41%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           L  LD++IK       +     ID++ K   K VHI  +LS      + +++  ++ +  K+G   + LH   DG+D  P S   +L  F+ +F       I ++ GR +   +  R        D +     E + D    + GL    A  E  E+    +     +AD      TI DG      D+++F+N   D    + R    +    G F       +G  +    +   +K          E+     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++
  S:    81 LTRLDKEIKEGDFFTNQTLTAAIDKAVKA-GKAVHIMGLLSAGGVHSHEEHIRAMVELAAKRGATAIYLHAFLDGRDTPPRSAEPSLKRFTEQFAALGKGRIASIIGRYYAMDRDNRWDRVQLAYDLMTQAKGEFIAD--NAVAGLQAAYARNENDEFVKPTVIQAAGEADA-----TINDG------DALIFMNFRADRARQITRAF-VNADFDG-FKRDKVVNFGDFVMLTEYAADIKVACAYPPASLENTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIGSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIY 473
>gi|169830516|ref|YP_001716498.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Candidatus Desulforudis audaxviator MP104C] >gi|169637360|gb|ACA58866.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Candidatus Desulforudis audaxviator MP104C] (509 aa)
Score = 141, Expect = 2.4e-06, Identities = 95/445 (21%), Positives = 183/445 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG-----TKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L+ ++ +G G   + +GN +  A+ PN N   S ++P  +L    +     P +   S    ++     ++Y +      L  +   ++  S     +    I+ S + N   +H+  +LS      +  +LF ++ +  +   + V +H   DG+D  P +  + +     K        + +V GR +      RD         Y   + G G +A + A +   +       D  I P    + DG  V++    D+++F N  PD    + R   T  +  G F    AP +      T+ D         G +E  + L N+++++  + L L    K   +  FF  G    +    R ++ SP   +      +S++ + D  + +I KYD+I +          + DL   +  +ET D+ LGR++      G  + ++  +G AE M D
  S:     7 LVLVILDGWGCGDRVEGNAIAQADTPNWNRYRS-VWPRTVLKCSGEDVGLPPGQMGNSEVGHLNLGAGRIVYQD------LTRITRAVRDGSFFENAVLRTSIEASRR-NGHALHLMGLLSDGGVHSHISHLFALLELAGRLDQRSVYVHAFLDGRDVPPANALEYVEALEDKLKTLGYGAVASVIGRYYAMD---RDRRWERTARAYRAMVYGEGLRA-SSARQAVEKGYERGETDEFIQPTV-IVRDGRPVAQVRDGDALVFFNFRPDRARQITRSF-TDAEFGG-FERGPAPAFPDFVCLTQYDRTIVAPVAFGPQELTNTLGNVLSRHGLRQLRLAETEKYAHVTFFFNGGVEQRDPGEDRLLIPSPKVPTYDLKPEMSAREVTDAFLANIEKYDIIIMNYANPDMVGHTGDLSAAIKAVETVDECLGRVVEAVLARGGTVLVSGDHGNAEHMCD 450
>gi|120600820|ref|YP_965394.1| phosphoglyceromutase [Shewanella sp. W3-18-1] >gi|166991466|sp|A1RQ95|GPMI_SHESW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|120560913|gb|ABM26840.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella sp. W3-18-1] (514 aa)
Score = 141, Expect = 2.5e-06, Identities = 91/354 (25%), Positives = 149/354 (42%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFL---DN--EHVMDYFETICGLGEQAFT--------EASEYTNEN--LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   V    GR F    DN  + V   +E I   G+  F         EA+   +EN    +     D+     T+ DG      D+++F+N   D    + R     P   G   + +  ++   L   A     P+    E+L+  +  V +N  +  L +    K   +  FF  G+    E   R +++SP   +      +SS  L DK + +I   KYDVI    P       + +    +   E  D  +GR++      G    +T+ +G AE+M D+        + S LVPF+F   D
  S:   113 VHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKASLSHFDDLF--------TTLGHGRVASIIGRYFAMDRDNRWDRVSQAYELITQ-GKAKFQYDNAVTALEAAYARDENDEFVSSSAITDVDGKVATLQDG------DALIFMNFRADRARQITRSF-IHPDFDGFERAVVPKMHFVTLTEYAGDITAPIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILINSPKVATYDLQPEMSSTELTDKLVAAIESTKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFIFVGRD 476
>gi|124546155|ref|ZP_01705271.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella putrefaciens 200] >gi|146291151|ref|YP_001181575.1| phosphoglyceromutase [Shewanella putrefaciens CN-32] >gi|166991464|sp|A4Y1E3|GPMI_SHEPC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|124510394|gb|EAY54464.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella putrefaciens 200] >gi|145562841|gb|ABP73776.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella putrefaciens CN-32] (514 aa)
Score = 141, Expect = 2.5e-06, Identities = 91/354 (25%), Positives = 149/354 (42%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFL---DN--EHVMDYFETICGLGEQAFT--------EASEYTNEN--LANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   V    GR F    DN  + V   +E I   G+  F         EA+   +EN    +     D+     T+ DG      D+++F+N   D    + R     P   G   + +  ++   L   A     P+    E+L+  +  V +N  +  L +    K   +  FF  G+    E   R +++SP   +      +SS  L DK + +I   KYDVI    P       + +    +   E  D  +GR++      G    +T+ +G AE+M D+        + S LVPF+F   D
  S:   113 VHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKASLSHFDDLF--------TTLGHGRVASIIGRYFAMDRDNRWDRVSQAYELITQ-GKAKFQYDNAVTALEAAYARDENDEFVSSSAITDVDGKVATLQDG------DALIFMNFRADRARQITRSF-IHPDFDGFERAVVPKMHFVTLTEYAGDITAPIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGGKEEPFEGEDRILINSPKVATYDLQPEMSSTELTDKLVAAIESTKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFIFVGRD 476
>gi|168224839|ref|ZP_02650070.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (514 aa)
Score = 140, Expect = 2.5e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTAPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIHAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|168232549|ref|ZP_02657607.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194471355|ref|ZP_03077339.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194457719|gb|EDX46558.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (514 aa)
Score = 140, Expect = 2.6e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|167549049|ref|ZP_02342808.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (514 aa)
Score = 140, Expect = 2.6e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEQAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|15616119|ref|NP_244424.1| phosphoglyceromutase [Bacillus halodurans C-125] >gi|27734391|sp|Q9K716|GPMI_BACHD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|10176181|dbj|BAB07276.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus halodurans C-125] (510 aa)
Score = 140, Expect = 2.6e-06, Identities = 96/471 (20%), Positives = 202/471 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           K  +  ++ +G  +  + KGN +  ANKPN +   +  YP ALL  D +       +   S    ++     ++Y        L  ++  I+       E F   ++   +  S + HI+ ++S      +  +L+ ++ +  ++ ++ V +H   DG+D  P S    L +    + +     + T+ GR +   +  R D ++      Y   + G G  A++ A +   ++  N + D  ++P+  T  DG  V+    DD+++F N  PD    ++++  T+   +G       P     +    F   V+G         ++ L  ++A+ + K L +    K   +  FF  G         R ++ SP   +      +S+  + D  ++ I   K+DVI +          S  L+  +  +E  D+ LG++++     G    +T+ +G A++++      +  + ++ VP + T   L
  S:     3 KKPVALIILDGFAMRDEAKGNAVAQANKPNFDRYWNQ-YPHALLKADGEAVGLPEGQMGNSEVGHLNIGAGRIVYQS------LTRVNLSIREGEFFENETFLNAMNHVKEKGSSL-HIYGLVSDGGIHSHINHLYALLELAKREQVERVYIHGFLDGRDVGPTSAESYLVDLEAKMKELGVGELATLHGRYYAMDRDKRWDRVEKS----YRAMVYGEGP-AYSSALDVIKDSYENSIHDEFVIPSVITNEDGSPVATIEDDDAIIFFNFRPDRAIQMSQVF-TNKDFRGFDRGEKLPQNVYYVCLTHFSETVQGDVAFKPTNLDNTLGEVLAQQNYKQLRIAETEKYPHVTFFFSGGREEPFPGEERILIDSPKVATYDLKPEMSAYEVTDALLNEIEADKHDVIILNFANPDMVGHSGMLEPTIKAVEAVDECLGKVVDAILAKGGAAVITADHGNADEVVTLEGKPMTAHTTNKVPVIVTEEGL 476
>gi|24371649|ref|NP_715691.1| phosphoglyceromutase [Shewanella oneidensis MR-1] >gi|27734302|sp|P59175|GPMI_SHEON 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|24345411|gb|AAN53136.1|AE015456_6 phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella oneidensis MR-1] (514 aa)
Score = 140, Expect = 2.7e-06, Identities = 90/365 (24%), Positives = 159/365 (43%)
  Q:   107 IDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSK-FLLKRNTPIVTVAGRNHVFGKKGR--------DFLDNEHVMDYFETICGLGEQAFT--EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFFG----ENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           +D + KT    VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F   F    +  I ++ GR     +  R        D +        ++      E A++  E  E+ +   ++ + DA+   A  T+ DG      D+++F+N   D    + R    +P+  G   +    +    L   A   + P+    ++L+  +  V +N  +  L +    K   +  FF     E  N E+  R +++SP   +      +SS  L DK + +I   KYDVI    P       + +    +   E  D  +GR++      G    +T+ +G AE+M D+        + S LVPFVF   D
  S:   103 VDAAVKTGGA-VHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKSSLSHFDDLFTTLGHGRIASIIGRYFAMDRDNRWDRVSQAYDLITQGKSKFQYDNAVTALEAAYSRDENDEFVS---SSAITDANGQVA--TLQDG------DALIFMNFRADRARQITRSF-INPEFDGFARAVTPKVNFVTLTEYAADIKAPIAYPSDNLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGGKEEPFNGED--RILINSPKVATYDLQPEMSSTELTDKLVAAIESTKYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVEALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVFVGRD 476
>gi|15891468|ref|NP_357140.1| phosphoglyceromutase [Agrobacterium tumefaciens str. C58] >gi|27734314|sp|Q8UAA5|GPMI_AGRT5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|15159878|gb|AAK89925.1| 2,3-Bisphosphoglycerate-Independent phosphoglycerate mutase [Agrobacterium tumefaciens str. C58] (505 aa)
Score = 140, Expect = 2.8e-06, Identities = 83/331 (25%), Positives = 134/331 (40%)
  Q:   140 INVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-------------FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNG 470
           + +++  GLK V+H I DG+D  P S    ++      L +   I TV GR +   +  R     E V   ++  + G GE A  +A     ++ ANKV D  ILP   T++DGY             F +     + L    DDF   AR       L G+        Y T+          K    + L   VAK       L    K   +  F         +   R +  SP   +      +S+  + +K ++ IGK YD+I            + DL+  +   E  D+ LG ++      G  + + + +G  E M+D  +   PH  + ++ VP +   G
  S:   134 VKLMVSHGLKVVVHAITDGRDVAPQSAEDFVAALVAS-LPQGASIGTVIGRYYAMDRDNR----WERVEKAYDAMVLGKGEHA-RDAVSAVAQSYANKVTDEFILP---TVIDGYEGFKAGDGLFCLNFRADRAREILLAIGADDFDGFAREKPVLSALLGMVE------YSTRHSDFMTTAYPKRDIVNTLGAWVAKQGLTQFRLAETEKYPHVTFFLNGGKEEPEVGEDRFMPKSPKVATYDLQPEMSAAEVTEKFVEVIGKGYDLIVTNYANPDMVGHTGDLQAAIKACEAVDRGLGAVVAALEKVGGAMLVIADHGNCETMVDP-VTGGPHTAHTTNPVPVILFGG 467
>gi|182419824|ref|ZP_02951064.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium butyricum 5521] >gi|182376372|gb|EDT73954.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium butyricum 5521] (512 aa)
Score = 140, Expect = 2.9e-06, Identities = 105/468 (22%), Positives = 195/468 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTN 469
           K  ++ ++ +G GL  K +GN + LANKPN + L +  YP + L     +      +   S    ++     ++Y E      L  + + I        E     ++ + KT S + H+  +LS      +  +L  ++    K+G++ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE A T A E   ++  +   D  +LP   T        +   DSV+F N  PD    + R +    +  G    +L  ++   T+ D       V    ++L   L   V+      L +    K   +  FF      EN    RK++ SP   +      +S+  + ++ +  +   KYD+I +          +  ++  +  IE  D+ LG ++N        + +T+ +G AE  +D    N    + ++ VPFV+ +
  S:     3 KKPVMLMILDGFGLAPKSEGNAVSLANKPNFDRLTAN-YPTSQLQASGMQVGLPEGQMGNSEVGHLNIGSGRIVYQE------LTRITKAISDGDFFENESIKLAMENAKKTGSAL-HLMGLLSDGGVHSHIDHLKGLLEFAKKEGVQNVFVHAFMDGRDVPPSSGKEFIEKCEAMMAEVGVGKIATISGRYYAMDRDNR----WERVELAYNALVLGKGETA-TSAVEAIEKSYHDNKTDEFVLPTVITENGAPLTNIKNGDSVVFFNFRPDRAREITRAI-NDKEFAGFKRETLDLVFVTMTQYDKTLEGVNVAYTPQTLVNTLGEYVSSKGLNQLRIAETEKYAHVTFFFNGGVEKENPGEDRKVIPSPKVATYDLKPEMSAYEVTEELLARLDSDKYDMIILNFANPDMVGHTGVVEAAVKAIEAVDECLGNVVNKVLEKDGTVFITADHGNAETEIDFSTGNPFTAHTTNPVPFVWVS 471
>gi|187734820|ref|YP_001876932.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Akkermansia muciniphila ATCC BAA-835] >gi|187424872|gb|ACD04151.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Akkermansia muciniphila ATCC BAA-835] (514 aa)
Score = 140, Expect = 3.0e-06, Identities = 87/399 (21%), Positives = 167/399 (41%)
  Q:   111 NKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS---PKLKGLFLSSLAP----IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDP 509
           ++  S  +H+  ++S      +  +L  ++    + G++ + +H I DG+D  P S    +    + +      I TV GR   F    RD   + + + +   + G GEQ     +EY  +  A    D  + P      +   V  +D V F N   D     AR M  +   P+  G F   + P    +  T+ DA +  +P+  ++E L      +V++     L +    K   +  FF  G  T      R ++ SP    T D +   +S+  + DK +D++ KYDV+ +          +  ++  ++  E  D  L + +      G  + +T+ +G AE M ++  +    + ++LV  ++   D     +    L   +  L +L  L    ++   SL+ P
  S:   109 SQAASSRLHLLGLVSDGGVHSHINHLIGIVKYAYEAGVRDICIHAITDGRDCSPTSGVGFIRQLEEAVRPYGAKIATVVGR---FYAMDRDKRWDRNKLAWDAIVLGRGEQCSCSPAEYVEQCYAKGETDEFLKPGIFAYGNEQRVRDNDVVFFFNFRADR----ARQMSDAFLYPEFDG-FDREVTPKVHYVTLTEYDAKY-PSPIVFEQEQLNNIFGQIVSEAGKTQLRIAETEKYAHVTFFFNGGVETQFPGEDRILVPSPREVATYDLKP-QMSAAEVADKFVDAVNKYDVVIMNFANGDMVGHTGFVEAGIAACEAVDSALEKCVKKVLELGGKLLITADHGNAEHMRNEDGSPNTAHTTNLVDLIYVADDKDQVTLSDGILADVAPTLLSLMGLKQPAEMSGHSLVTP 512
>gi|56964782|ref|YP_176513.1| phosphoglyceromutase [Bacillus clausii KSM-K16] >gi|81600752|sp|Q5WDK8|GPMI_BACSK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|56911025|dbj|BAD65552.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus clausii KSM-K16] (510 aa)
Score = 140, Expect = 3.1e-06, Identities = 104/467 (22%), Positives = 203/467 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKG-------KEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K  +  ++ +G GL ++ KGN +  A KPN +   +  +P A L  D + N  +P+          +S    +  G   I    L  ++  I+       E F K +D   +  S + HI+ +LS      +  +++ ++++  ++ ++ V +H   DG+D  P S    L     KF       + TV GR +   +  R D ++      Y   + G G  ++    E  +++  N ++D  ++P+  T  DG     V  DD+V+F N  PD    L+++  T+   +G       P     +    F   VKG         ++ L  ++++ +   L +    K   +  FF     +E     R +++SP   +      +S+  + D  +  I   K+DVI +          S  L+  +  IE  D+ LGR+++     G    +T+ +G A++++      +  + ++ VP + T
  S:     3 KKPVALIILDGFGLREEEKGNAVAHAQKPNFDRYWNE-FPHATLRADGE-NVGLPEGQMG------NSEVGHLNIGAGRIVYQSLTRVNLSIREGDFFKNETFIKAMDHVKEKQSAL-HIYGLLSDGGIHSHIDHIYALLDMAKQQNVERVYVHGFLDGRDVGPTSAEVYLKGLQDKFDEVGLGKLATVHGRYYAMDRDKRWDRVEKS----YRAMVYGEGP-SYKNGLELLDDSYKNNIVDEFVIPSVITEEDGTPVATVKDDDAVIFCNFRPDRAIQLSQVF-TNEDFRGFDRGEKMPKRLHFVCLTKFSETVKGFVAFKPTNLDNTLGEVLSQQNYTQLRIAETEKYPHVTFFFSGGREDEFPGEERILINSPKVATYDLKPEMSAYEVTDALVKEIEGEKHDVIILNFANPDMVGHSGMLEPTVKAIEAVDECLGRVVDALLQKGGAAIITADHGNADEVVTLDGKPMTAHTTNKVPVIVT 472
>gi|167771104|ref|ZP_02443157.1| hypothetical protein ANACOL_02458 [Anaerotruncus colihominis DSM 17241] >gi|167666774|gb|EDS10904.1| hypothetical protein ANACOL_02458 [Anaerotruncus colihominis DSM 17241] (512 aa)
Score = 140, Expect = 3.2e-06, Identities = 117/467 (25%), Positives = 184/467 (39%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV---DSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK-----LIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNE-NLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKG---------LFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIA-----EAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVF 467
           MK  L  ++ +G G N +  GN +  A KP I+ L +                  P     +   DV   D        G T+I     +  E  + SKS+ + + F        ID   K NS + H+  + S      +  +L+ ++ +    GL  V +H   DG+D  P S    L      + +     I TV GR +   +  R       V   +  I   GE  F  +   T E +   +V D  I P       G  V  +DS++F N  PD    L R     P+  G         +F   +     T+ DA      V  K ESL       ++      L +    K   +  FF  G         R ++ SP   +      +S+  + D+ +  I  GKYDVI   +  C M+      EAAR +        +E  D  LGR +      G    +T+ +G A++M +   +    + ++ VP  F
  S:     8 MKKPLALIILDGFGYNPRDYGNAIAAAKKPTIDSLYAN----------------CPHTLIGASGMDVGLPDGQMGNSEVGHTNIGAGRIVYQELTRISKSIEDGDFFRNSALTAAIDNCKKHNSAL-HLMGLCSDGGVHSHITHLYGLLRLARDAGLHDVWVHCFMDGRDVPPTSGRDYLEALEAEMNRIGVGRIATVMGRYYAMDRDNR----WTRVERAYNAIVN-GEGNFNPSVVDTAEKSYGAEVTDEFIEPTVCQKDAG--VKDNDSIIFYNFRPDRARELTRTF-VDPQFNGFERKGGQKHVFFVCM-----TQYDATMPNVEVAFKPESLTNTFGKYISDKGMTQLRIAETEKYAHVTFFFNGGVEEPYPGEDRALIPSPQVATYDMQPEMSAFTVTDEVVRRIESGKYDVIILNYANCDMVGHTGVFEAARKA--------VEAVDTCLGRTLAAIEKMGGRALITADHGNADQMFEDDGSPFTAHTTNPVPLFF 472
>gi|16766989|ref|NP_462604.1| phosphoglyceromutase [Salmonella typhimurium LT2] >gi|161936206|ref|YP_152669.2| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167541917|ref|ZP_02337493.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167994324|ref|ZP_02575416.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168220150|ref|ZP_02645382.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168241882|ref|ZP_02666814.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168260542|ref|ZP_02682515.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168473252|ref|ZP_02702275.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818467|ref|ZP_02830467.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194450570|ref|YP_002047735.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|27734321|sp|Q8ZL56|GPMI_SALTY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|85541655|sp|Q5PBZ2|GPMI_SALPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|16422271|gb|AAL22563.1| phosphoglyceromutase [Salmonella typhimurium LT2] >gi|194408874|gb|ACF69093.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (514 aa)
Score = 140, Expect = 3.3e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|16504911|emb|CAD03290.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139732|gb|AAO71297.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (507 aa)
Score = 139, Expect = 3.4e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    74 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 446
>gi|167215152|ref|ZP_02285459.1| phosphoglyceromutase [Listeria monocytogenes FSL R2-503] (452 aa)
Score = 139, Expect = 3.5e-06, Identities = 88/380 (23%), Positives = 160/380 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           L  +D+ I+       +  N     + + NS + H+F +LS      +  +L  ++     KG+K V +H   DG+D  P S  + L    K +   N   I TV+GR +   +  R     E V   ++ I     + F +  E    + AN   D  ++PA  T  DG     V  +D+V+F N  PD    L+            + +   K +   ++  +Y   +DA     P++ K  +++  +++      L +    K   +  F     N E     R +++SP   +      +S+  + D  ++ I   K+D I +          S  L+  +  IE  D++LGR+++L    G    + + +G +E M        PH   + VP
  S:    21 LTRIDKAIEEGEFQENKALNNAFTHTKENNSDL-HLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIHAFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKR----WERVEKAYKAIVSAEGEKFEDPIELVKASYANDKNDEFVVPAIIT-KDGKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDHFDRGANHPKNIKFVTMT-LYNPSIDAEVAFEPIEMK--NVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIKNDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNSETMSTPEGK--PHTAHTTVP 407
>gi|86610111|ref|YP_478873.1| phosphoglyceromutase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123500917|sp|Q2JIE9|GPMI_SYNJB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|86558653|gb|ABD03610.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Synechococcus sp. JA-2-3B'a(2-13)] (530 aa)
Score = 139, Expect = 3.5e-06, Identities = 80/337 (23%), Positives = 142/337 (42%)
  Q:   135 NLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFL-LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +L+ ++ +  +  +   +H I DG+D  P    + L+   K L    N  I T++GR +   +  R     E     +E +   G      A+E      A  + D  I P   T +    V   D+VLF N  PD    L +     P   G     L +L  I  T+ +A   + PV+          LL  +V++   K L +    K   +  FF  G         R ++ SP  T+  +   +S+  + DK I++I +  Y ++ +          + + +  +  +ET D+ LGRL+      G    + + +G AE M D++ N    + ++ VP +   G+
  S:   131 HLYGLLKLAAQAEIPAYVHAITDGRDTLPRDGARVLAALEKELQWLGNGVIATLSGRYYAMDRDRR----WERTQKAYEIMTQDGPGRGQSAAEVMEAFYAQDLTDEFIPP---TRLAPGAVQPGDAVLFFNFRPDRARQLTQAF-VCPDFSGFQRPLLPALTFITMTQYEA---DLPVQVLFKPQNLNHLLGQVVSEAGLKQLRIAETEKYAHVTYFFNGGIEQPFPGEDRILVQSPLVTTYDQAPEMSAVEVTDKAIEAIARREYSLVVLNYANPDMVGHTGNYEATIRALETVDRCLGRLLAAVVDAGGTTLILADHGNAELMWDENGNPWTAHTTNPVPCILVEGE 469
>gi|56129851|gb|AAV79357.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (507 aa)
Score = 139, Expect = 3.5e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    74 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 446
>gi|91228392|ref|ZP_01262318.1| phosphoglyceromutase [Vibrio alginolyticus 12G01] >gi|91188033|gb|EAS74339.1| phosphoglyceromutase [Vibrio alginolyticus 12G01] (510 aa)
Score = 139, Expect = 3.7e-06, Identities = 85/365 (23%), Positives = 151/365 (41%)
  Q:   107 IDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQA---FT--------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGD 471
           ID + K   K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K         G+  V    GR + +D ++  D  +    L  QA   FT        EA+    EN  ++ + A  + A     +   +   D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF     N  E   R++++SP   +      +SS  L DK + +I  GK+D I    P       +   +     IE  D+ +G+++   +  G  + +T+ +G AE M+D     +    ++L VP ++  GD
  S:   102 IDSAVKA-EKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLQRFQDLFAK--------LGKGRVASLVGRYYAMDRDNNWDRVQVAYDLLTQAKAEFTAETAVAGLEAAYAREEN--DEFVKATAIKAEG--QEDAIMQDGDAVIFMNYRADRARQITRAF--VPAFDGFERAVFPAINFVMLTQYAADIPLAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGGVENEFEGEERQLVASPKVATYDMQPEMSSPELTDKMVAAIKSGKFDTIICNYPNADMVGHTGVYEAAEKAIEALDESVGKVVEAIKEVGGQLLITADHGNAEMMIDPETGGIHTAHTNLPVPLIYV-GD 473
>gi|161486772|ref|NP_807437.2| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|161501906|ref|NP_458223.2| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|27734319|sp|Q8Z2F0|GPMI_SALTI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (514 aa)
Score = 139, Expect = 3.8e-06, Identities = 88/365 (24%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM----VAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+     Y   +       P        LAN     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTE----YAADIKTAVAYPPAS------LANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|163802735|ref|ZP_02196625.1| phosphoglyceromutase [Vibrio campbellii AND4] >gi|159173442|gb|EDP58264.1| phosphoglyceromutase [Vibrio campbellii AND4] (510 aa)
Score = 139, Expect = 4.2e-06, Identities = 86/365 (23%), Positives = 152/365 (41%)
  Q:   107 IDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQA---FT--------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGD 471
           ID + K   K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K         G+  V    GR + +D ++  D  +    L  QA   FT        EA+    EN  ++ + A  + A +   +   +   D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF     N  E   R++++SP   +      +SS  L +K + +I  GK+D I    P       +   +     IE  D+ +G+++   +  G  + +T+ +G AE M+D     V    +SL VP ++  GD
  S:   102 IDSAVKA-EKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLQRFQDLFTK--------LGKGRVASLVGRYYAMDRDNNWDRVQVAYDLLTQAKAEFTAETAVAGLEAAYAREEN--DEFVKATAIKAED--QEDAIMQDGDAVIFMNYRADRARQITRAF--VPAFDGFERTVFPTINFVMLTQYAADIPLVAAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGGVENEFEGEERQLVASPKVATYDMQPEMSSPELTEKMVTAIKSGKFDTIICNYPNADMVGHTGVYEAAEKAIEALDESVGKVVEAIKEVGGQLLITADHGNAEMMIDPTTGGVHTAHTSLPVPLIYV-GD 473
>gi|118475593|ref|YP_892503.1| phosphoglyceromutase [Campylobacter fetus subsp. fetus 82-40] >gi|118414819|gb|ABK83239.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter fetus subsp. fetus 82-40] (487 aa)
Score = 139, Expect = 4.3e-06, Identities = 114/470 (24%), Positives = 190/470 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISG-----IYPWAL---LSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL-------FLSSLAPI--YGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVP-HNKSSLVPFVFTNG 470
           M    I ++T+GIG NK    N    A KP  ++L        I    L   L + +  N  +   T  S +         +LY        L  +D+ I   SL   E+   LI +  +     VHI  + S      + K+   + N+  + G +   H I DG+D  P S   F K L   SKF       I +++GR +   +  R     E V   ++ I           ++Y   +  NK+ D  I PA  +   G  +  +D ++F+N   D     AR + ++  +K            +L  +  Y  K +  + FEN    + +  LA ++A+N+ + L      K   +  FF  G+    EN  R ++ SP   +  E   +S+  +    I +I    D I V          + D    +  +E  D+ LG +I   +  G      S +G  E M DK   ++  H    +  F+  +G
  S:     1 MNKKCILVITDGIGYNKSSDFNAFAAAKKPTYDWLFKNAPMNYIKTSGLAVGLPDGQMGNSEVGHMTIGSGR---------ILYQN------LVKIDKAIDDGSLEKNEVLLNLIKKVKR-----VHIIGLYSDGGVHSHLKHFDVICNICKQNGKETFAHAITDGRDVSPTSGLGFIKELE--SKF------KIASISGRFYAMDRDKR----WERVNKAYQVISQNSNLQNITPTQYIQNSYNNKIFDEFIEPASFSDFGG--IRSEDGIIFVNFRNDR----AREICSALSIKDFNEFQRKNICENLITMTNYDDKFNFPIMFENE---EIKDTLAEIIARNNLRQLHTAETEKYAHVTFFFNGGKEELVENEIRVLIPSPKVKTYDEKPQMSAYEVTQAVIKAINDGIDFIVVNYANGDMVGHTGDFDAAVKAVEAVDECLGLVIKAAKKEGYSYMQISDHGNCEAMQDKKGGVLTNHTTFDVFAFILADG 454
>gi|91773854|ref|YP_566546.1| phosphoglyceromutase [Methanococcoides burtonii DSM 6242] >gi|121689100|sp|Q12UT0|GPMI_METBU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|91712869|gb|ABE52796.1| phosphoglycerate mutase [Methanococcoides burtonii DSM 6242] (518 aa)
Score = 138, Expect = 4.4e-06, Identities = 98/448 (21%), Positives = 191/448 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDP------------DDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K   +  + +G G + + +GN +  AN PN++ L+   YP  LLS   +       +   S    ++     ++Y +      L  ++  I +       +  + I+ + K     +H+  + S+     + K+L  +I     +G+  + +H   DG+D  P +  +++    ++    +   I TV+GR +   +  R     +   D +  I  G G        +  +E       D  I P      +G  + +   +D+V+F N  P            D+F +  R  K+ PK+  + ++     Y  KL     E P+    E L   L  +++K   K L +    K   +  FF  G    NE   R ++ SP   +      +S+  + ++ I+ I  GKYDVI +    +     S  ++  +  +E  D  +G++I   +  G    + + +G AEKM++
  S:     5 KRPFLLTILDGWGYSPEVEGNAIHAANTPNLDDLLE-TYPNTLLSASGEDVGLPEGQMGNSEVGHLNIGAGRVVYQD------LTRINRDIGNGDFFKNPVLKQAIENA-KAQGSALHLMGLFSYGGVHSHMKHLRALIEFAKDEGITEIFIHAFLDGRDVSPRAALEDMKEHVEYCNNLSVGKIATVSGRYYAMDRDNR----WDRTEDAYNAITRGDGVYYSKGPVDAISEGYGRGENDEFIKPTVIVDENGRPIGRMNENDTVIFFNFRPDRARQLTYAFVNDEFDNFER--KSHPKVHFVCMTE----YDEKL-----EVPIAFPSEELKNTLGEVLSKEGIKQLRIAETEKYAHVTFFFNGGVEKQNEGEERCLIPSPKVATYDLKPEMSAYEVTEELIERIGSGKYDVIVLNLANMDMVGHSGIMEAAVKAVEVVDDCVGKIITAIKEVGGEAMVMADHGNAEKMVE 454
>gi|153802852|ref|ZP_01957438.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MZO-3] >gi|124121607|gb|EAY40350.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio cholerae MZO-3] (510 aa)
Score = 138, Expect = 4.5e-06, Identities = 90/367 (24%), Positives = 152/367 (41%)
  Q:   101 EIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL-----GEQAFTEASE-----YTNENLANKVMDADILPAYN---TIMDGYFVSKDDSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           E+    ID++     K VH+  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K     I ++ GR +         +D ++  D  E    L     GE  +  A E     Y  E     V   +I  A      + DG      D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I   KYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:    96 EVLVAAIDKAVAA-GKAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAEASLKRFQDLFAKLGKGRIASIVGRYYA--------MDRDNNWDRVEKAYDLLTLAQGEFTYDSAVEALQAAYAREENDEFVKATEIRAAGQESAAMQDG------DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLKCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSXKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 470
>gi|117918510|ref|YP_867702.1| phosphoglyceromutase [Shewanella sp. ANA-3] >gi|166991465|sp|A0KR77|GPMI_SHESA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|117610842|gb|ABK46296.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella sp. ANA-3] (514 aa)
Score = 138, Expect = 4.6e-06, Identities = 91/354 (25%), Positives = 156/354 (44%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSK-FLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMD--GYFVSKDD--SVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFFG----ENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F   F    +  I ++ GR     +  R     + V   +E I   G+  F   +  T    A +  + D   + + I D  G   S +D  +++F+N   D            DF    R +  +PK+  + L+     Y   + A     P+    E+L+  +  V +N  +  L +    K   +  FF     E  N E+  R +++SP   +      +SS  L DK + +I   +YDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D+        + S LVPFVF   D
  S:   113 VHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKGSLSHFDDLFTTLGHGRIASIIGRYFAMDRDNR----WDRVSQAYELITQ-GKAKFQYDNAVTALEAAYERNENDEFVSSSAITDSEGKVASLNDGDALIFMNFRADRARQITRSFINADFDGFERAV--TPKVNFVTLTE----YAADIKA-----PIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGGKEEPFNGED--RILINSPKVATYDLQPEMSSTELTDKLVAAIESAQYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVFVGRD 476
>gi|194446578|ref|YP_002042954.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194405241|gb|ACF65463.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (514 aa)
Score = 138, Expect = 5.2e-06, Identities = 87/365 (23%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|117617846|ref|YP_854823.1| phosphoglyceromutase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559253|gb|ABK36201.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (574 aa)
Score = 138, Expect = 5.2e-06, Identities = 109/466 (23%), Positives = 192/466 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSL-HNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYT--------NENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           K  L+ ++ +G G + K + N +  A  PN++ L    Y   L+S           +   S    V+     ++Y E      L  + + I+      N+E+  K +D +  T  K VHI  ++S      + +++  +I +  K+G + +  H   DG+D  P S   ++  F     +         G+       GR + +D ++  D  +    L   G+  FT  S           +EN  ++ + A  + A   + DG      D+++F+N   D            DF   AR    +P L  + L+     Y   +       P      + L   +AK     L +    K   +  FF  GE        R+I++SP   +      +SS+ L DK + +I  GKYDVI    P       +      +   E  D  +GR+ +     G    +T+ +G AEKM+D+         ++L VP ++
  S:    70 KKPLVLVIMDGWGYSTKQEHNAVAAAKTPNLDRLARD-YTSTLISGSGLDVGLPDGQMGNSEVGHVNIGAGRIVYQE------LTRISKDIQDGDFFQNVEL-AKAVDAA-VTKGKAVHIMGLMSPGGVHSHEEHIMGMIEMAAKRGAEQIYFHAFLDGRDVPPRSAQSSIEQFDALFAR--------LGKGRFASMIGRYYAMDRDNRWDRVQQAYDLMTQGKGEFTADSASEALAAAYARDEN--DEFVKATRIGAAAPMQDG------DALIFMNFRADRAREITRAFVDSDFTGFART--ATPALNFVMLTE----YAADIKTACAYPPTA--LVNTLGEWLAKQGKTQLRISETEKYAHVTFFFNGGEEACFTGEDREIVASPKVATYDLQPEMSSEELTDKLVGAIKSGKYDVIICNYPNGDMVGHTGVFDAAVKACEAVDHCIGRVTDALAEVGGECLITADHGNAEKMMDEETGQAHTAHTNLPVPLIY 533
>gi|89098798|ref|ZP_01171679.1| phosphoglyceromutase [Bacillus sp. NRRL B-14911] >gi|89086474|gb|EAR65594.1| phosphoglyceromutase [Bacillus sp. NRRL B-14911] (511 aa)
Score = 138, Expect = 5.3e-06, Identities = 107/467 (22%), Positives = 205/467 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEI------FNK---LIDRSN--KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K+ +  ++ +G  L  +  GN +  ANKPN                +R  NKY P  T  +    V     E   G +++  +L +   +I  +SL  + +      F K    +D  N  K N K +H+F +LS      +  +L+ ++ +   +GLK V +H   DG+D  P +  K +    + + +       T++GR +   +  R D ++      Y   + G G  ++++  +   +N  N + D  ++P+  T  +G  V+    +DSV+F N  PD            DF S  R       L  +  +     +   +D      P     ++ +  ++A+N+ K L +    K   +  F   G         R +++SP   +      +S+  + D  +  I    +D I +          S  L+  +  IET D+ LGR+++L    G    +T+ +G A++++    N +  + ++ VP + T
  S:     3 KSPVALIILDGFALRGERMGNAVAQANKPNF---------------ERYWNKY-PHSTLQASGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRVNVAIREGEFEKNQTFLDAINHAKENDKALHLFGLLSDGGVHSHIHHLYALLKLAADEGLKKVYIHGFLDGRDVGPKTAEKYIKEAQEKIKEYGVGEFATISGRYYSMDRDKRWDRVEKS----YRAMVYGDGP-SYSDPLDLVEDNYKNGIFDEFVIPSVITRENGEPVATIEDNDSVIFYNFRPDRAIQISNTFTNKDFRSFDRGPGHPQNLHFVCFTH----FSETVDGYVAFKP--NNLDNTVGEVLAQNNLKQLRIAETEKYPHVTFFMSGGREEKFPGEERILINSPKVATYDLQPEMSAYEVTDALVKEIEADNFDAIILNFANPDMVGHSGMLEPTVKAIETVDECLGRIVDLIIQKGGHAIITADHGNADEVVTLEGNPMTAHTTNPVPVIVT 472
>gi|161616782|ref|YP_001590747.1| phosphoglyceromutase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|189042200|sp|A9MVK6|GPMI_SALPB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|161366146|gb|ABX69914.1| hypothetical protein SPAB_04601 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (514 aa)
Score = 138, Expect = 5.3e-06, Identities = 87/365 (23%), Positives = 155/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G         R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFANPVLTNAVDQA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAEASLKKFEDKFAALGKGRVASIVGRYYAMDRDNRWDRVEKAYDLMTLAQGEFQADTAVAGLQAAYARDENDEFVKATVILAEGQADAAMEDGDTLIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEEPFAGEERILINSPKVATYDLQPEMSSAELTEKLVAAIESGKYDTIICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVESVGGQLLITADHGNAEQMRD 453
>gi|56459344|ref|YP_154625.1| phosphoglyceromutase [Idiomarina loihiensis L2TR] >gi|81600214|sp|Q5QZA9|GPMI_IDILO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|56178354|gb|AAV81076.1| Phosphoglyceromutase [Idiomarina loihiensis L2TR] (511 aa)
Score = 138, Expect = 5.6e-06, Identities = 87/390 (22%), Positives = 156/390 (40%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI--------YGTKLDA--VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           VHI  +LS      +  +L  +I + +++G + V LH   DG+D  P S   ++  F     +       T++GR     +  R     +     +  + G+     T+A E   E       D  + P    I     ++  DSV F+N   D    + +         G    S A I        Y   L+A   F   P+     ++L   +AK+D   L +    K   +  FF  G     E   R ++ SP   +      +SS+ L D+ + +I    +DV+    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D         + + LVPF++      P K ++  L   +  +  L  ++   ++  TSL+
  S:   113 VHIMGLLSAGGVHSHEDHLVAMIEMAVEQGAEDVYLHAFLDGRDTPPKSALPSIERFEALFARLGKGRFATLSGRFFAMDRDKRWERIEQSYKAVYHGLSGVTSANATDAVENAYERGET---DEFVTPV--VIGQPAPIANGDSVFFMNFRADRAREMTQAF-VDKDFDGFDRGSRADISEFVMLTQYADTLEAPSAFPPEPLN----NVLGEWLAKHDKTQLRISETEKYAHVTFFFSGGREQEFEGEKRVLIPSPKVKTYDLQPEMSSEQLTDELVAAIESQAFDVVICNYPNGDMVGHTGNFDAAVKACEAVDHSVGRVVSALEAVGGECLITADHGNAEQMSDATTGQAHTAHTNELVPFIYVGR---PAKARNGRLSDVAPTILHLIGMEQPDEMTGTSLM 506
>gi|153834946|ref|ZP_01987613.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio harveyi HY01] >gi|148868626|gb|EDL67712.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio harveyi HY01] (510 aa)
Score = 137, Expect = 5.7e-06, Identities = 85/365 (23%), Positives = 151/365 (41%)
  Q:   107 IDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQA---FT--------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGD 471
           ID + K   K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K         G+  V    GR + +D ++  D  +    L  QA   FT        EA+    EN  ++ + A  + A     +   +   D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF     N  E   R++++SP   +      +SS  L +K + +I  GKYD I    P       +   +     IE  D+ +G+++   +  G  + +T+ +G AE M+D     +    ++L VP ++  GD
  S:   102 IDSAVKA-EKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLQRFQDLFAK--------LGKGRVASLVGRYYAMDRDNNWDRVQVAYDLLTQAKAEFTAETAVAGLEAAYAREEN--DEFVKATAIKAEG--QEDAIMQDGDAVIFMNYRADRARQITRAF--VPAFDGFERAVFPAINFVMLTQYAADIPLAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGGIENEFEGEERQLVASPKVATYDMQPEMSSPELTEKMVAAIKSGKYDTIICNYPNADMVGHTGVYEAAEQAIEALDESVGKVVEAIKEVGGQLLITADHGNAEMMIDPETGGIHTAHTNLPVPLIYV-GD 473
>gi|167621984|ref|YP_001672278.1| phosphoglyceromutase [Shewanella halifaxensis HAW-EB4] >gi|189042202|sp|B0TLE6|GPMI_SHEHH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|167352006|gb|ABZ74619.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella halifaxensis HAW-EB4] (514 aa)
Score = 137, Expect = 5.8e-06, Identities = 110/470 (23%), Positives = 191/470 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASE-----YTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKN----DNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           K  L  L+ +G G  +  + N +  AN P ++ L +  YP +L+S           +   S    ++     ++Y E      L  + + I            K ID + K ++  VHI  +LS      +  ++  +  + +K+G K V LH   DG+D  P S    L++F +      T  + ++ GR +   +  R     + V   +E I  G G    T A E     YT +     V    I  A   I+    +  +D+++F+N   D            DF    R +  +PK+  + L+     Y   + A            S L N + +     D   L +    K   +  FF  G+    +   R ++ SP   +      +SS  L DK +++I   +YDVI    P       + +    +   E  D  +GR++      G    +T+ +G AE+M D+        + S LVP ++   D
  S:     5 KRPLALLILDGWGYRENTQKNAVFHANTPVLDQL-TAKYPNSLISGSGIDVGLPDGQMGNSEVGHINIGSGRIVYQE------LTRISKAIDDGEFDTNPTLIKAIDDAIKADAA-VHIMGLLSPGGVHSHQDHIEAMCRLSVKRGAKKVYLHAFLDGRDTPPRSAKPGLAHFEELFKTLGTGQVASLIGRYYAMDRDNR----WDRVSQAYELITEGKGLHQATSAVEGIEAAYTRDENDEFVGSTAIPDAQGNIIK---LEDNDALIFMNFRADRARQITRSFINADFDGFKRAV--TPKINFVMLTE----YAADIKAAI------AYPSSDLVNTLGETLQNRDLTQLRISETEKYAHVTFFFNGGKEEPFKGEDRILVQSPKVATYDLQPEMSSVELTDKLVEAIESTQYDVIICNYPNGDMVGHTGNFDAAVKACEAVDSCIGRIVEALEKVGGECLITADHGNAEQMTDESTGQAHTAHTSELVPLIYVGRD 476
>gi|169824487|ref|YP_001692098.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Finegoldia magna ATCC 29328] >gi|167831292|dbj|BAG08208.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Finegoldia magna ATCC 29328] (516 aa)
Score = 137, Expect = 6.6e-06, Identities = 106/449 (23%), Positives = 187/449 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKP-VLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMD----GYFVSKDDSVLFLNSDPDDFASLARMMK-------TSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSA-YGAAEKMLDK 450
           KN LI ++ +G GL K + GN +KLA+ P  + L+S  YP + L            +   S    ++     +++ +      L  +  +I+S   +  EI   +I ++ K N K +H+  +LSF     +  +L  ++ +  K   K  V+H   DG+D  P S   ++      +       I +V GR +   +  R     + V   +  I         +  +Y  ++    + D  I P    I+D    G  V   DS +F N  PD    L R             K K +   ++   Y   +  V    P +G   ++L  +V++   K L +    K   +  FF      E  N  R ++ SP  ++      +S+  + +  +D I K  YD+I   F    M+      S  K     +ET D+ L  ++      G   AL +A +G +E ++D+
  S:     5 KNKLILIILDGWGLGKDYPGNVIKLADTPTFDKLMSE-YPNSQLIASGNEVGLPAGQMGNSEVGHMNIGSGRIIFQD------LSKISNEIESGKFYENEILKNIILKT-KENRKRLHLLGLLSFGGVHSHYDHLVAILKLCKKLDFKDVVIHCFTDGRDVSPTSAKNDIKKLQDDIKVIGVGTIASVCGRYYAMDRDKR----WDRVEKAYNCITNCEGNKTNDPIQYLQKSYDRNITDEFIEPC--AIVDENNQGIKVENGDSFVFFNFRPDRARQLTRAFVDDDFDGFARKKFKDISFVTMTE-YDKTIKNVQIAYPKQGY-NNVLGQIVSEKGLKQLRIAETEKYAHVTFFFNGGIEKEFKNEDRILVPSPKVSTYDLKPEMSAIEVKNHVVDVINKDIYDLIILNFANSDMVGHTGVISADK---IAVETVDKCLDEILTAIDKNGKYHALITADHGNSEYLIDE 455
>gi|168334250|ref|ZP_02692451.1| phosphoglyceromutase [Epulopiscium sp. 'N.t. morphotype B'] (508 aa)
