>gi|26553653|ref|NP_757587.1| formamidopyrimidine-DNA glycosylase [Mycoplasma penetrans HF-2] >gi|26453659|dbj|BAC43991.1| formamidopyrimidine-DNA glycosylase [Mycoplasma penetrans HF-2] (277 aa)
Score = 1295, Expect = 5.6e-141, Identities = 276/277 (99%), Positives = 277/277 (100%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK
  S:     1 MPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
>gi|31544438|ref|NP_853016.1| formamidopyrimidine-DNA glycosylase [Mycoplasma gallisepticum R] >gi|31541283|gb|AAP56584.1| Nei [Mycoplasma gallisepticum R] (275 aa)
Score = 682, Expect = 6.4e-70, Identities = 143/275 (52%), Positives = 195/275 (70%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEVQ+VI+ LK +  +N+ I N+     K+ KN + ++F  +++NE   DI R GKY+IF L+N+KV V HLRMEGK    +  + YD++HVLV+  +DD+E+ YHDTRRFGTF I++  +Y D   +KKL +DP ++E+DWKYLKNN +KS+R IK+ LLDQ  V+GIGNIYADEILF S I+P   AN+LTD  FK+I++N+  +L KA+E  GTTI +Y FK+   G +Q +L VH +KD  C  C N + K K+N RGTY C KCQK
  S:     2 MPELPEVQTVINYLKTK-IINQKINNVIVSALKVLKNATAKEFKKFLVNEHFVDIKRIGKYIIFILSNNKVLVSHLRMEGKYKISQFKAKYDERHVLVRFILDDFELHYHDTRRFGTFHIHSVLDYQDQDYLKKLAIDPTQQEWDWKYLKNNAQKSSRVIKSVLLDQSVVAGIGNIYADEILFLSKINPAKKANELTDQQFKEISKNATKVLLKAIELNGTTIFSYQFKENHAGSYQDYLNVHLQKDKPCKVCGNLVKKTKLNNRGTYYCAKCQK 275
>gi|13508119|ref|NP_110068.1| formamidopyrimidine-DNA glycosylase [Mycoplasma pneumoniae M129] >gi|2494594|sp|P75402|FPG_MYCPN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|1674146|gb|AAB96105.1| formamidopyrimidine-DNA glycosylase [Mycoplasma pneumoniae M129] (277 aa)
Score = 643, Expect = 2.3e-65, Identities = 135/277 (48%), Positives = 187/277 (67%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV +VI  LK    LN+ +  ++  + K+ KN + +     ++N    DI R+GKY+IF L+N    V HLRMEGK FFE   S +D  HVLV+    D  ++ YHDTR+FGTF ++N   + +++E+ KL LDPL++EF+ + + N   KSN+ IKT +LDQ N+SGIGNIYADEILFAS IHPET+A  L  + ++ I +N+  IL KAVE KGTTI T+ FKK+  G +Q FLK+H KK   C +C   I+K K+NGRG+Y+C KCQ ++
  S:     1 MPELPEVATVITELK-SCVLNKPVKQVKVHLDKVLKNTNVKQLNDALVNHSFVDIKRRGKYIIFCLSNGLFLVSHLRMEGKYFFEAKGSQFDLNHVLVEFLFQDGDQLNYHDTRQFGTFHLFNRYQFENARELNKLALDPLDQEFNHQAIFNKGHKSNKKIKTFILDQTNISGIGNIYADEILFASKIHPETLAKNLNLSQYQLICQNATDILKKAVEMKGTTIGTFTFKKDHTGGYQHFLKIHGKKGKQCQSCNTTIIKKKINGRGSYICEKCQIQR 277
>gi|188524384|ref|ZP_03004411.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530943|ref|ZP_03005212.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195660050|gb|EDX53430.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (277 aa)
Score = 633, Expect = 3.6e-64, Identities = 139/277 (50%), Positives = 188/277 (67%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEVQ+++D L     LN  I  +   +PKI KN +  +F + ++N +I +I R GKYL+F L N+ V  VHLRMEGK +++  D  ++  H  + IE ++  ++RY+DTR+FGTF IY + ++LDSKE+KK+ LDPL+  F  +YL   +KKSN+AIKT LLDQ NVSGIGNIYADEILFA+ I P T+A  LT  D++ IA+ ++ IL  +++NKGTTI TY F  ++ G FQK L VHT     C  C   I K KVNGRGTY C  CQ +K
  S:     1 MPELPEVQTIVDYLNLNV-LNLLIKKVIVHLPKILKNKTPAEFENLLVNHKITNIKRLGKYLLFFLDNNLVLSVHLRMEGKFYYQPKDEWFNLAHTHIIIEFENGMQLRYNDTRQFGTFHIYEQESFLDSKELKKIALDPLDANFTPQYLYEKLKKSNKAIKTALLDQSNVSGIGNIYADEILFATKIFPTTLAKDLTIKDYENIAKEAKRILLLSIQNKGTTIHTYKFGNDETGMFQKMLLVHTHAKKPCQTCGTIIRKTKVNGRGTYYCSNCQNQK 277
>gi|171920859|ref|ZP_02932023.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178962|ref|ZP_02964719.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024108|ref|ZP_02996848.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039560|ref|ZP_02998283.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 8] >gi|188518256|ref|ZP_03003784.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188569178|ref|ZP_03005701.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 2] >gi|188592818|ref|ZP_03006086.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 10] >gi|195867830|ref|ZP_03079830.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903064|gb|EDT49353.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209239|gb|EDU06282.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019158|gb|EDU57198.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998107|gb|EDU67204.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660527|gb|EDX53784.1| formamidopyrimidine-DNA glycosylase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (277 aa)
Score = 633, Expect = 3.8e-64, Identities = 139/277 (50%), Positives = 188/277 (67%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEVQ+++D L     LN  I  +   +PKI KN +  +F + ++N +I +I R GKYL+F L N+ V  VHLRMEGK +++  D  ++  H  + IE ++  ++RY+DTR+FGTF IY + ++LDSKE+KK+ LDPL+  F  +YL   +KKSN+AIKT LLDQ NVSGIGNIYADEILFA+ I P T+A  LT  D++ IA+ ++ IL  +++NKGTTI TY F  ++ G FQK L VHT     C  C   I K KVNGRGTY C  CQ +K
  S:     1 MPELPEVQTIVDYLNLNV-LNLLIKKVIVHLPKILKNKTPAEFENLLVNHKITNIKRLGKYLLFFLDNNLVLSVHLRMEGKFYYQPKDEWFNLAHTHIIIEFENGMQLRYNDTRQFGTFHIYEQESFLDSKELKKIALDPLDANFTPQYLYEKLKKSNKAIKTALLDQSNVSGIGNIYADEILFATKIFPTTLAKDLTIKDYENIAKEAKRILLLSIQNKGTTIHTYKFGNDETGMFQKMLLVHTHAKKPCQTCGTIIQKTKVNGRGTYYCSNCQNQK 277
>gi|171920356|ref|ZP_02931689.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902783|gb|EDT49072.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 1 str. ATCC 27813] (275 aa)
Score = 616, Expect = 3.3e-62, Identities = 135/274 (49%), Positives = 182/274 (66%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEVQ+++D L     L+  I      +PKI KN + ++F   +IN +I  I R GKYL+F L+N+ V  VHLRMEGK +++  +  ++  H  + IE ++  ++RY+DTR+FGTF IY + ++LDSKE+KK+ LDPL+  F  +YL    KKSN+AIKT LLDQ  VSGIGNIYADEILFA+ I P  +A  LT  D++KI + ++ IL  +++NKGTTI TY F  ++ G FQK L VHT     C  C   I K KVNGRGTY C  CQ
  S:     1 MPELPEVQTIVDYLNHH-VLDIFIKKTIVHLPKILKNKTPQEFEKLLINHKIVKIKRLGKYLLFFLSNNLVLSVHLRMEGKFYYQAKEEWFNLAHTHIIIEFNNGMQLRYNDTRQFGTFHIYQQQSFLDSKELKKIALDPLDNNFSAQYLYEKFKKSNKAIKTALLDQSVVSGIGNIYADEILFAAKIFPTILAKNLTLKDYEKITKEAQRILLLSIKNKGTTIHTYKFGNDETGLFQKMLLVHTHAKEPCQICGTIIQKTKVNGRGTYYCPNCQ 274
>gi|186701833|ref|ZP_02971501.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701121|gb|EDU19403.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 6 str. ATCC 27818] (275 aa)
Score = 613, Expect = 6.7e-62, Identities = 134/274 (48%), Positives = 183/274 (66%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEVQ+++D L     L+  I      +PKI KN + ++F   +IN +I  I R GKYL+F L+N+ V  VHLRMEGK +++  +  ++  H  + IE ++  ++RY+DTR+FGTF IY + ++LDSKE+KK+ LDPL+  F  +YL   +KKSN+AIKT LLDQ  VSGIGNIYADEILFA+ I P  +A  LT  +++KI + ++ IL  +++NKGTTI TY F  ++ G FQK L VHT     C  C   I K KVNGRGTY C  CQ
  S:     1 MPELPEVQTIVDYLNHH-VLDIFIKKTIVHLPKILKNKTPQEFEKLLINHKIVKIKRLGKYLLFFLSNNLVLSVHLRMEGKFYYQAKEEWFNLAHTHIIIEFNNGMQLRYNDTRQFGTFHIYQQQSFLDSKELKKIALDPLDNNFSAQYLYEKLKKSNKAIKTALLDQSVVSGIGNIYADEILFAAKIFPTILAKNLTLKNYEKITKEAQRILLLSIKNKGTTIHTYKFGNDETGLFQKMLLVHTHAKEPCQICGTIIQKTKVNGRGTYYCPNCQ 274
>gi|13357975|ref|NP_078249.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762015|ref|YP_001752497.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508489|ref|ZP_02958019.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|24211711|sp|Q9PQ76|FPG_UREPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|11264463|pir||B82895 formamidopyrimidine-DNA glycosylase UU413 [imported] - Ureaplasma urealyticum >gi|6899401|gb|AAF30824.1|AE002138_11 formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827592|gb|ACA32854.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675912|gb|EDT87817.1| formamidopyrimidine-DNA glycosylase [Ureaplasma parvum serovar 14 str. ATCC 33697] (275 aa)
Score = 612, Expect = 8.7e-62, Identities = 134/274 (48%), Positives = 183/274 (66%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEVQ+++D L     L+  I      +PKI KN + ++F   +IN +I  I R GKYL+F L+N+ V  VHLRMEGK +++  +  ++  H  + IE ++  ++RY+DTR+FGTF IY + ++LDSKE+KK+ LDPL+  F  +YL   +KKSN+AIKT LLDQ  VSGIGNIYADEILFA+ I P  +A  LT  +++KI + ++ IL  +++NKGTTI TY F  ++ G FQK L VHT     C  C   I K KVNGRGTY C  CQ
  S:     1 MPELPEVQTIVDYLNHH-VLDIFIKKTIVHLPKILKNKTPQEFEKLLINHKIVKIKRLGKYLLFFLSNNLVLSVHLRMEGKFYYQAKEEWFNLAHTHIIIEFNNGMQLRYNDTRQFGTFHIYEQQSFLDSKELKKIALDPLDNNFSAQYLYEKLKKSNKAIKTALLDQSVVSGIGNIYADEILFAAKIFPTILAKNLTLKNYEKITKEAQRILLLSIKNKGTTIHTYKFGNDETGLFQKMLLVHTHAKEPCQICGTIIQKTKVNGRGTYYCPNCQ 274
>gi|12045118|ref|NP_072929.1| formamidopyrimidine-DNA glycosylase [Mycoplasma genitalium G37] >gi|2494593|sp|P55825|FPG_MYCGE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|3844857|gb|AAC71484.1| formamidopyrimidine-DNA glycosylase [Mycoplasma genitalium G37] >gi|166078880|gb|ABY79498.1| formamidopyrimidine-DNA glycosylase [synthetic Mycoplasma genitalium JCVI-1.0] (284 aa)
Score = 611, Expect = 1.2e-61, Identities = 134/275 (48%), Positives = 185/275 (67%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV +VI+ LKE   LN+ +  ++  + K+ KN   +     + N+   DI RKGKY+IF L+N    V HLRMEGK FFE+  S +++KHVLV+   DD  ++ YHDTR+FGTF +Y +     + ++ KL  DPLE  FD++ +    + S R +KT +LDQ  +SGIGNIYADEILFAS I+PET+ ++LT  + + + +N+  ILAKA+  KGTTI+++ FKK+  G +Q FLKVHTKKD  C  C   IVK K+NGRG+Y CL CQK
  S:     1 MPELPEVTTVINELKET-VLNKPLDQVQVNLRKVLKNIDPQLLNKQLKNQFFTDIKRKGKYIIFLLSNGLYLVSHLRMEGKYFFEERGSKFNQKHVLVEFHFDDGSQLNYHDTRQFGTFHLYEKLE--QAAQLNKLAFDPLEAGFDYRKIFQKAQNSKRKVKTFILDQTVISGIGNIYADEILFASKINPETMVDQLTIKEIEILCKNATKILAKAIVMKGTTISSFSFKKDHTGGYQNFLKVHTKKDQPCSVCNQLIVKKKINGRGSYFCLNCQK 273
>gi|115252785|emb|CAK98221.1| probable formamidopyrimidine-dna glycosylase protein [Spiroplasma citri] (277 aa)
Score = 573, Expect = 3.5e-57, Identities = 124/277 (44%), Positives = 181/277 (65%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L +   + +TIT+ +    KI K     ++F   I+ ++I  I R GK+L+F L +D V + HLRMEGK +F   D   + +H++V  E+D  +++RYHDTR+FGT  +Y++N+YL    + KLG +P +E+    YLKN+ +  ++ IKTTLL+Q  + GIGNIYA+EILFAS IHP  I   L D D++ I EN++++L KA++  GTTIATY  +    G+F + LKVH +   +C+NC   I KI +NGRGTY C  CQK K
  S:     1 MPELPEVETVRRILTKH-VVGKTITDCQIFWNKIIKYPLDSKEFIKEIVKQKINRIDRMGKHLLFIL-DDYVLISHLRMEGKYYFTSKDEPGEWQHIMVLFELDHQFQLRYHDTRKFGTMHLYSKNDYLQQAPLNKLGYEPFDEKITVSYLKNSWQNKSQPIKTTLLEQNVIVGIGNIYANEILFASKIHPGEITKNLVDQDYQNIIENTKLVLQKAIDEGGTTIATYHPEPGMDGKFLQQLKVHGRNKMECLNCHQLIDKIFINGRGTYFCNYCQKLK 277
>gi|47096729|ref|ZP_00234314.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes str. 1/2a F6854] >gi|153174724|ref|ZP_01930193.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes FSL N3-165] >gi|153179597|ref|ZP_01932816.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes F6900] >gi|153183915|ref|ZP_01934732.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes J0161] >gi|153191002|ref|ZP_01938313.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes J2818] >gi|47014913|gb|EAL05861.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes str. 1/2a F6854] >gi|126943567|gb|EBA21288.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes J0161] >gi|127765570|gb|EBA25918.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes J2818] >gi|133729955|gb|EBA31653.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes FSL N3-165] >gi|133733082|gb|EBA34780.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes F6900] (273 aa)
Score = 511, Expect = 4.7e-50, Identities = 109/275 (39%), Positives = 172/275 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+  +   ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDENEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK 273
>gi|16079960|ref|NP_390786.1| formamidopyrimidine-DNA glycosylase [Bacillus subtilis subsp. subtilis str. 168] >gi|2293273|gb|AAC00351.1| formamidopyrimidine-DNA glycosidase [Bacillus subtilis] >gi|2635373|emb|CAB14868.1| formamidopyrimidine-DNA glycosidase [Bacillus subtilis subsp. subtilis str. 168] (278 aa)
Score = 510, Expect = 6.6e-50, Identities = 118/277 (42%), Positives = 164/277 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLN-RTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           VPELPEV++V  +L   G +  +TI ++E   P I K     E+F   +  E I+ I R+GK+L+FHL +  V V HLRMEGK    + +   D KHV V   M D  ++RY D R+FGT  ++          + +LG +P  EEF   YLK+ + K+NRA+KT LLDQ+ V G+GNIY DE LF + +HPET AN+L+D   K +    +  L +A++  G+T+ +Y   + + G FQ    V+ KKD  C NC   I KI V GRGT+ C KCQ KK
  S:     3 VPELPEVETVRRTLT--GLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRRGKFLLFHL-DHYVMVSHLRMEGKYGLHQAEEP-DDKHVHVIFTMTDGTQLRYRDVRKFGTMHLFKPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEALFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQHFVYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQTKK 278
>gi|153167011|ref|ZP_01927433.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes FSL N1-017] >gi|153202485|ref|ZP_01944021.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes HPB2262] >gi|133727202|gb|EBA28900.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes FSL N1-017] >gi|133735260|gb|EBA36958.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes HPB2262] (273 aa)
Score = 509, Expect = 7.4e-50, Identities = 109/275 (39%), Positives = 172/275 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+  +   ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDEKEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK 273
>gi|167014783|ref|ZP_02277316.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes FSL J1-194] >gi|167454151|ref|ZP_02320374.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes FSL J2-064] (273 aa)
Score = 509, Expect = 7.6e-50, Identities = 109/275 (39%), Positives = 172/275 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+  +   ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDEKEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTDEPCVVCGKPIEKIKLNGRGTHFCPNCQK 273
>gi|46907795|ref|YP_014184.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes str. 4b F2365] >gi|47093101|ref|ZP_00230878.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes str. 4b H7858] >gi|67460686|sp|Q71ZA3|FPG_LISMF Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|46881064|gb|AAT04361.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes str. 4b F2365] >gi|47018541|gb|EAL09297.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes str. 4b H7858] (273 aa)
Score = 508, Expect = 1.1e-49, Identities = 109/275 (39%), Positives = 172/275 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+  +   ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDEKEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTSTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTDEPCVVCGKPIEKIKLNGRGTHFCPNCQK 273
>gi|154687040|ref|YP_001422201.1| formamidopyrimidine-DNA glycosylase [Bacillus amyloliquefaciens FZB42] >gi|154352891|gb|ABS74970.1| MutM [Bacillus amyloliquefaciens FZB42] (278 aa)
Score = 508, Expect = 1.1e-49, Identities = 117/276 (42%), Positives = 162/276 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLN-RTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           VPELPEV++V  +L   G +  +TI + +   P I K     E+F   I  E I+ I R+GK+L+FHL +  V V HLRMEGK    + D   D KHV V   M D  ++RY D R+FGT  ++      ++  + +LG +P +E F   YLK  + K+NRA+KT LLDQ+ V G+GNIY DE LF + IHPET AN L+D   K +    +  L +A++  G+T+ +Y   + + G FQ    V+ KKD  C  C   I KI V GRGT+ C +CQKK
  S:     3 VPELPEVETVRRTLT--GLVKGKTIESADIRWPNIIKKPAEPEEFARQIAGETIRSIGRRGKFLLFHL-DHYVMVSHLRMEGKYGLHQADEP-DDKHVHVVFHMTDGTQLRYRDVRKFGTMHLFAPGEEQNALPLSQLGPEPDDEAFTAAYLKERLAKTNRAVKTALLDQKAVVGLGNIYVDEALFRARIHPETKANSLSDGQIKTLHTEIKDTLQEAIDAGGSTVRSYINSQGEIGMFQLKHYVYGKKDEPCKTCGTMISKIVVGGRGTHFCARCQKK 277
>gi|153196800|ref|ZP_01941127.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes 10403S] >gi|127633683|gb|EBA23091.1| formamidopyrimidine-DNA glycosylase [Listeria monocytogenes 10403S] (273 aa)
Score = 508, Expect = 1.2e-49, Identities = 109/275 (39%), Positives = 171/275 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+  +   ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D   K+I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDENEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKKIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK 273
>gi|7531268|sp|O34403|FPG_BACSU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) (276 aa)
Score = 507, Expect = 1.4e-49, Identities = 117/277 (42%), Positives = 164/277 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLN-RTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V  +L   G +  +TI ++E   P I K     E+F   +  E I+ I R+GK+L+FHL +  V V HLRMEGK    + +   D KHV V   M D  ++RY D R+FGT  ++          + +LG +P  EEF   YLK+ + K+NRA+KT LLDQ+ V G+GNIY DE LF + +HPET AN+L+D   K +    +  L +A++  G+T+ +Y   + + G FQ    V+ KKD  C NC   I KI V GRGT+ C KCQ KK
  S:     1 MPELPEVETVRRTLT--GLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRRGKFLLFHL-DHYVMVSHLRMEGKYGLHQAEEP-DDKHVHVIFTMTDGTQLRYRDVRKFGTMHLFKPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEALFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQHFVYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQTKK 276
>gi|16800667|ref|NP_470935.1| hypothetical protein lin1599 [Listeria innocua Clip11262] >gi|21362544|sp|Q92BF1|FPG_LISIN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|16414086|emb|CAC96830.1| mutM [Listeria innocua] (273 aa)
Score = 507, Expect = 1.6e-49, Identities = 109/275 (39%), Positives = 169/275 (61%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+      ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    ++K IKKLG +PL   F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + +HPE  AN L+D +  +I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K    CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVATPPDEFVHMLVGQEIEAVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDENEEVTKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGESETKSIKKLGPEPLTPAFTLADFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVHPERAANSLSDKEINRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTGEPCVICGTPIEKIKLNGRGTHFCPHCQK 273
>gi|16803604|ref|NP_465089.1| hypothetical protein lmo1564 [Listeria monocytogenes EGD-e] >gi|21362541|sp|Q8Y6W7|FPG_LISMO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|16410993|emb|CAC99642.1| mutM [Listeria monocytogenes] (273 aa)
Score = 506, Expect = 1.7e-49, Identities = 108/275 (39%), Positives = 172/275 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+  +   ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I + ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDENEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFKATKSIMTEAVALGGSTVRTYVNSQGKLGQYQNKLKVYGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK 273
>gi|78044278|ref|YP_360470.1| formamidopyrimidine-DNA glycosylase [Carboxydothermus hydrogenoformans Z-2901] >gi|90101299|sp|Q3ABL4|FPG_CARHZ Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|77996393|gb|ABB15292.1| formamidopyrimidine-DNA glycosylase [Carboxydothermus hydrogenoformans Z-2901] (263 aa)
Score = 506, Expect = 1.8e-49, Identities = 107/275 (38%), Positives = 168/275 (61%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++  +L  +  L +TI  +E  +PKI KN S E+FT  ++ ++I  + R+GKYL+  L+  +   VHLRM GKL      S  DK H     ++ D E+ ++D R+FG F+           E+ ++G +PLE+EF  +YLK  +K S + +K  LLDQ+ ++GIGNIYADEILF + + P+ IA  L++++ +++ +  R ILA  +E +GT+I  Y   + Q+G FQ+ LKV+ K    CV C N +++ +  GR T+ C  CQK
  S:     1 MPELPEVETIKRTLAPK-ILGKTIYRVEVYLPKIIKNVSVEEFTRRVVGKEIVALKRRGKYLLIDLSGKETVTVHLRMTGKLLILPKGSPKDK-HTHAIFDLGDLELHFNDIRQFGGFSF----------EMPEIGPEPLEDEFTPEYLKTKLKASQKNLKAVLLDQKIIAGIGNIYADEILFEAGLSPKRIAASLSEDEAEELFKAIRKILALGIEYRGTSIRDYVDAENQQGSFQRLLKVYGKNGSLCVRCNNVLIRERHAGRSTHYCPHCQK 263
>gi|15828781|ref|NP_326141.1| formamidopyrimidine-DNA glycosylase [Mycoplasma pulmonis UAB CTIP] >gi|17366043|sp|Q98QQ1|FPG_MYCPU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|14089724|emb|CAC13483.1| FORMAMIDOPYRIMIDINE-DNA GLYCOSYLASE (FAPY-DNA GLYCOSYLASE) [Mycoplasma pulmonis] (278 aa)
Score = 502, Expect = 5.2e-49, Identities = 124/277 (44%), Positives = 168/277 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV+ V  SL E+   N     +E   PK+FK      F  ++I E+I  I+  GK +I+ LTN+K+ + HLRMEGK  F +       KH+      ++  E+ Y ++R FGTF I   NNYL    + K+   P E +F+  Y  N + K   AIK TLLDQ  VSGIGNIYADEILFAS IHP T +N L+ +  K+I +N+  IL K+ E  G++I +Y    +++G++Q FLKVHTKK   C+ C +KI KIK  GRGTY C  CQK+K
  S:     1 MPELPEVRVVCKSLNEK-VQNLVFKKVEIFNPKLFKEYDPSYFQEFLIGEKILKISNLGKNIIYFLTNNKIMLSHLRMEGKYSFYEQKPKETLKHIQAIFYFENGSELHYRESRPFGTFHIRYLNNYLKIDPLAKVAQSPGEIDFETFY--NRLSKKALAIKPTLLDQSIVSGIGNIYADEILFASKIHPATPSNLLSKDKVKEILKNAIEILDKSTELGGSSINSYESLNKKEGQYQNFLKVHTKKGEFCIKCSSKIEKIKFKGRGTYFCPTCQKQK 275
>gi|50365398|ref|YP_053823.1| formamidopyrimidine-DNA glycosylase [Mesoplasma florum L1] >gi|50363954|gb|AAT75939.1| formamidopyrimidine-DNA glycosylase [Mesoplasma florum L1] (275 aa)
Score = 501, Expect = 6.6e-49, Identities = 117/274 (42%), Positives = 170/274 (62%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSS-YDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L ++  +N TI   E    K+      +DF   ++N++I  ++  GKYL+F L+N ++ + HLRMEGK    K +   Y+  H+ ++ E+ + E ++Y+D+R+FGT  I+++ NY     + KLG +PL  +  ++YLK    KSN  IK  +LDQ  + GIGNIYA+EILFA+ I+PE I   LTD + KKI   S  IL KA+  KGT+I +Y     + G+FQ  LKVH +KD  C  C  KI+K +V GRGTY C KCQ
  S:     1 MPELPEVRTVAVFLNKR-IVNTTILKAECFFEKMIWRNEVKDFYKSVLNQKILKVSNYGKYLMFELSN-QIIISHLRMEGKWSISKKEIDIYNANHLRLQFELSNGEYLKYYDSRKFGTIEIWDKKNYKQKSGMDKLGPEPLNSQPSFEYLKEKAIKSNSLIKAFILDQSVLCGIGNIYANEILFAAGINPERITKTLTDEELKKIIMFSNAILEKAISLKGTSIHSYKSGDGETGQFQHELKVHLRKDEKCFVCGTKILKKQVAGRGTYFCAKCQ 274
>gi|52081409|ref|YP_080200.1| formamidopyrimidine-DNA glycosylase [Bacillus licheniformis ATCC 14580] >gi|52786785|ref|YP_092614.1| formamidopyrimidine-DNA glycosylase [Bacillus licheniformis ATCC 14580] >gi|81690937|sp|Q65G93|FPG_BACLD Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|52004620|gb|AAU24562.1| formamidopyrimidine-DNA glycosidase [Bacillus licheniformis ATCC 14580] >gi|52349287|gb|AAU41921.1| MutM [Bacillus licheniformis DSM 13] (275 aa)
Score = 498, Expect = 1.5e-48, Identities = 114/276 (41%), Positives = 160/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSY-EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKK-HVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L       +TI  ++    KI K     E+F   +  + I+ I R+GK+L+FHL +D V V HLRMEGK    + D   DK  HV+ +   D  E+RY D R+FGT  ++     L    +++LG +P   EF   YL+  +KK+NR++KT LLDQ  V G+GNIY DE LF + IHPE  ANKLT      + +     L +AVE  G+T+ +Y   + + G FQ  L V+ +KD  C  C + I K  V GRGT+ C+KCQKK
  S:     1 MPELPEVETVRRTLAGL-VRGKTIDAVDVRWTKIIKRPEEPEEFARLLAGQTIQSIGRRGKFLLFHL-DDCVMVSHLRMEGKYGLHQNDEPLDKHVHVIFRF-TDGSELRYRDVRKFGTMHLFKPGEELTELPLRQLGPEPFSSEFTADYLRERLKKTNRSVKTALLDQRTVVGLGNIYVDEALFRAGIHPEATANKLTKKQTVLLHKEIIQTLKEAVEAGGSTVRSYINSQGEIGMFQLKLFVYGRKDEPCKKCGSPIEKTVVGGRGTHFCIKCQKK 275
>gi|116872993|ref|YP_849774.1| formamidopyrimidine-DNA glycosylase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741871|emb|CAK20995.1| mutM [Listeria welshimeri serovar 6b str. SLCC5334] (273 aa)
Score = 494, Expect = 5.2e-48, Identities = 109/275 (39%), Positives = 168/275 (61%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV++V  +L+E     + I  +   +PK+      ++F H ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ D      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL   F        +KK++RAIKT LLDQ+ V+GIGNIYADEI F + + PE  AN L++ + K+I E +  I+ +AV   G+T+ TY   + + G++Q  LKV+ K    CV C   I KIK+NGRGT+ C  CQK
  S:     1 MPEMPEVENVRATLQEL-VPGKKIDQVIVRVPKMIVTTPPDEFVHMLVGQEIEAVRRRGKFLLFDLTNCTI-MSHLRMEGKFRLMDEKDEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGENETRSIKKLGPEPLTNTFTLTDFATGVKKTSRAIKTALLDQKLVAGIGNIYADEICFEAKVQPERPANSLSNKEIKRIFEATISIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTGEPCVVCGTPIEKIKLNGRGTHFCPHCQK 273
>gi|47459207|ref|YP_016069.1| formamidopyrimidine-DNA glycosylase [Mycoplasma mobile 163K] >gi|81697049|sp|Q6KHS0|FPG_MYCMO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|47458536|gb|AAT27858.1| formamidopyrimidine-DNA glycosylase [Mycoplasma mobile 163K] (274 aa)
Score = 491, Expect = 9.9e-48, Identities = 118/275 (42%), Positives = 168/275 (61%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGL-DPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++VI  LK+   L++TI+ IE  +PK+ K  S E+F  Y+ NE I +I  +GK+++F L+N+K+ + HLRMEG   F       +    L+    D   + YHD+R FGTF   N  NYL   +IK L L  P+  + D       +K+   AIK  LLDQ+ ++G+GNIY DE LFAS +HPE  AN+L+    K I +N+  IL ++ +  G++I +Y    E++G FQ FL+VHTK +  C NC   I KIK+ GRGTY C KCQ+
  S:     1 MPELPEVKTVILHLKKL-ILDKTISKIEIFIPKMIKEISSEEFKKYLENETIFNIENEGKFIVFFLSNNKIMLSHLRMEGGYNFYSKKRQKEIHDRLIFHFTDGSSLHYHDSRMFGTFHFRNSENYL---KIKPLSLVAPVPWKIDLDEFFKLLKRKKTAIKKILLDQQIIAGLGNIYVDETLFASKVHPEFKANQLSLEQVKLILKNATRILQESTKLGGSSIRSYTSLNEKEGSFQNFLQVHTKFNKPCPNCGELIQKIKLGGRGTYFCKKCQQ 272
>gi|69246665|ref|ZP_00604055.1| Formamidopyrimidine-DNA glycolase [Enterococcus faecium DO] >gi|68195139|gb|EAN09597.1| Formamidopyrimidine-DNA glycolase [Enterococcus faecium DO] (278 aa)
Score = 486, Expect = 4.3e-47, Identities = 111/277 (40%), Positives = 162/277 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E+  + +TI  ++ + PKI +      F   ++ E I+ I R+GK+LIFHL + ++ + HLRMEGK  F K ++  DK  HVL   E D  ++RY+D R+FG  TI  +      + I KLG +PL + F      N +KKS++AIK  LLDQ  V+G+GNIY DE L+ + IHPE  AN L   + +++  +   +L +A+E  GTTI +Y     + G FQ  L V+ +    C+ C   IVK KV  RGT+ C  CQ+ K
  S:     1 MPELPEVETVRKGL-ERLVVGKTIQKVQVLWPKIIEQPETPIFEASLVGETIQSIGRRGKFLIFHLDHCEL-ISHLRMEGKYQFTKENTPIDKHTHVLFFFE-DGSQLRYNDVRKFGRMTIVEKGASATYRGIMKLGPEPLPDSFLLADFANGLKKSHKAIKPLLLDQRLVTGLGNIYVDEALWEAKIHPEQPANTLRPKEVEQLRLSIIDVLDRAIEAGGTTIRSYLNALGESGGFQVALHVYQQTGKPCIRCGTPIVKTKVAQRGTHYCPNCQRLK 275
>gi|157693308|ref|YP_001487770.1| formamidopyrimidine-DNA glycosylase [Bacillus pumilus SAFR-032] >gi|157682066|gb|ABV63210.1| DNA-formamidopyrimidine glycosylase [Bacillus pumilus SAFR-032] (276 aa)