Score = 137, Expect = 7.0e-06, Identities = 99/444 (22%), Positives = 186/444 (41%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTE-ASEYTNENLANKVMDADILPAYNTIMDGYFV---SKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG---TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           + L+ +G GLN+  +GN +KL   P I+ L+    P   ++           +   S    ++     ++Y E      L  + + I+  ++         ++++ +   K VH+  +LS      +  +L+ +I +    G+  + +H   DG+D  P S    +      L +     I +++GR +   +  R     E V   +  +C  GE   +E  S    ++    ++D  ++P   T   G+ +    K DSV+F N  PD    + R +    +  G F  +L P+     T+ D    +  V    E L   L   +A    K L +    K   +  FF  G    NEN  R ++ SP   +      +S   + DK  ++I   KYDVI            +  +   ++ +E  D+ + ++I     TG    +T+ +G A++M+D
  S:     4 LLLILDGFGLNQATEGNAVKLGKTPYIDQLMESC-PHTSIAASGLEVGLPAGQMGNSEVGHLNIGAGRIVYQE------LTRITKAIEDGTILENPALKGAMEKA-RDEGKAVHLMGLLSDGGVHSHNTHLYGLIEMAKNLGVTELYVHAFMDGRDVAPDSGKDFVDQLQAKLREIGLGKIASISGRYYAMDRDNR----WERVEVAYNALCK-GEGNTSENVSTIMQKSYDENILDEFVVPTVVT-KSGHAIGKIKKGDSVIFFNFRPDRAREITRAI-VDKEFTG-FNRNLIPVTFVALTQYDITIVDKEVAFTPEILTNTLGEYLAHLGKKQLRIAETEKYAHVTFFFNGGIEEPNENEERILIPSPKVATYDLQPEMSIYEVADKLTEAIESKKYDVIIANYANSDMVGHTGSMDAAMAAVEAVDKSVEQVIKAIXATGGSALITADHGXADQMID 447
>gi|167402535|ref|ZP_02307985.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048090|gb|EDR59498.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Antiqua str. UG05-0454] (515 aa)
Score = 137, Expect = 7.0e-06, Identities = 94/411 (22%), Positives = 167/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK             +D + KT  K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF    N  I ++ GR +   +  R        D L     E   D    + GL    A  E  E+    +     +AD             +++ D+++F+N   D    + R    + +  G F       +G  +    +   +K           +     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K +++   G  S I  T+ SL
  S:    81 LTRLDKEIKEGDFFTNPTLTAAVDNAVKT-GKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTAD--NAVAGLQAAYARGENDEFVKPTVIQATGEADAA-----------MNESDTLIFMNFRADRARQITRTF-VNAEFDG-FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KAVKAVEGGKLSDIAPTMLSL 497
>gi|146309790|ref|YP_001174864.1| phosphoglyceromutase [Enterobacter sp. 638] >gi|166991383|sp|A4W533|GPMI_ENT38 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|145316666|gb|ABP58813.1| phosphoglycerate mutase [Enterobacter sp. 638] (514 aa)
Score = 136, Expect = 8.0e-06, Identities = 88/365 (24%), Positives = 154/365 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDNEHVMDYFETICGLGEQA--------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  LD +IK ++  +       +D++  +  K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R        D +        F+T     E A        F +A+    E  A+  M D D L   N   D    +++ +  F+N+D D FA      K    L  + L+  A            + P      SL   L   +AK+D   L +    K   +  FF  G     +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +ET D  + ++       G  + +T+ +G AE+M D
  S:    81 LTRLDVEIKERTFFSNPTLTGAVDKA-VSAGKAVHIMGLLSAGGVHSHEDHILAMVEMAAERGAEKIYLHAFLDGRDTPPRSAKSSLQTFEDKFAELGKGRVASIIGRYYAMDRDNRWDRVEQAYDLMTMAKGEFQFDTAVAGLEAAYARDENDEFVKATVIRAEGQADAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNLNFIMLTEYA---------ADIKVPCAYPPASLANTLGEWMAKHDKTQLRISETEKYAHVTFFFNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAITSGKYDTIICNYPNGDMVGHTGVMEAAVKAVETLDHCVEQVAKAVESVGGQLLITADHGNAEQMRD 453
>gi|126661005|ref|ZP_01732091.1| phosphoglyceromutase [Cyanothece sp. CCY0110] >gi|126617704|gb|EAZ88487.1| phosphoglyceromutase [Cyanothece sp. CCY0110] (532 aa)
Score = 136, Expect = 8.5e-06, Identities = 76/327 (23%), Positives = 141/327 (43%)
  Q:   145 KKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K+GL  + +H I DG+D       K ++  S  + +     I T++GR     +  R     + V   ++ I   G      A E   +   +   D  I P    I  G  +   D V+F N  PD    L+  + T P   G    F+ SL+ +  T+ D     N     +   ++L  +VA++  K   +    K   +  FF  G     E   R+++ SP  ++  +  ++S++ +      ++  G Y +I +          + + +  +  IET D  LG+L++     G    +T+ +G AE M D++ N+   + ++ VP +F  G+
  S:   141 KQGLADICVHAITDGRDTNTTDGVKAIAKISDHIQELGIGRIATISGRYFAMDRDRR----WDRVKLAYDMITQDGVGDGRSAVEVLEDYYRHDKTDEFIPPT--RIAPGA-IESGDGVIFFNFRPDRARQLSAAL-TMPTFDGFEREFIHSLSFVTFTQYDPRLPVNVAFQPQNLNNILGEVVAEHGLKQFRVAETEKYPHVTYFFNGGLEQPLEGEERELIQSPMVSTYDQSPAMSAEAVTKAACKAVEKGIYSLIVINYANPDMVGHTGNTEAAIEAIETVDNCLGKLLSSISKLGGTALITADHGNAETMRDENGNLWTAHTTNPVPLIFVEGE 470
>gi|149911000|ref|ZP_01899629.1| putative phosphoglycerate [Moritella sp. PE36] >gi|149805903|gb|EDM65889.1| putative phosphoglycerate [Moritella sp. PE36] (510 aa)
Score = 136, Expect = 8.8e-06, Identities = 87/363 (23%), Positives = 147/363 (40%)
  Q:   114 NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA-------DILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKK 476
           N K VHI  + S      +   +  +I +  ++G   + LH   DG+D  P S    L  F +KF         T+ GR           +D ++  D  E    L    FT+A      + A   +DA       D       I +   +S  D+V+F+N   D            DF    R +  +PKL    + +    Y   +D       VK    + L +++ + +   L +    K   +  FF     +      R+++ SP   +      ++S+ML DK + +I   KYDVI    P       +      +   E  DQ +GR++      G    +T+ +G AE M++     V    ++L VP ++   D  P +
  S:   109 NDKAVHILGLASPGGVHSHDDQILAMIELAARQGATKIYLHAFLDGRDTPPRSALATLEKFDAKFAEVGAGKTATLIGRYFA--------MDRDNRWDRVEEAYKL----FTQAESQYTADTAVAGLDAAYARDENDEFVKATVIGEAAPISDGDAVIFMNFRADRAREITRAFVDTDFTGFERAV--TPKLADFVMLTE---YAASIDTSIAFPSVK--LVNTLGSILEQQNKTQLRISETEKYAHVTFFFNGGVEDPFTGEDRELIPSPQVATYDLQPEMNSEMLTDKFVAAIESEKYDVIICNYPNGDMVGHTGVFDAAVKACEAVDQSIGRVVEALEKVGGECLITADHGNAEMMINPETGGVHTAHTNLPVPLIYFGRDAEPAE 478
>gi|113968390|ref|YP_732183.1| phosphoglyceromutase [Shewanella sp. MR-4] >gi|123130882|sp|Q0HP91|GPMI_SHESM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|113883074|gb|ABI37126.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella sp. MR-4] (514 aa)
Score = 136, Expect = 8.9e-06, Identities = 91/354 (25%), Positives = 154/354 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMD--GYFVSKDD--SVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFFG----ENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   +    GR F +D ++  D       L   G+  F   +  T    A +  + D   + + I D  G   S +D  +++F+N   D            DF    R +  +PK+  + L+     Y   + A     P+    E+L+  +  V +N  +  L +    K   +  FF     E  N E+  R +++SP   +      +SS  L DK + +I   +YDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D+        + S LVPFVF   D
  S:   113 VHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKGSLSHFDDLF--------TTLGHGRIASIIGRYFAMDRDNRWDRVSQAYDLITQGKAKFQYDNAVTALEAAYERNENDEFVSSSAITDSEGKVASLNDGDALIFMNFRADRARQITRSFINADFDGFERAV--TPKVNFVTLTE----YAADIKA-----PIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGGKEEPFNGED--RILINSPKVATYDLQPEMSSTELTDKLVAAIESAQYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVFVGRD 476
>gi|114045556|ref|YP_736106.1| phosphoglyceromutase [Shewanella sp. MR-7] >gi|123131870|sp|Q0I0Q6|GPMI_SHESR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|113886998|gb|ABI41049.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella sp. MR-7] (514 aa)
Score = 136, Expect = 9.0e-06, Identities = 91/354 (25%), Positives = 154/354 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMD--GYFVSKDD--SVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM--VAKNDNKV-LVLGLNHKKGFINKFFG----ENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           VHI  +LS      + +++  +  + + +G   V LH   DG+D  P S   +LS+F            T  G   +    GR F +D ++  D       L   G+  F   +  T    A +  + D   + + I D  G   S +D  +++F+N   D            DF    R +  +PK+  + L+     Y   + A     P+    E+L+  +  V +N  +  L +    K   +  FF     E  N E+  R +++SP   +      +SS  L DK + +I   +YDVI    P       + +    +   E  D  +GR+++     G    +T+ +G AE+M D+        + S LVPFVF   D
  S:   113 VHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAKGSLSHFDDLF--------TTLGHGRIASIIGRYFAMDRDNRWDRVSQAYDLITQGKAKFQYDNAVTALEAAYERNENDEFVSSSAITDSEGKVASLNDGDALIFMNFRADRARQITRSFINADFDGFERAV--TPKVNFVTLTE----YAADIKA-----PIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGGKEEPFNGED--RILINSPKVATYDLQPEMSSTELTDKLVAAIESAQYDVIICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAKVGGECIITADHGNAEQMTDETTGQAHTAHTSELVPFVFVGRD 476
>gi|152002490|dbj|BAF73514.1| phosphoglyceromutase [Onion yellows phytoplasma OY-W] (512 aa)
Score = 136, Expect = 9.3e-06, Identities = 102/466 (21%), Positives = 198/466 (42%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL--KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEAS-EYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKT-----------------SPKLKGLFLSSLAPIYGTKLDAVF-FENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
            ++ +G+GL  + + N   LA  P ++YL+                K  P  T  +   +V     +M   E           +   L  +++ I+ KS    + F + I+   K NSK+ H+  ++S      +  +   + ++L +  L     LH   DG+D  P+S      N+ K LL     I +V GR +   +      +N + ++    +    +    +   E T +N  N+ +  + +  + T  +G  +  +D+V+F+N  PD    LA  +                   +  L  LFL ++   Y T++ +V  FE   K   +++   ++A      L +    K   +  FF  G+    +N  R ++ SP   +      +S+  +      +I  GKYD + +          +  L   +  I+T D  L  ++N          + + +G AE+M D   N    + ++LVPF+ T+ ++
  S:     8 LIILDGLGLTNQKENNAFHLAKTPYLDYLL----------------KNFPNTTLKASGEEVGLPQGQMGNSEVGHLNLGAGRVVYQSLTQINKAIRDKSFFTNKQFLQAIEHVKKNNSKM-HLLGLISDGGIHSHLDHFKALFDLLKENNLANNTFLHAFTDGRDTSPHSG----INYIKDLLDYGFNIASVVGRYYALDRD-----NNWNRINLVYNMLTSKQAPVVDLPLENTIQNFYNQGITDEFITPFITNPNG-LIDDNDAVIFVNFRPDRAMRLATALSNPCATNAFCSEGKTNFCGTKLLNNLFLVTMTK-YSTQVKSVVAFE---KITLKNIYGEVIANLGMHQLRIAETEKYPHVTFFFDGGKELQLKNADRILIPSPKVKTYDLKPEMSALEITTHAKTAILSGKYDTLILNFANPDMVGHTGFLDATIKAIQTVDSCLKEVLNAIFAVKGKACIVADHGNAEQMTDNQGNPHTAHTTNLVPFIVTDKNV 476
>gi|16120415|ref|NP_403728.1| phosphoglyceromutase [Yersinia pestis CO92] >gi|22123998|ref|NP_667421.1| phosphoglyceromutase [Yersinia pestis KIM] >gi|45439928|ref|NP_991467.1| phosphoglyceromutase [Yersinia pestis biovar Microtus str. 91001] >gi|108809469|ref|YP_653385.1| phosphoglyceromutase [Yersinia pestis Antiqua] >gi|108813946|ref|YP_649713.1| phosphoglyceromutase [Yersinia pestis Nepal516] >gi|145601081|ref|YP_001165157.1| phosphoglyceromutase [Yersinia pestis Pestoides F] >gi|150260874|ref|ZP_01917602.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis CA88-4125] >gi|162421119|ref|YP_001604708.1| phosphoglyceromutase [Yersinia pestis Angola] >gi|165926146|ref|ZP_02221978.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936228|ref|ZP_02224797.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Orientalis str. IP275] >gi|166011516|ref|ZP_02232414.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213705|ref|ZP_02239740.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167418851|ref|ZP_02310604.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426670|ref|ZP_02318423.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|123073074|sp|Q1CD17|GPMI_YERPN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|123372045|sp|Q1C282|GPMI_YERPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|166991471|sp|A4TSC2|GPMI_YERPP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|27734320|sp|Q8ZJN0|GPMI_YERPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|21956739|gb|AAM83672.1|AE013608_7 putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis KIM] >gi|45434783|gb|AAS60344.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Microtus str. 91001] >gi|108777594|gb|ABG20113.1| phosphoglycerate mutase [Yersinia pestis Nepal516] >gi|108781382|gb|ABG15440.1| phosphoglycerate mutase [Yersinia pestis Antiqua] >gi|115345894|emb|CAL18753.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis CO92] >gi|145212777|gb|ABP42184.1| phosphoglycerate mutase [Yersinia pestis Pestoides F] >gi|149290282|gb|EDM40359.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis CA88-4125] >gi|162353934|gb|ABX87882.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis Angola] >gi|165915842|gb|EDR34450.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Orientalis str. IP275] >gi|165922006|gb|EDR39183.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989662|gb|EDR41963.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205107|gb|EDR49587.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962845|gb|EDR58866.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167054359|gb|EDR64176.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis biovar Mediaevalis str. K1973002] (515 aa)
Score = 136, Expect = 9.3e-06, Identities = 94/411 (22%), Positives = 167/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK             +D + KT  K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF    N  I ++ GR +   +  R        D L     E   D    + GL    A  E  E+    +     +AD             +++ D+++F+N   D    + R    + +  G F       +G  +    +   +K           +     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K +++   G  S I  T+ SL
  S:    81 LTRLDKEIKEGDFFTNPTLTAAVDNAVKT-GKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTAD--NAVAGLQAAYARGENDEFVKPTVIQATGEADAA-----------MNEGDTLIFMNFRADRARQITRTF-VNAEFDG-FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KAVKAVEGGKLSDIAPTMLSL 497
>gi|153948376|ref|YP_001399076.1| phosphoglyceromutase [Yersinia pseudotuberculosis IP 31758] >gi|166991470|sp|A7FCU8|GPMI_YERP3 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|152959871|gb|ABS47332.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pseudotuberculosis IP 31758] (515 aa)
Score = 135, Expect = 1.0e-05, Identities = 94/411 (22%), Positives = 166/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK             +D + KT  K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF    N  I ++ GR +   +  R        D L     E   D    + GL    A  E  E+    +     +AD             +++ D+++F+N   D    + R    +    G F       +G  +    +   +K           +     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K +++   G  S I  T+ SL
  S:    81 LTRLDKEIKDGDFFTNPTLTAAVDNAVKT-GKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTAD--NAVAGLQAAYARGENDEFVKPTVIQATGEADAA-----------MNEGDTLIFMNFRADRVRQITRTF-VNADFDG-FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KAVKAVEGGKLSDIAPTMLSL 497
>gi|172058401|ref|YP_001814861.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Exiguobacterium sibiricum 255-15] >gi|171990922|gb|ACB61844.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Exiguobacterium sibiricum 255-15] (515 aa)
Score = 135, Expect = 1.1e-05, Identities = 105/471 (22%), Positives = 188/471 (39%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS---KDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP-----IYGTKL------DAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           K  +  ++ +G G+  +  GN +  ANKPN +      YP  LL+    + +Y+     P  +       +  +     +   L  ++  IK +S  + +  N       K  S + HIF ++S      +  +L+ V+       ++ V LH   DG+D  P S    L +    + + N     +V+GR +   +  R     E V   ++ I         +       +    V D  I P      DG  V+    +D+++F N  PD    LA+  K      G  L    P     +  TK       D VF    +K    + L   ++K   K L +    K   +  FF        E   R ++ SP   +      +S   + +  +D+I   K+D I +          S  L+     IE  D+ LG++++L    G    +T+ +G A+K+L+   + +  + +  VP + T  D+
  S:     3 KRPVALIILDGFGMRDEEFGNAVTAANKPNFDRYWEQ-YPHTLLN---AKGEYV---GLPEGQMGNSEVGHLNIGAGRVVYQSLSRINNAIKDRSFFSRQAMNDAAGHVKKYGSAL-HIFGLVSDGGIHSHINHLYAVLEFAKLHEIEKVYLHAFTDGRDCDPQSGAGFLRDAQAKMDELNVGQFASVSGRYYAMDRDNR----WERVKKVYDVITFADGPTTKDPIAMVEASYKTDVTDEFIEPTVVVQEDGTPVAPIHDNDAIMFFNYRPDRAIQLAKTYKEKTGFTGFELPDNVPKNLLLVSMTKYSDAIDTDIVFPPEDIK----NTLGETLSKQGLKQLRIAETEKYPHVTFFFNGQREEPYEGEDRILIPSPKVATYDLKPEMSVYEVTEALVDAINSDKHDAIILNFANPDMVGHSGMLEPTKKAIEAVDKCLGQVVDLIISKGGAAIITADHGNADKVLNADGSKMTAHTTEPVPCIVTVEDV 477
>gi|157738114|ref|YP_001490798.1| phosphoglyceromutase [Arcobacter butzleri RM4018] >gi|166991369|sp|A8EW05|GPMI_ARCB4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|157699968|gb|ABV68128.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Arcobacter butzleri RM4018] (491 aa)
Score = 134, Expect = 1.5e-05, Identities = 105/468 (22%), Positives = 189/468 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQ--IKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF-VSKDDSVLFLNSDPDDFASLARMM-KTSPKLKGLFLSSLAPIYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-----GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVP-HNKSSLVPFVFT 468
           M N  + ++T+GIG N   K N    A KP  +YL   + P++L+      + Y      P ++   +S    M  G   +  Y +L+     IK+ +L + E+    I +SN      +H+  + S      +  ++  +  +    G K  +H+I DG+D  P +  K   N    +   +  I T++GR +   +  R     + V   +++I     +   +   Y   +  N++ D  I P   T  +GY  + K+D ++F N   D    ++ +  K        F  SL     T+ D   F  PV   K   ++ LA +++      L      K   +  FF         N +R ++ SP   +    + L  +M   +   ++        D I V          +   +  +  +E  D  LG++  L +     I LTS +G  E M D   NI+  H    +  FV++
  S:     1 MSNKTLLIITDGIGHNSSNKNNAFYTAKKPTYDYLFENV-PYSLI------HTYGEYVGLPDMQMG-NSEVGHMTIGSGRV-LYQDLVKIHLAIKNDTLKDNEVLKNTISKSNN-----IHLLGLASDGGVHSHINHIIAMAKIAKNMGKKVFIHIITDGRDVAP-NCAKTYINQILEICDEDIKIATISGRYYAMDRDNR----WDRVKKAYDSITFANPKTQDDILSYIETSYKNEIFDEFIEP---TSFEGYNGIEKNDGIIFCNFRSDRMREISSVFAKADFNEFDTFKGSLNFASMTQYDKNVFI-PVLFPKDNPKNTLAEVISNAGLSQLHTAETEKYAHVTFFFNGGVEEPVLNESRVLIPSPQVAT----YDLKPEMSAPEVGSAVRTAMNNNIDFIVVNFANGDMVGHTGVFEAAVKAVEAVDFELGQIFELAKKQNYNIILTSDHGNCEMMKDDEGNILTNHTVGDVYCFVYS 456
>gi|188588099|ref|YP_001922185.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum E3 str. Alaska E43] >gi|188498380|gb|ACD51516.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum E3 str. Alaska E43] (512 aa)
Score = 134, Expect = 1.5e-05, Identities = 108/482 (22%), Positives = 201/482 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQSNFLG 483
           K  ++ ++ +G G+  K +GN + LA KPN + L++  YP + L            +   S    ++     ++Y E      L  + + IK       E   K +  + K N+  +H+  +LS      + ++L  ++    K+G++ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE A   A E   ++  +   D  +LP    + +G     +   DSV+F N  PD    + R +  K     K   L +L  +  T+ D       V  K ++L   L   V+      L +    K   +  FF      EN    R ++ SP   +      +S+  + D+ ++ +   KYD++ +          +  +   +  IE+ D+ LG++ +        + +T+ +G AE M+D    N    +    VPFV+   D   K ++   L 
  S:     3 KRPVMLMILDGFGIAPKSEGNAVSLAKKPNFDRLVAN-YPTSQLQASGLEVGLPEGQMGNSEVGHLNIGSGRIVYQE------LTRITKAIKDGDFFENESLMKAMTNA-KNNNSALHLMGLLSDGGVHSHIEHLRGLLEFAKKEGIQNVYVHAFMDGRDVAPSSGKEFVEKTEAMMAEVGIGKIATISGRYYAMDRDNR----WERVELAYNALVLGKGETA-NNAVEAMEKSYHDNKTDEFVLPTV-VLENGAPTATIKNGDSVIFFNFRPDRAREITRAINDKVFDGFKRETL-NLTFVTMTQYDKTLEGVEVAYKPQTLANTLGEYVSSKGLNQLRIAETEKYAHVTFFFNGGVEKENPGEERVVIPSPKVATYDLKPEMSAYEVTDELLNRLDSDKYDMVILNFANPDMVGHTGVIPAAVKAIESVDECLGKIADKMLEKDGCLFITADHGNAETMIDFSTGNPFTAHTIDPVPFVWVANDTEGKAIKDGKLA 485
>gi|51594418|ref|YP_068609.1| phosphoglyceromutase [Yersinia pseudotuberculosis IP 32953] >gi|170026348|ref|YP_001722853.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Yersinia pseudotuberculosis YPIII] >gi|186893406|ref|YP_001870518.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Yersinia pseudotuberculosis PB1/+] >gi|81640822|sp|Q66GC2|GPMI_YERPS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|51587700|emb|CAH19300.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pseudotuberculosis IP 32953] >gi|169752882|gb|ACA70400.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Yersinia pseudotuberculosis YPIII] >gi|186696432|gb|ACC87061.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Yersinia pseudotuberculosis PB1/+] (515 aa)
Score = 134, Expect = 1.5e-05, Identities = 94/411 (22%), Positives = 166/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK             +D + KT  K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF    N  I ++ GR +   +  R        D L     E   D    + GL    A  E  E+    +     +AD             +++ D+++F+N   D    + R    +    G F       +G  +    +   +K           +     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K +++   G  S I  T+ SL
  S:    81 LTRLDKEIKEGDFFTNPTLTAAVDNAVKT-GKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTAD--NAVAGLQAAYARGENDEFVKPTVIQATGEADAA-----------MNEGDTLIFMNFRADRARQITRTF-VNADFDG-FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KAVKAVEGGKLSDIAPTMLSL 497
>gi|77977369|ref|ZP_00832819.1| COG0696: Phosphoglyceromutase [Yersinia intermedia ATCC 29909] (515 aa)
Score = 134, Expect = 1.5e-05, Identities = 88/383 (22%), Positives = 156/383 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           L  LD++IK             ID++ K   K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF       I ++ GR +   +  R        D L     E  +D    + GL    A  E  E+    +     +AD       + DG      D+++F+N   D    + R    +    G F       +G  +    +   +K          ++     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++
  S:    81 LTRLDKEIKDGDFFTNSTLTAAIDKAVKA-GKAVHIMGLLSAGGVHSHEDHILAMVELAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTDKFAALGKGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTVD--NAVAGLQAAYARDENDEFVRPTVIQAAGEADA-----AMNDG------DALIFMNFRADRARQITRTF-VNADFDG-FKRDKVVNFGDFVMLTEYAADIKVACAYPPASLQNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVGAIGSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIY 473
>gi|149183683|ref|ZP_01862096.1| phosphoglyceromutase [Bacillus sp. SG-1] >gi|148848610|gb|EDL62847.1| phosphoglyceromutase [Bacillus sp. SG-1] (511 aa)
Score = 134, Expect = 1.6e-05, Identities = 103/467 (22%), Positives = 203/467 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTN------ENLANKVMDADILPAYNTIMDGYFVS---KDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K+ +  ++ +G    ++ KGN +  A KPN                DR  N++ P  T  +    V     +M   E           +   L  ++  I+       E F   I+ + K+ +K +HIF +LS      + ++LF ++ +   +GLK V +H   DG+D  P +    +    + + +       T++GR +         +D +   D  E         + E  EY+N      ++  N + D  +LP+     +G  V+   ++D+V+F N  PD            DF S  R  K    L  + L+     +   +D       V    ++ L  ++++N+ K L +    K   +  F      +E  + TR +++SP   +      +S+  + +  ++ I   + D I +          S  L+  +  IET D+ LG++++L    G    +T+ +G A++++    N +  + ++ VP + T
  S:     3 KSPVALIILDGFACREEDKGNAVTQAKKPNF---------------DRYWNQF-PHSTLKASGEAVGLPEGQMGNSEVGHLNIGAGRVVYQSLTRVNVSIREGEFEKNETFVNAIEHA-KSKNKALHIFGLLSDGGVHSHIEHLFALLRIAAAEGLKEVYVHGFLDGRDVGPKTAETYILQTQEVMRELGVGEFATISGRYYS--------MDRDKRWDRVEK--AYRAMVYGEGPEYSNPLEVVVDSYDNGIFDEFVLPSVIKRDNGEPVATIDEEDAVIFYNFRPDRAIQISNTFTNDDFRSFERGPKHPKNLHFVCLTH----FSETVDGYVAFKSVN--LDNTLGEVLSQNNLKQLRIAETEKYPHVTFFMSGGREDEFPDETRILINSPDVATYDLKPEMSAYEVTEALMEEIKNDRQDAIILNFANPDMVGHSGMLEPTIKAIETVDECLGQIVDLIVEKGGTAIITADHGNADEVVTPEGNPMTAHTTNPVPVIVT 472
>gi|59710809|ref|YP_203585.1| phosphoglyceromutase [Vibrio fischeri ES114] >gi|75431863|sp|Q5E8E9|GPMI_VIBF1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|59478910|gb|AAW84697.1| phosphoglycero mutase III, cofactor-independent [Vibrio fischeri ES114] (510 aa)
Score = 134, Expect = 1.6e-05, Identities = 84/383 (21%), Positives = 155/383 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGK--------KGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           L  + + I        E     ID++ K   K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L NF +   K     I ++ GR +   +        K  D +        F T     E A+  A E  +E +    + A+   +   I+DG      D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF  G     E   R++++SP   +      +S+  L +K + +I  GKYD I    P       +      +  +E+ D+ +G+++   +     + +T+ +G AE M+D     V    ++L VP ++
  S:    80 LTRITKAISDGEFQQNETLVNAIDKAVKA-GKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLKNFQELFAKLGKGRIASLVGRYYAMDRDNNWERVQKAYDLMTEAKAEFTFATAVEGLEAAY--AREENDEFVQATEIKAEGEES-AAIVDG------DAVIFMNYRADRARQITRTF--VPSFDGFTRNVFPAIDFVMLTQYAADIPLLCAFAPASLENTYGEWLSKEGKTQLRISETEKYAHVTFFFNGGIEDEFEGEERQLVASPKVATYDLQPEMSAPELTEKLVAAIKSGKYDAIVCNFPNCDMVGHTGVYDAAVKAVESLDECIGKVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTNLPVPLIY 470
>gi|28899603|ref|NP_799208.1| phosphoglyceromutase [Vibrio parahaemolyticus RIMD 2210633] >gi|153837996|ref|ZP_01990663.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio parahaemolyticus AQ3810] >gi|33301159|sp|Q87KZ5|GPMI_VIBPA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|28807839|dbj|BAC61092.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Vibrio parahaemolyticus RIMD 2210633] >gi|149748604|gb|EDM59463.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio parahaemolyticus AQ3810] (510 aa)
Score = 133, Expect = 1.6e-05, Identities = 82/356 (23%), Positives = 148/356 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQA---FT--------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGD 471
           K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K         G+  V    GR + +D ++  +  +    L  QA   FT        EA+   +EN  ++ + A  + A     +   +   D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF     N  E   R++++SP   +      +SS  L +K + +I  GKYD I    P       +   +     IE  D+ +G+++   +  G  + +T+ +G AE M+D     V    ++L VP ++  GD
  S:   110 KAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLQRFQDLFAK--------LGKGRVASLVGRYYAMDRDNNWERVQVAYDLLTQAKAEFTAETAVAGLEAAYARDEN--DEFVKATAIKAEG--QEDAIMQDGDAVIFMNYRADRARQITRAF--VPGFDGFERAVFPAINFVMLTQYAADIPLATAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGGVENEFEGEERQLVASPKVATYDLQPEMSSPELTEKLVAAIKSGKYDTIICNYPNADMVGHTGVYEAAEKAIEALDESVGKVVEAIKEVGGQLLITADHGNAEMMIDPETGGVHTAHTNLPVPLIYV-GD 473
>gi|109947594|ref|YP_664822.1| phosphoglyceromutase [Helicobacter acinonychis str. Sheeba] >gi|122973287|sp|Q17X03|GPMI_HELAH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|109714815|emb|CAJ99823.1| phosphoglycerate mutase [Helicobacter acinonychis str. Sheeba] (492 aa)
Score = 133, Expect = 1.7e-05, Identities = 108/470 (22%), Positives = 193/470 (41%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDD-SVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG-KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN-IVPHNKSSLVPFVFTNG 470
           M    + ++T+GIG  K    N    A KP  + +   + P++L+ +    +  +PK          +S    M  G   +     L  + +K S SL N  + N     S    S +VH+  ++S      + ++   +     K   K  LHLI DG+D  P S    L    + +   +  I T++GR +   +  R     E +   + ++ GL +      SEY        + D  I+P   T    Y   +DD S +F+N   D            +F    R +      K L ++++ P          F  P+   +ES+   LA +V++ +     +    K   +  F   G  T  +N  R ++ SP  T+      +S+K +    ++ +    D+I V          + + +  +  +E  D  LG +++L +     + LTS +G  E M D++ N +  H   S+  FV  NG
  S:     1 MAQKTLLIITDGIGYRKDSDYNAFFHAKKPTYDLMFKTL-PYSLI-DTHGLSVGLPKGQMG------NSEVGHMCIGAGRV-----LYQDLVKISLSLQNDGLKNNTAFLSAIQKSSVVHLMGLMSDGGVHSHIEHFIALALECEKFHKKVYLHLITDGRDVAPKSALTYLE-IMQNICNESIQIATMSGRFYAMDRDNR----FERIKLAYNSLMGLTDPTPLSPSEYIQSQYDKNITDEFIMP---TCFKNYCGMQDDESFIFINFRNDRAREITSALGQKEFNGFKRQV-----FKKLHIATMTPYDKN------FPYPILFPKESIQNTLAEVVSECNLTQSHIAETEKYAHVTFFINGGVETPFKNENRVLIQSPKVTTYDLKPEMSAKEVTLAVLEQMRLGTDLIIVNFANGDMVGHTGNFEASVKAVEAVDTSLGEILSLAKELNYAMLLTSDHGNCEHMKDENQNPLTNHTAGSVYCFVLGNG 459
>gi|161486071|ref|NP_756300.2| phosphoglyceromutase [Escherichia coli CFT073] >gi|50400533|sp|Q8FCA6|GPMI_ECOL6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (514 aa)
Score = 133, Expect = 1.8e-05, Identities = 100/411 (24%), Positives = 173/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR--------DFL---DNEHVMDYFETICGLG-------EQAFTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R        D L     E   D   T+ GL           F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQAD--TTVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 496
>gi|56751058|ref|YP_171759.1| phosphoglyceromutase [Synechococcus elongatus PCC 6301] >gi|81299280|ref|YP_399488.1| phosphoglyceromutase [Synechococcus elongatus PCC 7942] >gi|123557416|sp|Q31R18|GPMI_SYNP7 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81596183|sp|Q5N381|GPMI_SYNP6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|56686017|dbj|BAD79239.1| phosphoglycerate mutase [Synechococcus elongatus PCC 6301] >gi|81168161|gb|ABB56501.1| phosphoglycerate mutase [Synechococcus elongatus PCC 7942] (532 aa)
Score = 133, Expect = 1.8e-05, Identities = 76/326 (23%), Positives = 136/326 (41%)
  Q:   146 KGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +G++ V +H I DG+D  P      ++   + +       IVT+ GR     +  R     +     +E +   GE     A+E   E  A  V D  + P   T +    ++  D V+F N  PD    L        + +G     +  L  +  T+ DA     PV  + ++L   L  +VA +  +        K   +  FF  G         R+++ SP   +      +S++ + D  I +I K  Y ++ +          +  +   +  IET D+ LGRL++     G    +T+ +G AE M D++      + ++LVPF+   G+
  S:   142 QGIQDVYIHAITDGRDTNPTEGVNCITKIERLIATAGVGQIVTICGRYFAMDRDRRWDRVRKA----YELLTIDGEGCGQTATEVLQETYAKGVSDEFVEP---TRLAPGAIAPGDGVIFFNFRPDRARQLTYAF-VEAEFEGFERDLIQPLTFVTFTQYDANL-NVPVAFEPQNLTNILGEVVANHGLRQFRTAETEKYPHVTYFFNGGIEEPFPGEDRELIPSPMVATYDRAPKMSAQAVTDAAIAAIDKGIYSLVVINYANPDMVGHTGKMGATVEAIETVDRCLGRLVSAINRAGGTALITADHGNAEYMWDENGEPWTAHTTNLVPFIVVEGE 470
>gi|118582010|ref|YP_903260.1| phosphoglyceromutase [Pelobacter propionicus DSM 2379] >gi|118504720|gb|ABL01203.1| phosphoglycerate mutase [Pelobacter propionicus DSM 2379] (510 aa)
Score = 133, Expect = 1.8e-05, Identities = 111/451 (24%), Positives = 200/451 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFN-----KLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG----YFVSKDDSVLFLNSDPDDFASLAR---------MMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKE---ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKH 451
           MK  L+ L+ +G G+N+    N +  A  PN++ L++  YP            ++  +T        D        G  +I     +  +  + SK++ + + F      + I+++     ++ H+  +LS      +  +LF ++ +  ++GL  V +H + DG+D  P S    LS     L +     I TV GR +   +  R     E V   Y   + G GE++   A E   ++ A  V D   LPA   +MDG      V   D  +F N   D    + R          ++ SP      LSS   +  T+ DA F   P+   +    +LL  +++      L +    K   +  FF  G  T      R ++ SP    T D++   +S  ++ ++ +  +   +YDVI   F  C M+     +  L+  +  +E  D   GR++      G  + +T+ +G AE+M+D++
  S:     1 MKQPLLLLILDGWGINQDADHNAVAQAQTPNLDRLLAD-YP------------HVQIRTSGMAVGLPDGQMGNSEVGHLNIGAGRVVYQDLTRISKAIVDGDFFTNPVLLECIEKTKAAGGRL-HLAGLLSDGGVHSHNSHLFALLELAKREGLTDVFVHCLLDGRDTPPQSGADYLSQLEVELERIGCGRIATVMGRYYAMDRDNR----WERVERAYSAMVLGKGERS-PSAGEAIRQSYAAGVYDEFGLPA--VVMDGNEPVATVRDGDGFIFFNFRSDRAREITRAIALDTFDGFLRPSPPR----LSSYVCM--TEYDATF-GLPIAFPQLEMTNLLGGVLSDAGLTQLRIAETEKYAHVTFFFNGGVETPFPGEERCLIPSPKDVATYDQKP-EMSVHLVTEELLSRLEADQYDVIVLNFANCDMVGH---TGVLEAAIKAVEAVDACAGRVVEAVLSRGGRLLITADHGNAERMMDEN 453
>gi|26110689|gb|AAN82874.1|AE016768_292 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli CFT073] (523 aa)
Score = 133, Expect = 1.8e-05, Identities = 100/411 (24%), Positives = 173/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR--------DFL---DNEHVMDYFETICGLG-------EQAFTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R        D L     E   D   T+ GL           F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    90 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQAD--TTVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 505
>gi|163730931|ref|ZP_02138400.1| phosphoglyceromutase [Vibrio fischeri MJ11] >gi|161395786|gb|EDQ20086.1| phosphoglyceromutase [Vibrio fischeri MJ11] (510 aa)
Score = 133, Expect = 1.8e-05, Identities = 84/383 (21%), Positives = 155/383 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGK--------KGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           L  + + I        E     ID++ K   K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L NF +   K     I ++ GR +   +        K  D +        F T     E A+  A E  +E +    + A+   +   I+DG      D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF  G     E   R++++SP   +      +S+  L +K + +I  GKYD I    P       +      +  +E+ D+ +G+++   +     + +T+ +G AE M+D     V    ++L VP ++
  S:    80 LTRITKAISDGEFQQNETLVNAIDKAVKA-GKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLKNFQELFAKLGKGRIASLVGRYYAMDRDNNWERVQKAYDLMTEAKAEFTFATAVEGLEAAY--AREENDEFVQATEIKAEGEES-AAIVDG------DAVIFMNYRADRARQITRTF--VPSFDGFTRNVFPAIDFVMLTQYAADIPLLCAFAPASLENTYGEWLSKEGKTQLRISETEKYAHVTFFFNGGIEDEFEGEERQLVASPKVATYDLQPEMSAPELTEKLVAAIKSGKYDAIVCNFPNCDMVGHTGVYDATVKAVESLDECIGKVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTNLPVPLIY 470
>gi|169625021|ref|XP_001805915.1| hypothetical protein SNOG_15777 [Phaeosphaeria nodorum SN15] >gi|111055752|gb|EAT76872.1| hypothetical protein SNOG_15777 [Phaeosphaeria nodorum SN15] (520 aa)
Score = 133, Expect = 1.8e-05, Identities = 94/403 (23%), Positives = 178/403 (44%)
  Q:    90 EQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL-KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPI-----VTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMM---KTSPKL-----KGLFLSSLAPIYGTKLDAVFFENPVK---GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           + IK   L ++E   K   R+   N ++ H   ++S      +  +L   + V  ++G+ K  +H  ADG+D  P    K+ + + + LLK    I      TV GR ++        +D +   D  E      + G GE++ ++      E  +    D  + P    I+ G    +  DD++ F N   D    + +++     SPK      K + L+++   Y  K     +  PV     + + +LA  + K   K   +    K   +  FF  G     EN  R+++ SP   +     ++S+  + DK  + I  GK++ +            +   K  +      D+ + R+   C+ +G ++ +T+ +G AE+ML +       + ++ VPFV  N  + W  K     LG V  ++L+ +
  S:    94 QTIKEGKLKDVETVKKSFQRAIDGNGRL-HFCGLVSDGGVHSHMDHLIEFLKVAKQQGVPKAYIHFFADGRDTDP----KSAAGYMETLLKATKEIGLGDIATVVGRYYI--------MDRDKRWDRVEIGMKGLVTGEGEES-SDPVATIKERYSKDENDEFLKP---IIVGGKERRIQDDDTLFFFNYRSDRVREITQLLGDVDRSPKADFPYPKNMSLTTMTS-YNPK-----YTFPVAFPPQRMDDVLAETLGKQGVKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLQPTMSAMAVADKLCERIQTGKFEFLMNNFAPPDMVGHTGVYKAAIEGCTETDKAIKRVYEQCKESGYVLFVTADHGNAEEMLTEEGTPKTSHTTNKVPFVMANAPESWSLKKTDGVLGDVAPTVLAVM 503
>gi|39938771|ref|NP_950537.1| phosphoglyceromutase [Onion yellows phytoplasma OY-M] >gi|50400339|sp|Q6YQT8|GPMI_ONYPE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|39721880|dbj|BAD04370.1| phosphoglyceromutase [Onion yellows phytoplasma OY-M] (512 aa)
Score = 133, Expect = 1.8e-05, Identities = 101/464 (21%), Positives = 190/464 (40%)
  Q:     9 VTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL--KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNE--HVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKT-----------------SPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
           + +G+GL  + + N   LA  P ++YL+                K  P  T  +   +V     +M   E           +   L  +++ I+ KS    + F + I+   K NSK+ H+  ++S      +  +   + ++L +  L     LH   DG+D  P+S      N+ K LL     I +V GR +   +      DN    +   +  +            E T +N  N+ +  + +  + T  +G  ++ +D+V+F+N  PD    LA  +                   +  L  LFL ++          V FE   K   +++   ++A      L +    K   +  FF  G+    +N  R ++ SP   +      +S+  +      +I  GKYD + +          +  L   +  I+T D  L  ++N          + + +G AE+M D   N    + ++LVPF+ T+ ++
  S:    10 ILDGLGLTDQKENNAFHLAKTPYLDYLL----------------KNFPNTTLKASGEEVGLPQGQMGNSEVGHLNLGAGRVVYQSLTQINKAIRDKSFFTNKQFLQAIEHVKKNNSKM-HLLGLISDGGIHSHLDHFKALFDLLKENNLANNTFLHAFTDGRDTSPHSG----INYIKDLLDYGFNIASVVGRYYALDR------DNNWNRINLVYNMLTSKQAPVIDLPLEDTIQNFYNQGITDEFITPFITNPNG-LINDNDAVIFVNFRPDRAMRLATALSNPCATNAFCSEGKTNFCGTKLLNNLFLVTMTKYSAQVKSVVAFE---KITLKNIYGEVIANLGMHQLRIAETEKYPHVTFFFDGGKELQLKNADRILIPSPKVKTYDLKPEMSALEITTHAKTAILSGKYDTLILNFANPDMVGHTGFLDATIKAIQTVDSCLKEVLNAIFAVKGKACIVADHGNAEQMTDNQGNPHTAHTTNLVPFIVTDKNV 476
>gi|77961963|ref|ZP_00825790.1| COG0696: Phosphoglyceromutase [Yersinia mollaretii ATCC 43969] (515 aa)
Score = 133, Expect = 2.0e-05, Identities = 95/411 (23%), Positives = 168/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK       +     ID++  T  K VHI  +LS      +  ++  +I +  ++G   + LH   DG+D  P S   +L  F+ KF       I ++ GR +   +  R        D +     E   D    + GL    A  E  E+    +     +AD       + DG      D+++F+N   D    + R    +    G F       +G  +    +   +K          E+     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K++++   G  S I  T+ SL
  S:    81 LTRLDKEIKEGDFFTNQTLTAAIDKA-VTAGKAVHIMGLLSAGGVHSHEDHILAMIELAAQRGATAIYLHAFLDGRDTPPRSAEPSLKRFTEKFAELGKGRIASIIGRYYAMDRDNRWDRVQLAYDLMTQAKGEFTAD--NAVAGLQAAYARNENDEFVKPTVIQAAGEADA-----AMNDG------DALIFMNFRADRARQITRAF-VNADFDG-FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLENTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIASGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KEVKAVEGGKLSDIAPTMLSL 497
>gi|150015489|ref|YP_001307743.1| phosphoglyceromutase [Clostridium beijerinckii NCIMB 8052] >gi|189042188|sp|A6LR07|GPMI_CLOB8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|149901954|gb|ABR32787.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Clostridium beijerinckii NCIMB 8052] (512 aa)
Score = 133, Expect = 2.0e-05, Identities = 106/482 (21%), Positives = 200/482 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY--GTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHL-NIVPHNKSSLVPFVFTNGDLWPKKMQSNFLG 483
           K  ++ ++ +G G+  K +GN + LA KPN++ L    YP + L            +   S    ++     ++Y E      L  + + I        E     +  + KT S + H+  +LS      + ++L  ++    K+ ++ V +H   DG+D  P S  + +    K + +     I TV+GR +   +  R     E V + Y   + G GE A + A++   ++  +   D  +LP   T        +   DSV+F N  PD    + R +    +  G    +L   +   T+ D       V    ++L   L   V+      L +    K   +  FF      EN    RK++ SP   +      +S+  + D+ ++ +   KYD++ +          +  ++  +  IET D+ +G++ +        + +T+ +G AE M+D    N    + +  VPFV+   D   KK+ +  L 
  S:     3 KKPVMLMILDGFGIAPKSEGNAVTLAKKPNLDKLFEK-YPTSQLQASGLAVGLPEGQMGNSEVGHLNIGSGRIVYQE------LTRITKAIADGDFFENESLKLAMTNAKKTGSSL-HLMGLLSDGGVHSHIEHLRGLLEFAKKEEVQNVYVHAFMDGRDVPPSSGQEFIEKTEKMMAEVGVGKIATVSGRYYAMDRDNR----WERVELAYNALVLGKGETA-SSATQAIEKSYHDNKTDEFVLPTVVTENGNPTANIKNGDSVIFFNFRPDRAREITRAI-NDKEFAGFKRETLDLTFVTMTQYDKTLERVNVAYTPQTLSNTLGEYVSNKGLNQLRIAETEKYAHVTFFFNGGVEKENPGEDRKVIPSPKVATYDLKPEMSAYEVTDELLNRLDSDKYDMVILNFANPDMVGHTGVVEAAVKAIETVDECVGKIADKILEKNGCLFITADHGNAETMIDFSTGNPYTAHTTHEVPFVWVANDTEGKKLSNGKLA 485