Score = 482, Expect = 1.2e-46, Identities = 110/276 (39%), Positives = 158/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSY-EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +LK      +TI  ++   P I K     E+F   ++ E I+ I R+GK+L+FHL +  V V HLRMEGK    +    YDK   +V    D  E+RYHD R+FGT  ++          + +LG +P +E+F  +YL   +KK+ R +KT LLDQ+ V G+GNIY DE+LF S IHPET AN+L+    K + +     L  AV+  G+TI +Y   +   G FQ  L V+ ++   C  C + I K  V GRGT+ C+ CQK+
  S:     1 MPELPEVETVRRTLKRL-VEGKTIETVDIKWPNIIKRPGEPEEFARRMVGETIQTIERRGKFLLFHL-DHYVMVSHLRMEGKYRVHEAHEPYDKHVHVVFTFTDGTELRYHDVRKFGTMHLFQPGEEEKELPLSQLGYEPFDEQFTPEYLWEQLKKTTRVVKTALLDQKIVVGLGNIYVDEVLFKSGIHPETKANQLSLESCKVLHKQIIDTLQVAVDAGGSTIRSYINSQGDIGTFQLQLLVYDRRGEPCQTCGSIIEKTVVGGRGTHFCVTCQKR 275
>gi|55820699|ref|YP_139141.1| formamidopyrimidine-DNA glycosylase [Streptococcus thermophilus LMG 18311] >gi|116627506|ref|YP_820125.1| formamidopyrimidine-DNA glycosylase [Streptococcus thermophilus LMD-9] >gi|81676735|sp|Q5M576|FPG_STRT2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|55736684|gb|AAV60326.1| formamidopyrimidine-DNA glycosylase [Streptococcus thermophilus LMG 18311] >gi|116100783|gb|ABJ65929.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Streptococcus thermophilus LMD-9] (273 aa)
Score = 479, Expect = 2.4e-46, Identities = 111/276 (40%), Positives = 165/276 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  L RTI ++E  +PK+ K  SY+ F H +  + I+ + R+GKYLIF      + + HLRMEGK L F  TD   D KH  +  ++DD   + Y D R+FGTF + +          KKLG +P ++ F +   +  +  S ++IK  LL+Q+ V+G+GNIY DE+L+A+ +HPET ANKL+    K++ + +  IL   +   G+TI TY     + G  Q +L+V+ K    C  C + IVKIK+ GRGT+LC  CQK+
  S:     1 MPELPEVETVRRGL-EKLLLGRTILSLEVKVPKMIKT-SYDSFLHDLPGQTIQAMRRRGKYLIFDF-GQLIIISHLRMEGKYLLF--TDQVPDNKHFHLFFKLDDGSTLVYQDVRKFGTFDLLDRKQEEAYFTRKKLGPEPTKKTFKYVPFERALMHSGKSIKPLLLEQKLVAGLGNIYVDEVLWAAKVHPETPANKLSKAAMKRVHDQTIAILQLGIAKGGSTIRTYRNALGEDGTMQNYLQVYGKTGQPCPRCASMIVKIKLGGRGTHLCPHCQKR 273
>gi|166984091|ref|ZP_02255464.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus AH187] (276 aa)
Score = 479, Expect = 2.4e-46, Identities = 109/276 (39%), Positives = 159/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + KI V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTVEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKIVVGGRGTHYCPICQPR 275
>gi|55822590|ref|YP_141031.1| formamidopyrimidine-DNA glycosylase [Streptococcus thermophilus CNRZ1066] >gi|81676585|sp|Q5M0P0|FPG_STRT1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|55738575|gb|AAV62216.1| formamidopyrimidine-DNA glycosylase [Streptococcus thermophilus CNRZ1066] (273 aa)
Score = 478, Expect = 3.2e-46, Identities = 113/276 (40%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  L RTI ++E  +PK+ K  SY+ F H +  + I+ + R+GKYLIF      + + HLRMEGK L F  TD   D KH  +  ++DD   + Y D R+FGTF + +   E  Y   KE   LG +P ++ F +   +  +  S ++IK  LL+Q+ V+G+GNIY DE+L+A+ +HPET ANKL+    K++ + +  IL   +   G+TI TY     + G  Q +L+V+ K    C  C + IVKIK+ GRGT+LC  CQK+
  S:     1 MPELPEVETVRRGL-EKLLLGRTILSLEVKVPKMIKT-SYDSFLHDLPGQTIQAMRRRGKYLIFDF-GQLIIISHLRMEGKYLLF--TDQVPDNKHFHLFFKLDDGSTLVYQDVRKFGTFDLLDRKQEEAYFTRKE---LGPEPTKKTFKYVPFERALMHSGKSIKPLLLEQKLVAGLGNIYVDEVLWAAKVHPETPANKLSKAAMKRVHDQTIAILQLGIAKGGSTIRTYRNALGEDGTMQNYLQVYGKTGQPCPRCASMIVKIKLGGRGTHLCPHCQKR 273
>gi|196040881|ref|ZP_03108179.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus NVH0597-99] >gi|196028335|gb|EDX66944.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus NVH0597-99] (276 aa)
Score = 477, Expect = 4.6e-46, Identities = 109/276 (39%), Positives = 157/276 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E IK+I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL   ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIKNIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLHERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTAEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|89100390|ref|ZP_01173254.1| formamidopyrimidine-DNA glycosylase [Bacillus sp. NRRL B-14911] >gi|89084909|gb|EAR64046.1| formamidopyrimidine-DNA glycosylase [Bacillus sp. NRRL B-14911] (275 aa)
Score = 475, Expect = 7.0e-46, Identities = 105/276 (38%), Positives = 157/276 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +LKE     + I  +    PK+ K     E F   +  + I D+ R+GK+LI + T+D   V HLRMEGK      +   DK   ++    D  E+RY D R+FGT  ++ +     S  + +LG +P  EEF  ++L+  +  +NRA+KT LLDQ+ V G+GNIY DE LF + IHPE +A+ L+D++  ++ +     L++AVE  G+TI +Y   + Q G FQ  L V+ +K   C  C + + +I V GRGT  C  CQ K
  S:     1 MPELPEVETVRKTLKEL-VTGKEIGQVSIHWPKMIKQPGEAEQFADALAGQTILDVGRRGKFLIIY-TDDYALVSHLRMEGKYALYSKEEDKDKHTHVIFHFTDGSELRYRDVRKFGTMHLFAKGEEFASLPLSQLGPEPFSEEFTPQFLQQRLAGTNRAVKTALLDQKAVVGLGNIYVDEALFRAGIHPERLASSLSDDEIGRLHKEIVATLSEAVEKGGSTIRSYVNSQGQIGMFQLELFVYGRKGEACKTCGSTLERIIVGGRGTVFCPVCQVK 275
>gi|167934949|ref|ZP_02522024.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus AH1134] (276 aa)
Score = 475, Expect = 7.7e-46, Identities = 108/276 (39%), Positives = 160/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E+I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L++AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGEKIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTTQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTVEEIERIYEATVTTLSEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|30264656|ref|NP_847033.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. Ames] >gi|47530126|ref|YP_021475.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187476|ref|YP_030728.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. Sterne] >gi|49481341|ref|YP_038631.1| formamidopyrimidine-DNA glycosylase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140924|ref|YP_085906.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus E33L] >gi|65321953|ref|ZP_00394912.1| COG0266: Formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A2012] >gi|118479733|ref|YP_896884.1| formamidopyrimidine-DNA glycosylase [Bacillus thuringiensis str. Al Hakam] >gi|165869590|ref|ZP_02214248.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0488] >gi|166996270|ref|ZP_02262730.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus AH820] >gi|167634061|ref|ZP_02392384.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0442] >gi|167638114|ref|ZP_02396392.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0193] >gi|170685575|ref|ZP_02876798.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0465] >gi|170705602|ref|ZP_02896066.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0389] >gi|177651233|ref|ZP_02934064.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0174] >gi|190569044|ref|ZP_03021944.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis Tsiankovskii-I] >gi|196032694|ref|ZP_03100107.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus W] >gi|196047497|ref|ZP_03114708.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus 03BB108] >gi|39931254|sp|Q81L04|FPG_BACAN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81685955|sp|Q633L1|FPG_BACCZ Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81696636|sp|Q6HCU5|FPG_BACHK Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|30259331|gb|AAP28519.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. Ames] >gi|47505274|gb|AAT33950.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181403|gb|AAT56779.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. Sterne] >gi|49332897|gb|AAT63543.1| formamidopyrimidine-DNA glycosylase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974393|gb|AAU15943.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus E33L] >gi|118418958|gb|ABK87377.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Bacillus thuringiensis str. Al Hakam] >gi|164714419|gb|EDR19938.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0488] >gi|167513931|gb|EDR89299.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0193] >gi|167530862|gb|EDR93564.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0442] >gi|170129727|gb|EDS98590.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0389] >gi|170670039|gb|EDT20779.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0465] >gi|172083059|gb|EDT68121.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis str. A0174] >gi|190559826|gb|EDV13811.1| formamidopyrimidine-DNA glycosylase [Bacillus anthracis Tsiankovskii-I] >gi|195994123|gb|EDX58078.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus W] >gi|196021712|gb|EDX60408.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus 03BB108] (276 aa)
Score = 474, Expect = 8.7e-46, Identities = 108/276 (39%), Positives = 157/276 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL   ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLHERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTAEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|168162582|ref|ZP_02597815.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus H3081.97] (276 aa)
Score = 474, Expect = 9.2e-46, Identities = 108/276 (39%), Positives = 158/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTVEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|75762013|ref|ZP_00741927.1| Formamidopyrimidine-DNA glycosylase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168143985|ref|ZP_02587214.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus G9842] >gi|74490499|gb|EAO53801.1| Formamidopyrimidine-DNA glycosylase [Bacillus thuringiensis serovar israelensis ATCC 35646] (276 aa)
Score = 474, Expect = 9.2e-46, Identities = 108/276 (39%), Positives = 159/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E+I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGEKIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTVEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|30022661|ref|NP_834292.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus ATCC 14579] >gi|168137881|ref|ZP_02581110.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus B4264] >gi|39931253|sp|Q817G5|FPG_BACCR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|29898219|gb|AAP11493.1| Formamidopyrimidine-DNA glycosylase [Bacillus cereus ATCC 14579] (276 aa)
Score = 474, Expect = 1.0e-45, Identities = 108/276 (39%), Positives = 159/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E+I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGEKIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAEMTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTVEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|47564996|ref|ZP_00236039.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus G9241] >gi|47557782|gb|EAL16107.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus G9241] (276 aa)
Score = 473, Expect = 1.3e-45, Identities = 108/276 (39%), Positives = 158/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     E F   +  E I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTVEEIERIYEATITTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|85057347|ref|YP_456263.1| formamidopyrimidine-DNA glycosylase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789452|gb|ABC65184.1| formamidopyrimidine-DNA glycosylase [Aster yellows witches'-broom phytoplasma AYWB] (276 aa)
Score = 471, Expect = 1.9e-45, Identities = 113/274 (41%), Positives = 165/274 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQ--IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEVQ ++D LK Q      +   + +  K+F   + ++   +   EQ  I DI RKGK+L+F LT + V + HLRMEGKLF +  D    K      I  D   +RY+D R+FG F + N+N +L    + +L LDP E   +  +L   I K+  A+K  LL+Q+ +SG+GNIY +E+LF   +HPET A +L+    ++I   S+ +LAKA++  GTT++T+  +    G FQ  L+VH K +  C+NC+ KI+KIKV GRGTYLC  CQ
  S:     1 MPELPEVQIIVDFLKTQ------LIGKKIVATKVFYEPTVKNTKEFQKIEQTTILDIQRKGKFLLFFLTQELVLIGHLRMEGKLFIKPCDEPKHKYEHFSIILGDKSSLRYYDFRKFGRFEVKNQNIFLTQTTLHQLALDPFE--INPVFLYQKILKTKSALKKVLLNQKIISGLGNIYVNEVLFLVKLHPETKACELSLKQVQEIVTISQKVLAKAIKLGGTTVSTFESQPGIIGYFQNKLQVHGKVNKPCINCQTKIIKIKVGGRGTYLCPICQ 268
>gi|42783763|ref|NP_981010.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus ATCC 10987] >gi|81699643|sp|Q72ZF1|FPG_BACC1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|42739693|gb|AAS43618.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus ATCC 10987] (276 aa)
Score = 471, Expect = 2.4e-45, Identities = 107/276 (38%), Positives = 158/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    PKI K     + F   +  E I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   ++   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A+ LT  + ++I E +   L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVIVTYPKIVKRPDDAKIFKEMLKGETIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEEMNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREASSLTAEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|163942319|ref|YP_001647203.1| formamidopyrimidine-DNA glycosylase [Bacillus weihenstephanensis KBAB4] >gi|163864516|gb|ABY45575.1| formamidopyrimidine-DNA glycosylase [Bacillus weihenstephanensis KBAB4] (276 aa)
Score = 469, Expect = 3.3e-45, Identities = 108/276 (39%), Positives = 156/276 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +TI ++    P+I K     E F   +  E I++I R+GK+L+ ++TN  V V HLRMEGK    + D   DK   +  +  D  E+ Y D R+FGT  ++ +   L+   +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S IHPE  A  LT  + ++I E     L +AV+  G+TI TY   + Q G FQ+ L V+ KK   CV C   + K  V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTIEDVVITYPQIVKRPDDAEIFKEMLRGETIENIKRRGKFLLLYVTN-YVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLFKKGEELNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEVLFRSQIHPEREAASLTKEEVERIYEAIVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLNVYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPR 275
>gi|149019561|ref|ZP_01834880.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP23-BS72] >gi|147930936|gb|EDK81916.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP23-BS72] (274 aa)
Score = 466, Expect = 8.2e-45, Identities = 109/276 (39%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + IHP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQIHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|56964473|ref|YP_176204.1| formamidopyrimidine-DNA glycosylase [Bacillus clausii KSM-K16] >gi|81678825|sp|Q5WEG7|FPG_BACSK Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56910716|dbj|BAD65243.1| formamidopyrimidine-DNA glycosylase [Bacillus clausii KSM-K16] (276 aa)
Score = 466, Expect = 8.5e-45, Identities = 105/276 (38%), Positives = 161/276 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L  Q   N+TI +++   PK+ K     E F   +  + I+DI R+GK+L+F L ND V V HLRMEG+   ++ TD      HV+     D  E+RY D R+FGT  ++ +     +  + +LG++P  E+F  + L+    K+ RAIKT LLDQ+ V G+GNIY DE LF + IHPE  A+ L+  ++  + +  +  L +A+E  G++I +Y   + + G FQ+ L V+ +K   C +C   I K  V GRGT+ C  CQ +
  S:     1 MPELPEVETVRRTLL-QLVKNKTIADVDVGWPKMIKEPDDVERFIQLLKGQTIEDIGRRGKFLLFVL-NDYVLVSHLRMEGRYGLYQPTDEKTKHTHVVFSF-TDGSELRYADVRKFGTMHLFAKGAEHVAMPLAQLGVEPFSEQFTVELLEQAYAKTTRAIKTALLDQKTVVGLGNIYVDEALFHAGIHPERTASSLSKEEYHNLHKEIKRTLKEAIEAGGSSIKSYVNGQGEIGMFQQQLHVYGRKQQPCHHCDTAIEKTVVGGRGTHYCPNCQPR 275
>gi|184155792|ref|YP_001844132.1| formamidopyrimidine-DNA glycosylase [Lactobacillus fermentum IFO 3956] >gi|183227136|dbj|BAG27652.1| formamidopyrimidine-DNA glycosylase [Lactobacillus fermentum IFO 3956] (279 aa)
Score = 466, Expect = 9.3e-45, Identities = 105/274 (38%), Positives = 151/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PEV++V   L       R I  I+    K  +N   E+F   +I + I+ I R+GKYL+F  +ND   V HLRMEG  F + T +  DK   ++    D  ++ Y DTR+FG   +      +    +K +G +P EE+F + Y K  +KKS   IK  LLDQ +V+G+GNIYADE+L+ + I+PE  AN LTD+  K++ EN    +A+A    GTT+ T+       G+FQ  L+ +      C  C  K+VKIKV  RGT  C  CQ
  S:     1 MPEMPEVETVRRGLMRIAA-GRQIKGIDVNYGKTIEN-DVEEFRQALIGQTIERIDRRGKYLLFRFSNDLTMVSHLRMEGSYFNQPTGAEVDKHTHVIFHFTDGTDLCYRDTRKFGRMHLVKTGEEMTVGGLKTIGPEPTEEDFQFDYFKQILKKSRSKIKPFLLDQSHVAGLGNIYADEVLWQTQINPEQPANSLTDDQIKRLRENIIAEIARATAGHGTTVHTFKNAFGDAGQFQNELQAYGHSGDACPRCGTKLVKIKVAQRGTTFCPHCQ 272
>gi|168494399|ref|ZP_02718542.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC3059-06] >gi|183575665|gb|EDT96193.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC3059-06] (274 aa)
Score = 465, Expect = 1.0e-44, Identities = 108/276 (39%), Positives = 168/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L++AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARSSQTLTAEEATAIHDQTIAVLSQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|149006353|ref|ZP_01830065.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP18-BS74] >gi|168485922|ref|ZP_02710430.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC1087-00] >gi|147762130|gb|EDK69092.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP18-BS74] >gi|183570931|gb|EDT91459.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC1087-00] (274 aa)
Score = 465, Expect = 1.2e-44, Identities = 108/276 (39%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|148998594|ref|ZP_01826034.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP11-BS70] >gi|168575632|ref|ZP_02721568.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae MLV-016] >gi|147755592|gb|EDK62639.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP11-BS70] >gi|183578675|gb|EDT99203.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae MLV-016] (274 aa)
Score = 464, Expect = 1.3e-44, Identities = 108/276 (39%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDTYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|152976968|ref|YP_001376485.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025720|gb|ABS23490.1| formamidopyrimidine-DNA glycosylase [Bacillus cereus subsp. cytotoxis NVH 391-98] (276 aa)
Score = 464, Expect = 1.5e-44, Identities = 109/276 (39%), Positives = 158/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  +L E     +T+ ++    PK+ K     E F   +  E I+ I R+GK+L+ ++TN  V V HLRMEGK F  K+D   DK H  V+ +  D  E+ Y D R+FGT  ++ +        +  LG +P + E   +YL+  ++K+NR IK  LLDQ  + G+GNIY DE+LF S I+PE  A+ L  N+ +KI   +   L +AV+  G+TI +Y   + + G FQ  L V+ KK   CV C   I KI V GRGT+ C  CQ +
  S:     1 MPELPEVENVRRTL-ENLVTGKTMKDVIVTYPKLVKRPDDAELFKELLRGETIERIERRGKFLLLYVTN-YVIVSHLRMEGKYFLCKSDDPVDK-HTHVRFQFTDGTELHYKDVRKFGTMHLFTKGEEYKEMPLADLGPEPFDPELTVEYLQKKLQKTNRKIKVALLDQRLLVGLGNIYVDEVLFRSGIYPEREASSLAKNEIEKIHAATVATLTEAVKRGGSTIRSYINSQGEIGSFQNLLNVYGKKGEPCVTCGTAIEKIVVGGRGTHYCPHCQPR 275
>gi|15902916|ref|NP_358466.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae R6] >gi|116515925|ref|YP_816340.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae D39] >gi|148988414|ref|ZP_01819861.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP6-BS73] >gi|168491059|ref|ZP_02715202.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC0288-04] >gi|29611712|sp|Q8DQ33|FPG_STRR6 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|15458476|gb|AAK99676.1| Formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae R6] >gi|116076501|gb|ABJ54221.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae D39] >gi|147926095|gb|EDK77169.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP6-BS73] >gi|183574637|gb|EDT95165.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC0288-04] (274 aa)
Score = 463, Expect = 1.8e-44, Identities = 108/276 (39%), Positives = 166/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  +  + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQAALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|188586505|ref|YP_001918050.1| formamidopyrimidine-DNA glycosylase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351192|gb|ACB85462.1| formamidopyrimidine-DNA glycosylase [Natranaerobius thermophilus JW/NM-WN-LF] (295 aa)
Score = 463, Expect = 1.9e-44, Identities = 106/274 (38%), Positives = 163/274 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTND-------KVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-------------IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++  SL      +R I+ +E   P + +N S EDF   +I+ QIKD+ R+GKYL+ +++ +       KV ++HLRM G+L  +  +      H+  +  + +Y              + +HD R+FGT  + N+      K +  LG +PL EEFD++     +KKS + IK  LLDQ+ V+GIGNIYADE+LFAS IHP     +LT+ +   + +    IL   ++ +GTT + Y   +  KG FQ  LKV  +   +C+ C+ ++ K KV  RGTY C  CQ
  S:     1 MPELPEVETIKKSLLSDLTGDR-ISRVEIYFPGMLQNMSPEDFKESVISNQIKDVKRRGKYLLIYVSCNGKMKDQVKVIIIHLRMTGRLILKNNEVEKSHNHLDDEEIIQEYRHLRCLFQLQSGITLEFHDQRKFGTMALVNQGEEFYWKGLANLGPEPLSEEFDYEDFYKGVKKSKKPIKGILLDQKLVAGIGNIYADEVLFASGIHPARKGEELTEQEVGSLYKTIIQILELGIKYRGTTFSDYRDSEGNKGNFQDLLKVFNRNKEECLICRREVQKTKVANRGTYYCPNCQ 293
>gi|147678312|ref|YP_001212527.1| formamidopyrimidine-DNA glycosylase [Pelotomaculum thermopropionicum SI] >gi|189044668|sp|A5D0T6|FPG_PELTS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|146274409|dbj|BAF60158.1| formamidopyrimidine-DNA glycosylase [Pelotomaculum thermopropionicum SI] (276 aa)
Score = 462, Expect = 2.2e-44, Identities = 97/277 (35%), Positives = 161/277 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-EKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V  +L+ +      IT +E ++PK+ ++    +F   I +++I  + R+GKYL+ +L+      VHLRM G+L +    D      HV+  +  +  ++ + D R+FG   +   +     K IK+LG++PLEE F  ++LK  +++ +  IK  LLDQ  ++G+GNIYADE L  + I+PE +A  LT  +  ++    R +L + +EN+GTT+  +     Q G +Q+FL+V+ ++   C  C +KI K KV GR +Y C  CQK K
  S:     1 MPELPEVETVRRTLQAK-LPGLKITGVEVLLPKVIRSPELSEFKETIADKKILKVGRRGKYLLINLSEGYTLAVHLRMTGRLVYCAGQDPPARHTHVIFNLS-NGCQLHFADMRQFGRIWLVPTDALDGLKGIKELGVEPLEELFTREFLKKELRRRHARIKPLLLDQTFIAGLGNIYADEALHRARINPERLATTLTPREIARLYRAIRDLLQEGIENRGTTVRDFIDGNGQAGNYQEFLQVYNREGKPCPRCGDKIAKKKVGGRSSYYCPTCQKVK 276
>gi|169833803|ref|YP_001694415.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae Hungary19A-6] >gi|168996305|gb|ACA36917.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae Hungary19A-6] (285 aa)
Score = 462, Expect = 2.6e-44, Identities = 107/276 (38%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L++AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GR T+ C  CQ++
  S:    12 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARSSQTLTAEEATAIHDQTIAVLSQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRSTHFCPNCQRR 284
>gi|15900847|ref|NP_345451.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae TIGR4] >gi|111657968|ref|ZP_01408675.1| hypothetical protein SpneT_02000857 [Streptococcus pneumoniae TIGR4] >gi|149010384|ref|ZP_01831755.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP19-BS75] >gi|182683916|ref|YP_001835663.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CGSP14] >gi|21362546|sp|Q97R61|FPG_STRPN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|14972445|gb|AAK75091.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae TIGR4] >gi|147764865|gb|EDK71794.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP19-BS75] >gi|182629250|gb|ACB90198.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CGSP14] (274 aa)
Score = 461, Expect = 2.7e-44, Identities = 108/276 (39%), Positives = 166/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD   I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDVYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|171854164|emb|CAM12157.1| Formamidopyrimidine-DNA glycosylase [Candidatus Phytoplasma australiense] (271 aa)
Score = 461, Expect = 2.9e-44, Identities = 108/277 (38%), Positives = 162/277 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEVQ +++ LK +  +   I   +     + KN  +E F+  I  + I DI RKGK+L+F LT   V + HLR+EGKLF +   + ++     V    +D  +RY+D R+FG F + N+ ++L    + +L  DP E +F   Y K  + KS  A+K  LL+Q+ +SG+GNIY +E+LF + +HPET A  L  +  + I E ++ +L KA+   G++I+T+  ++  KG FQ  L VH K+   C  C   I+KIKV GRGTYLC  CQ  K
  S:     1 MPELPEVQIIVNILKSK-LIGAKIIKTKVFYAPVIKN--FEAFSQ-IEEKTILDIQRKGKFLLFFLTQKLVIIGHLRLEGKLFLKPASNPHEATEHFVLFFDNDLSLRYYDFRKFGRFEVQNQKDFLTKTTLNQLASDPFEIDFMTFYQK--VVKSKTALKKVLLNQKIISGLGNIYVNEVLFLAKLHPETKACDLNPSQVQNILEIAKKVLKKAIFFGGSSISTFEPEEGTKGSFQNHLLVHGKQKIPCTVCMTNIIKIKVGGRGTYLCPSCQPIK 271
>gi|148984712|ref|ZP_01817980.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP3-BS71] >gi|147923103|gb|EDK74218.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP3-BS71] (274 aa)
Score = 460, Expect = 3.7e-44, Identities = 109/276 (39%), Positives = 166/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  SL E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  +  + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRSL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFCLT-DKVLISHLRMEGKYFY-YPDQVPERKHAHVFFRFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQAALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|148992895|ref|ZP_01822514.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP9-BS68] >gi|168490211|ref|ZP_02714410.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP195] >gi|147928347|gb|EDK79363.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP9-BS68] >gi|183571439|gb|EDT91967.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP195] (274 aa)
Score = 460, Expect = 3.9e-44, Identities = 108/276 (39%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARSSQTLTAEEATAIHDQTIAVLNQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|23099617|ref|NP_693083.1| formamidopyrimidine-DNA glycosylase [Oceanobacillus iheyensis HTE831] >gi|29611715|sp|Q8EPE6|FPG_OCEIH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|22777847|dbj|BAC14118.1| formamidopyrimidine-DNA glycosidase [Oceanobacillus iheyensis HTE831] (280 aa)
Score = 460, Expect = 4.2e-44, Identities = 107/277 (38%), Positives = 163/277 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV+++ ++LK   C N+TI +I+   P + K+    E+F   +  + I+ + RKGK+L+F+L ++ V + HLRMEGK           KKH  V     +  E+RY+D R+FGT  +Y        K + +LG DP +  F+ +Y    +K+++R IKT LLDQ  V+G+GNIY DE LF +++HP    +KL+  + KK+  N++  L  A++  GTTI +Y   +   G FQ+ L V+ +    C  C   I+KIKV GRGT+LC  CQ  K