>gi|90994570|ref|YP_537060.1| phosphoglycerate mutase [Porphyra yezoensis] >gi|122194647|sp|Q1XDA8|GPMI_PORYE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|90819134|dbj|BAE92503.1| phosphoglycerate mutase [Porphyra yezoensis] (534 aa)
Score = 132, Expect = 2.3e-05, Identities = 100/467 (21%), Positives = 192/467 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLK---------RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTN--ENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP----KLKGLFLSSLAPI--YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++  + +G G     +GN +K+A  P I+ LI   YP  LL+   +      +   P  +       +  + G   I+  L  +   I   S  N    N+  + +N  N   +H+  + S      +  +L  +I++   K +  + LHLI DG+D          SN +K+ +K         +   I T++GR +      RDF  +     Y   +          +  Y +  ++  NK +  + +P     +    +  +D+++F N  PD    + +     P      K L+   +     Y T L+     +P      + L  ++ K   K   +    K   +  FF  G         R+++SSP  T+      +S++++  K+I +I K  Y  I +          +  LK+ + +IET D+ +  L++        + +T+ +G AE M     N    + ++LVP +   G+
  S:     9 IVLAILDGWGHTNIQQGNAIKIAKTPTIDSLIQA-YPSTLLAASGQ------EVGLPKGQMGNSEVGHTTIGGGRVIQQELVKIGNSIVDNSFFNNLELNEACEYAN-NNKASLHLIGLCSNGGVHSHIDHLLALIDLADSKQVTNLYLHLITDGRDTS--------SNSAKYFIKIVADHIEHKQFATISTISGRYYAMD---RDFRWSRTQAAY-NILTSNNSIKLNASVNYGDLIDHYYNKGISDEFIPPSRINLGS--IKDNDAIVFFNFRPDRMRQIVQAFVQKPFNCFATKPLYNLRVVTFTNYDTSLNTTIAFHP--HILNNFLGEVLYKYGLKQFRVSETEKYAHVTYFFNGGAEEPFPGEDRELVSSPDVTTYDLSPDMSAELVTQKSISAIKKAIYSCIVINYANADMLGHTGKLKETIQSIETVDRCITELLDAVSKLNGTLIITADHGNAECMFTDEGNPCTAHTTNLVPLILIEGE 473
>gi|58584660|ref|YP_198233.1| phosphoglyceromutase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75497875|sp|Q5GSN3|GPMI_WOLTR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|37681508|gb|AAQ97628.1| independent phosphoglycerate mutase [Wolbachia endosymbiont of Brugia malayi] >gi|58418976|gb|AAW70991.1| Phosphoglyceromutase [Wolbachia endosymbiont strain TRS of Brugia malayi] (501 aa)
Score = 132, Expect = 2.6e-05, Identities = 88/382 (23%), Positives = 159/382 (41%)
  Q:    85 LELLDEQIKS-KSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPI-YGTKLD------AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGN-IIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFV 466
           L+ +D +IK+ ++  NL  F  + D  +K    + HI  ++S      + K++  + N + +  +K V+H   DG+D  P S  K +  F + +   +  I TV+GR +   +  R     E  ++ +E I               + N  N + D  I P    I D   +   D VL  N   D    LA ++  KT       F S L+ + Y   L         FF N         L  ++A N  + L +    K   +  FF  G+     N  R ++ SP   +      +S+  L +K +  I   +   ++           + +++     +   D  L +++N  +   + ++ +T+ +G  E M D+  N  PH   +L  VPF+
  S:    80 LQRIDREIKTIENNKNLRSF--ISDLKDKNG--VCHIMGLVSDGGVHSHQKHISTLANKISQHEIKVVIHAFLDGRDTLPNSGKKCVQEFEENIKGNDIRIATVSGRYYAMDRDNR----WERTIETYEAIAFARATCHNNVMSLIDNNYQNNITDEFIRP--TVIGDYKGIELKDGVLLANFRADRMIQLASILLGKTGYTEVAKFSSILSMMKYKEDLQIPCLFPPAFFTNT--------LGEIIADNKLRQLRIAETEKYAHVTFFFNCGKEEPFSNEERILIPSPKVETYDLQPEMSAFELTEKLVGKIRSQEFTLIVANYANPDMVGHTGNMEAAKKAVLAVDDCLAKVLNTVKEINDAVLIVTADHGNVECMFDEK-NNTPHTAHTLNKVPFI 459
>gi|170766795|ref|ZP_02901248.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia albertii TW07627] >gi|170124233|gb|EDS93164.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia albertii TW07627] (514 aa)
Score = 132, Expect = 2.6e-05, Identities = 92/411 (22%), Positives = 169/411 (41%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH-----VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLD--AVFFENPVKGKEESLL---ANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  +         F+    +       A +  +E +   V+ A+  P    + DG      D+++F+N   D    + R    +    G     +  +    L   A   +  V     SL+      +AKND   L +    K   +  FF  G   + +   R ++ SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K ++    G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPD-AAMEDG------DALIFMNFRADRAREITRAF-VNADFNGFARKKVVNVDFVMLTEYAADIKTAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILIDSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDAIICNYPNGDMVGHTGVMEAAVKAVEALDHCVNEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GDKQVKAVEG---GKLSDIAPTMLSL 496
>gi|77359332|ref|YP_338907.1| phosphoglyceromutase [Pseudoalteromonas haloplanktis TAC125] >gi|85540994|sp|Q3IIE4|GPMI_PSEHT 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|76874243|emb|CAI85464.1| phosphoglycerate mutase III, cofactor-independent [Pseudoalteromonas haloplanktis TAC125] (514 aa)
Score = 132, Expect = 2.8e-05, Identities = 88/366 (24%), Positives = 154/366 (42%)
  Q:   106 LIDRSNKTNS--KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSN----FSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIM----DGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDA--VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD-KHLNIVPHNKSSLVPFVFTNGD 471
           L+D  +K  S  K VHI  +LS      +  ++   I +  K+G K V  H   DG+D  P S   ++      F+K    R   + ++ GR +   +  R      + ++    +  L +  F+  +  +    A +  + D   A +TI     +   ++  D+V+F N   D    + R            + SP L    + +    Y   +DA   F   P+     ++L     K+    L +    K   +  FF     +E    TR+++ SP   +      ++S+ML DK + +I  GKYD I    P       S      +   E  D  +GR++      G    +T+ +G AE+M + K       + S  VPF++   D
  S:    99 LVDNIDKAVSADKAVHIMGLLSPGGVHSHEDHIVASIELAAKRGAKEVYFHGFLDGRDTPPRSAKASIERIEAVFAKLQCGR---LASLIGRYYAMDRDNR-----WNRVEKAYNLLTLAQGDFSYPTGVSALEAAYERDENDEFVAASTITPAGAEPVQINDGDTVIFANFRADRAREITRAFVEPNFDGFAKQKSPALSAFVMMTE---YAADIDAPVAFGPTPLV----NVLGEWFEKHGKTQLRISETEKYAHVTFFFSGGREDEFNGETRELIPSPQVATYDLQPEMNSEMLTDKLVAAIKSGKYDAIICNYPNGDMVGHSGVFAAAVKACEAVDHCIGRVVAALNKYGGEALITADHGNAEQMANLKTGQAHTAHTSEPVPFIYVGRD 477
>gi|156972489|ref|YP_001443396.1| phosphoglyceromutase [Vibrio harveyi ATCC BAA-1116] >gi|166991468|sp|A7MX70|GPMI_VIBHB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|156524083|gb|ABU69169.1| hypothetical protein VIBHAR_00121 [Vibrio harveyi ATCC BAA-1116] (510 aa)
Score = 132, Expect = 2.8e-05, Identities = 85/365 (23%), Positives = 150/365 (41%)
  Q:   107 IDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQA---FT--------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGD 471
           ID + K   K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K         G+  V    GR + +D ++  D  +    L  QA   FT        EA+    EN  ++ + A  + A     +   +   D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF     N  E   R++++SP   +      +SS  L +K + +I  GKYD I    P       +   +     IE  D+ +G+++   +     + +T+ +G AE M+D     V    ++L VP ++  GD
  S:   102 IDSAVKA-EKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLQRFQDLFAK--------LGKGRVASLVGRYYAMDRDNNWDRVQVAYDLLTQAKAEFTAETAVAGLEAAYAREEN--DEFVKATAIKAEG--QEDAIMQDGDAVIFMNYRADRARQITRAF--VPAFDGFERAVFPAINFVMLTQYAADIPLAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGGIENEFEGEERQLVASPKVATYDMQPEMSSPELTEKMVAAIKSGKYDTIICNYPNADMVGHTGVYEAAEQAIEALDESVGKVVEAIKEVSGQMLITADHGNAEMMIDPETGGVHTAHTNLPVPLIYV-GD 473
>gi|193068453|ref|ZP_03049415.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli E110019] >gi|192958104|gb|EDV88545.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli E110019] (514 aa)
Score = 131, Expect = 2.9e-05, Identities = 97/411 (23%), Positives = 176/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D+D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDSDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAAESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 496
>gi|193066081|ref|ZP_03047137.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli E22] >gi|194427416|ref|ZP_03059965.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli B171] >gi|192926243|gb|EDV80881.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli E22] >gi|194414456|gb|EDX30729.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli B171] (514 aa)
Score = 131, Expect = 3.2e-05, Identities = 97/411 (23%), Positives = 175/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSVGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 496
>gi|163733047|ref|ZP_02140491.1| phosphoglyceromutase [Roseobacter litoralis Och 149] >gi|161393582|gb|EDQ17907.1| phosphoglyceromutase [Roseobacter litoralis Och 149] (505 aa)
Score = 131, Expect = 3.3e-05, Identities = 110/460 (23%), Positives = 192/460 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDS---------NFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKF--LLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLF-LN-------------SDPD----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           ++  + +G GL+++ +GN   LA+ PN++ L++   P A L+       + P    PS +                  M  G+ D+      ++E I +++   L  F   +  S  T     H+  ++S      +  ++      L  + +  V+H + DG+D  P S    L  F      L     I TV GR     +  R D +       Y   + G G +A   AS+  ++  A    D  ILP   T++DGY  +KD+   F LN              DP+          D+A L  M + S +    +++++ P               K +  + L + VA+   +   L    K   +  F   GE  +     R +  SP   +      +SSK + D  + +I + YD+I V          + DL+  +   E  D  LGR++      G  + +T+ +G  + M+D      PH   +L P
  S:     7 VVLCILDGWGLSERREGNAPLLADTPNMDRLMATC-PHATLTT------FGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLA-----IEEGIFAQN-SRLRAFIVTLQDSGGT----AHLMGVVSDGGVHGHINHMVAAAKALADENIPVVIHALTDGRDVAPRS---ALGYFETLQAALPDGVEIATVTGRYFAMDRDNRWDRVSKA----YQAIVTGTGRKA-ASASDAVDQAYAQGENDEFILP---TVLDGYTGAKDNDGFFCLNFRADRAREIMAAIGDPEFSAFDTGDRPDWARLMGMAQYS-QAHAAYMTTMYP---------------KPEIVNTLGDWVAQQGLRQYRLAETEKYPHVTFFLNGGEEVSFAGEDRLMPKSPDVATYDLQPEMSSKEVTDAFVAAIEEGYDLIVVNYANPDMVGHTGDLQAAMKACEAVDHGLGRVLAALEKAGGAMIVTADHGNCDVMIDPETG-GPHTAHTLNP 460
>gi|73669713|ref|YP_305728.1| phosphoglyceromutase [Methanosarcina barkeri str. Fusaro] >gi|85540981|sp|Q46AE4|GPMI2_METBF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 (Phosphoglyceromutase 2) (BPG-independent PGAM 2) (iPGM 2) >gi|72396875|gb|AAZ71148.1| phosphoglycerate mutase [Methanosarcina barkeri str. Fusaro] (525 aa)
Score = 131, Expect = 3.5e-05, Identities = 103/448 (22%), Positives = 194/448 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTY-LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKR-NTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICG----LGE-QAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLN--SD----------PDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           +  L+ ++ +G G  +  +GN +  A  PN++ L     PW  L    +    +PK          +S    +  G   I    L  ++  IK+       +F   I    K N+  +H+  + S         +L  ++ ++ +K LK V +H   DG+DE P +   ++     F  +  N  I TV+GR +   +  R        D L      +     ET        GE   F + +  T + +  +V+         T+ D      +DSV+F N  +D           DDF    R  +  P++  + ++     Y   L+      P+K   E++L  +++K+    L +    K   +  F   GE    ++  R ++ SP   +      +S+  + D+ I  I  GKYDVI +    +     +   +  +  +E  D+ +GR++ + +  G +  +T+ +G AE+M+D
  S:     5 RRPLMLIIFDGWGYREAKEGNAVMTARTPNLDRLEKEC-PWCFLKASGEAVG-LPKGMMG------NSEVGHLTIGAGRIVNQDLTRINISIKNGDFFKNPVFLNAISNV-KANASSLHLMGLASCGGIHSYMPHLHALLKLVQEKDLKKVYIHAFLDGRDEPPKAALGDIKKLDAFCKEHGNAKIATVSGRYYAMDRDKRWDRTKLAYDALTRGVAPYTAPNAETAVSNAYSRGETDEFVKPTIITEQVITEQVITEQAEKPVATVQD------NDSVIFFNFRADRARQITWAFVKDDFDGFMR--EKRPEVYFVCMTQ----YDETLEVPIAFPPIK--LENVLGEVLSKHGLIQLRIAETEKYAHVTYFLNGGEEKRYKDEDRCLIPSPKIATYDLKPEMSAYEITDEVIRRIQSGKYDVIVLNFANMDMVGHTGIFEAAVKAVEAVDKCIGRIVEVLKEKGGVALITADHGNAEEMID 464
>gi|15804156|ref|NP_290195.1| phosphoglyceromutase [Escherichia coli O157:H7 EDL933] >gi|15833744|ref|NP_312517.1| phosphoglyceromutase [Escherichia coli O157:H7 str. Sakai] >gi|74314151|ref|YP_312570.1| phosphoglyceromutase [Shigella sonnei Ss046] >gi|82545980|ref|YP_409927.1| phosphoglyceromutase [Shigella boydii Sb227] >gi|157155712|ref|YP_001465095.1| phosphoglyceromutase [Escherichia coli E24377A] >gi|157163096|ref|YP_001460414.1| phosphoglyceromutase [Escherichia coli HS] >gi|168709290|ref|ZP_02741567.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4045] >gi|168716782|ref|ZP_02749059.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4206] >gi|168735121|ref|ZP_02767398.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4115] >gi|168746836|ref|ZP_02771858.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4113] >gi|168753438|ref|ZP_02778445.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4401] >gi|168759712|ref|ZP_02784719.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4501] >gi|168766034|ref|ZP_02791041.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4486] >gi|168772420|ref|ZP_02797427.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4196] >gi|168779770|ref|ZP_02804777.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4076] >gi|168785492|ref|ZP_02810499.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC869] >gi|168791166|ref|ZP_02816173.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4042] >gi|168797458|ref|ZP_02822465.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC508] >gi|170018155|ref|YP_001723109.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Escherichia coli ATCC 8739] >gi|187733244|ref|YP_001882312.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella boydii CDC 3083-94] >gi|188494782|ref|ZP_03002052.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli 53638] >gi|191168148|ref|ZP_03029945.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli B7A] >gi|194435928|ref|ZP_03068031.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli 101-1] >gi|195935141|ref|ZP_03080523.1| phosphoglyceromutase [Escherichia coli O157:H7 str. EC4024] >gi|166991380|sp|A7ZTG6|GPMI_ECO24 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|166991381|sp|A8A677|GPMI_ECOHS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|189042194|sp|B1IZH8|GPMI_ECOLC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|27734315|sp|Q8XDE9|GPMI_ECO57 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|85541656|sp|Q31V09|GPMI_SHIBS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|85541658|sp|Q3YVX7|GPMI_SHISS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|12518362|gb|AAG58759.1|AE005588_10 putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 EDL933] >gi|13363965|dbj|BAB37913.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. Sakai] >gi|73857628|gb|AAZ90335.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella sonnei Ss046] >gi|81247391|gb|ABB68099.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella boydii Sb227] >gi|157068776|gb|ABV08031.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli HS] >gi|157077742|gb|ABV17450.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli E24377A] >gi|169753083|gb|ACA75782.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Escherichia coli ATCC 8739] >gi|187430236|gb|ACD09510.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella boydii CDC 3083-94] >gi|187771678|gb|EDU35522.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4196] >gi|188018371|gb|EDU56493.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4113] >gi|188489981|gb|EDU65084.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli 53638] >gi|189002576|gb|EDU71562.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4076] >gi|189358981|gb|EDU77400.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4401] >gi|189364642|gb|EDU83061.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4486] >gi|189369897|gb|EDU88313.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC4501] >gi|189374417|gb|EDU92833.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC869] >gi|189380029|gb|EDU98445.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli O157:H7 str. EC508] >gi|190901817|gb|EDV61569.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli B7A] >gi|194425471|gb|EDX41455.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli 101-1] (514 aa)
Score = 130, Expect = 3.7e-05, Identities = 97/411 (23%), Positives = 175/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVAGGKLSDIAPTMLSL 496
>gi|85057716|ref|YP_456632.1| phosphoglyceromutase [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518167|sp|Q2NJ40|GPMI_AYWBP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|84789821|gb|ABC65553.1| phosphoglycerate mutase [Aster yellows witches'-broom phytoplasma AYWB] (512 aa)
Score = 130, Expect = 4.3e-05, Identities = 103/466 (22%), Positives = 196/466 (42%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL--KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL--GEQA--FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKT-----------------SPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
            ++ +G+GL  + + N   LA  P ++YL+                K  P  T  +   +V     +M   E           +   L  +++ I+ K+    + F + I+   K NSKI H+  ++S      +  +   + ++L +  L     LH   DG+D   +S      N+ K LL     I +VAGR +         LD ++  D    +  +   +QA   T + E T +N  N+ +  + +  + T  +G  +  +D+V+F+N  PD    LA  +                   +  +  LFL ++          V FE   K   +++   ++A      L +    K   +  FF  G+    +N  R ++ SP   +      +S+  + +    +I   KYD + +          +  L   +  ++T D  L  ++N          + + +G AEKM D   N    + ++LVPF+ T+ ++
  S:     8 LIILDGLGLTDQKENNAFHLAKTPYLDYLL----------------KNFPNTTLKASGEEVGLPQGQMGNSEVGHLNLGAGRVVYQSLTQINKAIRDKTFFTNKQFLQAIEHVKKNNSKI-HLLGLISDGGIHSHLDHFKALFDLLKENNLANNTFLHAFTDGRDTGTHSG----INYIKNLLDYGFNIASVAGRYYA--------LDRDNNWDRINLVYNMLTSKQAPVITLSLEKTMQNFYNQGITDEFITPFITDPNG-LIDDNDAVIFVNFRPDRAMRLATALSNPCATNAFCSEGKTNFCGNKLVNNLFLVTMTQYNVQVKSVVAFE---KKTLKNIYGEVIANLGMHQLRISETEKYPHVTFFFDGGKELQLKNADRILIPSPKVKTYDLKPEMSALEITNAAKTAIFSRKYDTLILNFANPDMVGHTGFLDATIKAVQTVDSCLKEVLNAIFAVKGKACIVADHGNAEKMKDNQGNPHTAHTTNLVPFIVTDKNV 476
>gi|91074704|gb|ABE09585.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli UTI89] (523 aa)
Score = 130, Expect = 4.4e-05, Identities = 97/411 (23%), Positives = 175/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    90 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 505
>gi|126732720|ref|ZP_01748516.1| phosphoglyceromutase [Sagittula stellata E-37] >gi|126706850|gb|EBA05920.1| phosphoglyceromutase [Sagittula stellata E-37] (517 aa)
Score = 130, Expect = 4.5e-05, Identities = 108/489 (22%), Positives = 200/489 (40%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFL--LKRNT-PI--VTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYN-----------TIMDGY-FVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKE-ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLD 493
           +I  + +G GL ++   N   LA  P I+ L++      L+++        P    P+ +       +  +     +   L  +D  I+ KS    +         N+   K VH+  + S      +  ++     ++  +GL+  LH++ DG+D  P    K ++N  K L   + NT P+   +V GR +   +  R     E V   +  +    +   ++A  + N    +   +A I   Y+           ++++GY    + D + FLN   D            DF   AR     P L     + L  +  ++    +       +E  + L   VAK+D     L    K   +  F   G+ T   +  R +  SP   +      +S+  + +K +D+IGK YD+I V          + DL   +   E  D  LG+++     TG  + + + +G  E M+D      PH  + ++LVP +   G             V  ++L+ +D
  S:     4 VILTILDGWGLREETANNAPALAKTPTIDRLMATCPHATLITHG-------PDVGLPTGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDKSFFENKAILDFCGAVNEAGGK-VHLAGLTSDGGVHAHVSHMIAAAKMMRDQGLEVWLHILTDGRDTDPKCALKYIANLRKELDIPEENTGPVRFASVIGRYYAMDRDNR----WERVEAAYRAMTAYAD---SDADAFPNGG-THPTPEAAIKAGYDQRGEGDEFIKPSVIEGYQGFGEGDGLFFLNFRADRAREILAAIAAPDFDGFAR---EKPALS----ACLGMVQYSEAHEKYMTTAFPKREIVNTLGEWVAKHDKTQFRLAETEKYPHVTFFLNGGKETPEPHEDRFMPKSPKVATYDLQPEMSAGEVTEKFLDAIGKGYDLIVVNYANPDMVGHTGDLDAAIKACEAVDHGLGQVVEKLEQTGGALLVIADHGNCETMVDPETG-GPHTAHTTNLVPVILFGGPDGASLADGRLADVAPTLLALMD 503
>gi|193076101|gb|ABO10705.2| phosphoglycerate mutase III cofactor independent [Acinetobacter baumannii ATCC 17978] (515 aa)
Score = 130, Expect = 4.6e-05, Identities = 86/380 (22%), Positives = 150/380 (39%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           + + I++ +    E+    ++++ K     VHI  +LS      +  ++  +  + +K+G K  LH   DG+D  P S   +L        +         G+  +    GR F +D ++  D  E    L   GE   T  +      LA    + D       I +   V   DSV+F+N   D            DFA   R  K  P L    + +    Y   +DA     PV    E L   L   ++      L +    K   +  FF     +E     R ++ SP   +      +S+  + D+ + +I  G+YD++ V          +      +  +E  D  LGR+          + +T+ +G  E+M D     V   + + LVPF++
  S:    87 ITKDIRTGAFFEHEVLVDAVEKA-KAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTPPRSAQPSLEKLDALFAQYE-------GKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRTANTAVEGLELAYAANENDEFVKATRIGESAKVQDGDSVVFMNFRADRAREITRAFVEKDFAGFER--KVVPNLSKFVMLTR---YQASIDA-----PVAYMPEELKNSLGEYLSSLGKTQLRIAETEKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEYDLLVVNYANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQMQDYESGQVHTQHTTELVPFIY 472
>gi|110643856|ref|YP_671586.1| phosphoglyceromutase [Escherichia coli 536] >gi|117625890|ref|YP_859213.1| phosphoglyceromutase [Escherichia coli APEC O1] >gi|162138341|ref|YP_543116.2| phosphoglyceromutase [Escherichia coli UTI89] >gi|170681198|ref|YP_001745914.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli SMS-3-5] >gi|191170326|ref|ZP_03031879.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli F11] >gi|194431078|ref|ZP_03063371.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella dysenteriae 1012] >gi|123048715|sp|Q0TBJ4|GPMI_ECOL5 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|166991382|sp|A1AHE9|GPMI_ECOK1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|110345448|gb|ABG71685.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli 536] >gi|115515014|gb|ABJ03089.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli APEC O1] >gi|170518916|gb|ACB17094.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli SMS-3-5] >gi|190909134|gb|EDV68720.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Escherichia coli F11] >gi|194420533|gb|EDX36609.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella dysenteriae 1012] (514 aa)
Score = 130, Expect = 4.6e-05, Identities = 97/411 (23%), Positives = 175/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 496
>gi|158334806|ref|YP_001515978.1| phosphoglyceromutase [Acaryochloris marina MBIC11017] >gi|189042185|sp|B0CA77|GPMI_ACAM1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|158305047|gb|ABW26664.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Acaryochloris marina MBIC11017] (534 aa)
Score = 129, Expect = 4.8e-05, Identities = 99/467 (21%), Positives = 194/467 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR--------DFLDNEHVM---DYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENP--VKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           ++ ++ +G G  +   GN +  AN P I+ L +  YP   +    K          P+ +       +  L     +   L  + + I+  SL      +K+  + ++ ++K+ H+  + S      ++ +L  ++ +  +  +  V +H I DG+D  P S    +    K +       IVT++GR     +  R        D + N+ V    D+          A T+A ++   +        + LP    I  G  +   D V+F N  PD    L +     PK  G     + P++         + P  V  K ++L   L  +VA +  K L L    K   +  FF     +      R ++ SP  ++  +   +S+  + ++ I ++ K  Y ++ +          +  +   +  +ET D  LG+L+N     G  + +T+ +G AE+M D+  N    + ++ VPF+   G+
  S:     9 VVLVILDGWGYQENSDGNAIATANTPIIDSLWTA-YPSTFIQTSGK------AVGLPAGQMGNSEVGHLNLGAGRTVPQELVRIADAIEDGSLATNPALDKVCKQVSQASTKL-HLIGLCSKGGVHAHSDHLLALLKLAKEHNISQVCIHAILDGRDTPPKSAKDEILRLQKQIAHIGVGQIVTLSGRYFAMDRDRRWDRIQQAYDVMVNDQVAVPRDWSPL------DAITDAYDHKTTD--------EFLPP-TRIAPGA-IEAGDGVIFFNFRPDRARQLTQAF-VDPKFDGFEREQVKPLHFVTFTQYDSDLPTDVAFKPQNLDNILGEIVANHGLKQLRLAETEKYAHVTYFFNGGIEDPLPGEDRILVPSPMVSTYDQDPPMSAAKVTEEAIAALDKRIYSLMVINYANTDMVGHTGMMDATIQAVETVDGCLGKLLNQVINVGGTLLITADHGNAERMWDETGNPWTAHTTNPVPFILVEGE 472
>gi|16131483|ref|NP_418069.1| phosphoglycero mutase III, cofactor-independent [Escherichia coli str. K-12 substr. MG1655] >gi|89110399|ref|AP_004179.1| phosphoglycero mutase III, cofactor-independent [Escherichia coli W3110] >gi|170083120|ref|YP_001732440.1| phosphoglycero mutase III, cofactor-independent [Escherichia coli str. K12 substr. DH10B] >gi|586733|sp|P37689|GPMI_ECOLI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|466750|gb|AAB18589.1| unnamed protein product [Escherichia coli] >gi|1790041|gb|AAC76636.1| phosphoglycero mutase III, cofactor-independent [Escherichia coli str. K-12 substr. MG1655] >gi|85676430|dbj|BAE77680.1| phosphoglycero mutase III, cofactor-independent [Escherichia coli W3110] >gi|169890955|gb|ACB04662.1| phosphoglycero mutase III, cofactor-independent [Escherichia coli str. K12 substr. DH10B] (514 aa)
Score = 129, Expect = 4.8e-05, Identities = 97/411 (23%), Positives = 175/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK ++     +    +D++ K   K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRAFFANPVLTGAVDKA-KNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 496
>gi|187934745|ref|YP_001887244.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum B str. Eklund 17B] >gi|187722898|gb|ACD24119.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium botulinum B str. Eklund 17B] (512 aa)
Score = 129, Expect = 5.2e-05, Identities = 100/448 (22%), Positives = 189/448 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K  ++ ++ +G G+  K +GN + LA KPN + L++  YP + L            +   S    ++     ++Y E      L  + + IK       E   K +  + K N+  +H+  +LS      + ++L  ++    K+G++ V +H   DG+D  P S  + +      + +     I T++GR +   +  R     E V + Y   + G GE A   A E   ++  +   D  +LP    + +G     +   DSV+F N  PD    + R +  K     K   L +L  +  T+ D       V  K ++L   L   V+      L +    K   +  FF      EN    R ++ SP   +      +S+  + D+ ++ +   KYD++ +          +  +   +  IE+ D+ LG++ +        + +T+ +G AE M+D
  S:     3 KRPVMLMILDGFGIAPKSEGNAVSLAKKPNFDRLVAN-YPTSQLQASGLEVGLPEGQMGNSEVGHLNIGSGRIVYQE------LTRITKAIKDGDFFENESLMKAMTNA-KNNNSALHLMGLLSDGGVHSHIEHLRGLLEFAKKEGIQNVYVHAFMDGRDVAPSSGKEFVEKTESMMAEVGIGKIATISGRYYAMDRDNR----WERVELAYNALVLGEGETA-NSAVEAMEKSYHDNKTDEFVLPTV-VLENGDPTATIKNGDSVIFFNFRPDRAREITRAINDKVFDGFKRETL-NLTFVTMTQYDKTLEGVEVAYKPQTLANTLGEYVSSKGLNQLRIAETEKYAHVTFFFNGGVEKENPGEERVVIPSPKVATYDLKPEMSAYEVTDELLNRLDSDKYDMVILNFANPDMVGHTGVIPAAVKAIESVDECLGKIADKMLEKDGCLFITADHGNAETMID 450
>gi|114762103|ref|ZP_01441571.1| phosphoglyceromutase [Roseovarius sp. HTCC2601] >gi|114545127|gb|EAU48130.1| phosphoglyceromutase [Roseovarius sp. HTCC2601] (504 aa)
Score = 129, Expect = 5.2e-05, Identities = 89/369 (24%), Positives = 154/369 (41%)
  Q:   140 INVLIKKGLKPVLHLIADGQDERPYS---FNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF-VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLF-----LSSLAPIYGTKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           + +L   G   ++H I DG+D  P S   F K+L +     L     I TV GR +   +  R     E +   ++  I   GE A  +     +++ AN   D + +PA  T++DGY  +   D    +N   D    + + +  +P   G       LS+L  +     D   +      K E  + L   VAK+  +   L    K   +  F   G+ T  E   R +  SP   +      +S   + +K +++I   YD+I            + DL+  +   E  D  LG++++     G  + + + +G  E M D+  +  PH  + ++LVP +   G             V  ++L  +  LD   ++  TSLID
  S:   134 VKMLTDLGCNVIIHAITDGRDVAPKSGEAFVKDLGDS----LPEGASIGTVIGRYYAMDRDNR----WERIQQAYDAMILAKGETA-PDPVTAVSQSYANGKTD-EFIPA--TVIDGYAGLDAGDGFFCMNFRADRAREILKAVG-APDFDGFERDKPELSALLGMVEYSDDHNAYMTTAYPKREIVNTLGEWVAKHGRRQFRLAETEKYPHVTFFLNGGKETPEEGEDRFMPKSPKVATYDMQPEMSEPEVAEKFVEAIEAGYDLIVTNFANPDMVGHTGDLEAAIKACEAVDDGLGKVVSALEKAGGAMVVIADHGNCETMWDEATD-GPHTAHTTNLVPVILFGGPEGATVHDGRLADVAPTLLQLM-GLDRPEEMTGTSLID 504
>gi|82779105|ref|YP_405454.1| phosphoglyceromutase [Shigella dysenteriae Sd197] >gi|85541657|sp|Q329P2|GPMI_SHIDS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81243253|gb|ABB63963.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Shigella dysenteriae Sd197] (514 aa)
Score = 129, Expect = 5.6e-05, Identities = 97/411 (23%), Positives = 175/411 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVM------DYFETICGLGEQA---------FTEASEYTNENLANKVM-DADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD +IK +      +    +D++ K+  K VHI  +LS      +  ++  ++ +  ++G + + LH   DG+D  P S   +L  F  KF       + ++ GR +   +  R D ++  + +      ++       G QA         F +A+    E   +  M D D L   N   D    +++ +  F+N+D D FA      K    +  + L+  A    T   AV +         +     +AKND   L +    K   +  FF  G   + +   R +++SP   +      +SS  L +K + +I  GKYD I    P       +  ++  +  +E  D  +  +       G  + +T+ +G AE+M D          ++L VP ++  GD   K +++   G  S I  T+ SL
  S:    81 LTRLDVEIKDRVFFANPVLTGAVDKA-KSAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADR---AREITRAFVNADFDGFAR-----KKVVNVDFVMLTEYAADIKT---AVAYP---PASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVDEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYV-GD---KNVKAVEGGKLSDIAPTMLSL 496
>gi|23099890|ref|NP_693356.1| phosphoglyceromutase [Oceanobacillus iheyensis HTE831] >gi|27734301|sp|P59174|GPMI_OCEIH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|22778121|dbj|BAC14391.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) [Oceanobacillus iheyensis HTE831] (512 aa)
Score = 129, Expect = 5.6e-05, Identities = 98/466 (21%), Positives = 200/466 (42%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRD--VDSNFYEMLYGETDIKT------YLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDL 472
            ++ +G  +  + KGN +K AN PN                DR  N+Y   +   S K     D        G  +I         L  ++  I     + ++ F K ++ + K + K +H+F +LS      +  +LF ++ +  K  L+ V +H   DG+D  P + +K +      + +       T++GR +   +  R     + V   ++ +      ++  A E  ++N AN++ D  ++P+  T  +   V+    +DS++F N  PD            DF    R  K   KL  + L++    +   +D      PV    ++ +  ++A+N+   L +    K   +  F       E     R ++ SP   +    + L  +M + +  D++      G+ + I +          S  L+  +  IE  D+ LG++I+     G    +T+ +G +++++      +  + ++ VP + T  D+
  S:     9 LIILDGFAIRDEVKGNAVKQANTPNF---------------DRFWNQYAHNQLEASGKAVGLPDGQMGNSEVGHLNIGAGRIVYQSLTRVNVSIDEGDFYEVDAFIKSVEHAKK-HDKALHLFGLLSDGGVHSHINHLFALLRLAKKHELENVFVHAFLDGRDVGPKTASKYIKETQDVMDELGVGQFATISGRYYSMDRDKR----WDRVKKCYDAMVYGEGPSYKSAQEVVDDNYANEIYDEFVIPSVITDDNDEPVATIKDEDSIIFYNFRPDRAIQISRTFANEDFRDFERGDKAPKKLDFVMLTN----FSETVDGYVAYQPV--NLDNTVGEVLAQNNLNQLRIAETEKYPHVTFFMSGGREKEFPGEKRILIDSPKVAT----YDLKPEMSVYEVTDALLKELDKGEQNAIILNFANPDMVGHSGKLQPTIDAIEAVDECLGKVIDKITELGGHAIITADHGNSDEVMTLEDKPMTAHTTNPVPVIVTKDDI 477
>gi|126640323|ref|YP_001083307.1| phosphoglyceromutase [Acinetobacter baumannii ATCC 17978] (475 aa)
Score = 129, Expect = 5.7e-05, Identities = 86/380 (22%), Positives = 150/380 (39%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           + + I++ +    E+    ++++ K     VHI  +LS      +  ++  +  + +K+G K  LH   DG+D  P S   +L        +         G+  +    GR F +D ++  D  E    L   GE   T  +      LA    + D       I +   V   DSV+F+N   D            DFA   R  K  P L    + +    Y   +DA     PV    E L   L   ++      L +    K   +  FF     +E     R ++ SP   +      +S+  + D+ + +I  G+YD++ V          +      +  +E  D  LGR+          + +T+ +G  E+M D     V   + + LVPF++
  S:    47 ITKDIRTGAFFEHEVLVDAVEKA-KAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTPPRSAQPSLEKLDALFAQYE-------GKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRTANTAVEGLELAYAANENDEFVKATRIGESAKVQDGDSVVFMNFRADRAREITRAFVEKDFAGFER--KVVPNLSKFVMLTR---YQASIDA-----PVAYMPEELKNSLGEYLSSLGKTQLRIAETEKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEYDLLVVNYANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQMQDYESGQVHTQHTTELVPFIY 432
>gi|196239902|ref|ZP_03138673.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 7425] >gi|196216161|gb|EDY10809.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 7425] (532 aa)
Score = 129, Expect = 5.7e-05, Identities = 72/320 (22%), Positives = 132/320 (41%)
  Q:   152 LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEH-VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +H I DG+D  P      +      L +     IVT++GR +   +  R D ++  + VM   E I        T A +      A  + D  + P    I  G  ++  D V+F N  PD    L +     P  KG   S ++P+       Y   L       P      ++L  ++A    K L +    K   +  FF     +      R ++ SP   +  +  ++S+  +  + I ++  G Y ++ V          +  +K  +  +E  D+ +G+L+      G  + +T+ +G AE M+D+  N    + ++ VPF+   G+
  S:   149 VHAITDGRDTLPTEGKTFIQRLQDHLDRLEMGQIVTLSGRYYAMDRDRRWDRVERAYRVMTSDENIVD------TPAWKILANGYAENITDEFLPPV--RIAPGA-IAAGDGVVFFNFRPDRARQLTQAF-VDPNFKGFERSLISPLDFVTFTQYDASLSCAIAFPP--QNLSNILGEVIAAKGLKQLRVAETEKYAHVTYFFNGGIEDPLPGEDRILVPSPMVATYDQAPAMSAAQVTQEVIAAVEKGVYSMVVVNYANPDMVGHTGQMKATIQALEAVDRCVGQLLQSVLQMGGTLLITADHGNAECMVDEQGNPWTAHTTNPVPFILVEGE 470
>gi|70727111|ref|YP_254025.1| phosphoglyceromutase [Staphylococcus haemolyticus JCSC1435] >gi|82592888|sp|Q4L4K6|GPMI_STAHJ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|68447835|dbj|BAE05419.1| 2,3-diphosphoglycerate- independentphosphoglycerate mutase [Staphylococcus haemolyticus JCSC1435] (505 aa)
Score = 129, Expect = 5.7e-05, Identities = 107/467 (22%), Positives = 192/467 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILP-----AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLDA-VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K     ++ +G    +   GN +K A+KPN                DR  +KY P     +   DV        +S    M  G   I    L  +++ I        ++ N  +   N+ +S + H+F +LS      + ++LF ++ +  +KGL  V +H   DG+D    S  K +    +KF         +++GR +   +  R   D E     +  I      A+  A E    N AN + D  + P       N I DG      D+V+F N  PD  A L+ +            ++K LF ++    Y   +D  V FE   K    + +  +   N+ K L +    K   +  F   G N   E   R+++ SP   +      +S+  + D  ++ +  G  D+I +          S  L+  +  IE  D+ LG +++          +T+ +G ++++L      +  + ++ VP + T
  S:     3 KQPTALIILDGFANRESEHGNAVKQAHKPNF---------------DRYYSKY-PTTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIADGDFFENDVLNNAVQHVNEHDSAL-HVFGLLSDGGVHSHYQHLFALLELAKQKGLDKVYVHAFLDGRDVDQKSALKYIEETEAKFKSLGVGEFASISGRYYAMDRDKR--WDREQ--KAYNAIRNFEGPAYASAKEGVEANYANDLTDEFVEPFIVEGQNNGINDG------DAVIFFNFRPDRAAQLSEVFTNKAFDGFKVEQVKDLFYATFTK-YNDNVDTEVVFE---KVDLTNTIGEVAQNNNLKQLRIAETEKYPHVTYFMSGGRNEEFEGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELDKGDLDLIILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILDMNGYAIITADHGNSDQVLTDDDQPMTTHTTNPVPVIVT 466
>gi|172036704|ref|YP_001803205.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Cyanothece sp. ATCC 51142] >gi|171698158|gb|ACB51139.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Cyanothece sp. ATCC 51142] (534 aa)
Score = 129, Expect = 6.1e-05, Identities = 76/327 (23%), Positives = 141/327 (43%)
  Q:   145 KKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---FLSSLAPIYGTKLD-----AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K+GL  V +H I DG+D       K ++  S  + +     I T++GR     +  R     + V   ++ I   G      A E   +   +   D  I P   T +    +   D V+F N  PD    L+  + T P   G     ++ L+ +  T+ D     AV FE        ++L  ++A+   K   +    K   +  FF  G     E   R+++ SP  ++  +  ++S++ +      ++  G Y +I +          + + +  +  IET D  LG+L++     G  + +T+ +G AE M D++ N    + ++ VP +F  G+
  S:   143 KQGLADVCVHAITDGRDTNTTDGVKAIAKISDHIQELGIGRIATISGRYFAMDRDRR----WDRVKLAYDLITQDGVGDGRSAVEVLEDFYRHDKTDEFIPP---TRVAPGAIEPGDGVIFFNFRPDRARQLSAAL-TMPNFDGFERELITPLSFVTFTQYDPRLPVAVAFE---PQNLNNILGEVIAEQGLKQFRVAETEKYPHVTYFFNGGLEQPLEGEERELIQSPMVSTYDQSPAMSAEAVTQAACKAVEKGVYSLIVINYANPDMVGHTGNTEAAIEAIETVDNCLGQLLSSVSKLGGTVLITADHGNAETMRDENGNPWTAHTTNPVPLIFVEGE 472
>gi|123440477|ref|YP_001004471.1| phosphoglyceromutase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166991469|sp|A1JHY1|GPMI_YERE8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|122087438|emb|CAL10219.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia enterocolitica subsp. enterocolitica 8081] (515 aa)
Score = 128, Expect = 6.3e-05, Identities = 94/411 (22%), Positives = 166/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK             +D++ K   K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF       I ++ GR +   +  R        D L     E   D    + GL    A  E  E+    +     + D       + DG      D+++F+N   D    + R    +    G F       +G  +    +   +K          E+     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K++++   G  S I  T+ SL
  S:    81 LTRLDKEIKDGDFFTNPTLTAAVDKAVKA-GKAVHIMGLLSAGGVHSHEDHILAMVELAAKRGATAIYLHAFLDGRDTPPRSAEPSLKRFTEKFAALGKGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTAD--NAVVGLQAAYARNENDEFVKPTVIQAAGEPDA-----AMNDG------DALIFMNFRADRARQITRTF-VNADFDG-FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLENTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVGAIASGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVQAVDGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KEVKAVEGGKLSDIAPTMLSL 497
>gi|169797501|ref|YP_001715294.1| phosphoglycerate mutase III, cofactor independent [Acinetobacter baumannii AYE] >gi|184156575|ref|YP_001844914.1| phosphoglyceromutase [Acinetobacter baumannii ACICU] >gi|169150428|emb|CAM88325.1| phosphoglycerate mutase III, cofactor independent [Acinetobacter baumannii] >gi|183208169|gb|ACC55567.1| Phosphoglyceromutase [Acinetobacter baumannii ACICU] (515 aa)
Score = 128, Expect = 7.2e-05, Identities = 86/380 (22%), Positives = 150/380 (39%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           + + I++ +    E+    ++++ K     VHI  +LS      +  ++  +  + +K+G K  LH   DG+D  P S   +L        +         G+  +    GR F +D ++  D  E    L   GE   T  +      LA    + D       I +   V   DSV+F+N   D            DFA   R  K  P L    + +    Y   +DA     PV    E L   L   ++      L +    K   +  FF     +E     R ++ SP   +      +S+  + D+ + +I  G+YD++ V          +      +  +E  D  LGR+          + +T+ +G  E+M D     V   + + LVPF++
  S:    87 ITKDIRTGAFFEHEVLVDAVEKA-KAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTPPRSAQPSLEKLDALFAQYE-------GKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRTATTAVEGLELAYAANENDEFVKATRIGEIAKVQDGDSVVFMNFRADRAREITRAFVEKDFAGFER--KVVPNLSKFVMLTR---YQASIDA-----PVAYMPEELKNSLGEYLSSLGKTQLRIAETEKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEYDLLVVNYANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQMQDYESGQVHTQHTTELVPFIY 472
>gi|86147230|ref|ZP_01065545.1| phosphoglyceromutase [Vibrio sp. MED222] >gi|85834945|gb|EAQ53088.1| phosphoglyceromutase [Vibrio sp. MED222] (510 aa)
Score = 128, Expect = 7.8e-05, Identities = 82/383 (21%), Positives = 162/383 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGK--------KGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYN----TIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           L  + + I        E     +D++ K + K VHI  ++S      +  +++  + +  ++G + + LH   DG+D  P S    L+ F +   K     + ++ GR +   +        +  D L        F+T + GL      EA+   +EN  ++ + A  + A       I+DG      D+V+F+N   D    + R     P   G   ++   I    L     + P+         E+     ++K     L +    K   +  FF  G+    E   R++++SP   +      +S+  L +K + +I  GKYD I    P       +      +  +E+ D+ LG+++   +     + +T+ +G AE M++     +    ++L VP ++
  S:    80 LTRITKSISDGEFGQTEALVNAVDKAVKAD-KAVHIMGLMSPGGVHSHEDHIYAAVEMAAERGAEKIYLHAFLDGRDTPPRSAENTLARFQELFAKLGKGRVASLIGRYYAMDRDNNWDRVQESYDLLTQAKAEFTFDTAVAGL------EAAYARDEN--DEFVKATEIKAEGEESAAIVDG------DAVIFMNYRADRAREITRAF--VPDFDGFARNAFPAIDFVMLTQYAADIPLLCAFPPASLENTYGEWLSKEGKTQLRISETEKYAHVTFFFNGGKEDEFEGEERQLVASPKVATYDLQPEMSAPELTEKLVAAIKGGKYDAIVCNFPNCDMVGHTGVYDAAVKAVESLDECLGKVVEAIKEADGQLLITADHGNAEMMVNPETGGIHTAHTNLPVPLIY 470
>gi|73663222|ref|YP_302003.1| phosphoglyceromutase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82592889|sp|Q49W02|GPMI_STAS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|72495737|dbj|BAE19058.1| phosphoglycerate mutase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (505 aa)
Score = 128, Expect = 8.0e-05, Identities = 110/507 (21%), Positives = 207/507 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIK-----------TYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLDA-VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           K     ++ +G    +   GN +KLANKPN                DR  +KY   +   S    +D    E   G +++              L  +++ I+       ++ N  I+   K N  ++H+F +LS      + K+LF ++++  K+GL+ V +H   DG+D    S  K +    +KF         +V+GR +   +  R   D E     +  I   G   F  A      N    + D  + P +        V+  D+V+F N  PD    L+ +            ++  LF ++    Y   ++A + FE   K    + +  +   N  K L +    K   +  F   G N   E   R+++ SP   +      +S+  + D  I+ + K D+  ++           S  L+  +  IE  D+ LG +++     G    +T+ +G ++ +L      +  + ++ VP + T   +  +  ++  LG  +  L  L ++D    +   SLI+
  S:     3 KQPTALIILDGFANRESEHGNAVKLANKPNF---------------DRYYSKYPTTQIEAS---GLDVGLPEGQMGNSEVGHMNIGAGRVVYQSLTRINKSIEDGDFFENDVLNNAINHVKK-NDSVLHVFGLLSDGGVHSHYKHLFALLDLAKKQGLEKVYVHAFLDGRDVDQKSALKYIEETEAKFKELGIGQFASVSGRYYAMDRDKR--WDREE--KAYNAIRNFGGTTFESAKAGVEANYDKDLTDEFVEP-FIVQDQNEGVNDGDAVIFYNFRPDRAGQLSEIFTDKAFEGFKVEQINDLFYATFTK-YNDNVNAEIVFE---KVDLTNTIGEVAQDNGLKQLRIAETEKFPHVTYFMSGGRNEEFEGERRRLIDSPKVATYDLKPEMSAYEVKDALIEELNKGDLDLILLNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKITEMGGHAIITADHGNSDMVLTDDDQPMTTHTTNPVPVIVTKDGVTLR--ETGRLGDLAPTLLDLLNVDQPEDMTGESLIN 504
>gi|56416912|ref|YP_153986.1| phosphoglyceromutase [Anaplasma marginale str. St. Maries] >gi|56388144|gb|AAV86731.1| 2,3-bisphosphoglycerate-independent phosphoglycerol mutase [Anaplasma marginale str. St. Maries] (525 aa)
Score = 128, Expect = 8.1e-05, Identities = 74/360 (20%), Positives = 144/360 (40%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDY----FETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K    + HI  +LS         ++  +  VL +  +K ++H   DG+D  P S  K+++  +  +   +  I T++GR +         +D +H +D     +E I       + +A      + +  + D  ++P+   I D    S  D +L  N   D    +  M+    +     L  +      ++ ++F    +     + L  +V+K   K L +    K   +  FF  G+        R I+ SP  ++      +S+  + +  ++ I   +Y +I V          + +L+ +   I   D  L  + N  +  G  + +T+ +G AEKM D        + S+ VP V  N D
  S:   134 KNGRGVCHIMGLLSDGGVHGLQDHITQLARVLAELRIKVLIHAFLDGRDVSPRSAKKHVTALNDAVHSYDISIATISGRYYA--------MDRDHRLDRTEKAYEAIALARGPRYRDAMTAIESSYSEGISDEFLVPS--VIGDYQGFSPKDGILLTNFRSDRIVQILSMILHRSQEVSNILGMVRYSEKIQVPSLFPPRNIC----NTLGEVVSKCGLKQLRIAETEKYAHVTFFFSGGKEEPFPGEDRVIIPSPQVSTYDLQPEMSAFPMTEVLVERIESRQYSLIVVNYANADMVGHTGNLEAVKKAISVIDACLQMVFNAAKKAGATMLITADHGNAEKMFDMRGTPFTAHTSNTVPLVLCNCD 487
>gi|85540982|sp|Q5PAE9|GPMI_ANAMM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (494 aa)
Score = 128, Expect = 8.1e-05, Identities = 74/360 (20%), Positives = 144/360 (40%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDY----FETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           K    + HI  +LS         ++  +  VL +  +K ++H   DG+D  P S  K+++  +  +   +  I T++GR +         +D +H +D     +E I       + +A      + +  + D  ++P+   I D    S  D +L  N   D    +  M+    +     L  +      ++ ++F    +     + L  +V+K   K L +    K   +  FF  G+        R I+ SP  ++      +S+  + +  ++ I   +Y +I V          + +L+ +   I   D  L  + N  +  G  + +T+ +G AEKM D        + S+ VP V  N D
  S:   103 KNGRGVCHIMGLLSDGGVHGLQDHITQLARVLAELRIKVLIHAFLDGRDVSPRSAKKHVTALNDAVHSYDISIATISGRYYA--------MDRDHRLDRTEKAYEAIALARGPRYRDAMTAIESSYSEGISDEFLVPS--VIGDYQGFSPKDGILLTNFRSDRIVQILSMILHRSQEVSNILGMVRYSEKIQVPSLFPPRNIC----NTLGEVVSKCGLKQLRIAETEKYAHVTFFFSGGKEEPFPGEDRVIIPSPQVSTYDLQPEMSAFPMTEVLVERIESRQYSLIVVNYANADMVGHTGNLEAVKKAISVIDACLQMVFNAAKKAGATMLITADHGNAEKMFDMRGTPFTAHTSNTVPLVLCNCD 456
>gi|93005503|ref|YP_579940.1| phosphoglyceromutase [Psychrobacter cryohalolentis K5] >gi|92393181|gb|ABE74456.1| phosphoglycerate mutase [Psychrobacter cryohalolentis K5] (552 aa)
Score = 127, Expect = 8.2e-05, Identities = 110/490 (22%), Positives = 200/490 (40%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-------PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG-----YFVSKDDSVLFLNSDPD--------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENP---VKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           + ++ +G G  +  K N +  AN PN++ +    YP  L+S   +       +   S    ++     +LY ++        +  ++ S+  +  E     +  +N      VHI  +LS      +  ++  + +  +  G K V +H   DG+D  P S +K ++     + K N         I T+ GR +   +  R     + V   +E I  G  ++  T A          +  D  I P   T++ G     Y V  +D+++F+N   D              +F+  AR     PKL    +        TK   V  +NP   +     SL   L   +       L +    K   +  FF  G     +  TR ++ SP   +      +S+  + D+ +++I  GKYDV+ V          +      +  +E  D  +GR+    R  G  + +T+ +G  E+M D     V   + +  VP ++       KK+Q    G  S +  T+ +L
  S:    33 VLMILDGFGHREDDKDNAIAAANMPNLDNIYEQ-YPHGLISASGEDVGLPDGQFGNSEVGHMNLGAGRVLYQDS------TRISSEVASRDFYKNEALVDAVKAANTLGGN-VHIMGLLSDGGVHSHQDHIEAMCHSALVHGAKNVFVHCFLDGRDTPPKSADKYINRLRDHIAKLNAHYESGRVQIATIIGRYYAMDRDNR----WDRVQKAYELITEGKADRLATRADGAVQAAYKARETDEFINP---TVVIGRDEVPYTVDDNDALIFMNFRADRARELAQAFVLPDHEFSGFAR--NKQPKLAAFVML-------TKYSDVLADNPKTSIAYYPNSLTNTLGEYLQDKGKTQLRIAETEKYAHVTFFFSGGREDEYKGETRILVPSPDVATYDLQPEMSAPEVTDRLVEAIESGKYDVLVVNYANGDMVGHTGIFDAAVQAVEALDICVGRVAEAVRAAGGDMLITADHGNCEQMQDYESGQVHTQHTTEHVPLIYVG----EKKVQVRSGGKLSDVAPTILAL 533
>gi|194538644|ref|YP_002073719.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio sp. Ex25] >gi|151937199|gb|EDN56067.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio sp. Ex25] (510 aa)
Score = 127, Expect = 8.5e-05, Identities = 75/334 (22%), Positives = 137/334 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQA---FT--------EASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K VHI  ++S      +  +++  + +   +G + + LH   DG+D  P S   +L  F     K         G+  V    GR + +D ++  D  +    L  QA   FT        EA+    EN  ++ + A  + A     +   +   D+V+F+N   D    + R     P   G   +    +    L     + P+         E+     ++K     L +    K   +  FF     N  E   R++++SP   +      +SS  L +K + +I  GK+D I    P       +   +     IE  D+ +G+++   +  G  + +T+ +G AE M+D
  S:   110 KAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRSAENSLQRFQDLFAK--------LGKGRVASLVGRYYAMDRDNNWDRVQVAYDLLTQAKAEFTAETAVAGLEAAYAREEN--DEFVKATAIKAEGE--EDAIMQDGDAVIFMNYRADRARQITRAF--VPDFDGFERAVFPAVNFVMLTQYAADIPLAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGGVENEFEGEERQLVASPKVATYDLQPEMSSPELTEKLVAAIKSGKFDTIICNYPNADMVGHTGVYEAAEKAIEALDESVGKVVEAIKEVGGQLLITADHGNAEMMVD 451
>gi|66048109|ref|YP_237950.1| phosphoglyceromutase [Pseudomonas syringae pv. syringae B728a] >gi|63258816|gb|AAY39912.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Pseudomonas syringae pv. syringae B728a] (529 aa)
Score = 127, Expect = 9.0e-05, Identities = 84/352 (23%), Positives = 143/352 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH--VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           K VHI  +LS      +  +L  +  + +K+G + + LH   DG+D  P S  K+L    + F++    R     T+ GR     +  R D + + +  ++D           A  EA+   +EN        D       I +   V   D+V+F+N   D    L R+              PK+  + L+  A        + F      G  +++L   +A N    L +    K   +  FF  G         R ++ SP   +      +S+  + DK +D+I   +YDVI V          S  ++  +  +E  D  +GR+       G    +T+ +G  E+M D         + S  VPFV+
  S:   130 KAVHIMGLLSDGGVHSHQDHLVAMAELAVKRGAEKIYLHAFLDGRDTPPRSAKKSLELMDATFARLGKGRTA---TIVGRYFAMDRDNRWDRVSSAYNLIVDSTADFHADSAVAGLEAAYARDEN--------DEFVKATRIGEAARVEDGDAVVFMNFRADRARELTRVFVEDDFKDFERARQPKVNYVMLTQYAA--SIPAPSAF----AAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDKIVDAIEHQRYDVIVVNYANGDMVGHSGIMEAAIKAVECLDVCVGRIAEALEKVGGEALITADHGNVEQMTDDSTGQAHTAHTSEPVPFVY 487
>gi|85541653|sp|Q4ZLR0|GPMI_PSEU2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (510 aa)
Score = 127, Expect = 9.0e-05, Identities = 84/352 (23%), Positives = 143/352 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH--VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           K VHI  +LS      +  +L  +  + +K+G + + LH   DG+D  P S  K+L    + F++    R     T+ GR     +  R D + + +  ++D           A  EA+   +EN        D       I +   V   D+V+F+N   D    L R+              PK+  + L+  A        + F      G  +++L   +A N    L +    K   +  FF  G         R ++ SP   +      +S+  + DK +D+I   +YDVI V          S  ++  +  +E  D  +GR+       G    +T+ +G  E+M D         + S  VPFV+
  S:   111 KAVHIMGLLSDGGVHSHQDHLVAMAELAVKRGAEKIYLHAFLDGRDTPPRSAKKSLELMDATFARLGKGRTA---TIVGRYFAMDRDNRWDRVSSAYNLIVDSTADFHADSAVAGLEAAYARDEN--------DEFVKATRIGEAARVEDGDAVVFMNFRADRARELTRVFVEDDFKDFERARQPKVNYVMLTQYAA--SIPAPSAF----AAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDKIVDAIEHQRYDVIVVNYANGDMVGHSGIMEAAIKAVECLDVCVGRIAEALEKVGGEALITADHGNVEQMTDDSTGQAHTAHTSEPVPFVY 468
>gi|157377600|ref|YP_001476200.1| phosphoglyceromutase [Shewanella sediminis HAW-EB3] >gi|189042204|sp|A8G1U9|GPMI_SHESH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|157319974|gb|ABV39072.1| Phosphoglycerate mutase [Shewanella sediminis HAW-EB3] (514 aa)
Score = 127, Expect = 9.1e-05, Identities = 111/471 (23%), Positives = 195/471 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASE-----YTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFT--NGDL 472
           K  L  L+ +G G  +  + N +  AN P ++ L +  YP +L+S           +   S    ++     ++Y E      L  + + I+       +   + ID++   N   VHI  +LS      +  ++  +  + + +G K V LH   DG+D  P S   +L++F        T  + +V GR +   +  R     + V   +E I  G     ++ A E     Y  +     V  + IL A     D   ++  D+++F+N   D            DF    R    +PK   + L+  A      + A    N V    E+L       +D   L +    K   +  FF  G+    +   R ++ SP   +      +SS  L DK +++I   KYDVI    P       +      +   E  D  +GR+++ L +  G  + +T+ +G AE+M D+        + S LVP ++   NG +
  S:     5 KRPLALLILDGWGYRENTQKNAVYHANTPVLDRL-NAQYPNSLISGSGLDVGLPDGQMGNSEVGHINIGSGRIVYQE------LTRIGKAIEDGEFDKNQALVESIDKA-IANQGAVHIMGLLSPGGVHSHESHIEAMCRLAVARGAKQVYLHAFLDGRDTPPRSAKGSLAHFDDLFTTLGTGRVASVIGRYYAMDRDNR----WDRVSQAYELITEGKSLHQYSNAVEALEAAYARDENDEFVGSSAILDAQG---DSAQLADGDALIFMNFRADRARQITRSFVDADFDGFER--NVTPKAHFVMLTEYAADIKAAI-AYPSTNLVNTLGEAL-----QDSDKTQLRISETEKYAHVTFFFNGGKEEPFKGEDRILIQSPKVATYDLQPEMSSAELTDKLVEAIESTKYDVIICNYPNGDMVGHTGSFDAAVKACEAVDTCIGRVVDALAKVDGECL-ITADHGNAEQMTDEQTGQAHTAHTSELVPLIYVGRNGSI 479
>gi|171853537|emb|CAM11395.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Candidatus Phytoplasma australiense] (516 aa)
Score = 127, Expect = 1.0e-04, Identities = 94/463 (20%), Positives = 196/463 (42%)
  Q:     7 FLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD--------------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL--KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLS-SLAPIYGTKL-------DAVFFENPVKGK-------EESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN 469
            L+ +G+GL+ + + N   LA  P ++YL+                     KT+P+           +  G+                +  YL  +++ I+ +S    + F K I+ + K +SKI H+  ++S      +  +   ++ ++ K  +  K  LH+  DG+D+ P S  K L      ++     I +V+GR +   +      +N   ++    +  LG     ++     ++   K +  + +  +    DG  ++ +DS++F+N   D    LA    ++P +   F +    P  G KL       +  F+    KG+        ++L   ++A ++   L +    K   +  FF  G+     N    ++ SP   +      + +  +  K  ++I   KY  + +          +  L+  +  +E  D  L  ++   +    I  + + +G AE+M D+       + ++LVPFV T+
  S:     7 LLILDGLGLSCQKENNAFYLAKTPYLDYLL---------------------KTFPTTTLQASGEAVGLPEGQMGNSEVGHLNLGAGRVVDQYLTQINKSIRDQSFLQNKQFLKAIEHAKKNHSKI-HLLGLVSEGGVHSHLDHFKALLELMKKHQIADKTYLHVFTDGRDDDPVSGVKYLQQ----MIDDGFQIASVSGRYYALDRD-----NNWDRINLVYDMLTLGTYPVIKSCIEEIKSSYQKGITDEFIKPFLVNPDG-LINDNDSLIFVNFRSDRIMRLATAF-SNPSMTASFQTPGKTPFKGQKLINNAFIVNMTFYSQYAKGEIAFQPTTLKNLYGKVIADHNLHQLRIAETEKYPHVTFFFDGGKELQLPNSKHLLIPSPRVATYDLKPEMGAYEITSKAKEAILSKKYQTMILNFANPDMVGHTGSLEAAIKAVEVVDSCLKGVVEAIQKIDGIACVVADHGNAEQMTDEAGKPHTAHTTNLVPFVITS 471
>gi|32266668|ref|NP_860700.1| phosphoglyceromutase [Helicobacter hepaticus ATCC 51449] >gi|50400429|sp|Q7VGZ8|GPMI_HELHP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|32262719|gb|AAP77766.1| phosphoglyceromutase [Helicobacter hepaticus ATCC 51449] (490 aa)
Score = 126, Expect = 1.1e-04, Identities = 94/453 (20%), Positives = 187/453 (41%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY---GTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHN 458
           I ++T+GIG + K + N    A KP  +YL   + P+ ++      + +      P  +   +S    M  G   +  Y +L+     S+++   EI +          S +VH+  +LS      +  +L  +  +L  +G +  LHLI DG+D  P S    L++    + + N  I +V+GR +   +  R     + V   +E+I            EY        + D  + P       G  ++ D+S +F+N   D    +   +  +P+ K         ++    T+ DA F   P+   K   ++ LA +++ +  K        K   +  F         I   R ++ SP   +      +++  + D  I ++ + YD + V          + +L+  +  +E  D+ LGR++   +     + +TS +G  E+M D+  N++ ++
  S:     4 ILVITDGIGYSDKTQYNAFYHAKKPTYDYLFKNV-PYGMI------DTFGLSVGLPQGQMG-NSEVGHMCIGSGRV-LYQDLVR---ISRAIEYDEIKDNPALVEVTQQSAVVHLCGLLSDGGVHSHIVHLKALAQILSTQGKRVYLHLITDGRDVLPKSALNYLADIES-ICEDNVSIASVSGRFYAMDRDKR----WDRVQKAYESIALGKNPTNLSPKEYIQSQYDEGIFDEFLTPVSFGGFQG--MNDDESFVFVNFRSDRAREIVDCLG-NPQFKEFKRERYVKLHIATMTEYDATF-PYPILFPKQNVQNTLAEVISSHRLKQFHTAETEKYAHVTFFLNGGREEAFIGEERVLIPSPNVKTYDLQPQMNASAVGDAVIKAVEQGYDFVVVNFANGDMVGHTGNLEAAIKAVEAVDKELGRIVESAQKHHYALFITSDHGNCEEMKDEKGNMLTNH 444
>gi|83592570|ref|YP_426322.1| phosphoglyceromutase [Rhodospirillum rubrum ATCC 11170] >gi|83575484|gb|ABC22035.1| phosphoglycerate mutase [Rhodospirillum rubrum ATCC 11170] (523 aa)
Score = 126, Expect = 1.1e-04, Identities = 90/365 (24%), Positives = 152/365 (41%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGL------FLSSLAPI-YGTKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           L  +D  +   S+ +     + ID + + +    H+  +LS      +  ++  +  V+   G+   +H   DG+D  P S    L  F+        PI TV+GR +   +  R   D    + Y   + G GE A   AS  +    +    D  +LP   T + GY   KD D V  +N   D    + + +   P   G       F  +LA   Y T  +A  F + + G E   ++L  +V++     L +    K   +  FF  G  T+     R ++ SP   +      +S+  L D+ ++ I  G++DVI V          S  L+  +  +E  D  LGR+       G  + +T+ +G AE M D
  S:    87 LPRIDAALADGSVAHFPALVRFID-ALRASGGTAHLLGLLSPGGVHSHQDHIAKLARVIAAAGVPVKIHAFLDGRDTPPRSALGFLETFAA-AAGPEAPIATVSGRYYAMDRDKR--FDRVR-LAYDVLVSGKGESAADAASAVSQFYDSKDKGDEFVLP---TAIAGYDGMKDGDGVFMVNYRSDRAREITQAL-LDPTFDGFERQPPHFAGALAMTEYSTAHNA--FMDVLFGPESLNNILGQVVSEAGMTQLRIAETEKYAHVTFFFNGGRETSFPGEERILIPSPKVATYDLQPEMSAPELTDRLVEVIDAGRFDVIIVNYANGDMVGHSGILEAAIKAVEAVDGCLGRVEEAVVRAGGTMLVTADHGNAELMRD 454
>gi|170729195|ref|YP_001763221.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella woodyi ATCC 51908] >gi|169814542|gb|ACA89126.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Shewanella woodyi ATCC 51908] (514 aa)
Score = 126, Expect = 1.2e-04, Identities = 83/354 (23%), Positives = 153/354 (43%)
  Q:   114 NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGK---------------KGRDFLDNEHVMDYFETICGLGEQ-AFTEASEYTN-ENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           N+  VH+  +LS      +  ++  +  + +K+G K V LH   DG+D  P S   +L++F        T  + ++ GR +   +               +G+      + ++  E   G  E   F  +S  T+ +  + K+ D D L   N   D    ++  +  F++SD D F       + +PK   + L+     Y   ++A     P      +L   ++ K     L +    K   +  FF  G+        R ++ SP   +      +SS+ L DK + +I   KYDVI    P       +   +  +   E  D  +GR+++ L +  G  + +T+ +G AE+M D+        + S LVP ++
  S:   109 NNGAVHVMGLLSPGGVHSHESHIEAMCRLAVKRGAKQVYLHAFLDGRDTPPRSAKSSLAHFDDLFTTLGTGRVASIIGRYYAMDRDNRWDRVSQAYDLITQGKSLHQYSNAVEALEAAYGRDENDEFVGSSAITDAQGNSAKLNDEDALIFMNFRADR---ARQITRSFVDSDFDGFTR-----EVTPKAHFVMLTE----YAADINAAI-AYPSTDLVNTL-GEVLQKEGKTQLRISETEKYAHVTFFFNGGKEQPFNGEDRILIQSPKVATYDLQPEMSSEELTDKLVGAIESTKYDVIICNYPNGDMVGHTGSFEAAVQACEAVDSCIGRVVDALAKVDGECL-ITADHGNAEQMTDESTGQAHTAHTSELVPLIY 472
>gi|92112182|ref|YP_572110.1| phosphoglyceromutase [Chromohalobacter salexigens DSM 3043] >gi|122421008|sp|Q1R1J7|GPMI_CHRSD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|91795272|gb|ABE57411.1| phosphoglycerate mutase [Chromohalobacter salexigens DSM 3043] (525 aa)
Score = 126, Expect = 1.4e-04, Identities = 89/333 (26%), Positives = 139/333 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEA-----SEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLN--SD----------PDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPA-CTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML 448
           + VH+  +LS      +  ++  V  +  ++G K V LH   DG+D  P S   +L    +  ++     N  + ++ GR +   +  R D ++      Y   + G G Q  T A     + Y        V    I P    +     ++  D+ LFLN  +D           DDF+   R  +  PKL    L  L   Y   + A     PV      L   L   VAK   K L +    K   +  FF  G     E   R+++ SP    +  E   +S+  L DK + +I  G YD+I            S +    +  IE  D  LGR+I      G    +T+ +G AE+M+
  S:   115 RAVHLLGLLSPGGVHSHEDHILAVAALAAERGAKHVYLHAFLDGRDTAPKSARASLERANARLAELFGADNAYVASIVGRYYAMDRDNRWDRVEQA----YRVIVEGEGSQVATSAEAGLDAAYERGETDEFVAATSIRPHGEPVR----MADGDAALFLNFRADRARELTRAFVEDDFSGFTRQAR--PKLAHEGLVMLTE-YAADIPA-----PVAFPPTDLVNTLGETVAKRGLKQLRIAETEKYAHVTFFFSGGREDEFEGEHRELIPSPQDVKTYDEKPEMSAYELTDKLVAAIDAGTYDLIVCNYANGDMVGHSGNFDAAVKAIEAVDDCLGRVIEAIERAGGECLVTADHGNAEQMV 462
>gi|94968102|ref|YP_590150.1| phosphoglyceromutase [Acidobacteria bacterium Ellin345] >gi|94550152|gb|ABF40076.1| phosphoglycerate mutase [Acidobacteria bacterium Ellin345] (538 aa)
Score = 125, Expect = 1.6e-04, Identities = 108/467 (23%), Positives = 203/467 (43%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSL-HNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQA-FTEASEYTNENLANKVMDADILP---------AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAV--------------------------FFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGD 471
           L+ ++ +G G       N + LA KPN + L++  +P  L+    +     P +   S    ++     ++Y   DI      +D  I++KSL  N  + + +    +  N + +H F +LS      +  +L+ ++ +  + G++ V +H   DG+D  P +  K +    + + +     I +++GR +   +  +   D E +      + G GE   + +  +   E+    V D  I+P             I DG      D+ +  N   D    + R++  +        S +    G +LDA                            F  P+    ++L   LAN +A  + + L +    K   +  FF  G         R+++ SP   +    + L  +M  +   D I      G +DVI V          S  +   ++ +ET D  LGR+ N+ R  G  + +T+ +G AE+M+D      P   + ++ VPF+F   D
  S:     7 LVLIILDGWGYAPPSNANAISLARKPNYDKLLTD-FPNTLIHTSGRYVGLPPGQMGNSEVGHLNIGAGRVVY--MDITK----IDLAIENKSLFKNQTLLDAM---KHAANGRQLHFFGLLSDGGVHSHQNHLYALLRMAKENGVERVFVHPFMDGRDTLPTNGVKYVDQLQQKMREYGIGKIASISGRYYAMDRDKK--WDREKLASD-AMLHGRGEGGRYKDPVQGIKESYNKGVTDEFIIPFVCVDDNDQPIGVIRDG------DACINFNFRADRARQITRVLARN--------SGITKDGGRELDAADTLDATIPRDTIPKDLHYTCMTQYDPKFTLPIVIPPDTLTHILANEMAAMNMRNLRVAETEKYAHVTYFFNGGIEKPYPGEERELVQSPKVAT----YDLKPEMSANGIADVIEHAVEKGAFDVIVVNFANADMVGHSGKIPPTITAVETVDSCLGRVYNVVRKKGGAMLITADHGNAEQMIDPETG-GPQTAHTTNPVPFIFVAED 493
>gi|58038805|ref|YP_190769.1| phosphoglyceromutase [Gluconobacter oxydans 621H] >gi|81557192|sp|Q5FU33|GPMI_GLUOX 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|58001219|gb|AAW60113.1| Phosphoglycerate mutase [Gluconobacter oxydans 621H] (510 aa)
Score = 125, Expect = 1.7e-04, Identities = 82/345 (23%), Positives = 145/345 (42%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMM--------KTSPKLK-------GLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD---------KHLNIVP 456
           K +    H+  ++S      +  ++  +  ++   G+   +H+ +DG+D  P S    +  F K  L  +  I T++GR +   +  R     E V    E I         +A      + A+   D  +LP   T++  Y   KD D +L  N   D    L  ++         +  K+K         +   LAP     +  +F + P+    + LL ++VAK     L +    K   +  F   G     +   R ++ SP   +      +S+  L DK + +I  GK+D+I +          +  L   +   ET DQ LGR+ +     G ++ +T+ +G  E M D           LN+VP
  S:   109 KASGGTCHLMGLISPGGVHAHQDHVVALTKIVSAAGVPVAVHIFSDGRDTAPRSGEDFIGKFLK-ELPDSVQIATLSGRYYAMDRDRR----WERVALAVEAIRDAKGPHAKDALSALQASYASDKGDEFVLP---TVLGDYAGMKDGDGILACNFRADRIRQLLDVLVLPDFTEYDSGRKVKFAAVCGMSRYSDHLAPY----MSILFPKVPL----DDLLGDVVAKAGRTQLRMAETEKYPHVTYFLNGGREVQFDGEERILVPSPKVATYDLQPEMSAPELTDKAVAAIESGKFDMIVLNFANPDMVGHTGSLSAAIKACETVDQGLGRINDAIVKAGGVLLVTADHGNCETMRDPVTGGAHTSHTLNVVP 466
>gi|170078830|ref|YP_001735468.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Synechococcus sp. PCC 7002] >gi|169886499|gb|ACB00213.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Synechococcus sp. PCC 7002] (525 aa)
Score = 125, Expect = 1.7e-04, Identities = 75/320 (23%), Positives = 129/320 (40%)
  Q:   152 LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-----GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +H I DG+D         L      + K     I T++GR     +  R +   +   D       L +++F   +E    +  N V D  I P    + +G  +   D V+F N  PD    L+  +  K     +   +  L  +  T+ DA     PV+          +L  ++A N  K        K   +  FF  G     E   R+++SSP   +  +   +S+K + D    +I  G Y ++ +          +  L+  +  IET D  LGRL+      G    +T+ +G AE M D++      + ++ VPF+   G+
  S:   149 IHAITDGRDTNTTEGINYLQQIQAHIDKFGVGSISTISGRYFAMDRD-RRWDRVKQAYDVMTQNGNLDQRSF---AEILQSHYDNGVTDEFIPPV--RLKEGA-IEPGDGVIFYNFRPDRARQLSYALVDKNFQGFERELIPDLNFVTFTQYDANL---PVQVAFAPQNLTKILGEVIADNGLKQFRTAETEKYPHVTYFFNGGLEVAFEGEDRELISSPQVATYDQKPEMSAKAVTDAACQAIEKGIYSLVVINYANPDMVGHTGKLEAAVQAIETVDHCLGRLVATIGKMGGTTLITADHGNAEYMADQNGKSWTAHTTNPVPFILIEGE 470
>gi|28872439|ref|NP_795058.1| phosphoglyceromutase [Pseudomonas syringae pv. tomato str. DC3000] >gi|1709675|sp|P52832|GPMI_PSESM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|607952|gb|AAA77677.1| phosphoglyceromutase >gi|28855694|gb|AAO58753.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Pseudomonas syringae pv. tomato str. DC3000] (510 aa)
Score = 125, Expect = 1.7e-04, Identities = 84/352 (23%), Positives = 146/352 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLS----NFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH--VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           K VHI  +LS      +  +L  +  + +++G   + LH   DG+D  P S  K+L      F++    R   I T+ GR     +  R D +   +  ++D           A  EA+   +EN  ++ + A  +     + DG      D+V+F+N   D    L R+              PK+  + L+  A        + F      G  +++L   +A N    L +    K   +  FF  G         R ++ SP   +      +S+  + DK +D+I   +YDVI V          S  ++  +  +E  D  +GR+ +     G    +T+ +G  E+M D         + S  VPFV+
  S:   111 KAVHIMGLLSDGGVHSHQDHLVAMAELAVRRGADKIYLHAFLDGRDTPPRSAKKSLELMDETFARLGKGR---IATIIGRYFAMDRDNRWDRVSTAYNLIVDSSAEFHAATGVAGLEAAYARDEN--DEFVKATRIGEPANVEDG------DAVVFMNFRADRARELTRVFVEDDFKDFERARQPKVNYVMLTQYAA--SIPAPSAF----AAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDKIVDAIEHQRYDVIIVNYANGDMVGHSGIMEAAIKAVEYLDVCVGRITDALEKVGGEALITADHGNVEQMTDDATGQAHTAHTSEPVPFVY 468
>gi|77972951|ref|ZP_00828505.1| COG0696: Phosphoglyceromutase [Yersinia frederiksenii ATCC 33641] (515 aa)
Score = 125, Expect = 1.7e-04, Identities = 94/411 (22%), Positives = 166/411 (40%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP-IVTVAGRNHVFGKKGR--------DFLDN---EHVMDYFETICGL-GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVK-------GKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           L  LD++IK             ID++ K   K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F++   K     I ++ GR +   +  R        D L     E   D    + GL    A  E  E+    +     +AD       + DG      D+++F+N   D    + R    +    G F       +G  +    +   +K           +     + K+D   L +    K   +  F+  G     +   R +++SP   +      +SS  L +K + +I  GKYDVI    P       + D    +  +ET D  + +++   +     + +T+ +G AE+M D          +SL VP ++       K++++   G  S I  T+ SL
  S:    81 LTRLDKEIKDGDFFTNPTLTAAIDKAVKA-GKAVHIMGLLSAGGVHSHEDHILAMVQLAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTEQFAKLGKGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTAD--NAVAGLQAAYARDENDEFVRPTVIKAAGEADA-----AMNDG------DALIFMNFRADRARQITRTF-VNKDFDG-FKRDKVVNFGDFVMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVGAITSGKYDVIICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAVDGQLLITADHGNAEQMRDPATGQAHTAHTSLPVPLIYVGN----KEVKAVEGGKLSDIAPTMLSL 497
>gi|89210712|ref|ZP_01189098.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Halothermothrix orenii H 168] >gi|89159682|gb|EAR79344.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Halothermothrix orenii H 168] (513 aa)
Score = 124, Expect = 1.9e-04, Identities = 100/466 (21%), Positives = 196/466 (42%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAY--------NTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG 470
           L  ++ +G GL++K  GN +K A+ PN++      YP  +L    +       +   S    ++     ++Y +         +++ I+  +L   +     I      NS + H+  +LS      +  +LF ++ +   K ++ V +H I DG+D  P S  K L+   + L +     I TV+GR +   +  R    +     Y   + G G +A ++A     ++ A    D  ++P           TI D      +D+V+F N   D    + + +         + +   + L+   +A  Y  + +      P++ K       +++K   K L +    K   +  FF  G         R ++ SP   +  E   +S+  + DK ++ +   KYDVI +          +  +   +  +E  D+ LG++I      G  + LT+ +G +EKM D        + ++ VP ++  G
  S:     8 LALIIMDGFGLSEKSDGNAIKQAHTPNLDKFFEE-YPDTVLDASGEAVGLPEGQMGNSEVGHLNLGAGRIVYQD------YTRINKAIEEGTLPENDALKNAIQHVKDNNSAL-HLMGLLSDGGVHSHINHLFGLLEMARVKNIEKVYVHPILDGRDTPPRSAEKYLNQLEEKLAELGIGEIATVSGRYYTMDRDNRW---DRTKKSYDALVLGEGLEA-SDAISALKQSYAADKSDEFVIPTVIKKNGQPVGTIKD------NDAVIFYNFRADRARQITKALALEEFDEFERPAEHPENLYYVCMAE-YDEEFNLPVAFPPLEIKNG--FGEILSKEGFKQLRIAETEKYAHVTFFFNGGVEKKYPGEDRVLVPSPKVATYDEKPEMSAYEVTDKLLEKLDEDKYDVIILNFANPDMVGHTGFMDAAVKAVEAVDECLGKIIPRIVDMGGQVLLTADHGNSEKMKDSEGKPHTAHTTNQVPLIYIGG 475
>gi|57240801|ref|ZP_00368749.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Campylobacter lari RM2100] >gi|57018420|gb|EAL55194.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Campylobacter lari RM2100] (492 aa)
Score = 124, Expect = 2.0e-04, Identities = 78/383 (20%), Positives = 163/383 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLSSLAPIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN-IVPHNKSSLVPFVFTNG 470
           +++ I++ +L + +   +L+ + N+     VHI  + S         +   ++ +  ++  +   H I+DG+D  P S    + +  +F  K    + +++GR +   +  R     + +  Y++ +     ++  +   Y  ++    + D  + P  N   DG  +  +D V+F+N   D    L   +        P+   +  +    +Y  K + ++ FE   K +  + LA+++A  +   L      K   +  FF  G+     N TR ++ S    +  E   +S+K + ++ I  I G  D I V          + D +  +  +E+ D+ LG +I + R       +TS +G  E M D++ N +  H    +  FV   G
  S:    81 INKAIENNTLKDNKALKELLQKCNR-----VHIIGLYSDGGVHSMHTHFNALLKICKEENKEVFAHAISDGRDCSPISGLNFIKSLQEFCEKEKINLASLSGRFYAMDRDKR----YDRIKLYYDALFAKAPKS-DDFITYIQKSYDENITDEFLTPVINPSFDG--IKAEDGVVFINFRNDRMRQLVASLTQENFDEFPRELLVKNAITMSLYDEKFNLSIMFE---KEELNNTLASVIANANLSQLHTAETEKYAHVTFFFNGGKEELEVNETRVLIPSSKVKTYDEKPCMSAKEVANEVIKGIKGGIDFIVVNFANGDMVGHTGDFEAAIRAVESVDECLGEVIKVARENDYAFIITSDHGNCEAMKDENNNSLTNHTTFDVFAFVEAKG 458
>gi|160940327|ref|ZP_02087672.1| hypothetical protein CLOBOL_05217 [Clostridium bolteae ATCC BAA-613] >gi|158436907|gb|EDP14674.1| hypothetical protein CLOBOL_05217 [Clostridium bolteae ATCC BAA-613] (513 aa)
Score = 124, Expect = 2.0e-04, Identities = 94/388 (24%), Positives = 167/388 (43%)
  Q:    84 YLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMMKTS-----PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN--IVPHNKSSLVPFVFTNGD 471
           Y EL  + + I+      +  F   I+   K +S + H+F ++S      +  +++ ++ +  K GLK V +H   DG+D  P S    +      + +     + +V GR +   +  R D ++    + Y     G G QA + A+       + K  D  ++P +  + DG     +   DSV+F N  PD    + R          P+ K L    L  +  T  D       V  K+ES+       +A +    + +    K   +  FF  G    NE   R ++ SP    T D +   +S+  + DK +++I   KYDVI +          +      +  IET D  +GR +   R    ++ + + +G AE+++D         H  ++ VPF+  N D
  S:    76 YQELTRITKSIQDGDFFQIPEFLTAIENCKKHDSAL-HMFGLVSDGGVHSHNTHIYGLLELAKKNGLKKVYVHCFLDGRDTPPESGKGFVEQLEAKMKEIGVGEVASVMGRYYAMDRDKRWDRVE----LAYNALTKGEGNQAESAAAGIQASYDSGKA-DEFVIP-FVVMKDGKPAATIQDKDSVIFYNFRPDRAREITRAFCDDSFDGFPREKRL---DLVYVCFTDYDETIQNKLVAFKKESITNTFGEFLAAHKKTQVRIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKP-EMSANGVCDKLVEAIKSDKYDVIIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAIREVDGVMFICADHGNAEQLVDYETGEPFTAHT-TNPVPFILVNAD 475
>gi|154175547|ref|YP_001407650.1| phosphoglyceromutase [Campylobacter curvus 525.92] >gi|112802310|gb|EAT99654.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter curvus 525.92] (486 aa)
Score = 124, Expect = 2.0e-04, Identities = 80/318 (25%), Positives = 129/318 (40%)
  Q:   153 HLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG-------TKLDA-----VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVP-HNKSSLVPFVFTNG 470
           H I DG+D  P    K+  NF K  L+    I +++GR +   +  R     E V   +E + G   Q   E  EY  ++  + V D  I+PA      G  + ++D V+F+N   D      R  +    L     S  A  +        T+ DA     V FEN    + ++ LA ++A      L      K   +  FF         N TR ++ SP   +  E   +S+  + D  I  +    D I V          + D    +  +E  D  LGR++   +     + +TS +G  E+M D    I+  H    ++ F+   G
  S:   141 HAITDGRDVSP----KSGLNFIK-ALQAKFKIASISGRFYAMDRDKR----WERVKLAYEAMMGENPQEI-EPFEYVMQSYEHDVTDEFIVPASFNGFRG--IGENDGVIFINFRND------RAREICAALGAKNFSEFARPFAVKNLLTMTEYDANFAFPVLFENE---RLQNTLAQVIANAGLTQLHTAETEKYAHVTFFFNGGVEELVPNETRILIPSPKVKTYDEKPEMSAPAVCDAVIKGMDDGQDFIVVNFANGDMVGHTGDFDAAVKAVEAVDTALGRIVAKAKERNYALIITSDHGNCEEMRDAEGKILTNHTTYDVLCFIMGEG 453
>gi|84386942|ref|ZP_00989966.1| phosphoglyceromutase [Vibrio splendidus 12B01] >gi|84378232|gb|EAP95091.1| phosphoglyceromutase [Vibrio splendidus 12B01] (510 aa)
Score = 124, Expect = 2.0e-04, Identities = 82/383 (21%), Positives = 161/383 (42%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGK--------KGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYN----TIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           L  + + I        E     +D++ K + K VHI  ++S      +  +++  + +  ++G + + LH   DG+D  P S    L+ F +   K     + ++ GR +   +        +  D L        F+T + GL      EA+   +EN  ++ + A  + A       I+DG      D+V+F+N   D    + R     P   G   +    I    L     + P+         E+     ++K     L +    K   +  FF  G+    E   R++++SP   +      +S+  L +K + +I  GKYD I    P       +      +  +E+ D+ LG+++   +     + +T+ +G AE M++     +    ++L VP ++
  S:    80 LTRITKSIADGEFAQTEALVNAVDKAVKAD-KAVHIMGLMSPGGVHSHEDHIYAAVEMAAERGAEKIYLHAFLDGRDTPPRSAENTLARFQELFAKLGKGRVASLIGRYYAMDRDNNWDRVQESYDLLTQAKAEFTFDTAVAGL------EAAYARDEN--DEFVKATEIKAEGEESAAIVDG------DAVIFMNYRADRAREITRAF--VPNFDGFERNVFPAIDFVMLTQYAADIPLLCAFPPASLENTYGEWLSKEGKTQLRISETEKYAHVTFFFNGGKEDEFEGEERQLVASPKVATYDLQPEMSAPELTEKLVAAIKGGKYDAIVCNFPNCDMVGHTGVYDAAVKAVESLDECLGKVVEAIKEADGQLLITADHGNAEMMVNPETGGIHTAHTNLPVPLIY 470
>gi|91216526|ref|ZP_01253492.1| phosphoglyceromutase [Psychroflexus torquis ATCC 700755] >gi|91185320|gb|EAS71697.1| phosphoglyceromutase [Psychroflexus torquis ATCC 700755] (506 aa)
Score = 124, Expect = 2.0e-04, Identities = 95/418 (22%), Positives = 180/418 (43%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL-KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEAS-EYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSP-KLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANM--VAKNDNKVLVLGLNHKKGFINKFF---GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE---AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLG-VYSSILSTLD----SLDTEHKLF 502
           L  ++  +K+ +L N     +  D + K N K VH   ++S      +  +L  +++   + G+ K  +H   DG+D  P+S    + +      K NT + +V GR +   +  R     E V   ++ I     + FTE   E   ++  + V D  I P   T  D     + + D V+F N   D    L +++     KL  +    L  +  TK D  F    V  K++++ A +  V ++  K  +     +K     FF   G      +  R +++SP   +      +S+ +L DK +  I +    F+ C   A       + D    +   ET D+ L  ++   +  G  + + + +G +E M++   +    + ++ VPF+  + D+    ++   LG +  +IL  +D     L T+H L 
  S:    78 LAKINMAVKNDTLKNEPALEQAFDYAKK-NDKAVHFLGLVSDGGVHSHTDHLKGLVSAAEEFGISKKYVHAFTDGRDVDPHSGKGFIESLLPHFKKTNTQLASVIGRYYAMDRDKR----WERVEKAYDLIVKGEAETFTENPLEALQKSYDDGVSDEFIKPISITKNDKPVAKIKEGDVVIFFNFRTDRGRQLTQVLSQEDFKLYDMKSIPLYFVTLTKYDDTFKNINVVFKKDNIKATLGEVLEHTGKSQIRAAETEKYPHVTFFFSGGREKPFRDEKRIMVNSPKVATYDLQPEMSAYLLKDKIVKEISEKSADFI-CLNFANPDMVGHTGDFDAAVKACETVDECLKDVVTAAKKEGYSVIVIADHGNSETMINPDGSPNTAHTTNPVPFILVDDDI--TSIKDGILGDIAPTILDLMDIEKPELMTQHSLL 505
>gi|145617560|ref|ZP_01773625.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacter bemidjiensis Bem] >gi|144946349|gb|EDJ81409.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacter bemidjiensis Bem] >gi|197089495|gb|ACH40766.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacter bemidjiensis Bem] (512 aa)
Score = 124, Expect = 2.3e-04, Identities = 113/506 (22%), Positives = 216/506 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK--LIDRSNKT--NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNL-SNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF----VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG----TKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI----TRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSS--LVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K  L+ ++ +G G+N   + N +  A  PN+  L +  YP   + +    +  +P     + +            G T+I     +  +  + SKS+ + + F+   L+D   K    S  +H+  +LS      +  +L+ +I++  + G++ V +H + DG+D  P S   + K L +  ++F   +   I TV GR +   +  R D ++      Y   + G+G + +  A+    ++    V D  +LP+   IM G      +   D  +F N   D    + R   T P   G        +      T  D  F      G EE  ++   +++      L +    K   +  FF  N   EN      R ++ SP    T D++   +S+ ++ ++ +  +   KYDV+ +          +  L   +  +E  D+ +G+L+   R  G I  +T+ +G AE M D+     PH   +  + P V  +      K++   L   +  +  L  L    ++   SL+
  S:     3 KKPLLLMILDGWGINSDTESNAIAQAKTPNMTRL-TAEYPSGTI-DGSGMSVGLPAGQMGNSE-----------VGHTNIGAGRVVYQDLTRISKSIDDGDFFHNPVLLDCMKKAVQGSGRLHLAGLLSDGGVHSHDTHLYALIDMAKRNGVREVFVHCLLDGRDTPPQSGIDYLKRLEAEMARFSFGK---IATVIGRYYAMDRDNRWDRVEQA----YRAIVSGVG-KPYPSAAAAIEQSYQGGVNDEFVLPS--VIMQGGAPVGRLGDGDGFIFFNFRSDRAREITRAF-TDPGFDGFKREEWPKLASYVCMTSYDETFGLPVAFGNEELVNIFPEVISNAGLTQLRIAETEKYAHVTFFF--NGGRENPFPGEDRALIPSPKEVATYDQKP-EMSAYLVTEELLKRLDEDKYDVVILNFANADMVGHTGILPAAVKAVEAVDECVGKLVAKVREKGGIALITADHGNAEMMKDEQGG--PHTAHTCEMAPVVLVDDSRKGAKLRKGVLADLAPTMLELLGLQQPSEMGGKSLL 510
>gi|114770921|ref|ZP_01448389.1| phosphoglycerate mutase III, cofactor-independent [alpha proteobacterium HTCC2255] (512 aa)
Score = 124, Expect = 2.3e-04, Identities = 101/470 (21%), Positives = 189/470 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFE---TICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLA-----RMMKTSPKLKGLFLSSLAPI--YGTKL--DAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           K  L  L+ +G G  +  + N +  AN PN++ L    YP  L+S           +   S    V+     ++Y +   K    + D++ +    HN  + N  ID++  +  K VH+  +LS      +  ++F  I +   +G + + LH   DG+D  P S        ++  L++   +   AG        GR + +D ++  D  E   T+   G+   T  +       A    + D       I D   ++  D+V+F+N   D    +A      +     +   + LS    +  Y + L     +   P+     ++L   +  N    L +    K   +  FF     +E     R ++ SP   +      ++S +L DK +++I   +YD I    P       + +    +   E  D  +GR++   +  G    +T+ +G AE+M D +       + S  VPF++   D
  S:     5 KTPLALLILDGWGYREASENNAILAANTPNLDALREQ-YPNTLISGSGLDVGLPDGQMGNSEVGHVNLGAGRVVYQDF-TKITKAIADDEFQ----HNPVLVNA-IDKA-VSAGKAVHLLGLLSPGGVHSHEDHIFAAIQLAASRGARDIYLHAFLDGRDTPPRS--------AQASLEKADAVFAAAGVGKTATIIGRYYAMDRDNRWDRVESAYTLMTKGQGLHTADNAVAGLEAAYARDENDEFVGATVIGDAVTMNAGDTVIFMNFRADRARQMAHTFVDEIFTGFERGAAIALSDFVMLTEYESNLAIPCAYPPEPL----HNVLGEWLQNNGKTQLRISETEKFAHVTFFFSGGKEDEYGGEQRILIPSPDVATYDLQPEMNSTLLTDKLVEAILAREYDAIICNYPNGDMVGHTGNFAAAVKACEAVDTCIGRVVEALKEVGGECLITADHGNAEQMQDPNTGQAHTAHTSEPVPFIYVGRD 473
>gi|170099924|ref|XP_001881180.1| phosphoglycerate mutase [Laccaria bicolor S238N-H82] >gi|164643859|gb|EDR08110.1| phosphoglycerate mutase [Laccaria bicolor S238N-H82] (528 aa)
Score = 124, Expect = 2.3e-04, Identities = 93/381 (24%), Positives = 169/381 (44%)
  Q:    88 LDEQIKSKSLH-NLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL-KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPK------LKGLFLSSLAPIYGTK--LDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSP-ACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMC----PMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFT 468
           +D  IK +  H N +I +    R+ +   ++ H+  ++S      +  +LF ++    ++G+    +H +ADG+D  P S NK       F  K N   + TV GR +   +  R     E V    + +  G+GE+   +  +    N A  V D  + P      +G  +   D++ F N   D    +  +     K       K L +++++  Y ++      F   P+     ++LA  +AK   K   +    K   +  FF      +  +  R ++ SP   T DKE   +S   + +K  + + K +  FVMC    P +       D   +++  ET D+ +G +       G I+ +T+ +G AEKM D  +   PH  + ++ VPF+ T
  S:    87 IDVSIKKRQFHKNPQILDS-CKRAVEGTGRL-HLLGLVSDGGVHSHINHLFALLETAKEQGVPHTYVHFLADGRDTAPRSSNKYAQQLLDFTKKENYGELATVVGRYYAMDRDKR----WERVKVAIDGLVGGVGEKVEEDVIKTIEANYAKDVTDEFLKPIIVNGDEGR-IKDGDTLFFFNYRSDRMREIVSVFGLPNKPMEVDIPKDLGITTMS-TYNSEFPFPVAFPPQPMT----NVLAEWLAKEGIKQAHIAETEKYAHVTFFFNGGVEKQFAHEERHMIPSPKVATYDKEP-KMSVHSVAEKVAEVLKKGEDQFVMCNFAPPDMVGHTGVYD-AAVVAVTET-DKAVGTVYKAAEEAGYILLITADHGNAEKMKDP-VTGNPHTAHTTNPVPFIMT 472