  S:     1 MPELPEVETIKETLKLFVC-NKTIKHIDIEWPNMIKHPDDVEEFKALVTGQTIRSMGRKGKFLLFYL-DEYVLISHLRMEGKYSVHSPGDPV-KKHTHVTFYFSNGEELRYNDVRKFGTMHVYPIGEEFMHKPLNQLGPDPFDTSFNLEYFYEKLKRTDRYIKTALLDQSIVTGLGNIYVDETLFRANVHPLKRCSKLSKQEVKKLQINAKETLRDAIKAGGTTIRSYVNTQGDMGMFQQDLYVYGQHSKPCRVCGADIIKIKVGGRGTHLCPTCQPNK 276
>gi|149002521|ref|ZP_01827455.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP14-BS69] >gi|147759458|gb|EDK66450.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae SP14-BS69] (274 aa)
Score = 460, Expect = 4.2e-44, Identities = 108/276 (39%), Positives = 167/276 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F+LT DKV + HLRMEGK F+   D   ++KH  V    +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  ++ + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRGL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFYLT-DKVLISHLRMEGKYFY-YPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVTGLGNIYVDEVLWRAQVHPARSSQTLTAEEATAIHDQTIAVLNQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|160914227|ref|ZP_02076448.1| hypothetical protein EUBDOL_00237 [Eubacterium dolichum DSM 3991] >gi|158433854|gb|EDP12143.1| hypothetical protein EUBDOL_00237 [Eubacterium dolichum DSM 3991] (275 aa)
Score = 460, Expect = 4.6e-44, Identities = 111/277 (40%), Positives = 157/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN----CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNE-NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V+ +L+ Q      +  IE +  ++  +       + F   I +++I+   R GKYL+F L +   F+VHLRMEGK + +     YDK  HV+  +  D  E+RYHDTR+FG   +Y +  NY +      +G D  +EE     L   + K    +K  LLDQ  ++GIGNIYADEI +A  +HPET  + L   DF  +   +R IL+ A+   GTTI +Y       G FQ  LKVH +K   C NC+ +I KI V GRGTY C  CQKK+
  S:     1 MPELPEVETVVRTLEHQ------LQQIEIMDCRVLWDNIIAMDTQAFIETIRHKKIQGYHRHGKYLMFDLGSYD-FIVHLRMEGKFYVQAPQEPYDKHTHVIFSLS-DGRELRYHDTRKFGKMVLYPKLENYQEYPCFAHIGPDAFDEELCADSLYRMLHKKKTYLKAVLLDQSVMAGIGNIYADEICYAMRMHPETKISHLRKKDFAVLITETRRILSGAIRAGGTTIRSYTSSLGVDGRFQLKLKVHARKGEACPNCQGEIKKITVAGRGTYYCPTCQKKR 275
>gi|188159183|ref|ZP_02998592.1| formamidopyrimidine-DNA glycosylase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (274 aa)
Score = 456, Expect = 1.1e-43, Identities = 111/274 (40%), Positives = 164/274 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-SYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV +V +++K +  +NRTI N +    KI  + S + F +   N++I D+    KY++  L  + V + HLRM GK   E +D  +Y K  +  ++ +D+  + R++D R FGT  +YN+  +L    + KLG  PL  +    YL N ++KSN+AIKT LLDQ  +SG+GNIY +E+LF S I+P T AN +T +   +I +N   +L++A+  KGTTI+ +       G +Q  L VH     +C  C  KI KIKVNGRGTY C KCQ
  S:     1 MPELPEVVTVTNTIKPK-IINRTILNSQIFTNKIISSTSVDQFINLTKNQKIYDVYNLAKYIVIEL-KEHVIISHLRMTGKWVIENSDQYAYKKSWLRAELLLDNNLVFRFYDMRGFGTLNLYNKQTFLKDSHLDKLGPIPLNNQTSVDYLFNKLQKSNKAIKTVLLDQHVISGLGNIYVNEVLFLSKINPLTSANLITRDQTNEIIKNCETVLSQAILLKGTTISDFESLPGITGGYQTKLLVHMNNK-NCKICDTKISKIKVNGRGTYYCSKCQ 273
>gi|167217634|ref|ZP_02287270.1| hypothetical protein LmonocFSL_12710 [Listeria monocytogenes FSL J1-175] (229 aa)
Score = 456, Expect = 1.1e-43, Identities = 96/229 (41%), Positives = 146/229 (63%)
  Q:    47 IINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           ++ ++I+ + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I E ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     2 LVGQEIEGVRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDEKEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKVYGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK 229
>gi|168483039|ref|ZP_02707991.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC1873-00] >gi|172043411|gb|EDT51457.1| formamidopyrimidine-DNA glycosylase [Streptococcus pneumoniae CDC1873-00] (274 aa)
Score = 455, Expect = 1.6e-43, Identities = 108/276 (39%), Positives = 165/276 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V  SL E+  + + I++IE   PK+ K    E+F   + ++ I+ + R+GKYL+F LT DKV + HLRMEGK F+   D   ++KH       +D   + Y D R+FGT  +   +  LD+  I KKLG +P E++FD +  +  + KS + IK+ LLDQ  V+G+GNIY DE+L+ + +HP   +  LT  +   I + +  +L +AVE  G+TI TY     + G  Q F +V+ K   +CV C   I KI++ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRSL-EKLIIGKKISSIEIRYPKMIKT-DLEEFQRELPSQIIESMGRRGKYLLFCLT-DKVLISHLRMEGKYFY-YPDQVPERKHAHFFFRFEDGGTLVYEDVRKFGTMELLVPD-LLDAYFISKKLGPEPSEQDFDLQIFQAALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLWRAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVYDKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRR 273
>gi|148544470|ref|YP_001271840.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Lactobacillus reuteri F275] >gi|184153835|ref|YP_001842176.1| formamidopyrimidine-DNA glycosylase [Lactobacillus reuteri F275] >gi|148531504|gb|ABQ83503.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Lactobacillus reuteri F275] >gi|183225179|dbj|BAG25696.1| formamidopyrimidine-DNA glycosylase [Lactobacillus reuteri F275] (276 aa)
Score = 454, Expect = 2.0e-43, Identities = 105/274 (38%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L +     R I  I+    K   N   EDF   +I + I++I R+GKYL+F  TND   + HLRMEG+ + +      DK   +V    D  E+ Y DTR+FG  T+    + ++   +K +G +P E+ F   Y    +KKS   IK  LL+Q +V+G+GNIY DE+L+ + I+PE  AN LT N   ++ EN    LA A++ KGTT+ ++       G FQ  LK +     +C  C  K+VKIKV  RGT  C  CQ
  S:     1 MPELPEVETVRRGLLKIAA-KRKINAIDVYYGKTITN-DVEDFRQALIGQTIENIDRRGKYLLFRFTNDLTMISHLRMEGRYYNQPIGGPIDKHTHVVFEFTDGTELCYQDTRKFGRMTLVKTGDEMNVGGLKTIGPEPTEDAFTLPYFTTELKKSRGKIKPFLLNQRHVAGLGNIYVDEVLWMTGINPEQPANTLTANQIAELRENIIKELATAIKYKGTTVHSFTNAFGDAGAFQDRLKAYGHAGDECPRCGTKMVKIKVAERGTTFCPHCQ 272
>gi|134299455|ref|YP_001112951.1| formamidopyrimidine-DNA glycosylase [Desulfotomaculum reducens MI-1] >gi|172044279|sp|A4J4X3|FPG_DESRM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|134052155|gb|ABO50126.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Desulfotomaculum reducens MI-1] (277 aa)
Score = 454, Expect = 2.3e-43, Identities = 96/277 (34%), Positives = 159/277 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQI-KDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++++ SL E+      IT+++   P++ +    + FT  I+  Q  K + R+GKYL+ H+++    V+HLRM G+L +   D   +K H  V   +D+  ++R+ D RRFG  ++           IK++G +PL+  F  +YLK  +++    IK+ LLDQ  V+G+GNIYADE L  + IHPE +A  LT  +   + +    +++  ++++GTT   Y   + + G +Q  LKV+ ++   C +C   I +IKV GR +Y C  CQK K
  S:     1 MPELPEVETIVRSL-EKHLSGLVITSVDLFKPEVIRTPRVDIFTDQIVGRQFQKKLGRRGKYLLLHMSDGLTLVIHLRMTGRLIYCDADLPLEK-HTHVIFHLDNGKQLRFADVRRFGRMSLVPTREVPHLPGIKEMGPEPLDTAFSREYLKKELRRRRTRIKSLLLDQCFVAGLGNIYADEALHEAKIHPERLAPDLTSREASGLHKAIIEVISSGIKHRGTTFRDYVDGEGRSGSYQHQLKVYNREGLPCPHCGKPIQRIKVAGRSSYYCSSCQKAK 277
>gi|172058210|ref|YP_001814670.1| formamidopyrimidine-DNA glycosylase [Exiguobacterium sibiricum 255-15] >gi|171990731|gb|ACB61653.1| formamidopyrimidine-DNA glycosylase [Exiguobacterium sibiricum 255-15] (276 aa)
Score = 453, Expect = 2.4e-43, Identities = 108/275 (39%), Positives = 157/275 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVV-HLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNN-IKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V  SL E+    +TI++++   PK+ +      F   +  E+I+ + R+GK+L+F  T D+ ++V HLRMEGK F        DK  HV+ +   D  E+ Y+D R+FGT  +  +   +    + +L  +P +  F  + L  N I+K    IKT+LLDQ    G+GNIY DE LFA+ +HP T A  LT +D  +I      +LAKAVE+ G+TI +Y      KGEFQ  L V+ +    C  C   I KIKV GRGT+ C  CQ+
  S:     1 MPELPEVETVRRSL-ERTVSGKTISSVKVFHPKMIRGMEVAPFVDALKQERIERVERRGKFLLF--TFDRFYLVSHLRMEGKYFPYPQAIEKDKHTHVIFRF-TDGSELHYNDVRKFGTMELREKETAMSVPPLAQLEREPFDPTFTAEVLAENLIRKKRSPIKTSLLDQSIFLGLGNIYVDETLFAARVHPLTKAGALTLDDISRIHAAGVDVLAKAVESGGSTIRSY-VSPTGKGEFQLQLAVYGQTGAPCPRCGTAIEKIKVGGRGTHFCPTCQQ 273
>gi|39939160|ref|NP_950926.1| formamidopyrimidine-DNA glycosylase [Onion yellows phytoplasma OY-M] >gi|39722269|dbj|BAD04759.1| formamidopyrimidine-DNA glycosylase [Onion yellows phytoplasma OY-M] (276 aa)
Score = 452, Expect = 3.1e-43, Identities = 111/274 (40%), Positives = 162/274 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQ--IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEVQ ++D LK+       +   + +  K+F     ++   +   EQ  I DI RKGK+L+F LT + V + HLRMEGKLF +  D    K      I  D   +RY+D R+FG F + N+N +L    + +L LDP E   +   L   I K+  A+K  LL+Q+ +SG+GNIY +E+LF   +HPET A +L+    ++I   S+ +L KA++  GTT++T+  +    G FQ  L+VH K +  C+NC+ KI+KIKV GRGTYLC  CQ
  S:     1 MPELPEVQIIVDFLKK------KLIGKKIVATKVFYETVVKNTKEFQKIEQTTILDIQRKGKFLLFFLTQELVLIGHLRMEGKLFIKPCDEPKHKYEHFAIILEDKSSLRYYDFRKFGRFEVKNQNIFLTQTTLHQLALDPFE--INPAVLYQKILKTKSALKKVLLNQKIISGLGNIYVNEVLFLVKLHPETKACELSLEQVQEIVTISQKVLTKAIKMGGTTVSTFESQPGIIGYFQNKLQVHGKVNKPCINCQTKIIKIKVGGRGTYLCPVCQ 268
>gi|42561208|ref|NP_975659.1| formamidopyrimidine-DNA glycosylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492706|emb|CAE77301.1| formamidopyrimidine-DNA glycosylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (274 aa)
Score = 451, Expect = 4.1e-43, Identities = 110/274 (40%), Positives = 164/274 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-SYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV +V +++K +  +NRTI N +    KI  + + + F +   N++I D+    KY++  L  + V + HLRM GK   E +D  +Y K  +  ++ +D+  + R++D R FGT  +YN+  +L    + KLG  PL  +    YL N ++KSN+AIKT LLDQ  +SG+GNIY +E+LF S I+P   AN +T +  K+I +N   +L++A+  KGTTI+ +       G +Q  L VH     +C  C  KI KIKVNGRGTY C KCQ
  S:     1 MPELPEVVTVTNTIKPK-IINRTILNSQIFTNKIISSTNVDQFINLTKNQKIYDVYNLAKYIVIEL-KEHVIISHLRMTGKWVIENSDQYAYKKSWLRAELLLDNNLVFRFYDMRGFGTLNLYNKQTFLKDSHLDKLGPIPLNNQTSADYLFNKLQKSNKAIKTVLLDQHVISGLGNIYVNEVLFLSKINPLVSANLITKDQTKEIIKNCETVLSQAILLKGTTISDFESLPGITGGYQTKLLVHMNNK-NCKICDTKISKIKVNGRGTYYCSKCQ 273
>gi|171326333|ref|ZP_02914815.1| formamidopyrimidine-DNA glycosylase [Geobacillus sp. WCH70] >gi|171087690|gb|EDT34059.1| formamidopyrimidine-DNA glycosylase [Geobacillus sp. WCH70] (274 aa)
Score = 450, Expect = 5.7e-43, Identities = 103/274 (37%), Positives = 152/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-EKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ +  +L       +TI +I+   PKI K      +F   +  + I+DI R+GK+L F L ++ V + HLRMEG+    +K D      H++ +  +D  E+RY D R+FGT  +Y +        + +LG +P  E F   +L   ++K+NR IKT LLDQ  V G+GNIY DE LF + IHPE I++ LTD +  ++      IL +A+E  G+T+ +Y     + G FQ  L V+ +K   C  C   I K  V GRGT+ C  CQ
  S:     1 MPELPEVEIIRRTLIPLTA-GKTIADIQVFWPKIIKYPADVTEFIETMKGQTIRDIHRRGKFLKFTL-DEHVLISHLRMEGRYAVCKKEDPIEPHTHIIFRF-IDGTELRYRDVRKFGTMHLYRKGEEEARLPLSQLGPEPFSETFTANFLAQRLRKTNRTIKTALLDQTVVVGLGNIYVDESLFRAGIHPERISSSLTDEEVARLHREMVTILQEAIEKGGSTVRSYVNTNGEAGTFQLQLFVYGRKGEPCQRCGQPIQKTVVAGRGTHYCAFCQ 273
>gi|29375464|ref|NP_814618.1| formamidopyrimidine-DNA glycosylase [Enterococcus faecalis V583] >gi|39931263|sp|Q837G3|FPG_ENTFA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|29342924|gb|AAO80688.1| formamidopyrimidine-DNA glycosylase [Enterococcus faecalis V583] (280 aa)
Score = 450, Expect = 6.6e-43, Identities = 102/277 (36%), Positives = 154/277 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E+  + +TI  +    P+I ++   + F   +  + I+ I R+GK+LIF L+++ + + HLRMEGK  F + D    K   ++    D  ++RY D R+FG  T+  +N     K I  LG +P  + F     +  +KK ++AIK  LLDQ+ V+G+GNIY DE L+ + IHPE  A+ L   +   + +    +LA+AVE  GTTI TY     + G FQ  L V+ +    C  C   IVK KV  RGT+ C +CQ+ K
  S:     1 MPELPEVETVRKGL-EKLVVGKTIQEVIVFWPRIIESPEVDVFQGQLAGQTIEGIERRGKFLIFKLSDNDM-ISHLRMEGKYEFHQADDEIAKHTHVMFTFTDGTQLRYLDVRKFGRMTLVPKNQGHQYKGILALGPEPTPDVFQLATFQQGLKKHHKAIKPLLLDQKLVTGLGNIYVDEALWQAQIHPEQPADSLKPAEVATLYQAIIDVLARAVEAGGTTIRTYLNALGEAGTFQVALNVYGQTGLPCNRCGTPIVKTKVAQRGTHYCPQCQQLK 275
>gi|90961465|ref|YP_535381.1| formamidopyrimidine-DNA glycosylase [Lactobacillus salivarius UCC118] >gi|122449230|sp|Q1WUN7|FPG_LACS1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|90820659|gb|ABD99298.1| Formamidopyrimidine-DNA glycosylase [Lactobacillus salivarius UCC118] (276 aa)
Score = 449, Expect = 7.2e-43, Identities = 109/274 (39%), Positives = 152/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E+  LN+ I +I  +  K   N   E F   + N+ IK I R+GKYL+F  ++D   + HLRMEGK F E +    +K   +V    D   +RY+D R+FG   +      + +  + KLG +P E+ F  +    N+K+  +AIK  LLDQ  V+G+GNIYADE+L+ S IHPET ANKLT+ + K + +N    LA A E  GTTI +Y       G FQ  L  + +    C  C   I +I V  RGT+ C KCQ
  S:     1 MPELPEVETVRRGL-EKLVLNKKIKDIRVLYSKTIVNEESE-FIEKLTNKTIKKIDRRGKYLLFRFSSDLTMISHLRMEGKYFVEPSTKEVEKHTHVVFDFTDGTSLRYNDVRKFGRMQLVKTGMEIQTAGLAKLGPEPKEKTFIVEDFSKNLKRRKKAIKNALLDQTIVAGLGNIYADEVLWMSKIHPETPANKLTEEEVKVLRDNIIKELALATEAGGTTIRSYTDAFRHSGGFQFSLHAYQRTGDPCERCGTPIQRIVVGQRGTHFCPKCQ 272
>gi|148377581|ref|YP_001256457.1| foramidopyrimidine DNA glycosylase [Mycoplasma agalactiae PG2] >gi|148291627|emb|CAL59013.1| Foramidopyrimidine DNA glycosylase [Mycoplasma agalactiae PG2] (279 aa)