>gi|146309260|ref|YP_001189725.1| phosphoglyceromutase [Pseudomonas mendocina ymp] >gi|166991398|sp|A4Y077|GPMI_PSEMY 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|145577461|gb|ABP86993.1| phosphoglycerate mutase [Pseudomonas mendocina ymp] (510 aa)
Score = 123, Expect = 2.4e-04, Identities = 90/402 (22%), Positives = 161/402 (40%)
  Q:    94 SKSLHNLEIF-----NKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEE------SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSL 495
           +K++ + E F     N+ +D++     K VHI  +LS      +  ++  +  +  ++G + + LH   DG+D  P S   ++        +         G+  +    GR F +D ++  D  E    L   G   F  AS       A +  ++D      TI     V   D+V+F+N   D    L R     P  +  F    AP  G  +   +  +             ++L   +AKN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + D+ +D+I   +YDVI V          +   +  +  +ET D  +GR+    +  G    +T+ +G  E+M D+      H   +  P  F      P +++    GV + +  TL +L
  S:    85 TKAIRDGEFFDNAAINQAVDKAVAA-GKAVHILGLLSDGGVHSHQDHIVAMAELAARRGAEKIYLHAFLDGRDTPPKSAQPSIELLDAAFAR--------LGKGRIASLTGRYFAMDRDNRWDRVEQAYHLIVDGAGQFNAASAVEGLQAAYERGESDEFVKATTIGAPVQVEDGDAVVFMNFRADRARELTRAF-VEPGFQE-FERKRAPQVGFVMLTQYAASIPAPAAFAPEALTNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFEGEERILIPSPDVATYDLKPEMSAPEVTDRIVDAIENQRYDVIIVNYANGDMVGHTGVFEAAVKAVETLDTCVGRITEALQKVGGEALITADHGNVEQMEDECTGQA-HTAHTCEPVPFIYVGKRPARIREG--GVLADVAPTLLTL 492
>gi|145252196|ref|XP_001397611.1| hypothetical protein An16g02990 [Aspergillus niger] >gi|134083156|emb|CAK48608.1| unnamed protein product [Aspergillus niger] (520 aa)
Score = 123, Expect = 2.4e-04, Identities = 92/405 (22%), Positives = 175/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPI-----VTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLSSLAPIYGT--KLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K   L  ++       R+ + N ++ H+  ++S      N  +L  ++ V  +  +  V +H   DG+D  P    K+ + + + LL +   I      TV GR           +D +   D  E      + G GE++ ++  +  NE   NK  D  + P    I+ G    V   D++ F N   D    + +++     SPK +  +   +     T  K D  F   PV    +   ++LA  + K D K   +    K   +  FF      +     R ++ SP   +      +S+  + DK  + +G+ +  FVM           +   +  +  +   D+ +G +   C+  G I+ +T+ +G AE+ML +       + ++ VPFV  N  + W  K +   LG V  ++L+ +
  S:    92 IDQTLKKGELGKVDNIVASFKRAKEGNGRL-HLLGLVSDGGVHSNITHLVGLLKVAKEMEIPQVFIHFFGDGRDTEP----KSATKYMQQLLDQAKEIGVGEIATVVGRYWA--------MDRDKRWDRVEIAMKGIVTGEGEES-SDPVKTINERYENKETDEFLKP---IIVGGKDRRVQDGDTLFFFNYRSDRVREITQLLGDYDRSPKPEFPYPKDIHITTMTRYKTDYTF---PVAFPPQHMGNVLAEWLGKKDVKQCHVAETEKYAHVTFFFNGGVEKQFPGEVRDMIPSPKVATYDLEPKMSAAAVGDKMAERLGEGNFEFVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGVIYEACKKHGYILFITADHGNAEEMLTEKGTPKTSHTTNKVPFVMANAPEGWSLKKEEGVLGDVAPTVLAAM 503
>gi|196255870|ref|ZP_03154408.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 7822] >gi|196203050|gb|EDX97867.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Cyanothece sp. PCC 7822] (532 aa)
Score = 123, Expect = 2.5e-04, Identities = 70/320 (21%), Positives = 127/320 (39%)
  Q:   152 LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEE-----SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +H I DG+D  P    K ++     + K     I T+ GR +   +  R     + V   ++ +   G      A +   ++ A  + D  ILP   T +    V   D ++F N  PD    L     T P   G     + P+          + PV+   E     ++L  ++A +  +        K   +  FF  G     E   R+++ SP   +      +S++ + D    +I  G Y ++ +          + +++     IE  DQ LG+L+N     G    + + +G AE M D+  N    + ++ VPF+   G+
  S:   149 VHAITDGRDTNPNEGVKAIAQIQAHIDKIGIGRISTICGRYYAMDRDRR----WDRVKKAYDLLTQDGPGDGRTALQILKDSYAKDITDEFILP---TRVAPGAVESGDGIIFYNFRPDRARQLCYAF-TMPNFDGFERKLIQPLSFVTFTQYDPKLPVQVAFEPQNLTNILGEVIANHGLRQFRTAETEKYPHVTYFFNGGLEKPFEGEDRELIQSPMVATYDLAPEMSAQAVTDTACAAIEKGIYSLVVMNYANPDMVGHTGNIEAAAKAIEKVDQCLGQLLNSIHKMGGTAIIIADHGNAEYMRDEEGNPWTAHTTNPVPFILVEGE 470
>gi|169634640|ref|YP_001708376.1| phosphoglycerate mutase III, cofactor independent [Acinetobacter baumannii SDF] >gi|169153432|emb|CAP02574.1| phosphoglycerate mutase III, cofactor independent [Acinetobacter baumannii] (515 aa)
Score = 123, Expect = 2.6e-04, Identities = 85/380 (22%), Positives = 150/380 (39%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           + + I++ +    E+    ++++ K     VHI  +LS      +  ++  +  + +K+G K  LH   DG+D  P S   +L        +         G+  +    GR F +D ++  D  E    L   GE   T  +      LA    + D       I +   V   DSV+F+N   D            DFA   R +   P L    + +    Y   +DA     PV    E L   L   ++      L +    K   +  FF     +E     R ++ SP   +      +S+  + D+ + +I  G+YD++ V          +      +  +E  D  LGR+          + +T+ +G  E+M D     V   + + LVPF++
  S:    87 ITKDIRTGAFFEHEVLVDAVEKA-KAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTPPRSAQPSLEKLDALFAQYE-------GKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRTATTAVEGLELAYAANENDEFVKATRIGEIAKVQDGDSVVFMNFRADRAREITHAFVEKDFAGFERTV--VPNLSKFVMLTR---YQASIDA-----PVAYMPEELKNSLGEYLSSLGKTQLRIAETEKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEYDLLVVNYANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQMQDYESGQVHTQHTTELVPFIY 472
>gi|121535411|ref|ZP_01667222.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Thermosinus carboxydivorans Nor1] >gi|121306010|gb|EAX46941.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Thermosinus carboxydivorans Nor1] (512 aa)
Score = 122, Expect = 3.1e-04, Identities = 85/362 (23%), Positives = 152/362 (41%)
  Q:   106 LIDRSNKTNSK--IVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTSP-----KLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVF 467
           L+D + +T +    +H+  +LS      +  +L+ ++ +  ++GL+ V +H   DG+D  P +  + +      +       I T+AGR   +    RD         Y   +   G  A +  +         +  D  ++P   T++DG     V   D V+F N  PD    L R    S      +  G F    A +  T+ D      PV    + L   L  +++K     L +    K   +  FF  GE     N  R ++ SP   +      +S+  + D+ +  I  GKYD I +          S   +  +  + T D+ +GR++   R  G I+ +T+ +G AE M D+       + ++ VPF+ 
  S:   100 LVDVATRTKAGGGALHLMGLLSDGGVHSHIDHLYALLELAKRQGLERVYVHAFLDGRDVPPANALEYVDALETKMADLGIGRIATIAGR---YWAMDRDKRWERTEKAYAALVYRDGLHAPSARAAVEAAYARGET-DEFVMP---TVVDGCGDCAVKAGDGVIFFNFRPDRARQLTRAFVDSQFSGFDRRYGYFPLHFATM--TQYDETL-AVPVAYAPQFLTNTLGEVISKAGLTQLRIAETEKYAHVTYFFNGGEERPFANEDRVLIPSPKVATYDLQPEMSAPAVTDRAVAEIRSGKYDFIVINYANGDMVGHSGKFEAAVQAVATVDECVGRVVATMRERGGIVCITADHGNAECMRDETGEPFTAHTTNEVPFIL 470
>gi|71734339|ref|YP_277006.1| phosphoglyceromutase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|85540992|sp|Q48C87|GPMI_PSE14 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|71554892|gb|AAZ34103.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Pseudomonas syringae pv. phaseolicola 1448A] (510 aa)
Score = 122, Expect = 3.7e-04, Identities = 84/352 (23%), Positives = 146/352 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH--VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           K VHI  +LS      +  +L  +  + +K+G + + LH   DG+D  P S  K+L    + F++    R     T+ GR     +  R D +   +  ++D           A  EA+   +EN  ++ + A  +     + DG      D+V+F+N   D    L R+              PK+  + L+  A        + F      G  +++L   +A N    L +    K   +  FF  G         R ++ SP   +      +S+  + DK +D+I   +YDVI V          S  ++  +  +E  D  +GR+       G    +T+ +G  E+M D         + S  VPFV+
  S:   111 KAVHIMGLLSDGGVHSHQGHLVAMAELAVKRGAEKIYLHAFLDGRDTPPRSAKKSLELMDATFARLGKGRTA---TIIGRYFAMDRDNRWDRVSTAYNLIVDSTAEFHADSGVAGLEAAYARDEN--DEFVKATRIGEPARVEDG------DAVVFMNFRADRARELTRVFVEDDFKDFERARQPKVNYVMLTQYAA--SIPAPSAF----AAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDKIVDAIEHQRYDVIIVNYANGDMVGHSGIMEAAIKAVECLDVCVGRITAALEKVGGEALITADHGNVEQMTDDSTGQAHTAHTSEPVPFVY 468
>gi|27467478|ref|NP_764115.1| phosphoglyceromutase [Staphylococcus epidermidis ATCC 12228] >gi|57866439|ref|YP_188038.1| phosphoglyceromutase [Staphylococcus epidermidis RP62A] >gi|38257577|sp|Q8CPY4|GPMI_STAES 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81675182|sp|Q5HQV1|GPMI_STAEQ 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|27315021|gb|AAO04157.1|AE016745_256 phosphoglycerate mutase [Staphylococcus epidermidis ATCC 12228] >gi|57637097|gb|AAW53885.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Staphylococcus epidermidis RP62A] (505 aa)
Score = 122, Expect = 3.7e-04, Identities = 88/375 (23%), Positives = 161/375 (42%)
  Q:    94 SKSLHNLEIFNKLI----DRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF--VSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLDA-VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           +KS+ + E F+  +     +  K N   +H+F +LS      + K+LF ++ +  K+G+  V +H   DG+D    S  K +     KF         +V+GR +   +  R   D E     +  I       FT A      N  N V D  + P    I++G    V+  D+V+F N  PD  A L+ +            ++  LF ++    Y   +DA + FE   K    + +  +   N  K L +    K   +  F   G N   E   R+++ SP   +      +S+  + D  ++ +  G  D+I +          S  L+  +  IE  D+ LG +++     G    +T+ +G ++++L      +  + ++ VP + T
  S:    83 NKSIEDGEFFDNTVLNNAVKHVKDNGSALHVFGLLSDGGVHSHYKHLFAILELAKKQGIDKVYVHAFLDGRDVDQKSALKYIEETEDKFKELGVGQFASVSGRYYAMDRDKR--WDREE--RAYNAIRNFEGPTFTSAKAGVEANYKNDVTDEFVEP---FIVEGQNDGVNDGDAVIFYNFRPDRAAQLSEIFTNKAFDGFKVEQVDNLFYATFTK-YNDNVDAEIVFE---KVDLNNTIGEVAQDNGLKQLRIAETEKYPHVTYFMSGGRNEEFEGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELDKGDLDLILLNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKIIDMGGHAIITADHGNSDQVLTDDDQPMTTHTTNPVPVIVT 466
>gi|77456561|ref|YP_346066.1| phosphoglyceromutase [Pseudomonas fluorescens PfO-1] >gi|123606300|sp|Q3KJH9|GPMI_PSEPF 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|77380564|gb|ABA72077.1| phosphoglycerate mutase [Pseudomonas fluorescens PfO-1] (508 aa)
Score = 121, Expect = 4.1e-04, Identities = 80/352 (22%), Positives = 144/352 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM----------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           K VH   +LS      +  +L  +  +  K+G + + LH   DG+D  P S   ++    + F       I ++ GR +   +  R     + V   +  I  G GE     A E      A    ++D      +I +   V   D+V+F+N   D    L+R+              PK++ + L+     Y   + A     P  G  E++L + +AKN    L +    K   +  FF  G         R ++ SP   +      +S+  + D+ +++I   +YDVI V          S   +  +  +E  D  +GR++      G    +T+ +G  E+M D+        + +  VPF++
  S:   111 KAVHFMGLLSDGGVHSHQDHLIAMAELAFKRGAEKIYLHAFLDGRDTPPKSAASSIELLDATFQALGKGRIASLIGRYYAMDRDNR----WDRVAQAYNLIVDGKGEINAATAQEGLEAAYARG--ESDEFVKATSIGEPVKVEDGDAVVFMNFRADRARELSRVFVEDGFKEFERARQPKVQYVGLTQ----YAESIPAPAAFAP--GSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVEAIENQRYDVIVVNYANGDMVGHSGVFEAAVKAVECLDTCVGRIVEALEKVGGEALITADHGNVEQMADESTGQAHTAHTTEPVPFIY 468
>gi|163814022|ref|ZP_02205415.1| hypothetical protein COPEUT_00175 [Coprococcus eutactus ATCC 27759] >gi|158450716|gb|EDP27711.1| hypothetical protein COPEUT_00175 [Coprococcus eutactus ATCC 27759] (514 aa)
Score = 121, Expect = 4.4e-04, Identities = 112/468 (23%), Positives = 198/468 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTN 469
           K  ++ +V +G GL+ K +GN + LA  P ++ L++   P+      +     +P    P  +   +S    M  G   I  Y EL  + + I        E     I+   K NS + H++ +LS      +  +L+ ++ +  K+  + V +H   DG+D  P S    L    +K        + +++GR +   +  R D ++    + Y   + G G QA  +A     E+   +V D  +LP   T  +G     V  +DSV+F N  PD            DF    R     P         L  +     D       V  K+E +       +A    K L L    K   +  FF  G    N+N  R ++ SPA  +      +S+  + +K   +I  G+YDVI +          +  +   +  +ET D+ +G  +        ++ + + +G AE+M++      PH  + ++ VPF+  N
  S:     3 KKPVVLMVLDGYGLSDKTEGNAVALAKTPVMDKLMA-TAPFV-----QGAASGLPVG-LPDGQMG-NSEVGHMNIGAGRI-IYQELTRITKAIADGDFFENEEMLAAIENCKKNNSDL-HLWGLLSDGGVHSHNTHLYAILELCKKQNFENVYVHPFFDGRDTPPASGKGYLEELIAKMKEIGVGKVASMSGRYYAMDRDNRWDRVE----LAYKSLVTGEGVQA-EDAVAAMQESYDKEVYDEFVLPTVIT-ENGKPVSLVKPNDSVIFFNFRPDRAREITRAFCCDDFDGFERANGRMP---------LTYVCFKDYDESIPNKLVAFKKEEIDNTFGEYLAAKGLKQLRLAETEKYAHVTFFFNGGVEEPNKNEDRILVKSPAVATYDLQPEMSAPEVSEKLNAAILGGEYDVIIINFANPDMVGHTGVIPAAIQAVETVDKCVGAAVEAIDKVDGVLFICADHGNAEQMINYETG-APHTAHTTNPVPFILYN 473
>gi|54303719|gb|AAV33247.1| independent phosphoglycerate mutase [Onchocerca volvulus] (515 aa)
Score = 121, Expect = 4.4e-04, Identities = 111/462 (24%), Positives = 195/462 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIK---------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLK-PVL--HLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA-FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP----IYGTKLDAVFFENPVKGKEES---LLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML----DKHL----NIVPHNKSSL 462
           +KN +  +V +G G++ + KGN +  A  P ++ L +                     ++P     +     E L G +++           Y ++  ++  +K+K+L   +   +  +R+ K N +I H+  ++S      +  +LF +I  L  K LK P L  H   DG+D  P S    L     F+ K     I T+ GR +   +  R     E + + Y   I G+GE+    +A +      A    D  + P    I+     +KD D+++F +   D    +   M    + K L      P    + G       F  P     ES   +LA  ++             K   +  FF  G     EN  R ++ SP   +     ++SS  + DK I+ + +    F+MC          +   +  +  +E  D  +GR+   C+    ++ +T+ +G AEKM+     KH     N+VP   SSL
  S:     4 VKNRVCLVVIDGWGISNESKGNAILNAKTPVMDELCA-------------------LNSHPIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINLAVKNKTLVENKHLKEAAERAIKGNGRI-HLCGLVSDGGVHSHIDHLFALITAL--KQLKVPQLYIHFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEIATIVGRYYAMDRDKR----WERIRVCYDALIAGVGEKTTIDKAIDVIKGRYAKDETDEFLKP---IILSDKGRTKDGDTLIFFDYRADRMREITECMGME-RYKDLKSDIKHPKDMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVKGLTQFHCAETEKYAHVTFFFNGGVEKQFENEERCLVPSPKVATYDLEPAMSSAGVADKMIEQLNRKAHAFIMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYVLMVTADHGNAEKMIAPDGGKHTAHTCNLVPFTCSSL 472
>gi|153208292|ref|ZP_01946671.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Coxiella burnetii 'MSU Goat Q177'] >gi|165919233|ref|ZP_02219319.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Coxiella burnetii RSA 334] >gi|120576076|gb|EAX32700.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Coxiella burnetii 'MSU Goat Q177'] >gi|165917094|gb|EDR35698.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Coxiella burnetii RSA 334] (519 aa)
Score = 121, Expect = 4.4e-04, Identities = 100/463 (21%), Positives = 191/463 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDN-----------EHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           ++ ++ +G G + +   N +K AN P ++ L    YP  LL    +          P  +       +  + G   +   L  +D  I S   +      + ++++   N K VHI  +LS          +  ++ +  + G+K + LH I DG+D  P S   ++   + +F    N  I ++ GR +   +  R        D L             E +M  +E   G  ++  +  S + +      + D D++   N   D    ++  +  FL+   D F +  R ++  PKL   F++  A  Y   +DA     P++    + L   ++    + L +    K   +  F   G+        R ++ SP   +      +S+  + +K ++ I   D   ++C          + D       I+  D  L R+I   +  G    +T+ +G AEKM D+  N  PH  + S+LVP ++
  S:    12 MVLIILDGFGESDETTHNAIKEANTPTLDKLFRH-YPHTLLEASGR------AVGLPDGQMGNSEVGHLHIGGGRKVPQDLTRIDAAIASGEFYENPALIEALEKAKALN-KAVHILGLLSPGGVHSRDNQIAALVELAHRCGIKKIYLHAILDGRDTPPKSALLSIEKITDQFHAYGNGKIASLIGRYYAMDRDKRWDRTEKAYDLLTQGTAQFHAPTAKEGLMLAYEQ--GNTDEFVSPTSIHRHNETPITIEDGDVVVFMNFRADR---ARQLTYAFLD---DHFTAFNRQVR--PKLSA-FVTLTA--YAKDIDAAVAFPPLE--LHNTLGEYLSARGYRQLRIAETEKYAHVTYFLNGGQEAPFNGEDRLLIPSPKVATYDLQPEMSAVEMTNKLVEIIQNDDYDLIVCNFANPDMVGHTGDETATREAIQVIDDCLKRIITALQSVGGEALITADHGNAEKMFDEKTN-QPHTAHTSNLVPLIY 477
>gi|138896641|ref|YP_001127094.1| phosphoglyceromutase [Geobacillus thermodenitrificans NG80-2] >gi|196249342|ref|ZP_03148040.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacillus sp. G11MC16] >gi|166991389|sp|A4ISP5|GPMI_GEOTN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|134268154|gb|ABO68349.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Geobacillus thermodenitrificans NG80-2] >gi|196211099|gb|EDY05860.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacillus sp. G11MC16] (511 aa)
Score = 121, Expect = 4.5e-04, Identities = 100/467 (21%), Positives = 198/467 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLA--------RMMKTSPKL-KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K  +  ++ +G  L ++  GN +  ANKPN                DR  N+Y P  T  +    V     E   G +++  +L +   +I  +SL   N+ I     DR+          K +   +H+F +LS      +  +L+ ++ +  K+G+K V +H   DG+D  P +  + +    + + +     I T++GR +   +  R     E V   +  +       + +  E   ++  N + D  +LP+     DG  V+    +D+++F N  PD    ++        R     PK  K LF   L     T    V F+       ++ +  +++++  + L +    K   +  F   G         R +++SP   +      +S+  + +  +  I   KYD I +          S  L+  +  +E  D+ LG++++     G I  +T+ +G A+++L         + ++ VP + T
  S:     3 KRPVALIILDGFALREETYGNAVAQANKPNF---------------DRYWNEY-PHATLKACGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRVNIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQEKIKEYGVGEIATLSGRYYSMDRDKR----WERVEKAYRAMVYGEGPTYRDPLECIEDSYKNGIYDEFVLPSVIVREDGSPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPKHPKNLFFVCLTHFSETVKGYVAFK---PTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEKFPGEDRILINSPKVATYDLKPEMSAYEVTEALLKEIAADKYDAIILNYANPDMVGHSGMLEPTIKAVEAVDECLGKVVDAILEKGGIAIITADHGNADEVLTPEGKPQTAHTTNPVPVIVT 472
>gi|82750483|ref|YP_416224.1| phosphoglyceromutase [Staphylococcus aureus RF122] >gi|82656014|emb|CAI80419.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus RF122] (505 aa)
Score = 121, Expect = 4.8e-04, Identities = 104/467 (22%), Positives = 192/467 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILP-AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLDA-VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K     ++ +G    +   GN +KLANKPN                DR  NKY P     +   DV        +S    M  G   I    L  +++ I+       ++ N  I   N  +S + HIF +LS      + K+LF ++ +  K+G++ V +H   DG+D    S  K +    +KF         +V+GR +   +  R     E     +  I       +  A E  + +    + D  ++P       DG  V+  D+V+F N  PD  A L+ +            ++K LF ++    Y   +DA + FE   K    + +  +   N+   L +    K   +  F   G N   +   R+++ SP   +      +S+  + D  ++ + K D+  ++           S  L+  +  IE  D+ LG +++          +T+ +G ++++L      +  + ++ VP + T
  S:     3 KKPTALIILDGFANRESEHGNAVKLANKPNF---------------DRYYNKY-PTTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSAL-HIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETEAKFNELGIGQFASVSGRYYAMDRDKR----WEREEKAYNAIRNFDAPTYATAKEGVDASYNEGLTDEFVVPFIVENQNDG--VNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQVKDLFYATFTK-YNDNIDATIVFE---KVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFKGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELNKGDLDLIILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILDMDGYAIITADHGNSDQVLTDDDQPMTTHTTNPVPVIVT 466
>gi|83855327|ref|ZP_00948857.1| phosphoglyceromutase [Sulfitobacter sp. NAS-14.1] >gi|83843170|gb|EAP82337.1| phosphoglyceromutase [Sulfitobacter sp. NAS-14.1] (505 aa)
Score = 121, Expect = 4.8e-04, Identities = 80/338 (23%), Positives = 136/338 (40%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKF--LLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLN-------------SDP--DDFASLARM-------MKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K      H+  ++S      +  ++   +  L  +G+  V+H + DG+D  P S    L  F      L     I TV+GR +   +  R     + V   +E I      A   A +  N+       D  I P   T+++GY   +D D +  LN             +DP  D F + AR        M    +  G F++++ P               K +  + L   VA++  +   L    K   +  F   GE T      R +  SP   +      +S   + D+ + +I  +YD+I V          + DL   ++  E  D  LGR++      G  + +T+ +G  E M+D
  S:   106 KQTGGTAHVMGLVSDGGVHGHLTHMIAAVRALRAQGIPVVIHALTDGRDVAPRS---ALGYFETLQAALPDGARIATVSGRYYAMDRDNR----WDRVAKAYEAIVQGKGSAAPTARDAVNDAYGLDENDEFITP---TVLEGYTGVQDGDGIFCLNFRADRAREIMSALADPEFDAFDTGARPAWSAVMGMAEYSEAHGAFMTTMYP---------------KPEIVNTLGAWVAQHGLRQFRLAETEKYPHVTFFLNGGEETPTTGEDRYMPKSPNVATYDLQPEMSCAEVTDRFVQAIKDRYDLIVVNYANPDMVGHTGDLDAAIAACEAVDTGLGRVLEALEEVGGAMIVTADHGNCETMID 446
>gi|119475544|ref|ZP_01615897.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [marine gamma proteobacterium HTCC2143] >gi|119451747|gb|EAW32980.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [marine gamma proteobacterium HTCC2143] (522 aa)
Score = 121, Expect = 5.2e-04, Identities = 83/358 (23%), Positives = 151/358 (42%)
  Q:   114 NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDNEHVMDYFETICGLGEQAF--TEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTNGD 471
           N + +H+  +LS      + K+++ ++++  K+G K V +H   DG+D  P S   +L   S +F       I ++ GR +   +  R          L  E    ++ T     E A+   E  E+ +  +  K  ++        I DG      DSV+F+N   D            DF+   R    +P+L    +++    Y + + A     P + K  +    ++ K   K L +    K   +  FF  G     E   R+++ SP   +      +S+  + DK + +I  G+YD I            +   +  +   E  D+ L R+ N     G    +T+ +G  E+M D         + + LVP ++  GD
  S:   115 NDRAIHLLGLLSPGGVHSHEKHIYAMVDMAAKRGAKKVYVHAFLDGRDTPPRSAKNSLQTLSEQFSSLGCGRIASLVGRFYAMDRDNRWDRVQSAYRLLTEERADYHYNTAVDGLEAAYLRDENDEFVSTTIIKKEGESSA-----AIEDG------DSVIFMNFRADRAREISRAFVDKDFSGFKR--DKTPELASFVMTTE---YASDIAAA-CAFPAE-KIHNSFGELIEKAGKKQLRIAETEKYAHVTFFFSGGREQPFEGEERELIPSPDVITYDLKPEMSAPEVTDKLVAAIKGGQYDTIICNYANGDMVGHTGIYEAAVKAAEAIDESLRRVTNAILDAGGDCLITADHGNCEQMQDYQSGQAHTQHTTELVPLIYV-GD 482
>gi|13399528|pdb|1EJJ|A Chain A, Crystal Structural Analysis Of Phosphoglycerate Mutase Cocrystallized With 3-Phosphoglycerate >gi|14278698|pdb|1EQJ|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Bacillus Stearothermophilus Complexed With 2-Phosphoglycerate >gi|30749850|pdb|1O98|A Chain A, 1.4a Crystal Structure Of Phosphoglycerate Mutase From Bacillus Stearothermophilus Complexed With 2- Phosphoglycerate (511 aa)
Score = 120, Expect = 5.4e-04, Identities = 102/467 (21%), Positives = 200/467 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLA--------RMMKTSPKL-KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K  +  ++ +G  L  +  GN +  ANKPN                DR  N+Y P  T  +    V     E   G +++  +L +   +I  +SL   N+ I     DR+          K +   +H+F +LS      +  +L+ ++ +  K+G+K V +H   DG+D  P +  + +    + + +     I T++GR +   +  R D ++      Y   + G G   + +  E   ++  + + D  +LP+     DG  V+    +D+++F N  PD    ++        R     PK  K LF   L     T    V F+       ++ +  +++++  + L +    K   +  F       E     R +++SP   +      +S+  + D  +  I   KYD I +          S  L+  +  +E  D+ LG++++     G I  +T+ +G A+++L         + ++ VP + T
  S:     3 KKPVALIILDGFALRDETYGNAVAQANKPNF---------------DRYWNEY-PHTTLKACGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQEKIKEYGVGEIATLSGRYYSMDRDKRWDRVEKA----YRAMVYGEGP-TYRDPLECIEDSYKHGIYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPKHPKHLFFVCLTHFSETVAGYVAFK---PTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFPGEDRILINSPKVPTYDLKPEMSAYEVTDALLKEIEADKYDAIILNYANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKPQTAHTTNPVPVIVT 472
>gi|118603030|ref|YP_904245.1| phosphoglyceromutase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166991459|sp|A1AXW7|GPMI_RUTMC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|118567969|gb|ABL02774.1| phosphoglycerate mutase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (512 aa)
Score = 120, Expect = 5.8e-04, Identities = 89/356 (25%), Positives = 146/356 (41%)
  Q:   114 NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVF--FENPVKGKEESLLANMVAKNDNKVLVLGLN--------HKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD-KHLNIVPHNKSSLVPFVFTN 469
           N+K VHI  +LS      + + +  ++ +  K+G K V LHL  DG+D    S  K +  F  K  +     IV++ GR     +  R       +   +E I   G+  F   S      LA    + D      +I     + K D ++F+N   D    + R   T   L+G    +  P     L      F  PV     S L N++ K  + + +  L         H   F+N    +  N E+  R ++ SP   +      +S+  L D  I+SI   KYD+I            S  L   +  +ET D  LG +          I +T+ +G AE+M++ K   +   + ++ VP +F +
  S:   109 NNKAVHIMGLLSDGGVHSHEEQIHAMLEMTHKQGCKNVYLHLFTDGRDCAQKSAEKYIQKFEEKMAILGTGEIVSIIGRYFSMDRDNR----WSRIRCAYELIAK-GKAKFLAQSALHAVELAYARGETDEFIQSTSIKIPISIKKGDVLIFMNYRADRARQITRAF-TDENLQGFSRGTFVPTQFICLTEYKKDFNLPV-AYPSSKLNNVLGKYLSNLGMTQLRIAETEKYAHVTFFLNGGVEQAFNGED--RILIPSPDVATYDLQPEMSAFELTDALIESIESQKYDLIICNFANTDMVGHSGKLNATIKAVETIDSCLGIIHKAMFAISGEILITADHGNAEQMINPKTHEVHTAHTNNPVPLIFVS 470
>gi|85703471|ref|ZP_01034575.1| phosphoglyceromutase [Roseovarius sp. 217] >gi|85672399|gb|EAQ27256.1| phosphoglyceromutase [Roseovarius sp. 217] (504 aa)
Score = 120, Expect = 5.8e-04, Identities = 84/383 (21%), Positives = 154/383 (40%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETI-------CGLGEQAFTEA-SEYTNENLANKVMDADILPAYNTIMDGYF-----VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKE-ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNG 470
           +D  I+ KS    +     I +   T  +  H+  ++S      +  ++      L   G+  +LH + DG+D  P S    L    + ++     I TV GR     +  R       V + +E I       C     A + A + +  +   +  +  + L A +   DG F       +   +L   +DP+ F++  R  +  P    L    L  +  ++    +FE     ++  + LA  VA++  +   L    K   +  F   G+        R +  SP   +      +S++ +  + + +I G+YD+I V          + DLK  ++  E  D+ LGR I      G  + +T+ +G  E M+D      PH   +L  VP +   G
  S:    81 IDLAIEDKSFFENKQLQAFIQKMKSTGGR-AHLLGLMSDGGVHGHINHIAAAAKALTDAGVPVLLHALTDGRDVAPKSARVQLEKLRE-IMPLEVTIATVTGRYFALDRDNR----WSRVQEAYEAIVLGRGLRCADPRMAISNAYARFETDEFISATVIGEYLGARDG--DGLFCLNFRADRAREILQAIADPE-FSAFERGAR--PNWAAL----LGMVEYSETHNAWFETVFPSRDIVNTLAEWVAQSGLRQFHLAETEKYPHVTFFLNGGKEHPEPGEDRYMAPSPNVATYDLKPEMSAEEVTTRLVAAIRGRYDLIVVNYANPDMVGHTGDLKAAMAACEAVDKGLGRAIEALNEVGGTLIVTADHGNCEVMVDPETG-GPHTAHTLNPVPVILVGG 466
>gi|191162195|ref|ZP_03024076.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacter sp. M21] >gi|190996985|gb|EDV72432.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacter sp. M21] (512 aa)
Score = 120, Expect = 6.3e-04, Identities = 107/482 (22%), Positives = 203/482 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIK-SKSLHNLEIFNK--LIDRSNKT--NSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYS---FNKNL-SNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYF----VSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG----TKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI----TRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSS--LVPFVFTNGDLWPKKMQSNFLG 483
           K  L+ ++ +G G+N   + N +  A  PN+  L S  YP   + +    +  +P     + +            G T+I     +  +  + +KS+ + + F    L+D   K    S  +H+  +LS      +  +L+ +I++  + G++ V +H + DG+D  P S   + K L +  ++    +   I TV GR +   +  R     + V   +  I     + +  A+    ++  + V D  +LP+   IM+G      +   D  +F N   D    + R   T P   G        +      T  D  F      G EE  ++   +++      L +    K   +  FF  N   EN      R ++ SP    T D++   +S+ ++ ++ +  +   KYDVI +          +  L   +  +E  D+ +G+L+   R  G I  +T+ +G AE M D+     PH   +  + P V  +      K++   L 
  S:     3 KKPLLLMILDGWGINSDTESNAIAQAKTPNMTRL-SAEYPSGTI-DGSGMSVGLPAGQMGNSE-----------VGHTNIGAGRVVYQDLTRITKSIDDGDFFRNPVLLDCMKKAVQGSGRLHLAGLLSDGGVHSHDTHLYALIDMAKRNGVREVFVHCLLDGRDTPPQSGIDYLKRLEAEMARLCFGK---IATVIGRYYAMDRDNR----WDRVEQAYRAIVSGEGKPYPSAAAAIEQSYKDGVNDEFVLPS--VIMEGGAPVGRLGDGDGFIFFNFRSDRAREITRAF-TDPGFDGFKREEWPKLASYVCMTSYDETFGLPVAFGNEELVNIFPEVISNAGLTQLRIAETEKYAHVTFFF--NGGRENPFPGEERALIPSPKEVATYDQKP-EMSAYLVTEELLKRLDEEKYDVIILNFANADMVGHTGILPAAVKAVEAVDECVGKLVAKVREKGGIALITADHGNAEMMKDEQGG--PHTAHTCEMAPVVLVDDSRKGAKLRQGVLA 486
>gi|163749818|ref|ZP_02157063.1| phosphoglyceromutase [Shewanella benthica KT99] >gi|161330332|gb|EDQ01311.1| phosphoglyceromutase [Shewanella benthica KT99] (514 aa)
Score = 120, Expect = 6.3e-04, Identities = 78/333 (23%), Positives = 136/333 (40%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR--------DFLDNEHVMDYFETICGLGEQAFTE-------ASEYTNENLAN--KVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           VHI  +LS      +  ++  +  + +++G K V LH   DG+D  P S   +L++F     +  T  I +V GR +   +  R        D +     +  +       E A+         AS    +N  N  K+ D+D L   N   D    ++  +  F++ D D F       K + K   L L+     Y   + A       +    + L  ++   D   L +    K   +  FF  G+    +   R ++ SP   +      +SS  L DK + +I    YDVI    P       + + +  +   E  D  +GR++      G    +T+ +G AE+M D+
  S:   113 VHIMGLLSPGGVHSHENHIEAMCRLAVERGAKQVYLHAFLDGRDTPPRSAKSSLAHFDDLFTRLGTGRIASVIGRYYAMDRDNRWDRVTLAYDLITQGESLHQYTNAVDALEAAYERDENDEFVASSAITDNQGNVAKLADSDSLIFMNFRADR---ARQITRSFVDPDFDGFER-----KVTTKAHFLMLTQ----YAANIPAAIAYPSTE--LVNTLGEVLQSRDKTQLRISETEKYAHVTFFFNGGKEEAFKGEDRILIQSPKVATYDLQPEMSSAELTDKLVAAIESTDYDVIICNYPNGDMVGHTGNFEAAVKACEAVDTSIGRVVEALAKVGGECLITADHGNAEQMTDE 454
>gi|28210137|ref|NP_781081.1| phosphoglyceromutase [Clostridium tetani E88] >gi|50400497|sp|Q898R1|GPMI_CLOTE 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|28202573|gb|AAO35018.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Clostridium tetani E88] (513 aa)
Score = 120, Expect = 6.3e-04, Identities = 111/491 (22%), Positives = 206/491 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTS-------PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN--IVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K  ++ ++ +G G+     GN +K+ANKPN + L+   YP   L            +   S    ++     ++Y E      L  + + I           N  ID + K NS +  +  +     +  +  +L  ++ +   KGL  V +H   DG+D  P S  + + N   ++ + +   I T+AGR +   +  R     E V + Y   + G GE +   A E   ++  +   D  +LP    + DG     +  +DS++F N  PD    + R +           +LK  F++       T+ D       +  K +S    L   V+      L +    K   +  FF  G  T N+   R ++ SP   +      +S+  + D+ I+ I   KYD+I +          +       + IE  D+ +G + +        + +T+ +G +E+M+D      +  H  +  VPFV+ + D   K+++S   G+ + I  T+
  S:     3 KKPVMLMILDGFGITNHEDGNAVKMANKPNFDKLLRE-YPHTQLKASGLNVGLPEGQMGNSEVGHLNIGSGRVIYQE------LTRITKDINDGVFFENTEINYAIDEAIKNNSSLHLLGLLSDGGVHS-HIDHLKAILKLAKDKGLNRVYVHAFLDGRDVPPSSAKEYIINIENYMKELSVGQIATLAGRYYAMDRDKR----WERVELAYNALVYGTGELS-NSAVEAIEKSYKDNTTDEFVLPTV-ILKDGKPTGTIKDEDSIIFFNFRPDRARQITRALNDKDFDGFERKRLKLNFITM------TQYDKTIENVRIAYKPQSYKNTLGEYVSSLGLNQLRIAETEKYAHVTFFFNGGVETPNKGEDRALIPSPKVATYDLKPEMSAFEVKDEVINRIESNKYDMIILNFANPDMVGHTGVFDAAKTAIEVVDKCVGEISDKILEKEGTVFITADHGNSEQMIDYSTGKPMTAHTTNE-VPFVYVSKDAKDKRLKSE--GILADIAPTM 492
>gi|189194371|ref|XP_001933524.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187979088|gb|EDU45714.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Pyrenophora tritici-repentis Pt-1C-BFP] (520 aa)
Score = 120, Expect = 6.4e-04, Identities = 91/405 (22%), Positives = 175/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL-KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPI-----VTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMM---KTSPKL-----KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           + + IK+  L +++   K   R+   N ++ H   ++S      +  +L  ++ V   +G+ K  +H   DG+D  P    K+   + + LLK    I      TV GR ++        +D +   D  E      + G GE++  +      E  A    D  + P    I+ G    +  DD+V F N   D    + +++     SPK      K + ++++          + FE     +   +LA  + K   K   +    K   +  FF  G     EN  R+++ SP   +      +S+  + +K  + I  GK++ +            +   K  +      D+ + R+ + C+ +G ++ +T+ +G AE+ML +       + ++ VPFV  N  + W  K     LG V  ++L+T+
  S:    92 IGQTIKNGKLKDVDTIKKSFQRAIDGNGRL-HFCGLVSDGGVHSHMDHLIALLKVAKDQGVPKAYIHFFGDGRDTDP----KSAVGYMETLLKATKEIGLGEIATVVGRYYI--------MDRDKRWDRVEIGMKGLVTGEGEES-NDPVATIKERYAKDENDEFLKP---IIVGGKERRIQDDDTVFFFNYRSDRVREITQLLGDVDRSPKPDFPYPKNIDITTMTSYNPKYTFNIAFE---PQRMTDVLAETLGKQGVKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLEPKMSAMAVAEKLCERIRTGKFEFLMNNFAPPDMVGHTGVYKAAIEACTETDKAIKRVYDQCKESGYVMFVTADHGNAEEMLTEEGTPKTSHTTNKVPFVMANAPEGWSLKKTDGVLGDVAPTLLATM 503
>gi|21282466|ref|NP_645554.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus MW2] >gi|49485647|ref|YP_042868.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650117|ref|YP_185715.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus COL] >gi|87161543|ref|YP_493460.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus USA300] >gi|88194558|ref|YP_499354.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267235|ref|YP_001246178.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus JH9] >gi|150393284|ref|YP_001315959.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus JH1] >gi|151220956|ref|YP_001331778.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509046|ref|YP_001574705.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727036|ref|ZP_02759313.1| bisphosphoglycerate mutase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|27734309|sp|Q8NXL5|GPMI_STAAW 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81649730|sp|Q6GB55|GPMI_STAAS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|81694964|sp|Q5HHP2|GPMI_STAAC 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|21203903|dbj|BAB94602.1| 2,3-diphosphoglycerate- independentphosphoglycerate mutase [Staphylococcus aureus subsp. aureus MW2] >gi|49244090|emb|CAG42516.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284303|gb|AAW36397.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Staphylococcus aureus subsp. aureus COL] >gi|87127517|gb|ABD22031.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202116|gb|ABD29926.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740304|gb|ABQ48602.1| phosphoglycerate mutase [Staphylococcus aureus subsp. aureus JH9] >gi|149945736|gb|ABR51672.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Staphylococcus aureus subsp. aureus JH1] >gi|150373756|dbj|BAF67016.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160367855|gb|ABX28826.1| bisphosphoglycerate mutase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (505 aa)
Score = 120, Expect = 6.7e-04, Identities = 104/467 (22%), Positives = 191/467 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILP-AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K     ++ +G    +   GN +KLANKPN                DR  NKY P     +   DV        +S    M  G   I    L  +++ I+       ++ N  I   N  +S + HIF +LS      + K+LF ++ +  K+G++ V +H   DG+D    S  K +    +KF         +V+GR +   +  R     E     +  I       +  A E    +    + D  ++P       DG  V+  D+V+F N  PD  A L+ +            ++K LF ++    Y   +D A+ FE   K    + +  +   N+   L +    K   +  F   G N   +   R+++ SP   +      +S+  + D  ++ + K D+  ++           S  L+  +  IE  D+ LG +++          +T+ +G ++++L      +  + ++ VP + T
  S:     3 KKPTALIILDGFANRESEHGNAVKLANKPNF---------------DRYYNKY-PTTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSAL-HIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETEAKFNELGIGQFASVSGRYYAMDRDKR----WEREEKAYNAIRNFDAPTYATAKEGVEASYNEGLTDEFVVPFIVENQNDG--VNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQVKDLFYATFTK-YNDNIDAAIVFE---KVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFKGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELNKGDLDLIILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILDMDGYAIITADHGNSDQVLTDDDQPMTTHTTNPVPVIVT 466
>gi|15923765|ref|NP_371299.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926452|ref|NP_373985.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus N315] >gi|156979103|ref|YP_001441362.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus Mu3] >gi|54037213|sp|P64270|GPMI_STAAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|54041321|sp|P64269|GPMI_STAAM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|13700666|dbj|BAB41963.1| 2, 3-diphosphoglycerate- independentphosphoglycerate mutase [Staphylococcus aureus subsp. aureus N315] >gi|14246544|dbj|BAB56937.1| 2, 3-diphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus subsp. aureus Mu50] >gi|156721238|dbj|BAF77655.1| 2, 3-diphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus subsp. aureus Mu3] (505 aa)
Score = 120, Expect = 6.8e-04, Identities = 104/467 (22%), Positives = 191/467 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILP-AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K     ++ +G    +   GN +KLANKPN                DR  NKY P     +   DV        +S    M  G   I    L  +++ I+       ++ N  I   N  +S + HIF +LS      + K+LF ++ +  K+G++ V +H   DG+D    S  K +    +KF         +V+GR +   +  R     E     +  I       +  A E    +    + D  ++P       DG  V+  D+V+F N  PD  A L+ +            ++K LF ++    Y   +D A+ FE   K    + +  +   N+   L +    K   +  F   G N   +   R+++ SP   +      +S+  + D  ++ + K D+  ++           S  L+  +  IE  D+ LG +++          +T+ +G ++++L      +  + ++ VP + T
  S:     3 KKPTALIILDGFANRESEHGNAVKLANKPNF---------------DRYYNKY-PTTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSAL-HIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETEAKFNELGIGQFASVSGRYYAMDRDKR----WEREEKAYNAIRNFDAPTYATAKEGVEASYNEGLTDEFVVPFIVENQNDG--VNDGDTVIFYNFRPDRAAQLSEIFANRAFEGFKVEQVKDLFYATFTK-YNDNIDAAIVFE---KVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFKGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELNKGDLDLIILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILDMDGYAIITADHGNSDQVLTDDDQPMTTHTTNPVPVIVT 466
>gi|27734396|sp|Q9X519|GPMI_BACST 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|4589058|gb|AAD26328.1|AF120091_1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Geobacillus stearothermophilus] (511 aa)
Score = 119, Expect = 7.0e-04, Identities = 102/467 (21%), Positives = 200/467 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLA--------RMMKTSPKL-KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K  +  ++ +G  L  +  GN +  ANKPN                DR  N+Y P  T  +    V     E   G +++  +L +   +I  +SL   N+ I     DR+          K +   +H+F +LS      +  +L+ ++ +  K+G+K V +H   DG+D  P +  + +    + + +     I T++GR +   +  R D ++      Y   + G G   + +  E   ++  + + D  +LP+     DG  V+    +D+++F N  PD    ++        R     PK  K LF   L     T    V F+       ++ +  +++++  + L +    K   +  F   G         R +++SP   +      +S+  + D  +  I   KYD I +          S  L+  +  +E  D+ LG++++     G I  +T+ +G A+++L         + ++ VP + T
  S:     3 KKPVALIILDGFALRDETYGNAVAQANKPNF---------------DRYWNEY-PHTTLKACGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQEKIKEYGVGEIATLSGRYYSMDRDKRWDRVEKA----YRAMVYGEGP-TYRDPLECIEDSYKHGIYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPKHPKHLFFVCLTHFSETVKGYVAFK---PTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEKFPGEDRILINSPKVPTYDLKPEMSAYEVTDALLKEIEADKYDAIILNYANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKPQTAHTTNPVPVIVT 472
>gi|16080444|ref|NP_391271.1| phosphoglyceromutase [Bacillus subtilis subsp. subtilis str. 168] >gi|3915798|sp|P39773|GPMI_BACSU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) (Vegetative protein 107) (VEG107) >gi|2635904|emb|CAB15396.1| phosphoglycerate mutase [Bacillus subtilis subsp. subtilis str. 168] (511 aa)
Score = 119, Expect = 7.5e-04, Identities = 111/506 (21%), Positives = 219/506 (43%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEH-VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K     ++ +G GL  +  GN + LA KPN                DR  N+Y P +T  +    V     E   G +++  +L +   +I  +SL   N+ I     +R+          K N+K +H+F +LS      +  +LF ++ +  K+GL  V +H   DG+D  P +    ++  +  + +     I +++GR +   +  R D ++  +  M Y E        ++  A +  +++ AN + D  ++P+  T  +G  V+K    DSV+F N  PD            DF    R       L  + L+     +   +D      P+    ++ +  +++++  K L +    K   +  F   G         R +++SP   +      +S+  + D  +  I   K+D I +          S  ++  +  IE  D+ LG +++     G    +T+ +G A+ ++ +       + ++ VP + T   +  +  +   LG  +  L  L  ++   ++  TSLI
  S:     3 KKPAALIILDGFGLRNETVGNAVALAKKPNF---------------DRYWNQY-PHQTLTASGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTKVYIHGFLDGRDVGPQTAKTYINQLNDQIKEIGVGEIASISGRYYSMDRDKRWDRVEKAYRAMAYGEG------PSYRSALDVVDDSYANGIYDEFVIPSVITKENGEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGENYPKNLYFVCLTH----FSETVDGYVAFKPI--NLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAEFPGEERILINSPKVATYDLKPEMSAYEVKDALVKEIEADKHDAIILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAILAKGGHAIITADHGNADILITESGEPHTAHTTNPVPVIVTKEGITLR--EGGILGDLAPTLLDLLGVEKPKEMTGTSLI 509
>gi|27574273|pdb|1O99|A Chain A, Crystal Structure Of The S62a Mutant Of Phosphoglycerate Mutase From Bacillus Stearothermophilus Complexed With 2- Phosphoglycerate (511 aa)
Score = 119, Expect = 7.8e-04, Identities = 102/467 (21%), Positives = 199/467 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLA--------RMMKTSPKL-KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K  +  ++ +G  L  +  GN +  ANKPN                DR  N+Y P  T  +    V     E   G  ++  +L +   +I  +SL   N+ I     DR+          K +   +H+F +LS      +  +L+ ++ +  K+G+K V +H   DG+D  P +  + +    + + +     I T++GR +   +  R D ++      Y   + G G   + +  E   ++  + + D  +LP+     DG  V+    +D+++F N  PD    ++        R     PK  K LF   L     T    V F+       ++ +  +++++  + L +    K   +  F       E     R +++SP   +      +S+  + D  +  I   KYD I +          S  L+  +  +E  D+ LG++++     G I  +T+ +G A+++L         + ++ VP + T
  S:     3 KKPVALIILDGFALRDETYGNAVAQANKPNF---------------DRYWNEY-PHTTLKACGEAV--GLPEGQMGNAEVG-HLNIGAGRIVYQSLTRINIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQEKIKEYGVGEIATLSGRYYSMDRDKRWDRVEKA----YRAMVYGEGP-TYRDPLECIEDSYKHGIYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPKHPKHLFFVCLTHFSETVAGYVAFK---PTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEEFPGEDRILINSPKVPTYDLKPEMSAYEVTDALLKEIEADKYDAIILNYANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKPQTAHTTNPVPVIVT 472
>gi|49483033|ref|YP_040257.1| phosphoglyceromutase [Staphylococcus aureus subsp. aureus MRSA252] >gi|81651514|sp|Q6GIL5|GPMI_STAAR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|49241162|emb|CAG39840.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Staphylococcus aureus subsp. aureus MRSA252] (505 aa)
Score = 119, Expect = 8.7e-04, Identities = 104/467 (22%), Positives = 191/467 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV--------DSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNF-SKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILP-AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLD-AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K     ++ +G    +   GN +KLANKPN                DR  NKY P     +   DV        +S    M  G   I    L  +++ I+       ++ N  I   N  +S + HIF +LS      + K+LF ++ +  K+G++ V +H   DG+D    S  K +    +KF         +V+GR +   +  R     E     +  I       +  A E    +    + D  ++P       DG  V+  D+V+F N  PD  A L+ +            ++K LF ++    Y   +D A+ FE   K    + +  +   N+   L +    K   +  F   G N   +   R+++ SP   +      +S+  + D  ++ + K D+  ++           S  L+  +  IE  D+ LG +++          +T+ +G ++++L      +  + ++ VP + T
  S:     3 KKPTALIILDGFANRESEHGNAVKLANKPNF---------------DRYYNKY-PTTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDGDFFENDVLNNAIAHVNSHDSAL-HIFGLLSDGGVHSHYKHLFALLELAKKQGVEKVYVHAFLDGRDVDQKSALKYIEETEAKFNELGIGQFASVSGRYYAMDRDKR----WEREEKAYNAIRNFDAPTYATAKEGVEASYNEGLTDEFVVPFIVEDQNDG--VNDGDAVIFYNFRPDRAAQLSEIFANRAFEGFKVEQVKDLFYATFTK-YNDNIDAAIVFE---KVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGGRNEEFKGERRRLIDSPKVATYDLKPEMSAYEVKDALLEELNKGDLDLIILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILDMDGYAIITADHGNSDQVLTDDDQPMTTHTTNPVPVIVT 466
>gi|160943252|ref|ZP_02090488.1| hypothetical protein FAEPRAM212_00738 [Faecalibacterium prausnitzii M21/2] >gi|158445491|gb|EDP22494.1| hypothetical protein FAEPRAM212_00738 [Faecalibacterium prausnitzii M21/2] (508 aa)
Score = 118, Expect = 9.3e-04, Identities = 88/373 (23%), Positives = 162/373 (43%)
  Q:    94 SKSLHNLEIF-NKLIDRSNKTN---SKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFV 466
           +KS+H+ E+  N ++ ++ K      K +H+  ++       +A + F V+ +    G K V LH I DG+D  P+S    L++    L +     I +V+GR +      RD   +     Y   + G GE A   A        A+K  D  +LP      +G  V   D+V+F+N  PD    + R+         +     K +    +A    T  +      PV+ K  ++L   ++ +    L +    K   +  FF  G     E   R ++ SP   +      +S+  +  + +  I  GKYDV+   F  C M+     +   +  +  +E  D  + +++      G    +T+ +G AEKM++        + +++VPF+
  S:    84 TKSIHDGEMLKNPVLVKNMKAAIEAGKAIHLMGLVGTGGVHSHADHWFGVLEMAKHLGAKEVYLHCITDGRDTDPHSGKGFLADLQAKLDELGVGKIASVSGRYYAMD---RDNNWDREEKAYAAFVYGEGEHAANAAEAIEASYAADKT-DEFVLPCVTC--EGGRVQDGDTVIFMNFRPDRARQMTRIFCDDAFTGFERRGGRKQVNYVCMAEYDATMPNCEVAYPPVELK--NVLGEYLSAHGKTQLRIAETEKYAHVTFFFNGGVEAPYEGEDRCVIPSPKVATYDLKPEMSAPEVAAECVKRIESGKYDVVILNFANCDMVGH---TGVFEAAVKAVEAVDTCVDQVVTAVLNAGGCAFITADHGNAEKMMNPDGTPFTAHTTNVVPFM 466
>gi|83941850|ref|ZP_00954312.1| phosphoglyceromutase [Sulfitobacter sp. EE-36] >gi|83847670|gb|EAP85545.1| phosphoglyceromutase [Sulfitobacter sp. EE-36] (505 aa)
Score = 118, Expect = 1.1e-03, Identities = 80/338 (23%), Positives = 134/338 (39%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKF--LLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLN-------------SDP--DDFASLARM-------MKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           K      H+  ++S      +  ++   +  L  +G+  V+H + DG+D  P S    L  F      L     I TV+GR     +  R     + V   +E I      A   A +  N+       D  I P   T+++GY   +D D +  LN             +DP  D F + AR        M       G F++++ P               K +  + L   VA++  +   L    K   +  F   GE T      R +  SP   +      +S   + D+ + +I  +YD+I V          + DL   ++  E  D  LGR++      G  + +T+ +G  E M+D
  S:   106 KQTGGTAHVMGLVSDGGVHGHLTHMIAAVRTLRAQGIPVVIHALTDGRDVAPRS---ALGYFETLQAALPDGASIATVSGRYFAMDRDNR----WDRVAKAYEAIVQGKGSAAPTARDAVNDAYGLDENDEFITP---TVLEGYTGVQDGDGIFCLNFRADRAREIMSALADPEFDAFDTGARPAWSAVMGMAEYSDAHGAFMTTMYP---------------KPEIVNTLGAWVAQHGLRQFRLAETEKYPHVTFFLNGGEETPTTGEDRYMPKSPNVATYDLQPEMSCAEVTDRFVQAIKDRYDLIVVNYANPDMVGHTGDLDAAIAACEAVDTGLGRVLEALEDVGGAMIVTADHGNCETMID 446
>gi|153820543|ref|ZP_01973210.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio cholerae NCTC 8457] >gi|126508913|gb|EAZ71507.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio cholerae NCTC 8457] (258 aa)
Score = 118, Expect = 1.2e-03, Identities = 55/209 (26%), Positives = 91/209 (43%)
  Q:   259 DSVLFLNSDPD-----------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           D++LF+N   D           DFA  +R  K  P L  + L+  A      L   F    +    E+     ++K     L +    K   +  FF     NE     R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:     2 DALLFMNYRADRARQITRTFVPDFAGFSR--KAFPALDFVMLTQYAA--DIPLQCAFGPASL----ENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGGVENEFPGEERQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 218
>gi|77920167|ref|YP_357982.1| phosphoglyceromutase [Pelobacter carbinolicus DSM 2380] >gi|85540990|sp|Q3A1E5|GPMI_PELCD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|77546250|gb|ABA89812.1| phosphoglycerate mutase [Pelobacter carbinolicus DSM 2380] (514 aa)
Score = 117, Expect = 1.3e-03, Identities = 93/393 (23%), Positives = 170/393 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFL----LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYG----TKLDAVFFENPVKGKEES---LLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDPN 510
           +H+  +LS      + ++L+ ++ +  + G++ V +H   DG+D  P S    L+     L    L R   + TV GR     +  R     E V   +  +  G+G  +F  ++    +  A    D  + P +        V   D ++F N   D    + R   TS    G        + G    T+ DA F   P+    E+   LL  +V++   K L +    K   +  FF  G     +   R ++ SP    T D +   +S+  + D  ++ +  G+YD+I   F    M+      S     ++ +ET D  +GR+++     G  + +T+ +G  E+M D      PH  + S+ VP +  + D    K+++  L   +  L  L  +D    +   SL++P+
  S:   114 LHLMGLLSDGGVHSHMEHLYALVEMARRAGVEQVCIHAFMDGRDTPPQSGAGYLAQLEDKLQDIGLGR---VATVIGRYWAMDRDNR----WERVEKAYRAMTEGVG-TSFESSAAAIADAYAQGQTDEFVEPRFVGGEKPCTVDDGDGMIFFNFRADRAREITRTF-TSSDFSGFSREKTPRLAGYVCLTEYDASF-GLPMAFPPETYPELLGEVVSRAGRKQLRIAETEKYAHVTFFFNGGSEEPFDGEDRVLIPSPKEVATYDLKP-EMSAPAVTDAMLERVASGRYDLIVLNFANPDMVGHTGVES---AAIAAMETVDACVGRVVDAVLNAGGSLLITADHGNCEQMADA--KGAPHTAHTSNPVPVILVDPDRTGVKLRNGILADLAPTLLELMGIDKPAAMTGRSLLEPS 514
>gi|167045527|gb|ABZ10179.1| putative Metalloenzyme superfamily protein [uncultured marine microorganism HF4000_APKG10H12] (228 aa)
Score = 117, Expect = 1.4e-03, Identities = 40/148 (27%), Positives = 67/148 (45%)
  Q:   317 LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           LA+++  ND   L L    K   +  FF  GE        R ++ SP   +      +S+  + D  +  +  G++DVI   F    M+    R   L   ++ +ET D  L R++   +  G  + +T+ +G AE+M D   N  PH   +  P
  S:    28 LADVLTANDRTNLRLAETEKYAHVTYFFNCGEEQPARGEDRILVPSPTVPTYDLQPEMSAAGITDHLVADLDAGRHDVIICNFANADMVGHTGR---LDAAVTAVETLDGCLARIVAAVKAAGGTLIITADHGNAEQMWDTERN-GPHTAHTTNP 178
>gi|148550131|ref|YP_001270233.1| phosphoglyceromutase [Pseudomonas putida F1] >gi|166991455|sp|A5WA89|GPMI_PSEP1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|148514189|gb|ABQ81049.1| phosphoglycerate mutase [Pseudomonas putida F1] (511 aa)
Score = 116, Expect = 1.5e-03, Identities = 75/335 (22%), Positives = 134/335 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENL------ANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLF---LSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           K VHI  +LS      +  +L  +  +  ++G + + LH   DG+D  P S   ++    + F+K    R   I ++ GR +   +  R           ++ +          A+EYT +        A    ++D       I D   V   D+V+F+N   D    L+R     P         L  +A   G    +     P      SL   L   +AKN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + D+ +++I   ++DVI V          +   +  +  +E  D  +GR+++     G    +T+ +G  E+M D+
  S:   111 KAVHILGLLSDGGVHSHQDHLVAMAKLAAQRGAEKIYLHAFLDGRDTPPRSAQSSIELLDATFAKLGKGR---IASLIGRYYAMDRDNR-----------WDRVSAAYNLIVDSAAEYTADTALAGLEAAYARDESDEFVKATRIGDAVKVEDGDAVIFMNFRADRARELSRAF-VEPDFTEFARARLPKMAAYIGLTQYSAKIPAPAAFAPSSLNNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFEGEERILIPSPKVATYDLQPEMSAPEVTDRIVEAIEQQRFDVIVVNYANGDMVGHTGVFEAAVKAVEALDTCVGRIVDALEKVGGEALITADHGNVEQMEDE 451
>gi|19074715|ref|NP_586221.1| PHOSPHOGLYCERATE MUTASE [Encephalitozoon cuniculi GB-M1] >gi|19069357|emb|CAD25825.1| PHOSPHOGLYCERATE MUTASE [Encephalitozoon cuniculi GB-M1] (503 aa)
Score = 116, Expect = 1.6e-03, Identities = 69/364 (18%), Positives = 152/364 (41%)
  Q:   103 FNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFL-LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLA-RMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRK--ILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFV 466
             K++D+  +     +H+  M+S      + ++L  ++  L  +  +  +H ++DG+D  P  F K L     FL +     + ++AGR +       D  +N+   +    +   G +   +   +        + D  + P    ++DG   +   D+++F N   D    +A +  K    +  + ++      G+K+  +F +  VK     +L++   ++ +    +  N K+  +  FF         T++  IL SP   S     S++S+ +    +  I K   ++ V          + + +   + +E  D+ +G++   C      + +T+ +G AEKM+DK       + +S VP +
  S:   102 LKKMLDKELQGIDGKIHVVGMVSDGGVHSHIRHLKAILEALEGRNEEVFVHCVSDGRDTEPRVFLKYLKEVRDFLRVTEVGKVASIAGRFYSM-----DRANNDERTELSFRMMTRGREVGGDIRSHICAMYEEGLSDETLRP---LLIDGRGRIDPKDTIIFFNFRADRMRQIASKFAKNGNSM--ITMTEYKKDLGSKV--LFKKICVKNTLAEVLSSRGIRHSH----IAENEKQAHVTYFFNGGREQAFSTQRTIILPSPGVQSFDAVPSMASREVAMSAVAEIEKGVPLVVVNLAPPDMVGHTGNFEATKAAVEVTDECIGKIYRACTRNRYTLVITADHGNAEKMVDKGGGCCKTHTTSKVPLI 455
>gi|56421590|ref|YP_148908.1| phosphoglyceromutase [Geobacillus kaustophilus HTA426] >gi|81557739|sp|Q5KVE6|GPMI_GEOKA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|56381432|dbj|BAD77340.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (phosphoglyceromutase) [Geobacillus kaustophilus HTA426] (511 aa)
Score = 116, Expect = 1.7e-03, Identities = 102/467 (21%), Positives = 199/467 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLA--------RMMKTSPKL-KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K  +  ++ +G  L  +  GN +  ANKPN                DR  N+Y P     +    V     E   G +++  +L +   +I  +SL   N+ I     DR+          K +   +H+F +LS      +  +L+ ++ +  K+G+K V +H   DG+D  P +  + +    + + +     I T++GR +   +  R D ++      Y   + G G   + +  E   ++  + + D  +LP+     DG  V+    +D+++F N  PD    ++        R     PK  K LF   L     T    V F+       ++ L  +++++  + L +    K   +  F   G         R +++SP   +      +S+  + D  +  I   KYD I +          S  L+  +  +E  D+ LG++++     G I  +T+ +G A+++L         + ++ VP + T
  S:     3 KQPVALIILDGFALRDETYGNAVAQANKPNF---------------DRYWNEY-PHTMLKACGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRVNIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAPQYIKELQEKIKEYGVGEIATLSGRYYSMDRDKRWDRVEKA----YRAMVYGEGP-TYRDPLECIEDSYKHGIYDEFVLPSVIVREDGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPKHPKHLFFVCLTHFSETVKGYVAFK---PTNLDNTLGEVLSQHGLRQLRIAETEKYPHVTFFMSGGREEKFPGEDRILINSPKVPTYDLKPEMSAYEVTDALLKEIEADKYDAIILNYANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKPQTAHTTNPVPVIVT 472
>gi|90580902|ref|ZP_01236704.1| phosphoglyceromutase [Vibrio angustum S14] >gi|90437973|gb|EAS63162.1| phosphoglyceromutase [Vibrio angustum S14] (513 aa)
Score = 116, Expect = 1.7e-03, Identities = 78/352 (22%), Positives = 149/352 (42%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA-------DILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTS---------PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           K VHI  +LS      +  ++   I +  K+G + + LH   DG+D  P S   +L  F++   K         G+       GR + +D ++  D  E    L   A    +E+T  N  + +  A       + + A     +G     V+  DSV+F+N   D    + R  +           P+L    + +    Y   ++      P     ++ L   ++K   K L +    K   +  FF  G+    +  +R++++SP   +      +S+  L DK + +I  G++D+I    P       +      +   E  D  LG+++   +     + +T+ +G AE M+D     +    ++L VP ++
  S:   110 KAVHILGLLSPGGVHSHEDHIAAAIEMAAKRGAEKIYLHAFLDGRDTPPRSAKNSLVRFNELFAK--------LGKGRTASLIGRYYAMDRDNNWDRVEKAYDLITAA---KAEFTVANAVDGLAAAYERDENDEFVQATEVRAEGQEAAIVADGDSVIFMNYRADRAREITRAFEPGFTDFARAQFPQLSDFVMLTQ---YAADIELTTAFKP--ASLDNTLGEWLSKKGKKQLRISETEKYAHVTFFFNGGKEDEFDGESRQLVASPKVATYDLQPEMSAPELTDKLVAAIKGGEFDMIICNYPNGDMVGHTGVYDAAVKACEALDTCLGKVVAAIKEMDGQLLITADHGNAEMMVDPSTGGIHTAHTNLPVPLIY 471
>gi|15790779|ref|NP_280603.1| phosphoglyceromutase [Halobacterium sp. NRC-1] >gi|169236523|ref|YP_001689723.1| phosphoglycerate mutase,2,3-biphosphateglycerate-independent type [Halobacterium salinarum R1] >gi|27734389|sp|Q9HNY7|GPMI_HALSA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|10581330|gb|AAG20083.1| phosphoglycerate mutase [Halobacterium sp. NRC-1] >gi|167727589|emb|CAP14377.1| phosphoglycerate mutase,2,3-biphosphateglycerate-independent type [Halobacterium salinarum R1] (508 aa)
Score = 116, Expect = 1.9e-03, Identities = 74/349 (21%), Positives = 146/349 (41%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM-------------KTSPKLKGLFLSSLAPIYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFV 466
           +H+  ++S      + +++  ++     +G++  +H   DG+D  P      L++      +  T  + +V+GR +    + +++   +   D      G+   A       T+   + +  D D      TI  G  +S  D+V+F N   D    L R++             +T+P        ++  +  T+ D   F+ PV     +    L  ++A +D+  L +  + K   +  F   G     +  TR I+ SP   +  E  ++S+  + D  +D++     DV+ +          + D    +  +E  D+ LGRL+      G    LT+ +G A+   D      PH   +   VPFV
  S:   108 LHVMGLVSDGGVHADQQHIHALVECAAGRGVEAAVHAFTDGRDTSPTGGEDYLADLEAVADEHGTGDVASVSGRYYAM-DRDQNWARTKRAYDAITRSDGVAHHAAAAVDAVTD---SYERGDTDEFVEPTTIEGGAALSDGDAVVFANFRADRARQLTRLLADIHPADWDADGIETNP-------PAVPVVTMTEYDET-FDCPVAFPAAEPTDTLGAVLAAHDHTQLRVAESEKYAHVTYFLNGGREVAFDGETRTIVDSPDVPTYDEQPAMSAPAVTDTVLDALAGDDPDVLVLNYANPDMVGHTGDFDAAIEAVEAVDRELGRLVPALNDAGAHAFLTADHGNAD---DLGTPADPHTAHTFNPVPFV 464
>gi|29654827|ref|NP_820519.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Coxiella burnetii RSA 493] >gi|50400471|sp|Q83BH2|GPMI_COXBU 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|29542095|gb|AAO91033.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Coxiella burnetii RSA 493] (519 aa)
Score = 115, Expect = 2.0e-03, Identities = 100/463 (21%), Positives = 189/463 (40%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDNE----HVMDYFETICGLGEQAFTE-----ASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           ++ ++ +G G + +   N +K AN P ++ L    YP  LL    +          P  +       +  + G   +   L  +D  I S   +      + ++++   N K VHI  +LS          +  ++ +  + G+K + LH I DG+D  P S   ++   + +F    N  I ++ GR +   +  R        D L       H +   E +    EQ  T+      S + +      + D D++   N   D    ++  +  FL+   D F +  R ++  PKL   F++  A  Y   + A     P++    + L   ++    + L +    K   +  F   G+        R ++ SP   +      +S+  + +K ++ I   D   ++C          + D       I+  D  L R+I   +  G    +T+ +G AEKM D+  N  PH  + S+LVP ++
  S:    12 MVLIILDGFGESDETTHNAIKEANTPTLDKLFRH-YPHTLLEASGR------AVGLPDGQMGNSEVGHLHIGGGRKVPQDLTRIDAAIASGEFYENPALIEALEKAKALN-KAVHILGLLSPGGVHSRDNQIAALVELAHRCGIKKIYLHAILDGRDTPPKSALLSIEKITDQFHAYGNGKIASLIGRYYAMDRDKRWDRTEKAYDLLTQGTAQFHALTAKEGLMLAYEQGNTDEFVSPTSIHRHNETPITIEDGDVVVFMNFRADR---ARQLTYAFLD---DHFTAFNRQVR--PKLSA-FVTLTA--YAKDIHAAVAFPPLE--LHNTLGEYLSARGYRQLRIAETEKYAHVTYFLNGGQEAPFNGEDRLLIPSPKVATYDLQPEMSAVEMTNKLVEIIQNDDYDLIVCNFANPDMVGHTGDETATREAIQVIDDCLKRIITALQSVGGEALITADHGNAEKMFDEKTN-QPHTAHTSNLVPLIY 477
>gi|15894000|ref|NP_347349.1| phosphoglyceromutase [Clostridium acetobutylicum ATCC 824] >gi|27734324|sp|Q97L53|GPMI_CLOAB 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|15023592|gb|AAK78689.1|AE007586_6 2,3-bisphosphoglycerate-independent phosphoglycerate mutase gene [Clostridium acetobutylicum ATCC 824] (510 aa)
Score = 115, Expect = 2.1e-03, Identities = 110/491 (22%), Positives = 210/491 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINV-LIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS--KD-DSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP--IYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K  ++ ++ +G G++ K  GN +K A+KPN +   +  YP   L            +   S    ++     ++Y        L  + + I+          NK ++   + +S + H+  +LS      +  +L  ++ +   K   K  +H   DG+D  P S  + + +   ++ +     I TV+GR +   +  R   + E  + Y   + G GE+A   A +  + +  +   D  +LP    + +G  V+  KD DSV+F N  PD    + R +       G     L    +  T+ DA F    V    E++   L   V+      L +    K   +  FF  G    N+N  R ++SSP   +      +S+  + D+ +  +   KYD++ +          +  L+     +ET D+ LG++++        + +T+ +G +E+M+D + N  P    ++  VPFV+ +     KK+     GV + I  T+
  S:     3 KKPVMLMILDGFGISDKVDGNAVKAASKPNFDKYFNN-YPHTHLGASGLSVGLPDGQMGNSEVGHLNIGAGRIVYQS------LTKITKAIEDGDFFKNAALNKAVNNVLENDSTL-HLMGLLSPGGVHSHTNHLKGLLQLAKKKNVKKVFVHAFLDGRDVPPSSAKEFIKDIEDYMNEIGLGEIATVSGRYYAMDRDNR--WEREE-LAYNAMVLGKGEEA-ESAIKAVDASYHDNKTDEFVLPTV-IVKEGKPVATIKDKDSVIFFNFRPDRARQITRAI-AEEAFDGFKRDRLNIEFVTMTEYDASFKGVDVAFGPENITNTLGEYVSNKGLNQLRIAETEKYAHVTFFFNGGVEEPNKNEDRALISSPKVATYDLKPEMSAYEVTDELLKRLDEDKYDMVILNFANPDMVGHTGILEAAKKAVETVDECLGKIVDKVLKLDGSVFITADHGNSEQMID-YSNGKPMTAHTVNPVPFVYVSNHTEAKKLNE---GVLADIAPTM 491
>gi|148259916|ref|YP_001234043.1| phosphoglyceromutase [Acidiphilium cryptum JF-5] >gi|146401597|gb|ABQ30124.1| phosphoglycerate mutase [Acidiphilium cryptum JF-5] (505 aa)
Score = 115, Expect = 2.2e-03, Identities = 79/321 (24%), Positives = 129/321 (40%)
  Q:   150 PV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQA---FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL-------FLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNG 470
           PV +H I DG+D  P S    L+ + +  L +   I TV GR +   +  R     E V   F+    G G  A            E + ++ +   ++  Y  + DG      D +L  N   D    +   +   P   G        F ++L  + Y   L           + + LL  +VA+   + L      K   +  F   G  T  E   R +++SP   +      +S+  L DK + +I  G++D+I +          +  L   +  +ET D  LGR+    R  G  + +T+ +G  E M D      PH   +L  VP + T G
  S:   141 PVFVHAITDGRDTAPESAPDCLA-WLRDALPKGAEIATVIGRYYAMDRDNR----WERVRLAFDLFTEGKGSHADDPVAAVKASHAEGVTDEFVKPVVIGDYEGMRDG------DGLLCANFRADRVREILSAL-LDPGFDGFEHARHIRFAAALGMVTYSDDLAHFMHTLFPPQRMDDLLGEVVARAGKRQLRAAETEKYPHVTYFLNGGRETPFEGEERILVASPKVATYDLQPEMSAPELTDKVVAAIESGRFDLIVLNFANPDMVGHTGSLPAAIKAVETVDAGLGRIEAAIRAQGGAMIVTADHGNCEMMRDPESG-GPHTAHTLNRVPVLLTGG 467
>gi|152993767|ref|YP_001359488.1| phosphoglyceromutase [Sulfurovum sp. NBC37-1] >gi|151425628|dbj|BAF73131.1| phosphoglycerate mutase [Sulfurovum sp. NBC37-1] (494 aa)
Score = 115, Expect = 2.4e-03, Identities = 100/465 (21%), Positives = 186/465 (40%)
  Q:     6 IFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIY---GTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKM-------LIDKTIDSIGKYDVI-FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVP-HNKSSLVPFVFTNG 470
           + ++T+GIG   +   N  + A KP  + L     P+AL+S           +   S    +      +LY +  +K  L L D  I+       +   ++++ S++     VH+  +LS      + ++      +   +G +  LHLI DG+D  P S  + +      +   +  I T+ GR +   +  R     E V   +  I     +       Y +E+ A    D  I P      +GY   K+ D+V+  N   D    +   +   P     F     P++    T+ DA F   PV   K   ++ LA ++++   + L      K   +  F         I  +R ++ SP    D + + +  +M        + K +D   ++ V+ F    M+         +Q    +E  D  LG++I   +  G  + LTS +G  E+M D   +++  H    +  F+  +G
  S:     7 VLIITDGIGYKPQGGCNAFEGAKKPTYDRLFK-TAPYALISTHGLSVGLPEGQMGNSEVGHMTIGSGRVLYQDL-VKISLALEDGSIEEN-----QALKEILETSDR-----VHLIGLLSDGGVHSHIEHTIGFAKLAKHRGKRVFLHLITDGRDVSPTSAKRYIEQIEA-ICDEDISIATIGGRFYTMDRDNR----WERVEKGYCAIAEATPKTTMSPESYVDESYARNETDEFIEP---VAFEGYEGMKEGDAVIVTNFRSDRVREITTALG-DPNFD-TFDRKFIPLHIATMTQYDASF-PYPVLFPKEAPKNTLAEVISRAGLRQLHTAETEKYAHVTFFLNGGIEEPMIGESRVLIPSP----DVKTYDMKPEMSAPQVGEAVRKAMDEAYEFIVVNFANGDMVGHTGNYDAARQ---AVEAVDSELGKIIEKAKEDGYAVVLTSDHGNCEEMCDIEGHVLTNHTVGEVWCFILADG 459
>gi|50083534|ref|YP_045044.1| phosphoglyceromutase [Acinetobacter sp. ADP1] >gi|81613385|sp|Q6FFD5|GPMI_ACIAD 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|49529510|emb|CAG67222.1| phosphoglycerate mutase III, cofactor independent [Acinetobacter sp. ADP1] (515 aa)
Score = 115, Expect = 2.5e-03, Identities = 77/350 (22%), Positives = 136/350 (38%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLK--RNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGL---GEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMK-------TSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVF 467
           VHI  +LS      +  ++  +  + +K+G    LH   DG+D  P S   +L        +      IV++ GR           +D ++  D  E    L    E   T  S      LA    ++D       I D   V   DS++F+N   D    L R          T  ++  L    +   Y   +DA     PV    E+L   +   ++      L +    K   +  FF     +E     R ++ SP   +      +S+  + D+ +++I  G++D++ V          +      +  +E  D  LGR+          + +T+ +G  E+M D     V   + + LVPF++
  S:   116 VHIMGLLSEGGVHSHEDHIVAMCELALKRGATVYLHAFLDGRDTPPKSAQPSLEKLDALFAQYPEQGRIVSMIGRYFA--------MDRDNRWDRVEQAYRLLTESEAVRTAQSAVQGLELAYAAGESDEFVKATRIGDAVAVQDGDSIVFMNFRADRARELTRAFVEHDFSGFTRQRIPHLSKFVMLTRYQATIDA-----PVAYMPEALHNSIGEYLSNLGKTQLRIAETEKYAHVTFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDQLVNAIDSGEFDLLVVNYANGDMVGHTGIFDAAVKAVEAVDTCLGRVYQAVMAKHGHMIITADHGNVEQMQDYQSGQVHTQHTTELVPFIY 472
>gi|121705356|ref|XP_001270941.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Aspergillus clavatus NRRL 1] >gi|119399087|gb|EAW09515.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Aspergillus clavatus NRRL 1] (520 aa)
Score = 114, Expect = 2.7e-03, Identities = 89/405 (21%), Positives = 172/405 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLS--SLAPIYGTKLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K+  L+ ++   K   R+ + N ++ H+  ++S      N  +L  ++ V  +  +  V +H   DG+D  P S  K + +    + +  T  I TV GR +         +D +   D  E      + G GE++ ++  +   E       D  + P      D   V  DD++ F N   D    + +++     SPK    +    S+  +   K D  F   PV    +   ++LA  ++K D     +    K   +  FF      +     R ++ SP   +      +S+  +  K  + I +    FVM           +   +  +  +   D+ +G +   C+  G I+ +TS +G AE+ML++       + ++ VPFV  N  + W  K +   LG V  ++L+ +
  S:    92 IDQTLKNGELNKVDNIVKSFTRAKEGNGRL-HLLGLISDGGVHSNITHLVGLLKVAKEMEIPHVFIHFFGDGRDTDPKSAAKYMQDLLDHMKEIGTGEIATVVGRYYA--------MDRDKRWDRVEVAMKGIVSGEGEES-SDPVKTIKERYEKGENDEFLKPIIVGGKDRR-VQDDDTLFFFNYRSDRVREITQLLGDFDRSPKPDFPYPKNISITTMTQYKTDYTF---PVAFPPQHMGNVLAEWLSKKDISQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVATYDLDPEMSAADVGKKMSERIAEDKFDFVMNNFAPPDMVGHTGVYEAAIKGVTATDKAIGEIYEACKKHGYILFITSDHGNAEEMLNEKGTPKTSHTTNKVPFVLANAPEGWSLKKEEGVLGDVAPTVLAAM 503
>gi|119492039|ref|XP_001263514.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Neosartorya fischeri NRRL 181] >gi|119411674|gb|EAW21617.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Neosartorya fischeri NRRL 181] (520 aa)
Score = 114, Expect = 2.8e-03, Identities = 86/405 (21%), Positives = 176/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMM---KTSPKL-----KGLFLSSLAPIYGTKLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K   L  ++   K   R+ + N ++ H+  ++S      N  +L  ++ V  +  +  + +H   DG+D  P S  K + +      +     I TV GR +         +D +   D  E      +CG GE++ ++  +   E       D  + P    I+ G    V  +D++ F N   D    + +++     SPK      K + ++++      K D  F   PV    +   ++LA  ++K D +   +    K   +  FF      +     R ++ SP   +      +S++ +  K  + I  GK++ I            +   +  +  +   D+ +G +   C+  G ++ +T+ +G AE+ML++       + ++ VPFV  N  + W  K +   LG V  ++L+ +
  S:    92 IDQTLKKGELKKVDNIVKSFTRAKEGNGRL-HLLGLVSDGGVHSNITHLVGLLKVAKEMEIPQIFIHFFGDGRDTDPKSATKYMQDLLDHTKEIGIGEIATVVGRYYA--------MDRDKRWDRVEVAMKGIVCGEGEES-SDPVKTIKERYEKGENDEFLKP---IIVGGKERRVQDNDTLFFFNYRSDRVREITQLLGDYDRSPKPDFPYPKNIHITTMTQY---KTDYTF---PVAFPPQHMGNVLAEWLSKKDIQQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVPTYDHEPEMSAEAVGKKMAERIAEGKFEFIMNNFAPPDMVGHTGVYEAAIKGVAATDKAIGEIYEACKKHGYVLFITADHGNAEEMLNEKGTPKTSHTTNKVPFVLANAPEGWSLKKEEGVLGDVAPTVLAAM 503
>gi|154687528|ref|YP_001422689.1| phosphoglyceromutase [Bacillus amyloliquefaciens FZB42] >gi|166991370|sp|A7Z8Y2|GPMI_BACA2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|154353379|gb|ABS75458.1| Pgm2 [Bacillus amyloliquefaciens FZB42] (511 aa)
Score = 114, Expect = 3.0e-03, Identities = 110/506 (21%), Positives = 213/506 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEH-VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K     ++ +G GL  +  GN +  A KPN                DR  N+Y P +T  +    V     +M   E           +   L  ++  I+       + F   I ++ K N K +H+F +LS      +  +LF ++ +   +GL  V +H   DG+D  P +    +   ++ + +     I +++GR +   +  R D ++  +  M Y E        ++  A +  +++ AN + D  ++P+  T  +G  V+K    DSV+F N  PD            DF    R  +  P  K L+   L   +   +D      PV    ++ +  ++A++  K L +    K   +  F       E     R +++SP   +      +S+  + D  +  I   K+D I +          S  ++  +  IE  D+ LG +++     G    +T+ +G A+ ++ +       + ++ VP + T   +  +  +   LG  +  L  L  ++   ++  TSLI
  S:     3 KKPAALIILDGFGLRNETVGNAVAQAKKPNF---------------DRYWNQY-PHQTLTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAI-KNAKDNDKALHLFGLLSDGGVHSHINHLFALLKLAKSEGLTKVYIHGFLDGRDVGPQTAKTYIQQLNEQVEEIGVGEIASISGRYYSMDRDKRWDRVEKAYRAMAYGEG------PSYRSAMDVVDDSYANGIHDEFVIPSVITKENGEPVAKIHDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDR-GENHP--KNLYFVCLTH-FSESVDGYVAFKPV--NLDNTVGEVLAQHGLKQLRIAETEKYPHVTFFMSGGREEEFPGEERILINSPKVATYDLKPEMSAYEVKDALVKEIAADKHDAIILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAIIAKGGHAIITADHGNADILITETGEPHTAHTTNPVPVIVTKEGVTLR--EGGILGDLAPTLLDLLGVEKPKEMTGTSLI 509
>gi|85094513|ref|XP_959896.1| hypothetical protein NCU02252 [Neurospora crassa OR74A] >gi|28921353|gb|EAA30660.1| hypothetical protein NCU02252 [Neurospora crassa OR74A] >gi|40804637|emb|CAF05897.1| probable phosphoglyceromutase [Neurospora crassa] (519 aa)
Score = 114, Expect = 3.3e-03, Identities = 92/405 (22%), Positives = 172/405 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPI-----VTVAGRNHVFGKKGRDFLDNEHVMDYFE-TICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLS-SLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHK--------KGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ IK   L   E+     +R+   N ++ H+  ++S         +L+ ++    + G+  V +H   DG+D  P    K+ + + + LL     I      TV GR +   +  R     E V    +  I G GE++ T+  +   E       D  + P      D   + +DD+V F N   D    + ++M     SP     F +  L  +   KLD  F       + +++LA  + K   K + +    K         G + K F   T +E+      +    T DK    +S+  + ++ +  +G+ +  FVM           +   +  +      D+ +G+++  C+  G I+ +TS +G AE+M          + ++ VPF+  N  + W  K +   LG V  +IL+ +
  S:    87 IDQTIKKGELSQNEVIKATFERAKNGNGRL-HLCGLVSHGGVHSKQTHLYALLKAAKEAGVPKVFIHFFGDGRDTDP----KSGAGYMQELLDTIKEIGIGELATVVGRYYAMDRDKR----WERVEVALKGMILGEGEES-TDPVKTIKERYEKGENDEFLKPIV-VGGDERRIKEDDTVFFFNYRSDRVRQITQLMGGVDRSPLPDFPFPNIKLVTMTQYKLDYPFDVAFKPQQMDNVLAEWLGKQGVKQVHIAETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVATYDKAP-EMSADGVANQVVKRLGEQEFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILEGCKKEGYILFITSDHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTILAAM 502
>gi|171326693|ref|ZP_02915140.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacillus sp. WCH70] >gi|171087316|gb|EDT33728.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Geobacillus sp. WCH70] (412 aa)
Score = 113, Expect = 3.4e-03, Identities = 76/351 (21%), Positives = 151/351 (43%)
  Q:   118 VHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLA--------RMMKTSPKL-KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           +HIF +LS      +  +L+ ++ +  K+G+K V +H   DG+D  P +  K +    + + +     I T++GR +   +  R     E V   +  +       + +  E   ++  + + D  +LP+     DG  V+    +D+++F N  PD    ++        R     PK  K LF   L     T    V F+       ++ L  +++++  + L +    K   +  F   G         R +++SP   +      +S+  + D  +  I   KYD I +          S  L+  +  IE  D+ LG++++     G I  +T+ +G A+++L         + ++ VP + T
  S:    11 LHIFGLLSDGGVHSHINHLYALLRLAAKEGVKNVYIHGFLDGRDVGPQTAPKYIKELQEKIKEYGVGEIATLSGRYYSMDRDKR----WERVEKAYRAMVYGEGPTYRDPLECIEDSYQHGIYDEFVLPSVIVREDGSPVATIKDEDAIIFYNFRPDRAIQISNTFTNEDFREFDRGPKHPKNLFFVCLTHFSETVKGYVAFK---PTNLDNTLGEVLSQHGLRQLRIAETEKYPHVTFFMNGGREEKFPGEDRILINSPKVATYDLKPEMSAYEVTDALLKEIEADKYDAIILNYANPDMVGHSGKLEPTIKAIEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKPQTAHTTNPVPVIVT 372
>gi|167747910|ref|ZP_02420037.1| hypothetical protein ANACAC_02640 [Anaerostipes caccae DSM 14662] >gi|167652641|gb|EDR96770.1| hypothetical protein ANACAC_02640 [Anaerostipes caccae DSM 14662] (520 aa)
Score = 113, Expect = 3.6e-03, Identities = 102/468 (21%), Positives = 201/468 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDS---NFYEMLYGETDIK---------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTE-ASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM-----KTSPKLKGLFLSSLAPIYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTN 469
           K   + ++ +G GLN K +GN +  AN P ++ L+                     KT P V  +         E   G +++           Y EL  + ++I+       E   + ++   K N   +H   ++S      +  +L+ ++ +  +  ++ V +H   DG+D  P S    +      + +     + TV+GR +   +  R     + V   ++ +  +GE    + A +   ++   +V D  +LP   T  +G     + ++DSV+F N  PD    + R +      +  +  G F ++   +  T+ DA      V   K + ++     +A+   K L L    K   +  FF  G    NE   R ++ SP+  +      +S+  +  K +++I   +YDVI V          +      +  IET D  +GR +   + T   + + + +G AE+++D ++   P    ++  VPF+  N
  S:    10 KKPTVLMILDGYGLNDKKEGNAIAAANTPVMDELM---------------------KTCPFVPGNASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKEIQDGDFFENEALLQAVENCKK-NGSALHAMGLVSDGGVHSHNTHLYGLLELAKRNNIEKVYVHAFLDGRDTAPTSGKGFVEELEAKMKEIGVGKVATVSGRYYAMDRDNR----WDRVEKAYKALV-MGEGVMKDSAVDAIADSYKEEVNDEFVLPTVIT-ENGEPTATIKENDSVIFFNFRPDRAREITRAICDDKFDSFERPNGYFKTTY--VCFTEYDATIPNKLVAFHKVEIKNTFGEFLAEQGLKQLRLAETEKYAHVTFFFNGGVEVPNEGEERILVKSPSVATYDLQPEMSAMEVGSKLVEAIESDQYDVIIVNFANPDMVGHTGICDAAVKAIETVDGCVGRAVEAIKKTDGQMFICADHGNAEQLVD-YVTGAPFTAHTINQVPFILVN 480
>gi|7380854|emb|CAB85498.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Trypanosoma brucei brucei] (550 aa)
Score = 113, Expect = 3.8e-03, Identities = 32/103 (31%), Positives = 56/103 (54%)
  Q:   365 SDKEYFS----LSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML----------DKHLNIVPHNKSSLVPFVF 467
           SD+  F+    + SK + D  +D+I  GKYD+I +  P       + DLK  ++++E  DQ L RL         +  +T+ +G ++ M+          D   N++P    +L P +F
  S:   384 SDRVQFNQKPLMKSKEITDAAVDAIKSGKYDMIRINYPNGDMVGHTGDLKATITSLEAVDQSLQRLKEAVDSVNGVFLITADHGNSDDMVQRDKKGKPVRDAEGNLMPLTSHTLAPVLF 502
>gi|162447265|ref|YP_001620397.1| phosphoglyceromutase [Acholeplasma laidlawii PG-8A] >gi|189042186|sp|A9NF91|GPMI_ACHLI 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|161985372|gb|ABX81021.1| phosphoglyceromutase [Acholeplasma laidlawii PG-8A] (511 aa)
Score = 113, Expect = 3.9e-03, Identities = 93/424 (21%), Positives = 177/424 (41%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL--KPVLHLIADGQD---ERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDN--EHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLS-------SLAPIYGTKLDAVFFENPVKGKE-------ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN-LCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           L  ++  IK  S    + F   +  + K NSK+ HI  ++S         +   + +   ++ +  +  LH+  DG+D   E  Y F K L ++          + TV+GR +   +      DN  + V   F+ +       F  A +    +  + + D  I P    + D   +  DD+V+F N  PD    +A  +      K ++         S AP     +  + ++  VKG         + L   ++ KN  K +      K   +  FF  G+     N TR +  SP   +      +S+  L DK I ++  G+Y  + +          + +++     +E   + +G++ + +    G +  + + +G AE+M D+       + ++LVP V T   +   K+ S  L   +  L  L  ++    +  TSLI+
  S:    79 LSRINVAIKDGSFFKNQAFLDAVAHAKKHNSKL-HIMGLVSDGGVHAQMGHYLALYDFAKQQNILDRTYLHVFTDGRDTPQESGYGFVKTLVDYG-------FNVATVSGRFYAMDR------DNNWDRVQLAFDAMTLGDGPHFNSALDGIESSYKSGIQDEFIKPF--IVNDKGLIENDDAVIFANFRPDRAIRIATALSNPSAAKTIYTEGKPMLNVSKAPKNIFLVSMMHYKETVKGPLAFELQTFDDLYGEVIEKNGFKQIRAAETEKYPHVTFFFDGGKEVPLANSTRILAESPKVPTYDLKPEMSAYELTDKVIAALKTGEYQTMILNFANPDMVGHTGNIEATKKAVEVTVECVGKVTDFIINELGGVAIILADHGNAEQMRDQEGKPHTAHTTNLVPVVVTKKGI---KLNSGALCDVAPTLLDLLGIEKPKAMTGTSLIE 509
>gi|110677738|ref|YP_680745.1| phosphoglyceromutase [Roseobacter denitrificans OCh 114] >gi|123362358|sp|Q16D84|GPMI_ROSDO 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|109453854|gb|ABG30059.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Roseobacter denitrificans OCh 114] (505 aa)
Score = 113, Expect = 4.0e-03, Identities = 106/454 (23%), Positives = 184/454 (40%)
  Q:     9 VTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSL---HNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKF--LLKRNTPIVTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLF-LN-------------SDPD--DFASLARMMKTSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL 462
           + +G GL+++ +GN   LA+ PN++ L++   P A L+       + P    PS +       +  +     +   L  +D  I+         L  F   +  S  T     H+  ++S      +  ++      L  + +  V+H + DG+D  P S    L  F      L     I TV GR     +  R D +       Y   + G G +A   AS+  ++       D  I P   T++ GY  +KD+   F LN              DPD   F + AR     PK   L  ++  +  +   +  ++     K +  + L + VA+   +   L    K   +  F   GE  + +   R +  SP   +      +SSK + D  + +I + YD+I V          + DL+  +   E  DQ LGR++      G  + +T+ +G  + M+D      PH   +L
  S:    11 ILDGWGLSERREGNAPLLADTPNMDRLMATC-PHATLTT------FGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEEGLFAQNSRLRAFIVTLQDSGGT----AHLMGVVSDGGVHGHINHMIAAAKALADENIPVVIHALTDGRDVAPRS---ALGYFETLQAALPDGVEIATVTGRYFAMDRDNRWDRVSKA----YQAIVTGTGRKA-ASASDAVDQAYGQGENDEFISP---TVLGGYTGAKDNDGFFCLNFRADRAREIMAAIGDPDFTAFETGAR-----PKWASLMGMAQYSEAHANYMTTMY----PKPEIVNTLGDWVAQQGLRQYRLAETEKYPHVTFFLNGGEEVSFDGEDRLMPKSPDVATYDLQPEMSSKEVTDAFVAAIEEGYDLIVVNYANPDMVGHTGDLQAAMKACEAVDQGLGRVLAALEKAGGAMIVTADHGNCDVMIDPETG-GPHTAHTL 458
>gi|161830441|ref|YP_001597373.1| phosphoglyceromutase [Coxiella burnetii RSA 331] >gi|189042192|sp|A9N970|GPMI_COXBR 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|161762308|gb|ABX77950.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Coxiella burnetii RSA 331] (519 aa)
Score = 113, Expect = 4.3e-03, Identities = 100/463 (21%), Positives = 188/463 (40%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR--------DFLDNE----HVMDYFETICGLGEQAFTE-----ASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVF 467
           ++ ++ +G G + +   N +K AN P ++ L    YP  LL    +          P  +       +  + G   +   L  +D  I S   +      + ++++   N K VHI  +LS          +  ++ +    G+K + LH I DG+D  P S   ++   + +F    N  I ++ GR +   +  R        D L       H +   E +    EQ  T+      S + +      + D D++   N   D    ++  +  FL+   D F +  R ++  PKL   F++  A  Y   + A     P++    + L   ++    + L +    K   +  F   G+        R ++ SP   +      +S+  + +K ++ I   D   ++C          + D       I+  D  L R+I   +  G    +T+ +G AEKM D+  N  PH  + S+LVP ++