Score = 449, Expect = 7.4e-43, Identities = 116/276 (42%), Positives = 170/276 (61%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK--KHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V+ +LK    LN TITN+   + K+ KN +  +F +Y++NE+I D+   GK +I+ L+N+K  V HLRM GK F   TDSS ++  KH  +  E+D    + Y+D+R+FGTF I N+N    SK + KLG +   ++ D K L  +++  +  IK+ LLDQ  + GIGNIYA+EILF S I+P T  NK+    FK+I  N++IIL KA E  G+TI  +      +G+FQ  L+VH + +  C  C   I +  +  R TY C  CQK+
  S:     1 MPELPEVKTVVKALKGN-ILNLTITNVIVKLDKLIKNATASEFKNYLLNEKILDVYNVGKNIIYKLSNNKNLVSHLRMTGKYF---TDSSINRTRKHDYIIFELDSQMFLFYNDSRQFGTFHIKNDNELFSSKPLDKLGKEV--DKIDPKNLYESVRNKSIPIKSFLLDQSYILGIGNIYANEILFLSKINPWTKTNKIPYEKFKEILSNTKIILDKATELGGSTIVDFSGLNGAEGQFQNHLQVHMRANMPCNKCNALIQQEFIAQRMTYYCPICQKE 273
>gi|54020255|ref|YP_116103.1| formamidopyrimidine-DNA glycosylase [Mycoplasma hyopneumoniae 232] >gi|53987428|gb|AAV27629.1| foramidopyrimidine DNA glycosylase [Mycoplasma hyopneumoniae 232] (275 aa)
Score = 449, Expect = 7.4e-43, Identities = 106/275 (38%), Positives = 167/275 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV +V+++LK +  + + I N+ +      K  ++ DF   I+N  I DI  + K+++  L N KV + HLRM GK F  K+   + K   +  +  D+  + Y+D+R+FGTF I +      +K +K L  +P   + D  Y K  I+KS R+IK  LLDQ+ +SG+GNIYADE+ FA+ I P   A  ++  + + I + S+ IL ++++  G++I++Y     ++G+FQ FLKVHTK++F C NC+ KI+K  + GRGTY C  CQK
  S:     1 MPELPEVITVVNALKTE-VIGKKIKNVLARDSNFIKEINFFDFQKSIVNATIIDIQNRAKHILIFLDNRKVILSHLRMNGKYFTYKS-PQWGKYDYISFVFSDNSVLNYNDSRKFGTFMIRDVELLFKTKPLKDLAPEPFFIKVDDFYQK--IRKSTRSIKAILLDQKIISGLGNIYADEVCFATKIFPGKAAKLISRKEAELIIDFSKKILQESIKLGGSSISSYTSLNAKEGKFQNFLKVHTKQNFPCSNCQTKILKTVIAGRGTYFCPFCQK 271
>gi|83319527|ref|YP_424603.1| formamidopyrimidine-DNA glycosylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283413|gb|ABC01345.1| formamidopyrimidine-DNA glycosylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (274 aa)
Score = 448, Expect = 1.0e-42, Identities = 113/275 (41%), Positives = 163/275 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-SYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV +V +++K    +N+TI   E    KI  + S E F +    ++I DI    KY++F L  + V + HLRM GK   E +D  +Y K  +  +  +D+  + R++D R FGT  +YN++ +L    + KLG  PL  +    YL N ++KSN+AIKT LLDQ  +SG+GNIY +E+LF S I+P T AN +T +  K+I +N   +L++A+  KGTTI+ +       G +Q  L VH     +C  C  KI KIKVNGRGTY C  CQK
  S:     1 MPELPEVVTVTNTIKPS-LINKTIIKSEIFSNKIVSSTSVEQFINLTKEQKILDIYNLAKYIVFEL-KEYVIISHLRMTGKWVIENSDQYAYKKSWLKAEFLLDNNLVARFYDMRGFGTLNLYNKSTFLKDSHLDKLGPIPLNNQTSVDYLFNKLQKSNKAIKTVLLDQHVISGLGNIYVNEVLFLSKINPLTNANLITKDQTKEIIKNCENVLSQAILLKGTTISDFESLPGVTGSYQTKLFVHLNNK-NCKLCNTKISKIKVNGRGTYYCSSCQK 274
>gi|71893928|ref|YP_279374.1| formamidopyrimidine-DNA glycosylase [Mycoplasma hyopneumoniae J] >gi|71852055|gb|AAZ44663.1| foramidopyrimidine DNA gycosylase [Mycoplasma hyopneumoniae J] (275 aa)
Score = 447, Expect = 1.2e-42, Identities = 106/275 (38%), Positives = 166/275 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV +V+++LK +  + + I N+ +      K  ++ DF   I+N  I DI  + K+++  L N KV + HLRM GK F  K+   + K   +  +  D+  + Y+D+R+FGTF I +      +K +K L  +P   + D  Y K  I+KS R+IK  LLDQ+ +SG+GNIYADE+ FA+ I P   A  ++  + + I   S+ IL ++++  G++I++Y     ++G+FQ FLKVHTK++F C NC+ KI+K  + GRGTY C  CQK
  S:     1 MPELPEVVTVVNALKTE-VIGKKIKNVLARDSNFIKEINFFDFQKSIVNATIIDIQNRAKHILIFLDNRKVILSHLRMNGKYFTYKS-PQWGKYDYISFVFSDNSVLNYNDSRKFGTFMIRDVELLFKTKPLKDLAPEPFFIKVDDFYQK--IRKSTRSIKAILLDQKIISGLGNIYADEVCFATKIFPGKTAKLISRKEAELIIYFSKKILQQSIKLGGSSISSYTSLNAKEGKFQNFLKVHTKQNFPCSNCQTKILKTVIAGRGTYFCPFCQK 271
>gi|72080906|ref|YP_287964.1| formamidopyrimidine-DNA glycosylase [Mycoplasma hyopneumoniae 7448] >gi|71914030|gb|AAZ53941.1| foramidopyrimidine DNA gycosylase [Mycoplasma hyopneumoniae 7448] (275 aa)
Score = 447, Expect = 1.4e-42, Identities = 106/275 (38%), Positives = 166/275 (60%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV +V+++LK +  + + I N+ +      K  ++ DF   I+N  I DI  + K+++  L N KV + HLRM GK F  K+   + K   +  +  D+  + Y+D+R+FGTF I +      +K +K L  +P   + D  Y K  I+KS R+IK  LLDQ+ +SG+GNIYADE+ FA+ I P   A  ++  + + I   S+ IL ++++  G++I++Y     ++G+FQ FLKVHTK++F C NC+ KI+K  + GRGTY C  CQK
  S:     1 MPELPEVVTVVNALKTE-VIGKKIKNVLARDSNFIKEINFFDFQKSIVNATIIDIQNRAKHILIFLDNRKVILSHLRMNGKYFTYKS-PQWGKYDYISFVFSDNSVLNYNDSRKFGTFMIRDVELLFKTKPLKDLAPEPFFIKVDDFYQK--IRKSTRSIKAILLDQKIISGLGNIYADEVCFATKIFPGKAAKLISRKEAELIIYFSKKILQESIKLGGSSISSYTSLNAKEGKFQNFLKVHTKQNFPCSNCQTKILKTVIAGRGTYFCPFCQK 271
>gi|475032|dbj|BAA05066.1| formamidopyrimidine-DNA glycosylase [Streptococcus mutans] (273 aa)
Score = 446, Expect = 1.6e-42, Identities = 108/276 (39%), Positives = 162/276 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E   + + I ++E  +PK+ K    EDF   I+ +  + I R+GKYL+ +L N +  + HLRMEGK L FE  D   D KH  +   +D    + Y D R+FGTF +  ++        KK+G +P  ++F  K  +  + KS++ IKT LLDQ  V+G+GNIY DE+L+A+ + PE +A++L  ++ K+I + +  IL  A+E  G+TI +Y     + G  Q  L+V+ K D  C  C   I KIKV GRGT+ C  CQK+
  S:     1 MPELPEVETVRRGL-EHLIVGKKIVSVEVRVPKMVKT-GVEDFQLDILGQTFESIGRRGKYLLLNL-NRQTIISHLRMEGKYLLFE--DEVPDNKHFHLFFGLDGGSTLVYQDVRKFGTFELLPKSQVEAYFVQKKIGPEPNAKDFKLKPFEEGLAKSHKVIKTLLLDQHLVAGLGNIYVDEVLWAAKVDPERLASQLKTSEIKRIHDETIRILQLAIEKGGSTIRSYKNSLGEDGSMQDCLQVYGKTDQPCARCATPIEKIKVGGRGTHFCPSCQKQ 273
>gi|118406894|gb|AAO39419.2| foramidopyrimidine-DNA glycosylase [Mycoplasma hominis] (275 aa)
Score = 446, Expect = 1.8e-42, Identities = 113/275 (41%), Positives = 162/275 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVK-IEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V+ +L     LN+ ITN+    PKIFK  S + F   + +++I+ I   GK++IF L+   V + HLRMEGK  +         KH++ + +  D+ E+ + D R FGT+ + N  NY     I  LG +P  ++ D + L   IK S   IKT LLDQ  V+GIGNIYADE LFAS IHP + A+ L+    K I +N+  I+ K+ E  GTT+ +Y    +Q+G++Q FL +H+     C  C  K +K+KVN RGTY+C  CQK
  S:     1 MPELPEVRVVVKALNNT-ILNKKITNLIIYKPKIFKEFSPQYFISILRDKKIEKIDNIGKHIIFFLSEKLVLLSHLRMEGKYRYYLNPPKEIDKHLVARFVFSDNSELHFLDKRLFGTYMLRNLENYNKIPPISLLGPEP--KDIDIEALFKKIKNSKMPIKTKLLDQSFVAGIGNIYADEALFASKIHPLSKASDLSLEQLKDIIKNANEIMEKSYELGGTTLFSYESLNKQEGKYQDFLNIHSDSIKKCKVCGQKTLKLKVNQRGTYVCPNCQK 273
>gi|24379994|ref|NP_721949.1| formamidopyrimidine-DNA glycosylase [Streptococcus mutans UA159] >gi|26006954|sp|P55045|FPG_STRMU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|24377981|gb|AAN59255.1|AE014992_10 putative formamidopyrimidine-DNA glycosylase [Streptococcus mutans UA159] (273 aa)
Score = 446, Expect = 1.9e-42, Identities = 108/276 (39%), Positives = 162/276 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E   + + I ++E  +PK+ K    EDF   I+ +  + I R+GKYL+ +L N +  + HLRMEGK L FE  D   D KH  +   +D    + Y D R+FGTF +  ++        KK+G +P  ++F  K  +  + KS++ IKT LLDQ  V+G+GNIY DE+L+A+ + PE +A++L  ++ K+I + +  IL  A+E  G+TI +Y     + G  Q  L+V+ K D  C  C   I KIKV GRGT+ C  CQK+
  S:     1 MPELPEVETVRRGL-EHLIVGKKIVSVEVRVPKMVKT-GVEDFQLDILGQTFESIGRRGKYLLLNL-NRQTIISHLRMEGKYLLFE--DEVPDNKHFHLFFGLDGGSTLVYQDVRKFGTFELLPKSQVEAYFVQKKIGPEPNAKDFKLKPFEEGLAKSHKVIKTLLLDQHLVAGLGNIYVDEVLWAAKVDPERLASQLKKSEIKRIHDETIRILQLAIEKGGSTIRSYKNSLGEDGSMQDCLQVYGKTDQPCARCATPIEKIKVGGRGTHFCPSCQKQ 273
>gi|120474|sp|P19210|FPG_BACFI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|39475|emb|CAA37877.1| unnamed protein product [Bacillus firmus] (274 aa)
Score = 445, Expect = 2.4e-42, Identities = 102/274 (37%), Positives = 155/274 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  +L E   + +TI  I      I K      +F   ++N+ I+ I R+GK+L+F   +D V V HLRMEG+   +EK +      HV+     D  E+RY D R+FGT  ++ + +      +  LG++P  E+F  + L N  +K+NR IK  LLDQ+ V G+GNIY DE LF + IHPE +A+ L+  +   + +     L +AVE  G++I +Y   + + G FQ+ L V+ +K+  C  C   I+K  V GRGT+ C  CQ
  S:     1 MPELPEVETVKRTLTEL-VIGKTIAGITVKWANIIKEPADVLEFETLLMNQTIRSIRRRGKFLLFEF-DDIVMVSHLRMEGRYGLYEKEEPLPPHTHVIFHF-TDGEELRYQDVRKFGTMHLFPKGSEEKVLPLAHLGVEPFSEQFTSELLMNAFQKTNRKIKVALLDQKTVVGLGNIYVDEALFRARIHPERLAHSLSKEEMAVLHKAIVSTLEEAVEMGGSSIKSYVNGQGEMGMFQQKLGVYGRKNEPCRQCGTDILKTVVGGRGTHFCPNCQ 273
>gi|167754595|ref|ZP_02426722.1| hypothetical protein CLORAM_00097 [Clostridium ramosum DSM 1402] >gi|167705427|gb|EDS20006.1| hypothetical protein CLORAM_00097 [Clostridium ramosum DSM 1402] (270 aa)
Score = 443, Expect = 3.9e-42, Identities = 112/277 (40%), Positives = 166/277 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKK-HVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V  +LK    LN+ I +I+ + P I ++   E+F     N+ I DI R GK+LIF L +D  FV HLRMEGK  + + D   +K  H++  ++ D+ ++RY+DTR+FG   + + +NY++   + KLG +P   + +  Y K  + KSN  IK  +LDQ  ++GIGNIYA+EI FA  ++P T A KLT    +++ E S  IL +A+   GTTI + F      G FQ  LK H +K   C  C  +I K+ + GRGTY C  CQK++
  S:     1 MPELPEVETVRRTLK-NFVLNKKIISIDVLYPNIIED-DVEEFIEACTNQTINDIDRAGKFLIFKL-DDIAFVSHLRMEGKYHYVEHDEPLNKHDHIIFNLD-DNKQLRYNDTRKFGRMKLVSLDNYMNEIPLCKLGPEPFNAKLEDIYPK--LHKSNLPIKHAILDQSIIAGIGNIYANEICFAMGLNPNTPACKLTKKSVQELIEVSSAILNEAIAQGGTTIHS-FSANGIDGLFQVKLKAHLQK--VCPICGGEITKVAIKGRGTYYCKHCQKRR 269
>gi|187606144|ref|ZP_02992316.1| formamidopyrimidine-DNA glycosylase [Exiguobacterium sp. AT1b] >gi|187481802|gb|EDU19834.1| formamidopyrimidine-DNA glycosylase [Exiguobacterium sp. AT1b] (275 aa)
Score = 443, Expect = 4.1e-42, Identities = 95/276 (34%), Positives = 152/276 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLF-FEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKK-SNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L+      +TI +++ + PKI +    E++ H++I E I D+ R+GK+++F LTN    V HLRMEGK F +E         HV++    D   + Y+D R+FGT  +        +  +  L  +P +E    + L   +++   RAIKT LLDQ    G+GNIY DE LF + +HP   A  L+  +  ++   +  +L +A+E  G+TI +Y       G FQ+ L V+ +    C  C ++I K+K+ GRGT+ C  CQ++
  S:     1 MPELPEVETVCRRLRP-AVSGKTIQSVDVLDPKIIRGLDPEEWVHHLIGETITDVERRGKFILFKLTNG-YLVSHLRMEGKFFPYETATEPVKHTHVVITF-TDQSTLHYNDVRKFGTMELRTNETIHTTPPLSLLAYEPFDERVTTEALHRRLERMKTRAIKTALLDQSIFVGLGNIYVDETLFRAGVHPTRPAASLSREEVDRVRTEAVAVLNEAIERGGSTIRSYADPDGATGTFQERLYVYGQTGEPCRRCGHEIEKMKLGGRGTHYCPHCQQR 275
>gi|94993817|ref|YP_601915.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS10750] >gi|139474273|ref|YP_001128989.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes str. Manfredo] >gi|94547325|gb|ABF37371.1| Formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS10750] >gi|134272520|emb|CAM30783.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes str. Manfredo] (275 aa)
Score = 440, Expect = 7.5e-42, Identities = 106/277 (38%), Positives = 157/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+A+ +HPET +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGL-EALVLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFETALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|167404517|ref|ZP_02309308.1| hypothetical protein LmonocytFSL_12585 [Listeria monocytogenes FSL J2-003] (221 aa)
Score = 440, Expect = 7.6e-42, Identities = 94/221 (42%), Positives = 140/221 (63%)
  Q:    55 ITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           + R+GK+L+F LTN  + + HLRMEGK    ++ +      H++   E D  E+R+ D R+FGT  + N+    +++ IKKLG +PL + F        +KK++RAIKT LLDQ+ V+G+GNIYADEI F + + PE  AN L+D + K+I + ++ I+ +AV   G+T+ TY   + + G++Q  LKV+ K D  CV C   I KIK+NGRGT+ C  CQK
  S:     2 VRRRGKFLLFDLTNCTI-LSHLRMEGKFRLMDENEEVSKHTHIIFHFE-DHTELRFLDVRKFGTMEVTNKYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEICFEAKVRPERAANSLSDKEIKRIFKATKSIMTEAVALGGSTVRTYVNSQGKLGQYQNKLKVYGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK 221
>gi|19745616|ref|NP_606752.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS8232] >gi|56808814|ref|ZP_00366528.1| COG0266: Formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes M49 591] >gi|94988038|ref|YP_596139.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS9429] >gi|94991924|ref|YP_600023.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS2096] >gi|24211705|sp|Q8P250|FPG_STRP8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|19747744|gb|AAL97251.1| putative formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS8232] >gi|94541546|gb|ABF31595.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS9429] >gi|94545432|gb|ABF35479.1| Formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS2096] (275 aa)
Score = 439, Expect = 1.1e-41, Identities = 106/277 (38%), Positives = 157/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+A+ +HPET +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGL-ETLVLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|124522852|ref|ZP_01697266.1| formamidopyrimidine-DNA glycosylase [Bacillus coagulans 36D1] >gi|124495847|gb|EAY43492.1| formamidopyrimidine-DNA glycosylase [Bacillus coagulans 36D1] (277 aa)