  S:    12 MVLIILDGFGESDETTHNAIKEANTPTLDKLFRH-YPHTLLEASGR------AVGLPDGQMGNSEVGHLHIGGGRKVPQDLTRIDAAIASGEFYENPALIEALEKAKALN-KAVHILGLLSPGGVHSRDNQIAALVELAHHCGIKKIYLHAILDGRDTPPKSALLSIEKITDQFHAYGNGKIASLIGRYYAMDRDKRWDRTEKAYDLLTQGTAQFHALTAKEGLMLAYEQGNTDEFVSPTSIHRHNETPITIEDGDVVVFMNFRADR---ARQLTYAFLD---DHFTAFNRQVR--PKLSA-FVTLTA--YAKDIHAAVAFPPLE--LHNTLGEYLSARGYRQLRIAETEKYAHVTYFLNGGQEAPFNGEDRLLIPSPKVATYDLQPEMSAVEMTNKLVEIIQNDDYDLIVCNFANPDMVGHTGDETATREAIQVIDDCLKRIITALQSVGGEALITADHGNAEKMFDEKTN-QPHTAHTSNLVPLIY 477
>gi|89076377|ref|ZP_01162710.1| phosphoglyceromutase [Photobacterium sp. SKA34] >gi|89047948|gb|EAR53539.1| phosphoglyceromutase [Photobacterium sp. SKA34] (513 aa)
Score = 111, Expect = 6.3e-03, Identities = 77/352 (21%), Positives = 145/352 (41%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA-------DILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL------FLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           K VHI  +LS      +  ++   I +  K+G + + LH   DG+D  P S   +L  F++   +         G+       GR + +D ++  D  E    L   A    +E+T  N  + +  A       + + A     +G     +   DSV+F+N   D    + R  +  P   G        LS    +     D            ++ L   ++K   K L +    K   +  FF  G+    +  +R++++SP   +      +S+  L DK + +I  G++D+I    P       +      +   E  D  LG+++   +     + +T+ +G AE M+D     +    ++L VP ++
  S:   110 KAVHIMGLLSPGGVHSHEDHIASAIEMAAKRGAEKIYLHAFLDGRDTPPRSAKNSLVRFNELFAQ--------LGKGRTASLIGRYYAMDRDNNWDRVEKAYDLISAA---KAEFTVANAVDGLAAAYERNENDEFVKATEVRAEGQEAAIMEDGDSVIFMNYRADRAREITRAFE--PGFTGFERTQRPQLSDFVMLTQYAADIALTTAFKPASLDNTLGEWLSKKGKKQLRISETEKYAHVTFFFNGGKEDEFDGESRQLVASPKVATYDLQPEMSAPELTDKLVAAIKGGEFDMIICNYPNGDMVGHTGVYDAAVKACEALDTCLGKVVAAIKEMDGQLLITADHGNAEMMVDPSTGGIHTAHTNLPVPLIY 471
>gi|94987457|ref|YP_595390.1| phosphoglyceromutase [Lawsonia intracellularis PHE/MN1-00] >gi|166991390|sp|Q1MPK8|GPMI_LAWIP 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|94731706|emb|CAJ55069.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Lawsonia intracellularis PHE/MN1-00] (510 aa)
Score = 111, Expect = 6.4e-03, Identities = 97/446 (21%), Positives = 184/446 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRK---RNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIV-TVAGRNHVFGKKGR--------DFLDNE---HVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVF---FENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           ++ L+ +G GL     GN  KLA  PNI+ +++      + ++ R     + Y+       +        Y+ +            +D  I++K L +  I   L  +   +N ++ H+  +LS      + ++L  ++++  +  ++ +LH   DG+D  P    K +     FL   ++ ++ +  GR +   +  R        D + +    HV D  + +    EQA+  AS  T+E +  +VM      + N + D      +D+VLF N   D    L       P   G     +  + G     ++   F  PV    E++   L  +V+      L +    K   +  FF  G         R ++ SP    D   + L  +M + +  D +       K+ +I            + ++K  +S +E  D  +GR+            LT+ +G  E+MLDK
  S:     6 ILLLILDGYGLAPDSTGNAAKLAFTPNIDRMLAMSGGTQIHASGRAVGLPDGYMGNSEVGHLNIGAGRVVYQQM----------TRIDVAIENKELDSNPILLDLFTKVKSSNGRL-HLLGLLSNGGVHSHIRHLEALLSIAKEHNIQVILHPFMDGRDTGPKDGLKFMKEIVSFLTSTSSGVIGSFCGRFYAMDRDKRWERIKLAWDAIVHGVGLHVEDSVKAL----EQAY--ASGETDEFIKPRVMGNS---SVNCVQD------NDAVLFFNFRADRARELVSAF-ILPDFNGFDRGRVPHLSGIATMTMYDKEFNIPVLFNHENITKTLGEVVSALGLLQLRIAETEKYAHVTYFFSGGREEVFTGEERILVQSP---RDVATYDLKPEMSVMEVTDRLLTAWNSKKFSLIVCNLANPDMVGHTGNIKASISALEAVDNCVGRIEKAVAEQHGCFILTADHGNVEEMLDK 450
>gi|169767532|ref|XP_001818237.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|9955875|dbj|BAB12237.1| phosphoglyceromutase [Aspergillus oryzae] >gi|83766092|dbj|BAE56235.1| unnamed protein product [Aspergillus oryzae] (520 aa)
Score = 111, Expect = 6.7e-03, Identities = 88/405 (21%), Positives = 176/405 (43%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPI-----VTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMM---KTSPKL-----KGLFLSSLAPIYGTKLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K   L+ ++       R+ + N ++ H+  ++S      N  +L  ++ V  +  +  V +H   DG+D  P    K+ + + + LL +   I      TV GR           +D +   D  E      + G GE++ ++  +  NE       D  + P    I+ G    V  DD++ F N   D    + +++     SPK      K + ++++      K D  F   PV    +   ++LA  ++K D +   +    K   +  FF      +     R ++ SP   +      +S++ +  K  D I +    FVM           +   +  +  +   D+ +G +   C+  G ++ +T+ +G AE+ML +       + ++ VPF+  N  + W  K +   LG V  ++L+ +
  S:    92 IDQTLKKGELNKVDNVVASFKRAKEGNGRL-HLLGLVSDGGVHSNITHLIGLLKVAKEMEIPKVFIHFFGDGRDTEP----KSATKYMQQLLDQTKEIGIGEIATVVGRYWA--------MDRDKRWDRVEIAMKGIVSGEGEES-SDPVKTINERYEKDETDEFLKP---IIVGGEERRVKDDDTLFFFNYRSDRVREITQLLGDYDRSPKPDFPYPKNIHITTMTQY---KTDYTF---PVAFPPQHMGNVLAEWLSKKDVQQCHVAETEKYAHVTFFFNGGIEKQFAGEVRDMIPSPKVATYDLDPKMSAEAVGQKMADRIAEGKFEFVMNNFAPPDMVGHTGKYEAAIQGVAATDKAIGVIYEACKKQGYVLFITADHGNAEEMLTEKGTPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLAAM 503
>gi|32475443|ref|NP_868437.1| phosphoglyceromutase [Rhodopirellula baltica SH 1] >gi|50400417|sp|Q7UFG7|GPMI_RHOBA 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|32445984|emb|CAD78715.1| phosphoglycerate mutase [Rhodopirellula baltica SH 1] (543 aa)
Score = 111, Expect = 7.0e-03, Identities = 92/387 (23%), Positives = 166/387 (42%)
  Q:    92 IKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGL---KPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIV-TVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA----DILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMM-------KTSP--------KLKGLFLSSLAPIYGTKLDA-VFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNN--ENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQ 478
           I+  S  +  +    ID   K+  ++ H+  ++S      + ++   VI++  + GL   +  +H I DG+D  P    K +S  +         +V +V GR   F    RD L  E V   +  +     Q F  AS       AN    +    + + A + + +G     V   D+VLF+N   D    + +         K  P        K+  L+ +++   Y T L   V FE P   K  ++L   VA             K   +  FF +  +N  E     +  SP    T D++   +S++ + +K +  I  GK D+I V          +  L+  +  +E  D  +GR+++     G  + +T+ +G  E+M+D      PH   +   VP +  + +   K ++
  S:    97 IRDDSFFSNPVVTGAIDHVKKSGGRL-HLLGLMSDGRVHSDLQHGIAVIDLAKRNGLTGDQLAIHAITDGRDTSPRGGLKFVSQLTDHCEASGVGVVASVIGR---FYAMDRD-LRWERVEAAYNLMTQGTGQTFPSASAAIESYYANPTESSRDGDEFITASSIVPEGGSPITVQPGDAVLFMNYRGDRTREITKAFTFDDAAWKDIPGGGFDRGKKIDNLYFATMTG-YETGLPVKVIFEKP--AKMPNILGEYVASKGLHQFRCAETEKYPHVTFFFNDYRDNPFEEEEWGMAPSPRDVSTYDQKP-EMSAEDITEKVLKQIKSGKCDMIIVNYANGDMVGHTGVLEAAIKAVEKVDACVGRVVDATLAAGGSLVVTADHGNCEQMIDPETG-GPHTAHTTYQVPLIVVDPEFVGKPLR 508
>gi|78224394|ref|YP_386141.1| phosphoglyceromutase [Geobacter metallireducens GS-15] >gi|78195649|gb|ABB33416.1| phosphoglycerate mutase [Geobacter metallireducens GS-15] (512 aa)
Score = 111, Expect = 7.1e-03, Identities = 104/450 (23%), Positives = 190/450 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP-----IYGTKLDAVFFENPVKGKEE--SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSP--ACTSDKE----YFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           M   L+ ++ +G G+N   + N +  A  PN++ L++  YP   +            +   S    ++     ++Y +      L  + + I+        +  + I ++     ++ H+  +LS      +  +L+ ++ +  ++GL  V +H I DG+D  P S    L+     + +     I TV GR     +  R     E V   Y   + G G Q  + A E    + A  V D  + P+   + DG  V +    D  +FLN   D    + R +   P  +G F     P     +  T+ DA F      G EE  ++L +++A    + L +    K   +  FF            R ++ SP    T D++     + ++ ++L  K IDS   YDV+ V          +  L+     +E  D  +GR++   R  G  + +T+ +G AEKM+D+
  S:     1 MTRPLMLMILDGWGINPSAEHNAVAQARTPNLDTLLA-TYPTTEIQTSGMAVGLPDGQMGNSEVGHLNIGAGRVVYQD------LTRITKAIQDGDFFTNPVLLECIAKTKAAGGRL-HLAGLLSDGGVHSHNTHLYALLELARRQGLTDVFIHAILDGRDTPPKSGADYLAQLEAEIARIGVGAIATVMGRYWAMDRDNR----WERVERAYNAMVQGEGVQRASSA-EAIEASYAADVTDEFVEPSV-MVRDGAPVGQLRDGDGFIFLNFRSDRAREITRALAL-PDCEG-FARQARPNLASYVCMTEYDATFGLPIAFGPEELKNILGDVLAHAGIRQLRIAETEKYAHVTFFFNGGVEEPFPLEERCLIPSPKDVATYDQKPEMSAYPVTDELL--KRIDS-DAYDVVIVNFANADMVGHTGILEAAARAVEAVDSCVGRIVAKVREKGGAVIITADHGNAEKMVDE 452
>gi|117926785|ref|YP_867402.1| phosphoglyceromutase [Magnetococcus sp. MC-1] >gi|189042197|sp|A0LDF3|GPMI_MAGSM 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|117610541|gb|ABK45996.1| phosphoglycerate mutase [Magnetococcus sp. MC-1] (518 aa)
Score = 110, Expect = 7.8e-03, Identities = 77/355 (21%), Positives = 146/355 (41%)
  Q:    97 LHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGE-QAFTEASEYTNENLANKVMDADILPAYNTIMDGY---FVSKDDSVLFLNSDPDDFASLARMMKTS----------PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKH 451
           +HN  + + +  R+       VH++ +LS      +   +   +    + G   + +H + DG+D  P S  + ++ F + L K     + TV GR     +  R     E V   +  +  LGE   F  A E        +  D  + PA   +  G     ++  D+++ +N   D    ++ +   +          PKL      +    Y   L  V    P      ++L  ++A++    L      K   +  FF  G+    E   R +++SP   +     ++S+  L D+ I+ I    YD++ V          +   +  +  IET D  LGRL +     G  + +T+ +G A++M+D+ 
  S:    95 MHNQVLLDAI--RAANEAGGAVHLYGLLSPGGVHSHQDQILAAVQCAKQNGASEIYIHALLDGRDTPPQSAMEYMTRFEEGLQKLGAGRVATVCGRYFTMDRDKR----WERVERGYR-LMALGEGTPFDSACEAIQAAYDAQQTDEFVEPAV-MVEQGQPIGMINDGDTLICMNFRADRVREISHVFTDTTFEPFVRDGLPKLSAYVCLTQ---YDVSLQNVQIAYPPVALT-NILGQVMAQHGLTQLRAAETEKYAHVTYFFNGGQEQPGEGEDRLLVASPKVATYDMQPAMSAAELTDRVIEKIQSTPYDLVVVNYANPDMVGHTGVYEAAVQAIETVDTQLGRLTDAIVQMGGEVLITADHGNADQMVDEQ 457
>gi|460258|gb|AAA21680.1| phosphoglycerate mutase (511 aa)
Score = 110, Expect = 8.4e-03, Identities = 111/506 (21%), Positives = 217/506 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLH--NLEIFNKLIDRSN---------KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGR-DFLDNEH-VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K     ++ +G GL  +  GN + LA KPN                DR  N+Y P +T  +    V     E   G +++  +L +   +I  +SL   N+ I     +R+          K N+K +H+F +LS      +  +LF ++ +  K+GL  V +H   DG+D  P +    ++  +  + +     I +++GR +   +  R D ++  +  M Y E        ++  A +  +++ AN + D   +P+  T  +G  V+K    DSV+F N  PD            DF    R       L  + L+     +   +D      P+    ++ +  +++++  K L +    K   +  F   G         R +++SP   +      +S+  + D  +  I   K+D I +          S  ++  +  IE  D+ LG +++     G    +T+  G A+ ++ +       + ++ VP + T   +  +  +   LG  +  L  L  ++   ++  TSLI
  S:     3 KKPAALIILDGFGLRNETVGNAVALAKKPNF---------------DRYWNQY-PHQTLTASGEAV--GLPEGQMGNSEVG-HLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTKVYIHGFLDGRDVGPQTAKTYINQLNDQIKEIGVGEIASISGRYYSMDRDKRWDRVEKAYRAMAYGEG------PSYRSALDVVDDSYANGIYDEFCIPSVITKENGEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGENYPKNLYFVCLTH----FSETVDGYVAFKPI--NLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAEFPGEERILINSPKVATYDLKPEMSAYEVKDALVKEIEADKHDAIILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAMVAKGGHAIITADDGNADILITESGEPHTAHTTNPVPVIVTKEGITLR--EGGILGDLAPTLLDLLGVEKPKEMTGTSLI 509
>gi|26991732|ref|NP_747157.1| phosphoglyceromutase [Pseudomonas putida KT2440] >gi|50400492|sp|Q88CX4|GPMI_PSEPK 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|24986837|gb|AAN70621.1|AE016705_1 2,3-biphosphoglycerate-independent phosphoglycerate mutase [Pseudomonas putida KT2440] (511 aa)
Score = 110, Expect = 8.4e-03, Identities = 74/335 (22%), Positives = 134/335 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENL------ANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLF---LSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           K VHI  +LS      +  +L  +  +  ++G + + LH   DG+D  P S   ++    + F+K    R   I ++ GR +   +  R           ++ +          A+EYT +        A    ++D       I +   V   D+V+F+N   D    L+R     P         L  +A   G    +     P      SL   L   +AKN    L +    K   +  FF  G     E   R ++ SP   +      +S+  + D+ +++I   ++DVI V          +   +  +  +E  D  +GR+++     G    +T+ +G  E+M D+
  S:   111 KAVHILGLLSDGGVHSHQDHLVAMAELAAQRGAEKIYLHAFLDGRDTPPRSAQSSIELLDATFAKLGKGR---IASLIGRYYAMDRDNR-----------WDRVSAAYNLIVDSAAEYTADTALAGLEAAYARDESDEFVKATRIGEAVKVEDGDAVIFMNFRADRARELSRAF-VEPDFTEFARARLPKMAAYIGLTQYSAKIPAPAAFAPSSLNNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFEGEERILIPSPKVATYDLQPEMSAPEVTDRIVEAIEQQRFDVIVVNYANGDMVGHTGVFEAAVKAVEALDTCVGRIVDALDKVGGEALITADHGNVEQMEDE 451
>gi|114769853|ref|ZP_01447463.1| phosphoglyceromutase [alpha proteobacterium HTCC2255] >gi|114549558|gb|EAU52440.1| phosphoglyceromutase [alpha proteobacterium HTCC2255] (514 aa)
Score = 110, Expect = 9.4e-03, Identities = 97/463 (20%), Positives = 185/463 (39%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTY-LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL---------FLSSLAPI---YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K  ++  + +G G +K  +GN + LAN P  + L    YP A L+       + P+   P  +   +S    M  G   I    L  ++  I++ +   L    +  D + K      H+  +LS      +  ++     +L   GLK +LHL  DG+D  P S    L++ +   +  NT I ++ GR +   +  R     E V + +  I  G+G   + +A++       N + D + +P+  +++DG+  +   D +L +N   D    +   +   P  K            LS  A     + T +D +F    +       ++    K           H   F+N       N E   R +  SP+  +  +   +SS+ +    +++I   +YD+I            + DL+  +   E+ D  L  +          + + + +G  E M++      PH   ++ P
  S:    11 KKPVVLCILDGWGTSKDTRGNAVSLANTPCFDNLNEN-YPSATLTT------FGPEVGLPEGQMG-NSEVGHMNIGAGRIVDMDLRKIERSIENNTFSTLPGIIRFAD-AIKAAKGTAHLCGILSDGGVHSHVDHMIKTAKILESLGLKIILHLFGDGRDVAPKSIQTYLNHLNAS-IGVNTTIGSLTGRYYSLDRDNR----WERVAEGYNAIVHGIGTH-YKDANDAILTAYENGLTD-EFIPS--SVIDGFQGIKNGDGLLCMNYRADRAREIMAAIG-DPSFKKFDLGIRPQLSILSGFAEYSEQHNTYMDCIFPNEKIVNTLGEWVSAHGLKQFRIAETEKYPHVTFFMNGGIEAPANLE--VRYLAPSPSVATYDQKPEMSSQEVTQNLVNAINTNEYDLIIANYANPDMVGHTGDLQAAIKACESVDSALIEITQAIHEIDGSMIICADHGNCETMMNVETG-NPHTAHTINP 468
>gi|71747944|ref|XP_823027.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Trypanosoma brucei TREU927] >gi|70832695|gb|EAN78199.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Trypanosoma brucei] (551 aa)
Score = 110, Expect = 9.9e-03, Identities = 34/106 (32%), Positives = 57/106 (53%)
  Q:   365 SDKEYFS----LSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML----------DKHLNIVPHNKSSLVPF-VFTNG 470
           SD+  F+    + SK + D  +D+I  GKYD+I +  P       + DLK  ++++E  DQ L RL         +  +T+ +G ++ M+          D   N++P    +L P  VF  G
  S:   384 SDRVQFNQKPLMKSKEITDAAVDAIKSGKYDMIRINYPNGDMVGHTGDLKATITSLEAVDQSLQRLKEAVDSVNGVFLITADHGNSDDMVQRDKKGKPVRDAEGNLMPLTSHTLAPVPVFIGG 506
>gi|163739558|ref|ZP_02146968.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Phaeobacter gallaeciensis BS107] >gi|161387311|gb|EDQ11670.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Phaeobacter gallaeciensis BS107] (506 aa)
Score = 109, Expect = 1.0e-02, Identities = 89/383 (23%), Positives = 154/383 (40%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFL---LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLF-LNSDPDDFASLARMM----------KTSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNG 470
           +D  I   S  + E     I R  +T     H+  ++S      +  ++   +  +   G+   LH + DG+D  P    K+  +F   L   L     I TV GR +   +  R     E V   ++  I G G+     A++    + A   +D  I     T++DGY   KD   LF LN   D    + R M           T PKL  L  +   +  +   +  VF +  +     + L   VAK   +   L    K   +  F   G+    E   R +  SP   +      +S+  + ++ +++I   YD+I            + DL   +   E  D+ L +++   +  G ++ +T+ +G  E M+D      PH  + ++LVP     G
  S:    83 IDLAIDDGSFFDNEALQGFIARLKETGGA-AHLMGLVSDGGVHGHITHILAAVKAIRDAGVPVWLHAMTDGRDVAP----KSALDFVTALQGDLAEGARIATVTGRYYAMDRDNR----WERVSQAYDAMIHGRGQYEAETAADAIKASYARDELDEFIKA---TVIDGYDGVKDGDGLFCLNFRADRAREILRAMGEPGFDAFDTGTRPKLAALLGMVEYSEGHNGYMQTVFPKRAIV----NTLGAWVAKQGKRQFRLAETEKYPHVTFFLNGGKEDPEEGEDRAMPQSPKVATYDLQPEMSAPEVTERFVEAIEAGYDLIVTNYANPDMVGHTGDLGAAIKACEAVDEGLAKVVAALKAAGGVMLVTADHGNCEVMVDPDTG-GPHTAHTTNLVPVALVGG 469
>gi|167036096|ref|YP_001671327.1| phosphoglyceromutase [Pseudomonas putida GB-1] >gi|189042199|sp|B0KN11|GPMI_PSEPG 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|166862584|gb|ABZ00992.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Pseudomonas putida GB-1] (511 aa)
Score = 109, Expect = 1.0e-02, Identities = 75/335 (22%), Positives = 136/335 (40%)
  Q:   116 KIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNL----SNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNEH--VMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLF---LSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDK 450
           K VHI  +LS      +  +L  +  +  ++G + + LH   DG+D  P S   ++    + F+K    R   I ++ GR +   +  R D +   +  ++D          QA  EA+   +E        +D       I +   V   D+V+F+N   D    L+R     P         L  +A   G    +     P      SL   L   +AKN    L +    K   +  FF  G     E   R ++ SP   +      +++  + D+ +++I   ++DVI V          +   +  +  +E  D  +GR+++     G    +T+ +G  E+M D+
  S:   111 KAVHILGLLSDGGVHSHQDHLVAMAELAAQRGAEKIYLHAFLDGRDTPPRSAQSSIELLDATFAKLGKGR---IASLIGRYYAMDRDNRWDRVSAAYNLIVDSAAEYTADTAQAGLEAAYARDE--------SDEFVKATRIGEAVKVEDGDAVVFMNFRADRARELSRAF-VEPDFTEFARARLPKMAAYIGLTQYSAKIPAPAAFAPSSLNNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFEGEERILIPSPKVATYDLQPEMNAPQVTDRIVEAIEQQRFDVIVVNYANGDMVGHTGVFEAAVKAVEALDTCVGRIVDALEKVGGEALITADHGNVEQMEDE 451
>gi|154149452|ref|YP_001407117.1| phosphoglyceromutase [Campylobacter hominis ATCC BAA-381] >gi|153805461|gb|ABS52468.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter hominis ATCC BAA-381] (487 aa)
Score = 109, Expect = 1.0e-02, Identities = 99/453 (21%), Positives = 168/453 (37%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS--------PKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI--TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLN 453
           MK   I ++T+GIG NK  K N    A KPN +Y+        L ++       +P           +S    M  G   I    L  +D+ I   +L        L+++      K +HI  + S      +  +   +  +    G +   H+I DG+D  P    K+  NF     K+   I T++GR +   +  R     E V   +ETI           SEY  ++   ++ D  I+PA      G  +  +D ++F+N   D    +   +             +K L   +L          V FEN      +  L+ ++A+N+   L      K   +  F G      NI  TR ++ SP   +  E   +S+  + +     I  + D I V          + + +  +  +E  D          RC G I+ +   +  A   +  H N
  S:     1 MKQKCILVITDGIGFNKNNKFNAFANAKKPNFDYMFDNFANSLLKTSGLAVG--LPDGQMG------NSEVGHMTIGAGRILYQNLVKVDKAISDGTLKKNRALIALLEKC-----KTIHIIGLYSDGGVHSHLNHFGAIYKICENYGAQTFAHIITDGRDVSP----KSAVNFVHEAEKK-FKIATISGRFYAMDRDKR----FERVQKAYETIKNGANNVKISPSEYIKKSYEQEITDEFIIPACFGNFGG--IKAEDGIVFINFRNDRAREICAALGAENFNEFDRKECVKNLI--TLTNYDDNFKFPVMFEN---DDIKDTLSEVIARNNLSQLHTAETEKYAHVTFFLGGGKETPNIGETRILIPSPKVKTYDEKPEMSAFEVCEAVKKGIVSREDFIVVNFANGDMVGHTGNYEAAIKAVEAVD----------RCIGEILKVADEHDYAYMQISDHGN 426
>gi|169334487|ref|ZP_02861680.1| hypothetical protein ANASTE_00890 [Anaerofustis stercorihominis DSM 17244] >gi|169259204|gb|EDS73170.1| hypothetical protein ANASTE_00890 [Anaerofustis stercorihominis DSM 17244] (503 aa)
Score = 109, Expect = 1.2e-02, Identities = 94/397 (23%), Positives = 169/397 (42%)
  Q:     3 NTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWA----LLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLS---SLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIA 399
           N ++ ++ +G G ++  +GN +  A+ PN++ L      W     L  N    +  +P+          +S    +  G   +  Y EL  + + I+       E F K ++   K NS + H+  ++S      + ++L+ ++ +  K+GLK V +H   DG+D  P S    +    + + +     I TV+GR +      RD         Y   + G+GE+A   A++    +      D  +LP    + +G  +SK+DSV+F N  PD    + R +       G       +L  +  T  DA F    +  K + +   L   ++ N    L +    K   +  FF      E     R ++ SP   +      +S+  + DK +D+I    YD I   F  C M+ 
  S:     2 NKVLLMILDGYGYSESHEGNAVYSASTPNLDKL------WENNPHLFLNCSGLSVGLPQGQMG------NSEVGHLNLGAGRV-VYQELTRITKSIQDGDFFTNEEFLKAVENVKKNNSAL-HLMGLVSDGGVHSSNEHLYALLELAKKQGLKEVYVHCYMDGRDTPPKSGKGYIEELEEKIKEIGVGKIATVSGRYYAMD---RDTRWERTKKAYDALVYGIGEKA-DSAADAMQASYDADTTDEFVLPT--IVGEGAKISKNDSVIFFNFRPDRARQITRAL-VEADFDGFDREEDLNLTFVTFTNYDASFKNVLIAFKPQVITNTLGEYLSDNGYTQLRIAETEKYAHVTYFFNGGIEKEYKGEDRILVPSPKVATYDLKPEMSAYEVKDKLVDAINNKDYDFIAVNFANCDMVG 398
>gi|148245098|ref|YP_001219792.1| phosphoglyceromutase [Candidatus Vesicomyosocius okutanii HA] >gi|166991467|sp|A5CVF0|GPMI_VESOH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|146326925|dbj|BAF62068.1| phosphoglycerate mutase [Candidatus Vesicomyosocius okutanii HA] (512 aa)
Score = 109, Expect = 1.2e-02, Identities = 104/468 (22%), Positives = 188/468 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSN----KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVF--FENPVKGKEESLLANMVAKNDNKVLVLGLN--------HKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIV-PHNKSSLVPFVFTN 469
           K T + L+ +G G +K  K N + LAN    + L +  +P +L+    K +  +P K       + +     +  G    + +  + +E      L N + F   I R++      N+K +HI  +LS      + + +  ++ +  ++G K V LH+  DG+D    S  K +      + + NT  IV++ GR     +  R        + Y   +   G+  F   S      LA    + D      +I     + K D ++ +N   D    +     T    +G    +  P     L      F  PV     S L N++ K  + + +  L         H   F+N    +  N E   R ++ SP   +      +S+  L D  +++I   KYD+I            S  L   +  +E  D  LG +       G  + +T+ +G AE+M++   N V   + ++ VP +F +
  S:     5 KQTKLLLILDGWGYSKTTKNNAIALANTSVWDRL-NQTFPHSLIHTSGK-DVGLPGKQMG----NSEVGHLNLGAGRIVKQDFTRIYNE------LQNGDFFRNPILRNSLEYANDNNKAIHIMGLLSDGGVHSHEEQIHAMLEMTSRQGCKNVYLHIFTDGRDCAQKSAKKYIKKLESKMKELNTGEIVSLIGRYFSMDRDNR-----WSRIRYAYELIAKGKAKFLAKSALNAIELAYARGETDEFIQSTSIKAPTSIKKGDVLILMNYRADRARQITCAF-TDEDFQGFSRGTFVPTQFVCLTEYKKDFNLPV-AYPSSKLNNVLGKYLSNLGMTQLRIAETEKYAHVTFFLNGGIEQAFNGEE--RVLIPSPDVATYDLQPEMSAFELTDALVENIESQKYDLIICNFANTDMVGHSGKLDATIKAVEAVDTCLGIIYKAMFAIGGEMLITADHGNAEQMINPQTNEVHTAHTNNPVPLIFVS 470
>gi|160369917|gb|ABX38807.1| independent phosphoglycerate mutase isoform 1 [Wuchereria bancrofti] (515 aa)
Score = 109, Expect = 1.3e-02, Identities = 104/464 (22%), Positives = 189/464 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIK---------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIK-KGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTE-ASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP----IYGTKLDAVFFENPVKGKEES---LLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPF 465
           KN +  +V +G G++ + KGN +  A  P ++ L +                     ++P     +     E L G +++           Y ++  ++  +K+K+L   +   +  +R+ K N ++ H+  ++S      +  +LF +I  L + K  K  +    DG+D  P S    L     F+ K     I T+ GR +   +  R     E + + Y   I G+GE+A  + A +      A    D  + P    I+     +KD D+++F +   D    +   M    + K L      P    + G       F  P     ES   +LA  ++ N           K   +  FF      +  N  R ++ SP   +      +SS  + DK I+ +      FVMC          +   +  +  +E  D  +GR+   C+    I+ +T+ +G AEKM+    +    +  +LVPF
  S:     5 KNRVCLVVIDGWGISNESKGNAILNAKTPEMDELCA-------------------MNSHPIQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINLAVKNKTLVENKHLKEAAERAIKGNGRM-HLCGLVSDGGVHSHIDHLFALITSLKQLKVPKLYIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEISTIVGRYYAMDRDKR----WERIRVCYDALIGGVGEKATVDKAIDVIKGRYAKDETDEFLKP---IILSDEGRTKDGDTLIFFDYRADRMREITECMGME-RYKDLNSDIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGLTQFHCAETEKYAHVTFFFNGGVEKQFANEERCLVVSPKVATYDLEPPMSSAAVADKVIEQLHIKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGNAEKMMAPDGSKHTAHTCNLVPF 467
>gi|23015118|ref|ZP_00054904.1| COG0696: Phosphoglyceromutase [Magnetospirillum magnetotacticum MS-1] (520 aa)
Score = 108, Expect = 1.3e-02, Identities = 83/353 (23%), Positives = 145/353 (41%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGR-DFLDNE-HVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGL-------FLSSLAPI-YGTKLDAVFFENPVKGKE--ESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENI----TRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K     +H+  +LS      +  +L  +   +   G+   +H   DG+D  P S    +  F   +   +  + TV+GR +   +  R D +    + M   + + G    A   AS       A+   D  +LPA   ++  Y   KD   L + +   D A        +P   G        F + L    Y   L+A  F   + G E  +++L  ++++   K L +    K   +  FF  N   E +     R ++ SP   +      +S+  + DK I +I  G +DVI V          +  +K  ++  +T D  LGRL    +  G  + +T+ +G AE+M D  +   PH   +  P
  S:   111 KARGGAMHLMGLLSPGGVHSHQDHLAALARTIADAGVTVQVHAFLDGRDTPPSSAKGFMERFLAAVKGHDVHLATVSGRYYAMDRDKRWDRVSLAWNAMVEAKGVAGADPLAAIAAS------YADSKTDEFMLPA---VIGSYAGMKDGDGLLMGNFRADRAREILDCLVNPAFDGFARARQVSFAARLGLTEYSKDLNA--FLGTLFGPETLDNILGEVLSRAGLKQLRIAETEKYAHVTFFF--NGGREMVFPGEERILVPSPKVATYDLQPEMSAAEVTDKLIAAIEGGTFDVIVVNYANGDMVGHTGFMKAAIAAAQTVDACLGRLETAVKTAGGTMLVTADHGNAEQMKDP-VTGEPHTAHTTGP 467
>gi|89069944|ref|ZP_01157277.1| phosphoglyceromutase [Oceanicola granulosus HTCC2516] >gi|89044498|gb|EAR50626.1| phosphoglyceromutase [Oceanicola granulosus HTCC2516] (506 aa)
Score = 108, Expect = 1.3e-02, Identities = 85/352 (24%), Positives = 144/352 (40%)
  Q:   119 HIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTN--ENLANKVMDADILPAYNTIMDGY-FVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVL--GLN-----------HKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNG 470
           H+ +++S      +  +L     +L  +G+  V+H + DG+D  P S    +    + L    T + TV GR +   +  R     E +   +  I  G GE   +EA++     E   +  M  + +PA  T+++GY  + + D +  LN   D    + R +   P+  G   +   P    +L  V + +      ES+      +N     V   GL            H   F+N    E    E+  RK+  SP   +      +S+  + D  + +I   YD+I V          + DL   +   E  D  LGR +      G  I +T+ +G  E M+D      PH   +L  VP +   G
  S:   113 HLLAVVSDGGVHGHIAHLLETARILDAEGVPVVVHAMTDGRDVAPTSGKGFVERLVEELPGSAT-VGTVIGRYYAMDRDER----WERIETAYRAIAEGKGE---SEAADPVAAVEAAYDADMTDEFIPA--TVIEGYDGLREADGLFCLNFRADRAREILRAL-ADPEFDGF--ARETPALAARLGMVDYSSDHNAWYESVFPKKAIRNTLGAWVAAQGLRQFRLAETEKYPHVTFFLNGGKEEPEAGED--RKMPKSPKVATYDLQPVMSAGEVSDAFVGAIEAGYDLIVVNYANPDMVGHTGDLDAAIKACEAVDAGLGRALEALEAAGGAIVVTADHGNCETMVDPETG-GPHTAHTLNPVPVIVVGG 468
>gi|163755701|ref|ZP_02162819.1| phosphoglycerate mutase (2,3-bisphosphoglycerate-independent phosphoglycerate mutase) [Kordia algicida OT-1] >gi|161324222|gb|EDP95553.1| phosphoglycerate mutase (2,3-bisphosphoglycerate-independent phosphoglycerate mutase) [Kordia algicida OT-1] (498 aa)
Score = 108, Expect = 1.3e-02, Identities = 88/392 (22%), Positives = 167/392 (42%)
  Q:    92 IKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE---AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLG 483
           IK+ +L +  +  + +  + K N+K VH   ++S      +  +L  ++N+     ++ V +H   DG+D  P S    +S    F  K N  + T+ GR +   +  R     E V + Y   + G G  + T A+    E+    + D  I P   T  +   ++K   DD V+F N   D    L  ++  K  P+  G+    L  +  T  DA +    V   +E++   L  +++K+  K + +    K   +  FF  G+ T  +   R +  SP   +      +S+  + DK I  + K D  FV C   A       + D    +   E  D+    +I + +       + + +G  + M++   +    + ++ VP +  + D+  K ++   LG
  S:    78 IKNNTLKDEAVLTEALQHA-KDNNKSVHFLGLVSDGGVHSHINHLEGLVNLANNHQVENVFVHAFTDGRDVDPKSGKDFISQTETFCQKANAKLATITGRYYAMDRDKR----WERVQLAYNALVHGKGTLS-TNATASIQESYDADITDEFIKPIVMTDSNNEPIAKIQADDVVIFFNFRTDRGRELTEVLSQKDFPEF-GMKKLPLYYVTLTNYDASYQNVHVVFNKENIKDTLGEVLSKHGKKQIRIAETEKYPHVTFFFNGGQETPFDGEERLLCPSPKVATYDLKPEMSAYDIRDKIIPELEKADTDFV-CLNFANPDMVGHTGDFAAAVKACEVVDECAKAIIEVAQKHDYSTIVIADHGNCDTMINPDGSPNTAHTTNPVPIILVDEDI--KHIKDGVLG 474
>gi|50365319|ref|YP_053744.1| phosphoglyceromutase [Mesoplasma florum L1] >gi|50363875|gb|AAT75860.1| phosphoglycerate mutase [Mesoplasma florum L1] (532 aa)
Score = 108, Expect = 1.4e-02, Identities = 98/469 (20%), Positives = 203/469 (43%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT--PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS--PKL-------------KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF-GENTNNENITRK------------ILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGN-IIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTN 469
           +K  +I  + +G G+ +   GN +  A++  +  ++ G+YPW + ++       +P+        + +     +  G  ++++ L  L+ ++K       E+         + NS + H+  + S      +  ++  +    +K GL  +   LI DG+D  P    + ++   + +   N    I +++GR     +  R   +         T   + +  FT+  EY      N + D  I+PAYN  +    +  +D+++F N  PD    +A +M  +  P               K  F+S++   Y   + + F   P      + L   ++    K L +    K   +  FF G N   +N   K            ++SSP   +      +S+  + DK ++ + K  +D+I   F  C M+     +      +  ++  D+ L R+ +      N ++ +T+ +G AE M+D+       + +SLVP + T+
  S:     3 VKKPVILAILDGWGIEEAGVGNAVANADQKFVKEMM-GMYPW-VKAHASGEWVGLPEGQMG----NSEVGHIHLGAGRINMES-LAKLNHEVKVDGFLTNEVLVDTFKYVKEHNSAL-HLMGLFSDGGVHSHMNHMISMYKAAVKFGLTNIKFDLITDGRDTAPKVAEQYINQLLQVIKDNNNIGEIASISGRYFAMDRDKR--FERSAAAYITMTERKVDQPKFTDPIEYVKAAYENGLDDEMIVPAYNASVVDSELKANDAMIFTNFRPDRAIQMASIMTNNNYPAWNDEAFKDVEFIGDKIRFVSTMK--YADSVTSQFIAYPPTPLTNT-LGEYISSLGLKQLRIAETEKIAHVTFFFDGGNDYFKNGLAKPEEISLPHASIDLISSPKVATYDLKPEMSAVEITDKLLEEVKKDEFDLIVLNFANCDMVGHTGNND---ATVKGVKVLDEQLKRIHDEFVLKHNGVMVITADHGNAEIMIDETGGPNKKHTTSLVPIIVTD 492
>gi|167767889|ref|ZP_02439942.1| hypothetical protein CLOSS21_02430 [Clostridium sp. SS2/1] >gi|167710218|gb|EDS20797.1| hypothetical protein CLOSS21_02430 [Clostridium sp. SS2/1] (518 aa)
Score = 108, Expect = 1.6e-02, Identities = 107/470 (22%), Positives = 201/470 (42%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPI-----VTVAGRNHVFGKKGR-DFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVS---KDDSVLFLNSDPDDFASLARMM-----KTSPKLKGLFLSSLAPIYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNI-VPHNKSSLVPFVFTNGD 471
           K   + ++ +G GLN+  + N +  A  P ++ L+   YP+       K N        P  +   +S    M  G   I  Y EL  + ++I+       E   + I+   K N   +H F +LS      +  +L+ V+ +  + GL+ V +HL  DG+D  P S       F + LL +   I      +++GR +   +  R D +       Y   + G G  A   A +  + +    V D  ++P    + +G  V+   ++DSV+F N  PD    + R +      +  +  G F ++   +  T+ D       V   K + ++     +A++  K L L    K   +  FF  G    NE   R ++ SPA  +      +S+  +  K +++I   KYDVI +          +   +  +  +E  D+ +G  +   +     + + + +G AE++ D         + ++ VPF+  N +
  S:     8 KKPTVLMILDGYGLNENKEANAVAEAKTPVMDKLMKE-YPFV------KGNASGMAVGLPEGQMG-NSEVGHMNMGAGRI-VYQELTRITKEIQDGDFFKNEAMLEAIENCKK-NGSALHCFGLLSDGGVHSHNTHLYGVLEMAKRNGLENVYVHLFLDGRDTAPTSGK----GFIEELLAKMDEIGVGKVASISGRYYAMDRDNRWDRVQKA----YNAIVMGQGNTA-DSAIDAIDASYKEDVTDEFVVPTV-IVENGEPVATLKENDSVIFYNFRPDRAREITRSICDDKFDSFDRPNGYFKTTF--VCFTEYDVTIPNKLVAFHKVEIKNTFGEFLAQHGLKQLRLAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPAVATYDLQPEMSAPEVGAKLVEAIKSDKYDVIIMNFANSDMVGHTGIEEAAIKAVEAVDKCVGDAVEAIKEVNGQMFICADHGNAEQLKDYETGAPFTAHTTNPVPFILVNAE 480
>gi|163741917|ref|ZP_02149306.1| phosphoglyceromutase [Phaeobacter gallaeciensis 2.10] >gi|161384638|gb|EDQ09018.1| phosphoglyceromutase [Phaeobacter gallaeciensis 2.10] (506 aa)
Score = 108, Expect = 1.6e-02, Identities = 86/383 (22%), Positives = 153/383 (39%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLF-LNSDPDDFASLARMM----------KTSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNG 470
           +D  I+  S  + +     I R  +T     H+  ++S      +  ++   +  +   G+   LH + DG+D  P S  + +S      L     I TV GR +   +  R     E V   ++  I G G+     A++    + A   +D  I     T++DGY   KD   LF LN   D    + R M             PKL  L  +   +  +   +  VF +  +     + L   VAK   +   L    K   +  F   G+    E   R +  SP   +      +S+  + ++ +++I   YD+I            + DL   +   E  D+ L +++   +  G ++ +T+ +G  E M+D      PH  + ++LVP     G
  S:    83 IDLAIEDGSFFHNDALQGFIARLKETGGA-AHLMGLVSDGGVHGHVSHIIAAVKAIRDAGIPVWLHAMTDGRDVAPKSALEFVSALQS-KLAEGARIATVTGRYYAMDRDNR----WERVSQAYDAMIHGRGQYQAETAADAIKASYARDELDEFIKA---TVIDGYDGVKDGDGLFCLNFRADRAREILRAMGEPGFDAFDTGARPKLAALLGMVEYSEGHNGYMQTVFPKRAIV----NTLGAWVAKQGKRQFRLAETEKYPHVTFFLNGGKENPEEGEDRAMPQSPKVATYDLQPEMSAPEVTERFVEAIEAGYDLIVTNYANPDMVGHTGDLGAAIKACEAVDEGLAKVVAALKAAGGVMLVTADHGNCEVMVDPDTG-GPHTAHTTNLVPVALVGG 469
>gi|153226568|ref|ZP_01954938.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio cholerae MAK 757] >gi|124117134|gb|EAY35877.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Vibrio cholerae MAK 757] (173 aa)
Score = 107, Expect = 2.0e-02, Identities = 36/130 (27%), Positives = 61/130 (46%)
  Q:   338 GFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           G  N+F GE        R++++SP   +      +SSK L DK + +I  GKYD I    P       +   +  +   E  D+ +GR++   +     + +T+ +G AE M+D     V    +SL VP ++
  S:     8 GVENEFPGEE-------RQLVASPKVATYDLQPEMSSKELTDKLVAAIKSGKYDAIICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKEVDGQLLITADHGNAEMMIDPETGGVHTAHTSLPVPLIY 133
>gi|150003942|ref|YP_001298686.1| phosphoglyceromutase [Bacteroides vulgatus ATCC 8482] >gi|166991373|sp|A6L050|GPMI_BACV8 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|149932366|gb|ABR39064.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacteroides vulgatus ATCC 8482] (504 aa)
Score = 106, Expect = 2.3e-02, Identities = 84/381 (22%), Positives = 155/381 (40%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLK-PVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSP-------KLKGLFLSSLAPIYGTKLDAV--FFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K N K +H   + S      +  +LF + ++  + G++   +H   DG+D  P S    +   +    K    I ++ GR +   +  R     E V + ++ +  G G+QA T+  +   E+    V D  I P  N+ +DG  + + D V+F N   D    L  ++            + GL    + P Y      V   F+   K   ++ L   +A N    L +    K   +  FF  G  T  +   R ++ SP   +      +S+  + DK +++I   K+D I V          +     +   ++  D+ +   +   +     + + + +G A+  L++  +  P+   SL  VPFV+   +   K        V  SIL  L
  S:   104 KENGKNIHFMGLTSNGGVHSSFDHLFKLCDISKEYGIENTFIHCFMDGRDTDPKSGKGFIEQLTAHCEKSAGKIASIVGRFYAMDRDKR----WERVKEAYDLLVEGKGKQA-TDMVQAMQESYDEGVTDEFIKPINNSTVDGT-IKEGDVVIFFNYRNDRAKELTVVLTQQDMPEQGMHTIPGLQFYCMTP-YDASFKGVHILFD---KENVQNTLGEYLAANGKTQLHIAETEKYAHVTFFFNGGRETPYDAEERILVPSPKVATYDLKPEMSAYEVKDKLVEAIKTQKFDFIVVNYANGDMVGHTGIYDAIEKAVKAIDECVKDTVEAAKANDYEVIIIADHGNADHALNE--DGTPNTAHSLNPVPFVYVTENKNAKVENGVLADVAPSILHIL 489
>gi|42561347|ref|NP_975798.1| phosphoglyceromutase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|50400326|sp|Q6MSF0|GPMI_MYCMS 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|42492845|emb|CAE77440.1| phosphoglycerate mutase (2,3-diphosphoglycerate-independent) [Mycoplasma mycoides subsp. mycoides SC str. PG1] (531 aa)
Score = 106, Expect = 2.5e-02, Identities = 115/510 (22%), Positives = 227/510 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERP---YSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKL---------------KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF-GEN-------TNNENITRK------ILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN--LCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDPN 510
           +K  ++  + +G G+++  KGN +  AN   + YL    YPW L ++   +   +P+        + +     +  G  ++++ L  L+ + K+ ++   +   K  +   K NS + H+  + S      +  ++  +    I  G+  +   LI DG+D +P   Y F K+L      L+K+N  I  ++  +  +    RD   +   + Y   +     ++FT   +Y  +       D  I+PA+N       +  +D+++  N  PD    ++ ++     +               K  F+S +   Y   + +     P K    + L   +++   K L +    K   +  FF G N         N+ IT        I S+   T D +   +S+  + DK ++ I K  +D I   F  C M+     +   K      +T D+ L R+    + R  G I+ +T+ +G AE M+DK   +   + +SLVP + T+ ++  K+       V  +IL  ++ ++   ++   S+ID N
  S:     3 VKRPVLLAILDGWGISEPDKGNAVDNANMVFVEYL-KKTYPW-LKAHASGKWVGLPENQMG----NSEVGHIHLGAGRINLES-LAKLNHETKTNNIAKNDEIVKTFEYVKKNNSAL-HLMGLFSNGGVHSHFDHMIAIYKAAIDYGITNIKFDLITDGRDTKPKLAYDFIKDLLE----LIKQNNNIGIISSISGRYYAMDRDKRFDRSRIAYNAIVNRNNVRSFTNILDYIQQEYMINHDDEMIIPAFNQDDLNGNLKANDAIIMTNFRPDRAIQISSILTNKNYIAWQNEAFSDAEFIGDKIRFVSMMK--YSDSVTSPHIAYPPKPLTNT-LGQYLSQLGLKQLRIAETEKIAHVTFFFDGGNDYFKNGLAKNDEITLANAYIDLIPSAKVATYDLKP-QMSAVEITDKLLEEIKKDEFDFIVLNFANCDMVGHTGNN---KATEIACKTLDEQLKRIHEEFVLRHNG-IMVITADHGNAEIMIDKDGQVNKKHTTSLVPIIITDLNIKLKQNDPEIAKVAPTILDLMN-IEIPKEMELESMIDHN 531
>gi|194015425|ref|ZP_03054041.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus pumilus ATCC 7061] >gi|194012829|gb|EDW22395.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Bacillus pumilus ATCC 7061] (511 aa)
Score = 106, Expect = 2.5e-02, Identities = 114/506 (22%), Positives = 204/506 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQAFTEASEYTN------ENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           K     ++ +G GL  +  GN +  A KPN                DR  N++ P +T  +    V     +M   E           +   L  ++  I+       E F + +  + K N K +H+F +LS      + ++LF ++ +  K+GL  V +H   DG+D    +        +K  LK+    +   G   V    GR + +D +   D  E        A+ E   Y N      ++  N + D  ++P+  T  +G  V+K    DSV+F N  PD            DF S  R       L  +  +     +   +D      PV    ++ +  ++A+N  K L +    K   +  F       E     R +++SP   +      +S+  + D  +  I   K+D I +          S  L+  +  IE  D+ LG +++     G    +T+ +G A+ ++ +       + ++ VP + T      +  +   L   S  L  L  L+   ++  TSLI
  S:     3 KKPAALIILDGFGLRGETVGNAVAQAKKPNF---------------DRYWNEF-PHQTLTASGEAVGLPQGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIRDGEFEKNETFLEAMTYA-KENDKALHLFGLLSDGGVHSHIQHLFALLKLAKKEGLTKVYIHGFLDGRDVGQKT--------AKVYLKQLEEQIKEIGVGEVATLSGRYYSMDRDKRWDRVEK--AYRAMAYGEGPSYQNIYDVVDDSYENGIYDEFVIPSVITRENGEPVAKVNDGDSVIFYNFRPDRAIQISNTFTNEDFRSFDRGEAHPKNLHFVCFTH----FSETVDGYVAFKPV--NLDNTVGEVLAQNGLKQLRIAETEKYPHVTFFMSGGREEEFPGEDRILINSPDVATYDLKPEMSAYEVKDALVADINADKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDECLGAVVDAILAKGGHAIITADHGNADVLITEEGKPHTAHTTNPVPVIVTKKGATLR--EGGILADLSPTLLDLLGLEKPKEMTGTSLI 509
>gi|188159110|ref|ZP_02998535.1| phosphoglyceromutase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (531 aa)
Score = 106, Expect = 2.7e-02, Identities = 116/510 (22%), Positives = 221/510 (43%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERP---YSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKL---------------KGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF-GEN-------TNNENITRK------ILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVI---FVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLIN--LCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDPN 510
           +K  ++  + +G G+++  KGN +  AN   + YL    YPW L ++   +   +P         + +     +  G  ++++  +L  E   +    N EI         K N+  +H+  + S      +  ++  +    I  G+  +   LI DG+D +P   Y F K+L      L+K+N  I  ++  +  +    RD   +   + Y         ++FT   +Y  +       D  I+PA+N       +  +D+++  N  PD    ++ ++     +               K  F+S +   Y   + +     P K    + L   ++K   K L +    K   +  FF G N         N+ IT        I S+   T D +   +S+  + DK ++ I K  +D I   F  C M+     +   K      +T D+ L R+    + R  G I+ +T+ +G AE M+DK   +   + +SLVP + T+ ++  K+       V  +IL  ++ ++   ++   S+ID N
  S:     3 VKRPVLLAILDGWGISEPDKGNAVDNANMVFVEYL-KKTYPW-LKAHASGKWVGLPDNQMG----NSEVGHIHLGAGRINLESLAKLNHETKTNNIAKNEEIVKSF--EYVKNNNSALHLMGLFSNGGVHSHFDHMIAIYKAAIDYGITNIKFDLITDGRDTKPKLAYDFVKDLLE----LIKQNNNIGVISSISGRYYAMDRDKRFDRSRIAYNAITNRNNVRSFTNILDYIQQEYMINHDDEMIIPAFNQDDLNGNLKANDAIIMTNFRPDRAIQISSILTNKNYIAWQSEAFSDAEFIGDKIRFVSMMK--YSDSITSPHIAYPPKPLTNT-LGQYLSKLGLKQLRIAETEKIAHVTFFFDGGNDYFKNGLAKNDEITLANAYIDLIPSAKVATYDLKP-QMSAVEITDKLLEEIKKDEFDFIVLNFANCDMVGHTGNN---KATEIACKTLDEQLKRIHEEFVLRHNG-IMIITADHGNAEIMIDKDGQVNKKHTTSLVPIIITDLNIKLKQNDPAIAKVAPTILDLMN-IEIPKEMELESMIDHN 531
>gi|157693806|ref|YP_001488268.1| phosphoglyceromutase [Bacillus pumilus SAFR-032] >gi|166991372|sp|A8FHJ1|GPMI_BACP2 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|157682564|gb|ABV63708.1| phosphoglycerate mutase [Bacillus pumilus SAFR-032] (511 aa)
Score = 106, Expect = 2.7e-02, Identities = 105/467 (22%), Positives = 190/467 (40%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETD---------IKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFETICGLGEQAFTEASEYTN------ENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPD------------DFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFT 468
           K     ++ +G GL  +  GN +  A KPN                DR  N++ P +T  +    V     +M   E           +   L  ++  I+       E F + +  + K N K +H+F +LS      + ++LF ++ +  K+GL  V +H   DG+D    +        +K  LK+    +   G   V    GR + +D +   D  E        A+ E   Y N      ++  N + D  ++P+  T  +G  V+K    DSV+F N  PD            DF S  R       L  +  +     +   +D      PV    ++ +  ++A+N  K L +    K   +  F       E     R +++SP   +      +S+  + D  +  I   K+D I +          S  L+  +  IE  D+ LG +++     G    +T+ +G A+ ++ +       + ++ VP + T
  S:     3 KKPAALIILDGFGLRGETVGNAVAQAKKPNF---------------DRYWNEF-PHQTLTASGEAVGLPQGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIRDGEFEKNETFLEAMTYA-KENDKALHLFGLLSDGGVHSHIQHLFALLKLAKKEGLTKVYIHGFLDGRDVGQKT--------AKVYLKQLEEQIKEIGVGEVATLSGRYYSMDRDKRWDRVEK--AYRAMAYGEGPSYQNIYDVVDDSYENGIYDEFVIPSVITRENGEPVAKVNDGDSVIFYNFRPDRAIQISNTFTNEDFRSFDRGEAHPKNLHFVCFTH----FSETVDGYVAFKPV--NLDNTVGEVLAQNGLKQLRIAETEKYPHVTFFMSGGREEEFPGEDRILINSPDVATYDLKPEMSAYEVKDALVADINADKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDECLGAVVDAILAKGGHAIITADHGNADVLITEEGKPHTAHTTNPVPVIVT 472
>gi|37681504|gb|AAQ97626.1| independent phosphoglycerate mutase isoform 1 [Brugia malayi] (515 aa)
Score = 105, Expect = 3.2e-02, Identities = 106/461 (22%), Positives = 190/461 (41%)
  Q:     2 KNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIK---------TYLEL--LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIK-KGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRN-TPIVTVAGRNHVFGKKGRDFLDNEHV-MDYFETICGLGEQA-FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAP----IYGTKLDAVFFENPVKGKEES---LLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKML----DKHL----NIVPHNKSSL 462
           KN +  +V +G G++ + KGN +  A  P ++ L                       ++P     +     E L G +++           Y ++  ++  +K+K+L   +   +  +R+ K N ++ H+  ++S      +  +LF +I  L + K  K  +    DG+D  P S    L     F+ K     I T+ GR +   +  R     E + + Y   I G+GE+    +A +      A    D  + P    I+     +KD D+++F +   D    +   M    + K L  +   P    + G       F  P     ES   +LA  ++ N           K   +  FF      +  N  R ++ SP   +      +SS  + DK I+ +      FVMC          +   +  +  +E  D  +GR+   C+    I+ +T+ +G AEKM+     KH     N+VP   SS+
  S:     5 KNRVCLVVIDGWGISNETKGNAILNAKTPVMDELCV-------------------MNSHPIQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINLAVKNKTLVENKHLKEAAERAIKGNGRM-HLCGLVSDGGVHSHIDHLFALITALKQLKVPKLYIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEISTIVGRYYAMDRDKR----WERIRVCYDALIGGVGEKTTIDKAIDVIKGRYAKDETDEFLKP---IILSDEGRTKDGDTLIFFDYRADRMREITECMGME-RYKDLNSNIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGLTQFHCAETEKYAHVTFFFNGGVEKQFANEERCLVVSPKVATYDLEPPMSSAAVADKVIEQLHMKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGNAEKMMAPDGSKHTAHTCNLVPFTCSSM 472
>gi|157164042|ref|YP_001467397.1| phosphoglyceromutase [Campylobacter concisus 13826] >gi|112801948|gb|EAT99292.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Campylobacter concisus 13826] (487 aa)
Score = 105, Expect = 3.3e-02, Identities = 105/470 (22%), Positives = 183/470 (38%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDI-KTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLSSLAPIYGTKLDAVF-FENPVKGKE-ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVP-HNKSSLVPFVFTNG 470
           M    I ++T+GIG NK  K N  + A KPN +     I P +L+         +PK          +S    M  G   +    L  +       S+   E    L  +  K     +H+  + S      + ++   +  +  K G +   H I DG+D  P   N  L NF K  L+    + +V GR +   +  R     E V + ++++      +    SEY  ++    V D  + PA      G  + KDD V+ +N   D    +   +   K S   +   + +L  I  T+ DA F FE   K ++ ++ L+ ++A    + L      K   +  FF  G      N TR ++ SP   +  E   +S+  +    +  +  + D I V          + + +  +  +E  D  LG +    +     + +TS +G  E+M D    ++  H    +  FV   G
  S:     1 MAQKTILIITDGIGSNKNGKFNAFEAAKKPNYDKFFKEI-PNSLIKTSGNAVG-LPKGQMG------NSEVGHMCIGSGRVLYQNLVKISRSFDDGSIAENEALKALFKKCKK-----IHVIGLYSDGGVHSHMEHFDGMCELASKNGCEVFAHAITDGRDVSP---NSGL-NFIKS-LEAKFKVASVCGRFYAMDRDKR----WERVKEAYDSLVNGANLSSLTPSEYLQKSYDEGVTDEFVKPASFNGFKG--IGKDDGVIVINFRNDRAREICEALGEEKFSEFERPFAIKNL--ITMTEYDANFKFEVLFKNEKIKNTLSEVIAAAGLRQLHTAETEKYAHVTFFFNGGVEELASNETRVLIPSPKVKTYDEKPEMSAADVCKAVLKGMEDEQDFIVVNFANGDMVGHTGNYEAAVKAVEAVDMALGEIYAKAKEKNYAMIITSDHGNCEEMRDSSGELLTNHTTYDVFCFVMAEG 454
>gi|196191023|gb|EDX85987.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Synechococcus sp. PCC 7335] (537 aa)
Score = 105, Expect = 3.6e-02, Identities = 76/373 (20%), Positives = 158/373 (42%)
  Q:    99 NLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK----------DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV--KGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK--YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           NL++  K+  +   T SK+ H+  + S      +  +L  +I +  ++G++ V +H + DG+D +P      L+     + +     IVT++GR +   +  R           ++ +    E+A+   +E  +    +    A +  +Y   ++  FV             D V+F N  PD    L +      + +G     + P+    +       PV    K +SL   L  +V+ +  K        K   +  FF     +      R+++ SP   +  +   +S+K + D  I ++ K  Y +I +          + +++  ++ +E  D  +GRL++     G    + + +G AE M D+       + ++ VPF+   G+
  S:    97 NLDLL-KVCQKVAYTGSKL-HLIGLCSDGGVHAHLDHLIGLIEMAKRQGVEDVCIHAVTDGRDTKPTDGEFALTKLQDAIDRIGVGKIVTLSGRYYAMDRDNR-----------WDRV----EKAYRVMTENGDRFPEDPSALAALKASYEQGINDEFVEPIRLAPGAIEPGDGVIFFNFRPDRARELTQAF-VMREFRGFERDPILPLSFVTMTQYDPSLPVGVAFKPQSLDNILGQVVSDHGLKQFRTAETEKYAHVTYFFNGGLEDPFPGEDRELVPSPMVATYDKDPKMSAKRVTDVAIAAVDKRKYSLIVINYANPDMVGHTGNMEATITALEAVDTEVGRLVSAVGKAGGTSIIIADHGNAEYMHDEEGRPWTAHTTNPVPFILVEGE 472
>gi|120602560|ref|YP_966960.1| phosphoglyceromutase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120562789|gb|ABM28533.1| phosphoglycerate mutase [Desulfovibrio vulgaris subsp. vulgaris DP4] (511 aa)
Score = 104, Expect = 4.2e-02, Identities = 78/319 (24%), Positives = 132/319 (41%)
  Q:   147 GLKPVLHLIADGQDERPYSFNKNLSNFSKFL-LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQA--------FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS----------PKLKGL-FLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPF 465
           G++ V+H   DG+D  P S    +   + FL   R   I ++ GR +      RD   + +++ +     G G  A           A+  T+E +  +V+  +   A  TI DG      D V F N   D    L+ M              P L G   ++S  P  G  L   F + P+ G     L  +VA    + L +    K   +  F   G         R++L SP    D   + L  +M  +   D++      G Y +       +     +  +   +   ET D  +GR+ +    +G  + +T+ +G AE++LD+  N    +  + VPF
  S:   140 GVEVVVHAFLDGRDTAPTSGVGYVKRLASFLESNRAGRIGSLVGRYYAMD---RDKRWDRNLLAWAMLTRGEGAPADDPVGAVEAAYAAGETDEFVKPRVV-VEGGTAIGTIRDG------DGVFFFNFRADRARQLSHMFVDGTFEHGDRGHVPSLAGFATMTSYDPALG--LPVAFDKQPLDGT----LGEVVANQGLRQLRIAETEKYAHVTYFLNCGREEPFPGEERRLLPSP---RDVATYDLKPEMSAEAVTDTLLEEWAGGGYTLAVCNLANLDMVGHTGVIPAAVRACETVDACVGRIADAVLASGGRLVITADHGNAEELLDESGNPQTAHSMNRVPF 467
>gi|126463353|ref|YP_001044467.1| phosphoglyceromutase [Rhodobacter sphaeroides ATCC 17029] >gi|166991457|sp|A3PMX9|GPMI_RHOS1 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|126105017|gb|ABN77695.1| phosphoglycerate mutase [Rhodobacter sphaeroides ATCC 17029] (506 aa)
Score = 104, Expect = 4.3e-02, Identities = 39/154 (25%), Positives = 70/154 (45%)
  Q:   355 RKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           R + +SP   +      +S+  + D  +++IG  YD+I V          + DLK  ++ +E  D+ LGR +      G  + +T+ +G  E M+D      PH  + ++ VP +  NG     ++ +  L   +  L  L  L    ++   SLID
  S:   351 RYMANSPKVATYDLQPEMSAPDVSDHLVEAIGAGYDLIVVNYANPDMVGHTGDLKAAMAAVEEVDRGLGRAVEAVTTAGGAMIVTADHGNCETMVDPETG-GPHTAHTTNPVPVILVNGPA-GARLHAGRLADLAPTLLQLMQLPQPEEMTGRSLID 505
>gi|162449314|ref|YP_001611681.1| phosphoglyceromutase [Sorangium cellulosum 'So ce 56'] >gi|161159896|emb|CAN91201.1| Phosphoglycerate mutase [Sorangium cellulosum 'So ce 56'] (543 aa)
Score = 103, Expect = 5.0e-02, Identities = 108/465 (23%), Positives = 195/465 (41%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDV----DSNFYEMLYGETDIKTY-LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPA----YNTIMDGYFVSK------------DDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLA----PIYG---------TKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSP--ACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTN 469
           L+  + +G G  ++ + N + LA  PN++ +             R   K +   + P V   V    +S    + +G   I    +  +D  I    L + EI ++    +     + VH+F ++S      +  +   +I +     +  VLH   DG+D  P S    +    + L      I T++GR +   +  R     + VM  +  I          A +   ++ A    D  + P     YN I  G FV+             ++  L +N  PD    ++ M+ T   L    L  L+    P++          T+ DA   + PV   ++ +      ++++     L      K   +  FF  G         RK++ SP    T DK+   +S+  + ++ + +I  GKYD I V          +  L+  +   E  D+ LG + +  R  G  + +T+ +G  E+M D+H N  PH   +L  VP  + N
  S:    15 LVLCILDGFGEREEKEQNAIALAAMPNLDAI------------KRDSEKTLIGTSGPDVGLPVGQMGNSEVGHLNFGAGRIALMDISRIDVAIAENKLGSNEIIDRTFRIAQDRKCR-VHLFGLVSDGGVHSSLDHFLALIKLAKFHEVPLVLHAFLDGRDTPPKSAWGYVEKIEEALQGVGV-IGTISGRYYAMDRDKR----WDRVMKAYTAIVRGDAPRADTAFDAIQQSYAAGKTDEFVEPVRIGDYNGI-KGDFVADFASQEPRWEWQGEEVGLAVNFRPDRMREISAML-TRRNLPAEVLELLSDRGKPVFAFQEHCYSGMTEYDAAL-KLPVAFPKDEVTESFPEVISRAGLTQLRCAETEKYAHVTYFFNGGREETFPGEDRKLVPSPRDVATYDKKP-EMSAAGVANEVVAAIKSGKYDFILVNFANPDMVGHTGILEAAIHANEAVDKGLGAIGDAVREAGGALIITADHGNCEQMKDEHGN--PHTAHTLNPVPLYYLN 500
>gi|166365978|ref|YP_001658251.1| phosphoglyceromutase [Microcystis aeruginosa NIES-843] >gi|189042198|sp|B0JLN5|GPMI_MICAN 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|166088351|dbj|BAG03059.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Microcystis aeruginosa NIES-843] (532 aa)
Score = 103, Expect = 5.3e-02, Identities = 68/320 (21%), Positives = 137/320 (42%)
  Q:   152 LHLIADGQDERPY----SFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASE-YTNENLANKVMD-ADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-------YGTKL--DAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           +H+I DG+D        +  +   + +K  L R   +VT++GR +   +  R +   E   +   +  G+  ++ TE  + + ++N+ ++ +    I P          +   D V+F N  PD    L   + T P  +      ++P+       Y  KL  D  F    +     ++L  ++A+   K        K   +  FF  G     E   R+++ SP   +  +  ++S+  +      +I  G Y ++ V          +  L   +  +ET D  L +L++     G  + +T+ +G AE M+D+  N    + ++ VP +   G+
  S:   149 IHVITDGRDTNVTDGMPAIKRIQEHINKIKLGR---MVTLSGRYYAMDRD-RRWDRVEKAYNVMTSDQGIDGRSITEVLQAFYDQNITDEFIPPTRIAPGA--------IEAGDGVIFYNFRPDRARQLCYAL-TMPDFEDFDRDLISPLSFVTFTQYDPKLPVDVAFAPQNLN----NILGQVIAQQGLKQFRCAETEKYPHVTYFFNGGLEKPFEGEVRELIPSPKVATYDQAPAMSAAAVTTSVCGAIEQGIYSLVVVNYANPDMVGHTGILDAAMKAVETVDLCLAKLLSSVNKLGGTVLITADHGNAETMVDESGNPWTAHTTNPVPLILIEGE 470
>gi|148976889|ref|ZP_01813544.1| phosphoglyceromutase [Vibrionales bacterium SWAT-3] >gi|145963763|gb|EDK29023.1| phosphoglyceromutase [Vibrionales bacterium SWAT-3] (510 aa)
Score = 102, Expect = 6.7e-02, Identities = 79/361 (21%), Positives = 153/361 (42%)
  Q:   107 IDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDN--EHVMDYFETICGLGEQAFT--------EASEYTNENLANKVMDADILPAYN----TIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPV-----KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNENIT--RKILSSPACTSDKEYFSLSSKMLIDKTIDSI--GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL-VPFVF 467
           ID++ K + K VHI  ++S      +  +++  + +  ++G + + LH   DG+D  P S   +L  F     K     + ++ GR +   +      DN  E V   +E +    +  FT        EA+   +EN  ++ + A  + A       I+DG      D+V+F+N   D    + R         G   +    I    L     + P+         E+     ++K     L +    K   +  FF      E     R++++SP   +      +S+  L +K + +I  GKYD I    P       +      +  +E+ D+ LG+++   +     + +T+ +G AE M++     +    ++L VP ++
  S:   102 IDKAVKAD-KAVHIMGLMSPGGVHSHEDHIYAAVEMAAERGAEKIYLHAFLDGRDTPPRSAENSLQRFQDLFAKLGKGRVASLVGRYYAMDR------DNNWERVQTAYELLTE-AKAEFTFDTAVAGLEAAYARDEN--DEFVKATEIKAEGEESAAIVDG------DAVIFMNYRADRARQITRTFVAD--FDGFERNVFPAIDFVMLTQYAADIPLLCAFPPASLENTYGEWLSKQGKTQLRISETEKYAHVTFFFNGGIEEEFEGEERQLVASPKVATYDLQPEMSAPELTEKLVAAIKGGKYDAIVCNFPNCDMVGHTGVYDAAVKAVESLDECLGKVVEAIKEADGQLLITADHGNAEMMVNPETGGIHTAHTNLPVPLIY 470
>gi|75758840|ref|ZP_00738953.1| pBt007 [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74493681|gb|EAO56784.1| pBt007 [Bacillus thuringiensis serovar israelensis ATCC 35646] (563 aa)
Score = 102, Expect = 6.9e-02, Identities = 31/130 (23%), Positives = 65/130 (50%)
  Q:    51 RNKYIPKKTYPSVKRDVDSNFYEMLYGE--TDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVL--HLIADGQDERPYSFNKNLSNFSKFLLKR 180
           R+ + PK TY    R ++S   EM  GE   D+  ++ +L      +    +     +IDR+ K  SK+V+    L       N  + +++++   K+G+ P++  H+ A  +++  + F  + S +S+  +K+
  S:   305 RDPFTPKVTYARKARFIESTLQEMHIGEFTRDMNKFIHVLKNTCHRQIRSVIHSLRDMIDRTEKYPSKLVYTLKKL------LNQTSQYHILDTAAKEGVYPLITQHVPAKQKEQAIFDFGLHFSMYSRRSIKK 432
>gi|77464513|ref|YP_354017.1| phosphoglyceromutase [Rhodobacter sphaeroides 2.4.1] >gi|123591014|sp|Q3IZB8|GPMI_RHOS4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|77388931|gb|ABA80116.1| phosphoglycerate mutase [Rhodobacter sphaeroides 2.4.1] (506 aa)
Score = 102, Expect = 8.2e-02, Identities = 39/154 (25%), Positives = 70/154 (45%)
  Q:   355 RKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPH--NKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLID 508
           R + +SP   +      +S+  + D  +++IG  YD+I V          + DLK  ++ +E  D+ LGR +      G  + +T+ +G  E M+D      PH  + ++ VP +  NG     ++ +  L   +  L  L  L    ++   SLID
  S:   351 RYMANSPKVATYDLQPEMSAPDVSDHLVEAIGAGYDLIVVNYANPDMVGHTGDLKAAMAAVEEVDRGLGRAVEAVTKAGGAMIVTADHGNCETMVDPETG-GPHTAHTTNPVPVILVNGPA-GARLHAGRLADLAPTLLQLMQLPQPEEMTGRSLID 505
>gi|70999946|ref|XP_754690.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Aspergillus fumigatus Af293] >gi|66852327|gb|EAL92652.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Aspergillus fumigatus Af293] >gi|159127699|gb|EDP52814.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Aspergillus fumigatus A1163] (520 aa)
Score = 101, Expect = 8.7e-02, Identities = 87/405 (21%), Positives = 172/405 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG--YFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLSSLAPIYGT--KLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K   L+ ++   K   R+ + N ++ H+  ++S      N  +L  ++ V  +  +  V +H   DG+D  P S  K + +      +     I TV GR +         +D +   D  E      + G GE++ ++  +   E       D  + P    I+ G    V  +D++ F N   D    + +++     SPK    +  ++     T  K D  F   PV    +   ++LA  ++K D +   +    K   +  FF      +     R ++ SP   +      +S++ +  K  + I +    FVM           +   +  +  +   D+ +G +   C+  G I+ +T+ +G AE+ML +       + ++ VPFV  N  + W  K +   LG V  ++L+ +
  S:    92 IDQTLKKGELNKVDNVVKSFTRAKEGNGRL-HLLGLVSDGGVHSNITHLVGLLKVAKEMEIPQVFIHFFGDGRDTDPKSAIKYMQDLLDHTKEIGIGEIATVVGRYYA--------MDRDKRWDRVEVAMKGIVSGEGEES-SDPVKTIKERYEKGENDEFLKP---IIVGGKERRVQDNDTLFFFNYRSDRVREITQLLGDYDRSPKPDFPYPKNIQITTMTQYKTDYTF---PVAFPPQHMGNVLAEWLSKKDIQQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVPTYDHEPEMSAEAVGKKMAERIAEGKFEFVMNNFAPPDMVGHTGVYEAAIKGVAATDKAIGEIYQACKKHGYILFITADHGNAEEMLTEKGTPKTSHTTNKVPFVLANAPEGWSLKKEEGVLGDVAPTVLAAM 503
>gi|170751012|ref|YP_001757272.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Methylobacterium radiotolerans JCM 2831] >gi|170657534|gb|ACB26589.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Methylobacterium radiotolerans JCM 2831] (512 aa)
Score = 101, Expect = 9.1e-02, Identities = 88/391 (22%), Positives = 148/391 (37%)
  Q:   119 HIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFG-KKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKD-DSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---------LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLIDP 509
           H+  +LS      +  +   +   L   G+   LH   DG+D  P S    +++     L +   I T+ GR   FG  + R +   E V   ++ +       F  A +    + A  V D  + PA   I+  Y   +D D +L  N   D    +   +   P   G F  + A  +   L  V +   +    E+L         L   VA+     L +    K   +  F   G           ++ SP   +      +S+  L D+ +++IG  +YD+I +          +  L   +  +ET D  LGR++      G  + +T+ +G  E M D      PH   +L P       +    +    L   +  L  L  LD   ++  TSLI P
  S:   115 HLVGLLSPGGVHAHQDHAVALARALTTAGIPVRLHGFTDGRDMPPRSAAACIADVEA-ALPKGARIATLCGR--YFGMDRDRRW---ERVQRAYDALTEARGTRFERAGQAVAASYAQDVSDEFMQPA---IIGDYAGMRDGDGILSFNFRADRTRQILEAL-LDPAFAG-FERARAVRFAAALGIVQYSVEIDAFAETLFGALDLPNGLGETVARAGRAQLRMAETEKYPHVTYFMNGGREEPFAGQDAVLVPSPKVATYDLQPEMSAPELTDRAVEAIGSGRYDLIILNFANPDMVGHTGSLAAAVKAVETVDTCLGRVVEAVTAQGGALLVTADHGNCEMMRDPETG-EPHTAHTLNPVPAALVGVDGVTLADGRLADVAPTLLDLMGLDQPAEMTGTSLIRP 508
>gi|89889309|ref|ZP_01200820.1| phosphoglyceromutase [Flavobacteria bacterium BBFL7] >gi|89517582|gb|EAS20238.1| phosphoglyceromutase [Flavobacteria bacterium BBFL7] (504 aa)
Score = 101, Expect = 9.4e-02, Identities = 109/507 (21%), Positives = 206/507 (40%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-GLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGY----FVSKDDSVLFLNSDPDDFASLARMMKTSP-KLKGLFLSSLAPIYGTKLD------AVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI---GKYDVIFVMCPMIAE---AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           M    I ++ +G G+ +  K + +  A  P I+ L    YP A L  D +       +   S    ++     ++Y +      L  +++ IK  +L + ++    +  + K NSK VH   +LS      +  +L  +++V     ++ V +H   DG+D  P S   +++N  K +   N  + TV GR     +  R     E V   ++ I  G+G+ +  +A++   E     V D  I P    +++G      V   D ++F N   D    L +M+       +      L  +  TK D       V FE   K   ++ L  ++A      + +    K   +  FF  G+    +   R + +SP   +    + L  +M ID    SI       V   +C   A       +  ++  +   E  DQ    +I         I + + +G  E ML+   ++   + ++ VP +  + DL  K+++   LG  +  +  L  +    ++   SL+
  S:     1 MNKKTILMILDGWGITQDPKVSAIAQAQTPFIDSLYDQ-YPHATLRTDGEHVGLPEGQMGNSEVGHMNLGAGRIVYQD------LAKINKAIKEDTLKDEQVLVDALAFA-KANSKKVHFLGLLSDGGVHAHIDHLKALLDVAESHEIEDVFIHAFTDGRDVDPKSGASHVANLEKHISGTNAQLATVTGRYFAMDRDQR----WERVKKAYDVIVHGMGQPSH-DATDSIKEFYNQGVTDEFIEPI--VVLNGTEPVATVEDGDVIIFFNYRTDRGRELTQMLSQQDYHEQNTHALDLYYVTMTKYDDSYNNVKVIFE---KDNLKNTLGEVLADAGKTQIRIAETEKYPHVTFFFNGGQEKPFKGEQRIMCNSPKVAT----YDLQPEMSIDCVSSSIIPEINRQVADFICLNFANPDMVGHTGSMEAAVKACEAVDQAAHDVITAAMEQDYTIIVIADHGNCEVMLNPDGSVNTAHTTNPVPIILVDKDL--KEVKDGILGDIAPTILKLIGVKQPEEMTQNSLL 504
>gi|126663196|ref|ZP_01734194.1| phosphoglycerate mutase (2,3-bisphosphoglycerate-independent phosphoglycerate mutase) [Flavobacteria bacterium BAL38] >gi|126624854|gb|EAZ95544.1| phosphoglycerate mutase (2,3-bisphosphoglycerate-independent phosphoglycerate mutase) [Flavobacteria bacterium BAL38] (505 aa)
Score = 101, Expect = 9.6e-02, Identities = 71/278 (25%), Positives = 123/278 (44%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLEL--LDEQIKSKSLHNLEIFNKLIDRSN--KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSK---DDSVLFLNSDPDDFASLARMM 278
           M   +I ++ +G G +   K + +  AN P I+ L S  YP A L  D   N  +P+          +S    M  G   I  Y +L  L+  +++K++   +    L+D  N  K N+K +H   ++S      +  +L  +I+V  K+G++ + +H   DG+D  P S  K +S+   +L   N  + +V GR +   +  R     E V   ++ +        T A    N + AN V D  I P      +   +++   DD V+F N   D    L  ++
  S:     1 MNKKVILMILDGWGKSPDPKVSAIDNANTPFIDGLYSK-YPNAQLRTD-GLNVGLPEGQMG------NSEVGHMNLGAGRI-VYQDLAKLNLAVENKTMSQEK---PLMDAFNYAKKNNKAIHFLGLVSDGGVHSHTSHLRGLIDVAQKEGVQNMYVHAFTDGRDVDPKSGVKYISDLENYLQNTNAKLASVIGRYYAMDRDKR----WERVKLAYDLMVNAEGTHSTNAVASINASYANNVTDEFIQPIVMVDENSNPIAQIKNDDVVIFFNFRTDRGRELTEVL 270
>gi|86134561|ref|ZP_01053143.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Tenacibaculum sp. MED152] >gi|85821424|gb|EAQ42571.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Polaribacter dokdonensis MED152] (505 aa)
Score = 101, Expect = 9.8e-02, Identities = 105/507 (20%), Positives = 214/507 (42%)
  Q:     1 MKNTLIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLID--RSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMD-YFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDG---YFVSKDDSVLFLNSDPDDFASLARMMKTSP------KLKGLFLSSLAPIYG---TKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAEA---ARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGDLWPKKMQSNFLGVYSSILSTLDSLDTEHKLFYTSLI 507
           M   +I ++ +G G+ +  K + +  AN P IN L    YP A L  D +       +   S    ++     ++Y        L  +++ ++  +L   ++   L+D  +  K N K VH+  ++S      +  +L  +++V  +  +  V LH   DG+D  P S    +++  +++      + TV GR +   +  R     E V + Y   + G G +  T+      +N  + + D    P   T  DG     + + D+V+F N   D    L   +  +       K   L+ +++  +Y    T ++ ++  + +K     +LAN       K + +    K   +  FF  G+    E  +R + +SP   +      +S+  L D   + + K D  FV C   A       +  ++  +   E  D+    +I+     G    L + +G  E M++   +    + ++ VPF+  + ++  K ++S  LG  +  +  L  ++   ++   SL+
  S:     1 MNKKVILMILDGWGITQDPKVSAIYNANTPYINALYDK-YPHAELRTDGEHVGLPEGQMGNSEVGHMNLGAGRIVYQN------LARINKAVQENTLGQEKV---LLDTFKYAKENHKNVHLLGLVSNGGIHAHINHLKGILDVAKENKVDNVFLHAFTDGRDCDPKSGAYFINDIQEYMANSTGQLATVTGRYYAMDRDNR----WERVSEAYHGVVNGTGTKT-TDVIATIKQNYQDGLTDEFHKPIIVTNEDGTPKTTIKEGDAVIFFNYRTDRGRELTNALSQTDFPEFNMKKLDLYYTTMT-LYDESFTNINVIYNNDNIKNTLGEVLANA----GKKQIRIAETEKYPHVTFFFSGGQEAPFEGESRILRNSPKVATYDLKPEMSAYELKDALCEDLEKGDADFV-CLNFANGDMVGHTGIMEAAIKACEAVDECAKAVIDTGLKNGYTTLLIADHGNCETMMNPDGSPHTAHTTNPVPFILIDDEI--KSIKSGILGDVAPTILELIGVEQPKEMTQKSLL 505
>gi|126733846|ref|ZP_01749593.1| phosphoglyceromutase [Roseobacter sp. CCS2] >gi|126716712|gb|EBA13576.1| phosphoglyceromutase [Roseobacter sp. CCS2] (504 aa)
Score = 101, Expect = 1.0e-01, Identities = 82/315 (26%), Positives = 130/315 (41%)
  Q:   150 PV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTP----IVTVAGRNHVFGKKGRDFLDNEHVMDYFETIC-----GLGEQAFTEASEYT---NENLANKVMDADILPAYNTIM--DGYFV-----SKDDSVLFLNSDPDDFASLARMMKTSPKLKGLFLSSLAPI-YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           PV +H I DG+D  P S    +       L+ N P    IVTV GR           +D ++  D  ET       G G +A T  +      ++   ++ + A ++  Y      DG+F       +   VL   +DPD F   AR   T P L    ++ L  + Y  + DA F     K   ++ L   VAK+D +   L    K   +  F   G  T  +   R +  SP   +      +S   + +  + +I   YD+I            + DL   +   E  D  LG+++      G  + +T+ +G  E M+D      PH   +L P
  S:   142 PVAIHAITDGRDVSPSSAESFMQT-----LEDNLPPQAQIVTVIGRYFA--------MDRDNRWDRVETAYDAMAKGKGRKADTPQAAIKAAYDDGKTDEFIPATVIADYAGFAADDGFFCLNFRSDRAREVLAAIADPD-FDGFAR---TQPSL----VARLGMVTYSDRHDAWFDTVFPKRDIQNTLGAWVAKHDLRQFRLAETEKYPHVTFFLNGGIETPEKGEDRYMPKSPDVATYDLQPEMSCGEVTEHFVKAIENGYDLIVTNYANPDMVGHTGDLDAAIKACEAVDAGLGQVLAALEKAGGAMIVTADHGNCETMIDPETG-GPHTAHTLNP 458
>gi|119195025|ref|XP_001248116.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGM) [Coccidioides immitis RS] >gi|90306902|gb|EAS36533.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGM) [Coccidioides immitis RS] (520 aa)
Score = 100, Expect = 1.4e-01, Identities = 90/405 (22%), Positives = 172/405 (42%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDF-LDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---KTSPKLKGLFLSSLAPIYGT--KLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K   L+ ++      +R+   N ++ H+  ++S      +  +L  ++ V  +  +  V +H   DG+D  P    K+ + + + LL     +    G   +    GR F +D +   D  E      + G GE A  +A +  NE       D  + P      D   V  DD++ F N   D    + +++     SPK    +  ++A    T  K D  F   P+    +   ++LA  ++    K   +    K   +  FF  G     E   R ++ SP   +      +S+  + +K  + I   KYD++            +   +  +  +   D+ +GR+   C+  G I+ +T+ +G AE+M +   +    + ++ VPFV  N  + W  K +   LG V  +IL  +
  S:    92 IDQTLKKGELNKVQSIVNTFNRAKTGNGRL-HLLGLVSDGGVHSHINHLVGLLKVAKEMEIPKVFIHFFGDGRDTDP----KSGAGYMQQLLDSMKEV----GIGELATVVGRYFAMDRDKRWDRIEVAMKGIVLGDGE-ASDDAVKAINERYEKGETDEFLKPIIFG-GDERRVKDDDTLFFFNYRSDRVREITQLLGDYDRSPKPDFPYPKNIAITTMTQYKTDYTF---PIAFPPQHMGNVLAEWLSVKGLKQCHIAETEKYAHVTFFFNGGIEKQFEGEDRDLIPSPRVATYDLDPKMSAAPVGEKMAERIAEKKYDLVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGRIFESCKENGYILFITADHGNAEEMKNGDGSPKTSHTTNKVPFVMANAPEGWSLKEKDGILGDVAPTILDAM 503
>gi|83949908|ref|ZP_00958641.1| phosphoglyceromutase [Roseovarius nubinhibens ISM] >gi|83837807|gb|EAP77103.1| phosphoglyceromutase [Roseovarius nubinhibens ISM] (505 aa)
Score = 99, Expect = 1.6e-01, Identities = 79/353 (22%), Positives = 140/353 (39%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDA------------DILPAYNTIMDGYFVSKDDSVLFLNSDPDD----FASLARM----MKTSPKLKGLFLSSLAPI---YGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLN---HKKGFINKFFGENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVP 464
           K +    H+  +LS      +  ++      L  +GL+  +H   DG+D    S    L    +  L +   I TV+GR +   +  R           ++ +  L   A   A  YT +  ++ + +A             +L  Y+ + DG      D +L LN   D      AS A        T P+ +   +S        +   +D +F   P +  E +L   + AK+  +  +       H   F+N   G         R + +SP   +      +SS  + D  + +I + +D I V          S DL   ++  E  D+ LGR+       G  + +T+ +G  E+M+D  +   PH   +  P
  S:   106 KASGGTAHLLGVLSDGGVHSHITHMIAAAEALTAQGLRVAIHAFTDGRDVAQVSAKTYLEEL-RDALPQGAFIATVSGRYYAMDRDNR-----------WDRV-SLAFDALVNARGYTADTASDAIDNAYDKGRTDEFIKPRVLGDYDGMKDG------DGILCLNFRADRAREILASFADPEFADFDTGPRPQFAIVSGFTEYSRRHTAYMDCIF---PDEAPENTLSQWIAAKSRTQFHIAETEKYPHVTFFLNG--GRERPEPGEERYMAASPKVATYDLAPEMSSGEVTDHLVRAIEQGFDFIVVNYANPDMVGHSGDLDAAIAACEAVDRGLGRVRAAIEAKGGALIVTADHGNCEQMIDP-VTGEPHTAHTTNP 460
>gi|149915325|ref|ZP_01903852.1| phosphoglyceromutase [Roseobacter sp. AzwK-3b] >gi|149810614|gb|EDM70455.1| phosphoglyceromutase [Roseobacter sp. AzwK-3b] (505 aa)
Score = 99, Expect = 1.6e-01, Identities = 100/466 (21%), Positives = 182/466 (39%)
  Q:     5 LIFLVTEGIGLNKKWKGNYLKLANKPNINYLISGIYPWALLSNDRKRNKYIPKKTYPSVKRDVDSNFYEMLYGETDIKTYLELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTP---IVTVAGRNHVFGKKGRDFLDNEHVMDYFET-ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLF-LNSDPDD----FASLAR--MMKTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKE-ESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGK-YDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNG 470
           ++  + +G GL+ + + N   LA+ PN + +I       L+++        P    P+ +       +  +     +   L  +D  I+  S    +     I  + K +    H+  ++S      +  ++      + + G+   LH I DG+D  P    K+   F + L     P   I TV GR     +  R     + V + +E  I   G +A T  +  TN   A    D  + P   T++  Y  ++D   LF LN   D       +LA        P  +  + + L  +  + L   F +     +E  + L   VAK   +   L    K   +  F   G+        R +  SP   +      +S+  + D  + +I + YD+I V          + DL   ++  E  D+ LG++++     G  + +T+ +G  E M+D      PH   +L  VP +   G
  S:     7 VVLCILDGWGLSDRTEANAPVLADTPNFDRMIQTCPHATLITHG-------PDVGLPTGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDGSFFENKSLKAFIG-AMKASGGTAHLMGLVSDGGVHGHLDHILAATRAIAEAGVPVALHAITDGRDVLP----KSARGFLERLESEMAPGVRIATVIGRYFALDRDNR----WDRVQEAYEAMIHAKGARARTARTAVTNA-YARSETDEFVTP---TVIGDYPGAQDGDGLFCLNFRADRAREILCALAEPGFDAFDPGTRPDWAALLGMVEYSDLHNTFMQTVFPAREIVNTLGEWVAKQGKRQFHLAETEKYPHVTFFLNGGKEAPEPGEDRYMAPSPKVATYDLQPEMSAAEVTDHLVAAIAEGYDLIVVNYANPDMVGHTGDLAAAMAACEAVDRGLGQVLDALETHGGAMIVTADHGNCEVMVDPESG-GPHTAHTLNPVPVILVGG 468
>gi|126738348|ref|ZP_01754069.1| phosphoglyceromutase [Roseobacter sp. SK209-2-6] >gi|126720845|gb|EBA17550.1| phosphoglyceromutase [Roseobacter sp. SK209-2-6] (505 aa)
Score = 97, Expect = 2.9e-01, Identities = 78/362 (21%), Positives = 136/362 (37%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMD-YFETICGLGE---QAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMK----------TSPKLKGLF-LSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI-GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLD 449
           +D  I+  S +  E     I +  +T     H+  ++S      +  ++   I  +   G+   LH + DG+D  P S     +  S+  L     I TV GR     +  R     E V + Y   I G G     A        N++ +++ + A ++  Y  + DG      D    LN   D    + R +             P L  L  +   +  + + +   +     K K  + L   VAK       L    K   +  F   G+    E   R +  SP   +      +S+  +  K I++I   YD+I            + DL+  +   E  DQ L +++      G  + +T+ +G  E M+D
  S:    83 IDLAIEDGSFYRNEALQAFIAKLQETGGA-AHLMGLVSDGGVHGHITHILAAIRAITDAGVPVWLHAVTDGRDVAPKSAFGYFAELSE-KLPEGARIATVTGRYFAMDRDNR----WERVSEAYGAMIKGEGRFVRDAHNAVDHAYNQSESDEFISASVIEGYEGLKDG------DGFFCLNFRADRAREILRAIGEPGFAEFDTGKRPALAALLGMVEYSESHSSYMTTAY----PKRKIVNTLGEWVAKQGKTQFRLAETEKYPHVTFFLNGGKEQPEEGEDRFMPKSPKVATYDLQPEMSAPEVTGKFIEAIEAGYDLIVTNYANPDMVGHTGDLQAAIKACEAVDQGLEQVVAALEKAGGAMLVTADHGNCEVMVD 446
>gi|160891433|ref|ZP_02072436.1| hypothetical protein BACUNI_03884 [Bacteroides uniformis ATCC 8492] >gi|156858840|gb|EDO52271.1| hypothetical protein BACUNI_03884 [Bacteroides uniformis ATCC 8492] (504 aa)
Score = 96, Expect = 3.6e-01, Identities = 83/381 (21%), Positives = 151/381 (39%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLK-PVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLA----------RMMKTSPKLKGLFLSSLAPIYGTKLDAV--FFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K N K +H   + S      +  +LF + ++  + G++   +H   DG+D  P S    +   +    K    I ++ GR +   +  R     E V   ++ +     +  T+  +   E+    V D  I P  N   DG  + + D V+F N   D    L           + M+T P   GL    + P Y      V   F+   K   ++ L   +A N    L +    K   +  FF  G  T  +   R ++ SP   +      +S+  + DK +++I   K+D I V          +   + +   ++  D+ +   +   +     + + + +G A+  L++  +  P+   SL  VPFV+   +   K        V  SIL  L
  S:   104 KENGKNIHFMGLTSNGGVHSSFDHLFKLCDISKEYGIENTFIHCFMDGRDTDPKSGKGFIEQLTAHCEKSAGKIASIVGRFYAMDRDKR----WERVKVAYDLLVNGEGKVATDMVQAMQESYDEGVTDEFIKPIVNGGFDGT-IKEGDVVIFFNYRNDRAKELTVVLTQQDMPEQGMQTIP---GLQFYCMTP-YDASFKGVHILFD---KENVQNTLGEYLAANGKTQLHIAETEKYAHVTFFFNGGRETPYDAEERILVPSPKVATYDLKPEMSAYEVKDKLVEAIKTQKFDFIVVNYANGDMVGHTGIYEAIEKAVKAIDECVKDTVEAAKANDYEVIIIADHGNADHALNE--DGTPNTAHSLNPVPFVYVTANKDAKVENGVLADVAPSILHIL 489
>gi|167471017|ref|ZP_02335721.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Yersinia pestis FV-1] (395 aa)
Score = 95, Expect = 4.5e-01, Identities = 32/115 (27%), Positives = 52/115 (45%)
  Q:    85 LELLDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFS-KFLLKRNTPIVTVAGRNHVFGKKGR 199
           L  LD++IK             +D + KT  K VHI  +LS      +  ++  ++ +  K+G   + LH   DG+D  P S   +L  F+ KF    N  I ++ GR +   +  R
  S:    81 LTRLDKEIKEGDFFTNPTLTAAVDNAVKT-GKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAESSLKRFTAKFAELGNGRIASIIGRYYAMDRDNR 196
>gi|46580030|ref|YP_010838.1| phosphoglyceromutase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|50400345|sp|Q72BL6|GPMI_DESVH 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) >gi|46449446|gb|AAS96097.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (511 aa)
Score = 95, Expect = 4.7e-01, Identities = 77/319 (24%), Positives = 130/319 (40%)
  Q:   147 GLKPVLHLIADGQDERPYSFNKNLSNFSKFL-LKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQA--------FTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMMKTS----------PKLKGL-FLSSLAPIYGTKLDAVFFENPVKGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSI------GKYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPF 465
           G++ V+H   DG+D  P S    +   + FL   R   I ++ GR +      RD   + +++ +     G G  A           A+  T+E +  +V+     P   TI DG      D V F N   D    L+ M              P L G   ++S  P  G  L   F + P+ G     L  +VA    + L +    K   +  F   G         R++L SP    D   + L  +M  +   D++      G Y +       +     +  +   +   ET D  + R+ +    +G  + +T+ +G AE++LD+  N    +  + VPF
  S:   140 GVEVVVHAFLDGRDTAPTSGVGYVKRLASFLESNRAGRIGSLVGRYYAMD---RDKRWDRNLLAWAMLTRGEGAPADDPVGAVEAAYAAGETDEFVKPRVVVEGGSPI-GTIRDG------DGVFFFNFRADRARQLSHMFVDGTFEHGDRGHVPSLAGFATMTSYDPALG--LPVAFDKQPLDGT----LGEVVANQGLRQLRIAETEKYAHVTYFLNCGREEPFPGEERRLLPSP---RDVATYDLKPEMSAEAVTDTLLEEWAGGGYTLAVCNVANLDMVGHTGVIPAAVRACETVDACVRRIADAVLASGGRLVITADHGNAEELLDESGNPQTAHSMNRVPF 467
>gi|167764145|ref|ZP_02436272.1| hypothetical protein BACSTE_02528 [Bacteroides stercoris ATCC 43183] >gi|167698261|gb|EDS14840.1| hypothetical protein BACSTE_02528 [Bacteroides stercoris ATCC 43183] (556 aa)
Score = 94, Expect = 6.7e-01, Identities = 78/381 (20%), Positives = 151/381 (39%)
  Q:   112 KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLK-PVLHLIADGQDERPYSFNKNLSNFSKFLLKRNTPIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPIYGTKLDAVFFENPV---KGKEESLLANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIG--KYDVIFVMCPMIAEAARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSL--VPFVFTNGDLWPKKMQSNFLGVYSSILSTL 492
           K + K +H   + S      +  +LF + ++  + G++   +H   DG+D  P S    +   +    K    I ++ GR +   +  R     E V   ++ +     +  ++ ++   E+    V D  I P  N   DG  + + D V+F N   D    L  ++  +  P+     +  L     T  DA F    +   K   ++ L   +A N    L +    K   +  FF  G  T  +   R ++ SP   +      +S+  + DK +++I   K+D I V          +   + +   ++  D+ +   +   +     + + + +G A+  L++  +  P+   SL  VPFV+   +   K        V  SIL  L
  S:   155 KEHGKNIHFMGLTSNGGVHSSFDHLFKLCDISKEYGIENTFIHCFMDGRDTDPKSGKGFIEQLTAHCEKSAGKIASIVGRFYAMDRDKR----WERVKVAYDLLVNGEGKVASDMAQAMQESYDEGVTDEFIKPIVNANFDGT-IKEGDVVIFFNYRNDRAKELTIVLTQQDMPEQGMHTIPGLQYYCMTPYDASFKGVHILFDKENVQNTLGEYLAANGKTQLHIAETEKYAHVTFFFNGGRETPYDAEERILVPSPKVATYDLKPEMSAYEVKDKLVEAINTKKFDFIVVNYANGDMVGHTGIYEAIEKAVKAIDECVKDTVEAAKANDYEVIIIADHGNADHALNE--DGTPNTAHSLNPVPFVYVTANKNAKVENGVLADVAPSILHIL 540
>gi|67525203|ref|XP_660663.1| hypothetical protein AN3059.2 [Aspergillus nidulans FGSC A4] >gi|40744454|gb|EAA63630.1| hypothetical protein AN3059.2 [Aspergillus nidulans FGSC A4] (520 aa)
Score = 93, Expect = 8.5e-01, Identities = 84/405 (20%), Positives = 168/405 (41%)
  Q:    88 LDEQIKSKSLHNLEIFNKLIDRSNKTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFET-----ICGLGEQAFTEASEYTNENLANKVMDADILPAYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM---KTSPKL-----KGLFLSSLAPIYGTKLDAVFFENPVKGKEE---SLLANMVAKNDNKVLVLGLNHKKGFINKFFGENTNNE--NITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNG-DLWPKKMQSNFLG-VYSSILSTL 492
           +D+ +K   L+ +E       R+   N ++ H+  ++S      N  +L  ++ V  +  +  V +H   DG+D  P S  K +        +     I TV GR +         +D +   D  E      + G GE++ ++  +   +       D  + P      D   V  DD++ F N   D    + +++     SPK      K + ++++      K D  F   PV    +   ++LA  + K D +   +    K   +  FF      +     R ++ SP   +      +S++ +  K  + I +    FVM           +   +  +  +   D+ +G +   C+  G  + +T+ +G AE+ML++       + ++ VPF+  N  + W  + Q   LG V  ++L+ +
  S:    92 IDQTLKKGELNKVENIAASFKRAKDGNGRL-HLLGLVSDGGVHSNITHLIGLLKVAKEMEIPQVFIHFFGDGRDTDPKSAAKYMQQLLDATKEIGVGEIATVVGRYYA--------MDRDKRWDRVEIAIKGILSGEGEES-SDPVKAIEKRYTEDETDEFLKPIIFGGKDRR-VQDDDTLFFFNYRSDRVREITQLLGDYDRSPKPDLPYPKNIHITTMTQY---KTDYTF---PVAFPPQHMGNVLAEWLGKKDVQQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVATYDLEPEMSAEGVGKKVEERIAEGKFEFVMNNFAPPDMVGHTGVYEAAIKGVAATDKAIGIIYEACKKHGYTLFITADHGNAEEMLNEKGTPKTSHTTNRVPFIMANAPEGWSLRKQPGVLGDVAPTVLAAM 503
>gi|71987956|ref|NP_001022132.1| F32A11.7 [Caenorhabditis elegans] >gi|33300171|emb|CAE17802.1| Hypothetical protein F32A11.7 [Caenorhabditis elegans] (657 aa)
Score = 93, Expect = 9.2e-01, Identities = 32/113 (28%), Positives = 54/113 (47%)
  Q:   643 VRND-EWINSIKFDLLESSKRTFDVDKNEKFSTRVYNEMIPFLFFEKIRKSEVEILKTNDAVSIAQ-FYELIKEEVRDIFEQYILDKLPVESEDATDEVVEEEKSPEQIATEKAV 755
           +R D EWI S KF     +KR   V   + ++ +   EM PF    +   S V++LK  D VS  Q   E I ++  +I EQ  ++    +      +  E+ K  ++IA + ++
  S:   102 IREDKEWIGSFKF----RAKREIRVHTRDSYTLKAEKEMTPFGLVTRHLSSAVKLLKKTDKVSKWQDTIERITKKAEEIKEQKKMEDFMQKRMSIYADAAEKMKQNKKIAKDDSL 212
>gi|78779911|ref|YP_398023.1| phosphoglyceromutase [Prochlorococcus marinus str. MIT 9312] >gi|78713410|gb|ABB50587.1| phosphoglycerate mutase [Prochlorococcus marinus str. MIT 9312] (540 aa)
Score = 92, Expect = 9.9e-01, Identities = 85/374 (22%), Positives = 154/374 (41%)
  Q:    98 HNLEIFNKLIDRSN--KTNSKIVHIFSMLSFNENKFNAKNLFYVINVLIKKGLKPV-LHLIADGQDERPYSFNKNLSNFSKFLLKRNT-PIVTVAGRNHVFGKKGRDFLDNEHVMDYFETICGLGEQAFTEASEYTNENLANKVMDADILP---AYNTIMDGYFVSKDDSVLFLNSDPDDFASLARMM--KTSPKLKGLFLSSLAPIYGTKLDAVFFENPVKGKEESL---LANMVAKNDNKVLVLGLNHKKGFINKFF--GENTNNENITRKILSSPACTSDKEYFSLSSKMLIDKTIDSIGKYDVIFVMCPMIAE--AARSSDLKQLLSTIETFDQHLGRLINLCRCTGNIIALTSAYGAAEKMLDKHLNIVPHNKSSLVPFVFTNGD 471
           + L I N+L + ++  K N   +HI  + S      +  +L  +I      G+K V +H+I DG+D    S +K L+     + K +T  I ++ GR  +     R+ L +     Y        + +     +Y  ++    + D  I P   + N + DG      DS++  N  PD    + + +  K     K   + +L  +  T+ D  F    V    ESL   +  +V++N  K        K   +  FF  G         R ++ SP   +      +S++ L      +I   D  FV+           + ++   +  IET D+ +G+++N     G  I +T+ +G AE M          +  + VP +F  G+
  S:   102 NQLCIVNELKEMADSLKRNKSTLHITGLCSDGGVHSHIDHLLGLIKWASDNGIKKVAIHIITDGRDTPAKSASKYLNQIESCIKKFDTGEIASICGRYWIMD---RNLLWDRTEKAYANLTDPDIKVSNISPQDYIKQSYDKNITDEFIEPIRISENYLKDG------DSLICFNFRPDRARQIIKSLSEKKFSDFKRKVVPNLDLVTFTQYDQNF-SVKVAFPPESLNNFIGQIVSENGLKQYRTAETEKYPHVTYFFNGGVEIPLPGEERHLIPSPRVATYDMEPEMSAEELTISCSKAIKSGDYAFVVINFANPDMVGHTGNMNATIKAIETVDKCIGQIVNATGEMGGSILITADHGNAEVMKGPAGEPWTAHTINKVPLIFIEGE 481