Score = 439, Expect = 1.1e-41, Identities = 103/277 (37%), Positives = 153/277 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSY-EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV+++  +L  Q     TI ++  ++PK+ K   + E F   +  E I+ + R+GK+LIF+ T+    V HLRMEG+      +   +K   ++       E+RY D R+FGT  ++ +   L S  + KLG +PL + F  KYL   +KK+ R +K+ LLDQ  +SG+GNIY DE LF + I+PE  A  LT  D   +       L +AVE  G+T+ +Y   + Q G FQ  L V+ +K   C  C   I K+   GRGT+ C  CQKK+
  S:     1 MPELPEVETIRRTLA-QLVAGETIESVTVLLPKMVKKPLHTEAFADALAGETIRSLGRRGKFLIFY-TDHYALVSHLRMEGRYRVYDQNEPVEKHTHMIFHFQSGKELRYKDVRKFGTMHLFLKGEELSSLPLSKLGPEPLSDTFTEKYLYGQLKKTERNVKSCLLDQTVISGLGNIYVDESLFRAHIYPERKAKSLTKKDVHLLHSEIIQTLQEAVEKGGSTVRSYVNSQGQMGMFQLELYVYGRKGEPCRKCGTPIEKMVTAGRGTHYCPNCQKKR 276
>gi|21909883|ref|NP_664151.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS315] >gi|28896419|ref|NP_802769.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes SSI-1] >gi|25090293|sp|Q8K8D0|FPG_STRP3 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|21904070|gb|AAM78954.1| putative formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS315] >gi|28811670|dbj|BAC64602.1| putative formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes SSI-1] (275 aa)
Score = 438, Expect = 1.3e-41, Identities = 106/277 (38%), Positives = 157/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+A+ +HPET +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGL-ETLVLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVYGQTGKSCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|169348424|ref|ZP_02866362.1| hypothetical protein CLOSPI_00139 [Clostridium spiroforme DSM 1552] >gi|169293893|gb|EDS76026.1| hypothetical protein CLOSPI_00139 [Clostridium spiroforme DSM 1552] (270 aa)
Score = 438, Expect = 1.5e-41, Identities = 116/277 (41%), Positives = 163/277 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V  +LK    LN+ I +I+ + PKI ++   E+F + + N+ I DI R GK+LIF L +D  FV HLRMEGK  +   D   +K   +V    D  ++RY+DTR+FG   + + +NY +   + KLG +P     D K L   + K N  IK  LLDQ  ++GIGNIYA+EI FA  + P T A+KLT    K++ E +  IL +A++  GTTI + F      G FQ  LKVH +K   C  C  +I K  + GRGTY C KCQK++
  S:     1 MPELPEVETVRRTLK-NFVLNKRIISIDIMYPKIIED-DIEEFKNKVCNQVINDIDRIGKFLIFKL-DDVAFVSHLRMEGKYHYVNRDEPLNKHDHIVFNLDDGKQLRYNDTRKFGRMKLVSLDNYANELPLSKLGPEPFYA--DEKKLYEKLHKCNLPIKHALLDQSIIAGIGNIYANEICFAMGLDPYTPASKLTKKSVKELIEVASSILNEAIKQGGTTIHS-FSANGIDGLFQVKLKVHLQK--KCSICGGEITKEAIKGRGTYYCKKCQKRR 269
>gi|15674603|ref|NP_268777.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes M1 GAS] >gi|71910221|ref|YP_281771.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS5005] >gi|21362547|sp|Q9A131|FPG_STRP1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|13621714|gb|AAK33498.1| putative formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes M1 GAS] >gi|71853003|gb|AAZ51026.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS5005] (275 aa)
Score = 437, Expect = 1.7e-41, Identities = 106/277 (38%), Positives = 157/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+A+ +HPET +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGL-ETLVLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|163790756|ref|ZP_02185182.1| formamidopyrimidine-DNA glycosylase [Carnobacterium sp. AT7] >gi|159873936|gb|EDP68014.1| formamidopyrimidine-DNA glycosylase [Carnobacterium sp. AT7] (279 aa)
Score = 437, Expect = 2.1e-41, Identities = 108/274 (39%), Positives = 149/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E+  L  TI +++    +I   +    +F   +I E+I    R+GKY++FH  N    V HLRMEGK   E++     KKH  V   + D  ++RY D R+FG  T+           I+ LG +P +E FD     N +    RAIK  LLDQ+ V+G+GNIY DE LFA+ IHP  +AN L   +  ++ E    +L  AV+  GTTI TY     + G+FQ  L V+ KK   C+ C   I KIKV  RGT+ C  CQ
  S:     1 MPELPEVETVRKGL-EKLVLGATIKSVDVYWDRIIAGSIESTEFKQLLIGEKITGFDRRGKYIVFHFKN-WALVSHLRMEGKYEVEESTVPL-KKHTHVVFHLADGRDLRYLDVRKFGRMTLVPLGEEYSMTGIRLLGPEPTKEAFDETTFFNTLLTKKRAIKPLLLDQKIVAGLGNIYVDEALFAAKIHPLRMANSLKKQEVSQLHEAIIKVLGDAVKAGGTTIRTYQNALGEAGKFQVKLSVYGKKGIPCIRCGTPIEKIKVAQRGTHFCPHCQ 273
>gi|146386274|gb|ABQ23941.1| formamidopyrimidine-DNA glycosylase [Streptococcus uberis] (273 aa)
Score = 436, Expect = 2.7e-41, Identities = 101/275 (36%), Positives = 154/275 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E   + + I ++   +PK+  + + + F   ++ ++I  I R+GKYLIFH T D V V HLRMEGK    +     +K         D   + Y D R+FGT  +  ++        +KLG +P +  F  K  +  ++ S + IK  LL+Q+ V G+GNIY DE+L+A+ +HP  +A++L   + K+I + +  ILA AV+  G+TI TY       G  Q +L+V+ +K   C  C  +I KIKV GRGT+ C KCQK
  S:     1 MPELPEVETVRRGL-ENLIIGKEIASVTIKVPKMIVS-NPDTFAGDLMGQEILSIGRRGKYLIFHFT-DLVMVSHLRMEGKYLLFEGGIPENKHFHFFFHFTDGSTLVYQDVRKFGTLELLAQDGLDLYFSQRKLGPEPTKNAFKLKAFEAALRLSKKPIKPLLLEQKLVVGLGNIYVDEVLWAAQVHPLRLASELKKAEVKRIHDQTIAILAFAVDKGGSTIRTYQNTLGMNGSMQDYLQVYGQKGSPCPRCGTEIEKIKVGGRGTHFCPKCQK 272
>gi|50913780|ref|YP_059752.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS10394] >gi|73919596|sp|Q5XDE4|FPG_STRP6 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|50902854|gb|AAT86569.1| Formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS10394] (275 aa)
Score = 435, Expect = 2.9e-41, Identities = 106/277 (38%), Positives = 157/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   LK    L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+A+ +HPET +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGLKAL-VLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAVLLSSKKTIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNTLGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|171780160|ref|ZP_02921064.1| hypothetical protein STRINF_01948 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281508|gb|EDT46943.1| hypothetical protein STRINF_01948 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (273 aa)
Score = 435, Expect = 3.2e-41, Identities = 103/276 (37%), Positives = 155/276 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + R I +++  +PK+ K      F   ++ + I+ I R+GKYL+ +L +++V + HLRMEGK L FE         H+   ++ D   + Y D R+FGT  +  EN      + +KLG +P +E+FD       +  S + IK  LLDQ  V+G+GNIY DE+L+A+ IHPE  AN L   +   + +    IL   ++  G+TI TY     + G  Q++L+V+ K D  C  C   I KIKV GRGT+ C  CQK+
  S:     1 MPELPEVETVRRGL-ERLIVGREIVSVDVRVPKMVKT-DLSAFESDLLGQTIQSIGRRGKYLLLNL-DEQVIISHLRMEGKYLLFEHQVPEDKHFHIFFGLD-DGSTLVYKDVRKFGTMELVAENQVAAYFQKRKLGPEPTKEDFDVAEFTRKLSASKKLIKPYLLDQTLVAGLGNIYVDEVLWAAKIHPERQANSLQKAEINLLHDEIIRILQLGIKKGGSTIRTYQNALGENGTMQEYLQVYGKTDEPCPRCATPIEKIKVGGRGTHFCPACQKR 273
>gi|94989918|ref|YP_598018.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS10270] >gi|94543426|gb|ABF33474.1| Formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS10270] (275 aa)
Score = 435, Expect = 3.3e-41, Identities = 105/277 (37%), Positives = 156/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+ + +HPET +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGL-EALVLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFETALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWVAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|157150267|ref|YP_001450016.1| formamidopyrimidine-DNA glycosylase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075061|gb|ABV09744.1| formamidopyrimidine-DNA glycosylase [Streptococcus gordonii str. Challis substr. CH1] (274 aa)
Score = 433, Expect = 5.4e-41, Identities = 105/277 (37%), Positives = 148/277 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   + +TI  +     K+      + F H +  + I+ I R+GKYL+F+LT   V V HLRMEGK  F   D+  ++KH  V  EM D   + Y D R+FGT  +  ++        +KLG +P E +F        + +S + IK  LLDQ  V G+GNIY DE L+   IHP   A  L   + K++ E    +L   +E +G+TI TY     + G  Q FL+V+ K    C  C N I KIK+ GRGT+LC  CQK +
  S:     1 MPELPEVETVRRGL-EHLVVGKTIGQVRVRYAKMI-GTGVDSFVHDLPGQTIEKIGRRGKYLLFYLTGG-VMVSHLRMEGKYLF-YPDAVPERKHAHVFFEMTDGGTLVYEDVRKFGTMELLKKDQLEAYFAARKLGPEPTEADFLLPPFVAALSRSKKPIKPYLLDQTLVVGLGNIYVDEALWRVRIHPARPAASLKPTEVKRLREQIIEVLQLGIEKRGSTIRTYRNALGEDGTMQDFLQVYGKTGQPCARCGNPIEKIKLGGRGTHLCPHCQKAR 274
>gi|71903062|ref|YP_279865.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS6180] >gi|90101320|sp|Q48UU6|FPG_STRPM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|71802157|gb|AAX71510.1| formamidopyrimidine-DNA glycosylase [Streptococcus pyogenes MGAS6180] (275 aa)
Score = 433, Expect = 5.7e-41, Identities = 105/277 (37%), Positives = 156/277 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK-LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   L + I  +   +PK+ K    E F   +  + I+ + R+GKYL+  L    V V HLRMEGK L F   D   D KH  V  E+ +   + Y D R+FGTF +  ++        +KLG +P +E F  K  +  +  S + IK  LLDQ  V+G+GNIY DE+L+A+ +HP T +++L   + K++ + +  ILA  +E  G+T+ TY       G  Q +L+V+ +    C  C   IVK+KV GRGT++C KCQKK+
  S:     1 MPELPEVETVRRGL-ETLVLGQEIVAVTLKVPKMVKT-DLETFALTLPGQIIQSVGRRGKYLLIDL-GQLVLVSHLRMEGKYLLF--PDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAKSQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLWAAKVHPGTASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVYGQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKR 274
>gi|15615714|ref|NP_244018.1| formamidopyrimidine-DNA glycosylase [Bacillus halodurans C-125] >gi|17375861|sp|Q9K855|FPG_BACHD Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|10175774|dbj|BAB06871.1| formamidopyrimidine-DNA glycosidase [Bacillus halodurans C-125] (274 aa)
Score = 431, Expect = 9.4e-41, Identities = 100/275 (36%), Positives = 153/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQ-IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V  +L E   + +TI  ++    K+ K     D   +++  Q I+ + R+GK+L+FHL +D   V HLRMEG+    + + S   KH  V+    D  E+RY D R+FGT  ++          + KLG++P  ++F  K L   + K++R IK+ LLDQ  + G+GNIY DE LF + IHPE +A  +T  + K + +     L +AV   G++I +Y   + + G FQ+ L V+ +K   C  C   I K  V GRGT+ C  CQK
  S:     1 MPELPEVETVRRTLAEL-VIGKTIEQVDVGWAKMIKRPDDVDQFKWLLKGQTIRSMGRRGKFLLFHL-DDYTLVSHLRMEGRYGLYQQNESV-AKHTHVRFVFGDGTELRYQDVRKFGTMHLFQSGREQMEPPLAKLGVEPFSDQFSAKLLTERLSKTSRKIKSALLDQGIIVGLGNIYVDEALFRARIHPERLAKDVTVAEVKILHQAILNTLTEAVNLGGSSIKSYVNGQGEMGMFQQRLDVYGRKGETCRQCGTPITKTVVGGRGTHFCSVCQK 274
>gi|6537224|gb|AAF15568.1|AF179376_3 foramidopyrimidine DNA gycosylase [Mycoplasma fermentans] (273 aa)
Score = 429, Expect = 1.5e-40, Identities = 114/275 (41%), Positives = 158/275 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKN-KIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+SV+  L+ +  +NR I  I+ + PK+ K  S E+F +++INE   D+    K++IF LTN+K  + HLRM GK F         K   L+    D+  I Y+D+R+FGTF I  +     +K + K+   P   E + K L N IK  N  IK  LLDQ  VSGIGNIYA+E LFA+ I+P T +  +T    +KI + +  I+ +A E  G++I TY      KG+FQ FL+VH   +  C  CK  KI KI +N RGTY C   QK
  S:     1 MPELPEVRSVVKDLRPK-VVNRKIVKIDILHPKLIKEVSVEEFKNFLINETFLDVNNLAKHIIFSLTNNKYLLSHLRMSGKYFTHYKYRPATKHDYLIFHLDDNSCIYYNDSRQFGTFHIKTKGTLYTTKPLDKVAKIP--SETNIKELFNKIKNKNIPIKQLLLDQSFVSGIGNIYANETLFATQINPLTPSKNITFEQLEKIIKAAAKIMDQATELGGSSIDTYTSVDGVKGQFQDFLQVHGHFNDVCKRCKKAKINKIFINKRGTYYCPNYQK 273
>gi|28378223|ref|NP_785115.1| formamidopyrimidine-DNA glycosylase [Lactobacillus plantarum WCFS1] >gi|38257325|sp|Q88WV4|FPG_LACPL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|28271058|emb|CAD63963.1| formamidopyrimidine-DNA glycosylase [Lactobacillus plantarum WCFS1] (274 aa)
Score = 427, Expect = 2.6e-40, Identities = 101/270 (37%), Positives = 149/270 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNR-----TITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLC 270
           +PELPEV++V      +G LNR     TI +IE   PKI  N   + F   + N+ I+ I R+GKYL+F  +N    V HLRMEGK     + +      HV+  +  DD ++ Y+DTR+FG  T+           ++ +G +P+ E+    Y+     KS + IK  LLDQ  ++GIGNIYADE L+ S IHP   AN LT ++   + +N    +A A++  GTT+ ++     + G+FQ  L V+ ++   C  C   I KIKV  RGT+ C
  S:     1 MPELPEVETV-----RRG-LNRLVSGATIASIEVFWPKIINN-DVDSFKQRLANQTIQTIDRRGKYLLFRFSNGLTMVSHLRMEGKYNVVPRGEDQGKHTHVIFHL-TDDRDLLYNDTRKFGRMTLVPTGEENTVAGLRTIGPEPVAEQLTLAYMTATFGKSKKMIKPLLLDQSKIAGIGNIYADETLWMSKIHPMRPANSLTTDEIATLRQNIIDEMAMAIKGHGTTVHSFSTAFGEAGQFQNHLHVYGREGEPCERCGTIIEKIKVAQRGTHFC 268
>gi|22537632|ref|NP_688483.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae 2603V/R] >gi|25011596|ref|NP_735991.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae NEM316] >gi|76788529|ref|YP_330125.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae A909] >gi|77405216|ref|ZP_00782314.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae H36B] >gi|77408547|ref|ZP_00785283.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae COH1] >gi|77411672|ref|ZP_00788011.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae CJB111] >gi|77414744|ref|ZP_00790872.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae 515] >gi|54037119|sp|P64153|FPG_STRA5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|54040773|sp|P64152|FPG_STRA3 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|90101319|sp|Q3K028|FPG_STRA1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|22534518|gb|AAN00356.1|AE014260_12 formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae 2603V/R] >gi|24413135|emb|CAD47213.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563586|gb|ABA46170.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae A909] >gi|77159211|gb|EAO70394.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae 515] >gi|77162244|gb|EAO73216.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae CJB111] >gi|77172821|gb|EAO75954.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae COH1] >gi|77176218|gb|EAO78989.1| formamidopyrimidine-DNA glycosylase [Streptococcus agalactiae H36B] (273 aa)
Score = 426, Expect = 3.6e-40, Identities = 105/274 (38%), Positives = 158/274 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGK--LFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E+  +N+ I +I   +PK+ K     DF   +  + I+ + R+GKYL+F    + V V HLRMEGK  LF  K     D KH  +  ++ +   + Y D R+FGTF +  +++  D    KKLG +P  + F ++     +  S + IK  LLDQ  V+G+GNIY DE+L+A+ IHP+ +AN+LT+++   + +    IL   +E  G+TI TY     + G  QK+L+V+ K    C  C   I KIKV GRGT+ C +CQ
  S:     1 MPELPEVETVRKGL-ERLVVNQEIASITIKVPKMVKT-DLNDFMISLPGKTIQQVLRRGKYLLFDF-GEMVMVSHLRMEGKYLLFPNKVP---DNKHFHLYFKLTNGSTLVYQDVRKFGTFELVRKSSLKDYFTQKKLGPEPTADTFQFEPFSKGLANSKKPIKPLLLDQRLVAGLGNIYVDEVLWAAKIHPQRLANQLTESETSLLHKEIIRILTLGIEKGGSTIRTYKNALGEDGTMQKYLQVYGKTGQPCPRCGCLIKKIKVGGRGTHYCPRCQ 271
>gi|116492457|ref|YP_804192.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Pediococcus pentosaceus ATCC 25745] >gi|122266079|sp|Q03GC2|FPG_PEDPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|116102607|gb|ABJ67750.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Pediococcus pentosaceus ATCC 25745] (275 aa)
Score = 424, Expect = 6.0e-40, Identities = 99/274 (36%), Positives = 148/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L       + +TN+     K+    + E F   +  ++I ++ R+GKYL+   + D   V HLRMEGK         Y K H  V  E+DD  ++RY+DTR+FG   +      L    +K +G +P  E    +YL + ++   R +K+ LLDQ  ++G+GNIYADE+L+ S IHP+ I+N LTD +   + E+    L  A+E KGTT+ +Y       G FQ  L V+ ++   C  C   I +IKV  RGT+ C  CQ
  S:     1 MPELPEVETVRRGLAAL-VEGKIVTNVVVRYSKMVSPKA-EIFAEELEGKKILNVRRRGKYLLIDFSGDYTMVSHLRMEGKYSVVDRREEYGK-HDHVIFELDDGKDLRYNDTRKFGRMNLVPTGEELQVGGLKTIGPEPTPETLTLEYLTHQLRNRKRGMKSFLLDQSMIAGLGNIYADEVLWLSKIHPQQISNTLTDEEIAILRESIFEELQLAIEAKGTTVFSYLNADGHAGSFQNQLHVYHRQGLPCQRCGTPIERIKVAQRGTHFCPHCQ 272
>gi|89894087|ref|YP_517574.1| hypothetical protein DSY1341 [Desulfitobacterium hafniense Y51] >gi|109646321|ref|ZP_01370225.1| formamidopyrimidine-DNA glycosylase [Desulfitobacterium hafniense DCB-2] >gi|122483280|sp|Q24XW2|FPG_DESHY Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|89333535|dbj|BAE83130.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109641567|gb|EAT51121.1| formamidopyrimidine-DNA glycosylase [Desulfitobacterium hafniense DCB-2] (273 aa)
Score = 424, Expect = 6.4e-40, Identities = 96/274 (35%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++  SL  Q  L R I  I    P   +    + F   +   + + I R+GKYL+F L     F+ H+RM G++ +    S   +KH  V +++   EI + DTR+FG   +      L    + +LG +PLEE F    L   +     AIK  LLDQ  V+GIGNIYADE LF + I PE  AN LT  + +K+      +L + +   GT+   Y     ++G+FQK LKV+ +    C  C + +V+I++ GR T  C  CQ
  S:     1 MPELPEVETIRRSL-SQHILERRIEEILIRWPGAVEGYEEKTFADAVRGLKFQSIERRGKYLLFTLEEGWSFIAHMRMTGRMVYH-AQSQEPEKHTHVVLKLSSGEIHFTDTRKFGRLQLVRTEERLQQPSLARLGPEPLEEGFSAAELGRRLAPRKLAIKAALLDQTLVAGIGNIYADEALFRAGIAPERCANSLTKEEIEKLYPAICQVLEEGIAANGTSFRDYQDANGERGDFQKELKVYGRGGEPCKECGHTLVRIRLAGRSTVFCPCCQ 272
>gi|146319050|ref|YP_001198762.1| formamidopyrimidine-DNA glycosylase [Streptococcus suis 05ZYH33] >gi|146321256|ref|YP_001200967.1| formamidopyrimidine-DNA glycosylase [Streptococcus suis 98HAH33] >gi|145689856|gb|ABP90362.1| Formamidopyrimidine-DNA glycosylase [Streptococcus suis 05ZYH33] >gi|145692062|gb|ABP92567.1| Formamidopyrimidine-DNA glycosylase [Streptococcus suis 98HAH33] (297 aa)
Score = 422, Expect = 1.0e-39, Identities = 98/276 (35%), Positives = 154/276 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L       + I+ +E     + K    + F   +I ++I D+ R+GKYL+ +LT D V + HLRMEGK  F       +K        +D   + Y D R+FGT  +  + + +D+  I +K+G +P EE+FD +     + KS + IK+ LLDQ  V+G+GNIY DE+LF + +HP   +N+L+ +    + + +  +L   +E  G+TI TY       G  Q +L+V+ K    C  C+ +IVKI++ GRGT+ C KCQ K
  S:    23 LPELPEVETVRRGLNRL-VKGKVISKVEVTYAPMIKT-GVDAFCQDLIGQEILDVDRRGKYLLIYLT-DHVLISHLRMEGKYNFFADQVPANKHFHAFFTFIDGSTLVYQDVRKFGTMELLGKAD-VDAYFISRKIGPEPTEEDFDLEEFAKKLAKSKKPIKSHLLDQSLVAGLGNIYVDEVLFKAKVHPAQTSNQLSTDQVADLRQATIEVLQLGIEKGGSTIRTYKNALGMDGTMQDYLQVYGKTGQACPRCQTEIVKIQLGGRGTHFCPKCQVK 295
>gi|116511212|ref|YP_808428.1| formamidopyrimidine-DNA glycosylase [Lactococcus lactis subsp. cremoris SK11] >gi|116106866|gb|ABJ72006.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Lactococcus lactis subsp. cremoris SK11] (272 aa)
Score = 421, Expect = 1.3e-39, Identities = 101/276 (36%), Positives = 161/276 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I +IE+  P++     +E     +  + I+ I R+GKYLIF + +D   + HLRMEGK      D+  +K H  + ++  D ++ Y D R+FGT+ + + +  +     KK+G +P  E+FD K  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE  AN+LT++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    C  C  +I KIKV GRGT+ C  CQ+K
  S:     1 MPELPEVETVRREL-EKRIVGQKIISIEATYPRMVLT-GFEQLKKELTGKIIQGILRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREK-HDHLTMKFSDGQLIYADVRKFGTWELISTDQVIPYFLNKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKEANQLTESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK 272
>gi|58337812|ref|YP_194397.1| formamidopyrimidine-DNA glycosylase Fpg [Lactobacillus acidophilus NCFM] >gi|75507557|sp|Q5FIV8|FPG_LACAC Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|58255129|gb|AAV43366.1| formamidopyrimidine-DNA glycosylase Fpg [Lactobacillus acidophilus NCFM] (276 aa)
Score = 421, Expect = 1.4e-39, Identities = 100/274 (36%), Positives = 148/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PEV++V  +L       +TI  +    P I     +++F   +  ++I  I R  KYL+  L+++   V HLRMEGK      D+  DK   +  +  D   +RY+D R+FG   +           IKKLG +P   EF  +YL +N+KK ++ IK  LLDQ  V+G+GNIY DE L+ S IHP +IANK+       + EN    +A A+E +GTT+ +Y     + G +Q+ L+V+     +C  C N   KIKV+GRGT  C  CQ
  S:     1 MPEMPEVETVRRTLLPL-IKGKTIEKVVLWYPTIVAT-DHDEFLKELPGKKIIGIDRYAKYLLIRLSDNLTIVSHLRMEGKYHLTTEDAPKDKHDHVEFVFTDKTALRYNDVRKFGRMQLIITGTERQVTGIKKLGPEPNTSEFSQQYLIDNLKKKHKNIKNVLLDQTTVAGLGNIYVDETLWQSKIHPLSIANKIPAKKVAGLWENINQTIALAIEKRGTTVHSYLDANGEVGGYQEMLQVYGHVGEECPRCGNIFEKIKVSGRGTTFCPHCQ 272
>gi|15672335|ref|NP_266509.1| formamidopyrimidine-DNA glycosylase [Lactococcus lactis subsp. lactis Il1403] >gi|13878494|sp|Q9CIK4|FPG_LACLA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|12723222|gb|AAK04451.1|AE006272_5 formamidopyrimidine-DNA glycosylase (EC 3.2.2.23) [Lactococcus lactis subsp. lactis Il1403] (272 aa)
Score = 421, Expect = 1.4e-39, Identities = 100/276 (36%), Positives = 159/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I +IE+  P++     +E     +  + I  I+R+GKYLIF +      + HLRMEGK      +   +K H  + ++  D ++ Y D R+FGT+ + + +  L     K +G +P  E FD +  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE +AN+LT++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    CV C N+I KIKV GRGT+ C  CQ+K
  S:     1 MPELPEVETVRREL-EKRIVGQKIVSIEATYPRMVLT-GFEQLKKELTGKTIHGISRRGKYLIFEIGEKDRLISHLRMEGKYRLASLNVPMEK-HDHLALKFTDEQLIYADVRKFGTWELISTDQVLPYFLKKNIGPEPTYETFDEQIFREKLQKSTKKIKPFLLEQTLVAGLGNIYVDEVLWLAKIHPEKVANQLTESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKMQDELRVYGKTGEKCVRCGNEIQKIKVAGRGTHFCPFCQQK 272
>gi|81097420|ref|ZP_00875704.1| Formamidopyrimidine-DNA glycolase [Streptococcus suis 89/1591] >gi|80976527|gb|EAP40126.1| Formamidopyrimidine-DNA glycolase [Streptococcus suis 89/1591] (297 aa)
Score = 419, Expect = 2.0e-39, Identities = 99/276 (35%), Positives = 153/276 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L       + I+ +E     + K    + F   +I ++I D+ R+GKYL+ +LT D V + HLRMEGK  FF     +    H       D   + Y D R+FGT  +  + + +D+  I +K+G +P EE+FD +     + KS + IK+ LLDQ  V+G+GNIY DE+LF + +HP   +N+L+      + + +  +L   +E  G+TI TY       G  Q +L+V+ K    C  C+ +IVKI++ GRGT+ C KCQ K
  S:    23 LPELPEVETVRRGLNRL-VKGKIISKVEVTYAPMIKT-GVDAFCQDLIGQEILDVDRRGKYLLIYLT-DHVLISHLRMEGKYNFFPDQVPANKHFHAFFTFS-DGSTLVYQDVRKFGTMELLGKAD-VDAYFISRKIGPEPTEEDFDLEEFAKKLAKSRKPIKSHLLDQSLVAGLGNIYVDEVLFKAKVHPAQTSNQLSAEQVADLRQATIEVLQLGIEKGGSTIRTYKNALGMDGTMQDYLQVYGKTGQACPRCQTEIVKIQLGGRGTHFCPKCQVK 295
>gi|116630047|ref|YP_815219.1| formamidopyrimidine-DNA glycosylase [Lactobacillus gasseri ATCC 33323] >gi|122273016|sp|Q041U1|FPG_LACGA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|116095629|gb|ABJ60781.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Lactobacillus gasseri ATCC 33323] (276 aa)
Score = 419, Expect = 2.2e-39, Identities = 101/274 (36%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PEV++V  +L       +TI  I    PKI  N   E F   + N++I  I R GKYL+F   +D   V HLRMEGK      D+   K   +  I  D   +RY D R+FG   +        +  I+ LG +P   EF+ KY  + + +  + IK TLLDQ  V G+GNIY DE+L+ S IHP + A  +  +  K + +N    +A A + +GTT+ TY     + G +QK L+V+     +C +C   + KIKVNGRGT  C  CQ
  S:     1 MPEMPEVETVRRTLTPL-VKGKTIAKINIWYPKIIVNDPAE-FVKKLTNKRILKIDRYGKYLLFRFNDDLTMVSHLRMEGKYHLVSPDTPKGKHEHVEFIFTDGTALRYDDVRKFGRMHLVETGTERKTTGIRHLGPEPNTAEFNLKYFVDALSQKKKNIKNTLLDQTIVCGLGNIYVDEVLWKSKIHPLSSAKAIPADKVKNLYQNINHTIAIATKERGTTVHTYLDANGEIGGYQKMLQVYGHAGEECSSCGTILEKIKVNGRGTTFCPHCQ 272
>gi|125718413|ref|YP_001035546.1| formamidopyrimidine-DNA glycosylase [Streptococcus sanguinis SK36] >gi|125498330|gb|ABN44996.1| Formamidopyrimidine-DNA glycosylase, putative [Streptococcus sanguinis SK36] (274 aa)
Score = 419, Expect = 2.5e-39, Identities = 103/277 (37%), Positives = 147/277 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E+  + +TI  +     K+      + F H +  + I+ I R+GKYL+F+LT   V V HLRMEGK  F   D   ++KH  V  E  D   + Y D R+FGT  +  +N        +KLG +P   +F        + +S + IK  LL+Q  V G+GNIY DE L+ + IHP   A  L   + K++ E    +L   +E KG+TI TY     + G  Q FL+V+ K    C  C + I KIK+ GRGT+LC  CQK +
  S:     1 MPELPEVETVRRGL-ERLVVGKTIEQVRVRYAKMI-GTGVDSFVHDLPGQTIERIGRRGKYLLFYLTGG-VLVSHLRMEGKYLF-YPDEVPERKHAHVFFETTDGGTLVYEDVRKFGTMELLRKNQLETYFTARKLGPEPTAADFLLPPFVAALNRSKKPIKPYLLEQTLVVGLGNIYVDEALWRARIHPARPAASLKPAEVKRLREQIIEVLQLGIEKKGSTIRTYRNALGEDGTMQDFLQVYGKTGQPCARCGSPIEKIKLGGRGTHLCPHCQKAR 274
>gi|125623242|ref|YP_001031725.1| formamidopyrimidine-DNA glycosylase [Lactococcus lactis subsp. cremoris MG1363] >gi|55669903|pdb|1TDZ|A Chain A, Crystal Structure Complex Between The Lactococcus Lactis Fpg (Mutm) And A Fapy-Dg Containing Dna >gi|124492050|emb|CAL96978.1| Fpg protein [Lactococcus lactis subsp. cremoris MG1363] (272 aa)
Score = 418, Expect = 3.2e-39, Identities = 100/276 (36%), Positives = 160/276 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I +IE+  P++     +E     +  + I+ I+R+GKYLIF + +D   + HLRMEGK      D+  +K H  + ++  D ++ Y D R+FGT+ + + +  L     KK+G +P  E+FD K  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE   N+L ++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    C  C  +I KIKV GRGT+ C  CQ+K
  S:     1 MPELPEVETVRREL-EKRIVGQKIISIEATYPRMVLT-GFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREK-HDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK 272
>gi|116617644|ref|YP_818015.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096491|gb|ABJ61642.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (277 aa)
Score = 417, Expect = 3.7e-39, Identities = 102/277 (36%), Positives = 154/277 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E+  +   I +++   PK+      + F   ++N + K I R+GKYL+  L N+   V HLRMEG+   E  ++    KH  +  E+ D   + Y+DTRRFG   +     EN  + S  + KLG +P EE+    Y+     KS R +KT LLDQ  ++GIGNIYADE+L+ S IHP+T AN L +     +  N    + +A+++ GTT+ ++     + G+FQ  L+ +      C+ C   +VKIKV  RGT  C  CQ +K
  S:     1 MPELPEVETVRRGL-EKLIIGSKIIDVQLPYPKVITG-DGQQFITGVMNTEFKQIDRRGKYLLLRLANNHTIVSHLRMEGQYSVESLET-VPYKHTEIVFELSDKRALFYNDTRRFGRMALTTTGFENTEVPS--LSKLGPEPTEEQLTLSYMMAIFSKSRRPVKTFLLDQTQIAGIGNIYADEVLWQSKIHPKTPANVLDEVQLSVLRANIISEIKRAIKHHGTTVHSFSNVFGEVGKFQNELQAYGHAGEPCLRCNTPMVKIKVGQRGTTFCPFCQVEK 276
>gi|167629831|ref|YP_001680330.1| formamidopyrimidine-DNA glycosylase [Heliobacterium modesticaldum Ice1] >gi|167592571|gb|ABZ84319.1| formamidopyrimidine-dna glycosylase [Heliobacterium modesticaldum Ice1] (277 aa)
Score = 416, Expect = 4.8e-39, Identities = 95/275 (34%), Positives = 151/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL--FFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V  SL  +     TI  +E  +PKI        FT  +   +I ++ R+GKYL+ HL  D+  V+HLRM G+L     +     +  H      +DD  + RY D R+FGT T+      L      +LG +PL ++F +   +N + K    +K  LLDQ  ++G+GNIYADE L  + +HP+  A+ L D + +++ +  R +L + ++ KGT+   Y   + +KGEFQ+ L V+ +    C  C  +I++ K  GR T+ C +CQK
  S:     1 MPELPEVETVRRSLAGR-ITGLTIEKVELRLPKIAFALPGTLFTDALRGRRIIELGRRGKYLLLHLDGDETLVIHLRMTGRLIHLRPEEREEPEAAHTHAVFFLDDGSLLRYTDVRQFGTLTLMTREAALRQPGKGRLGPEPLGQDFSFVDFRNALVKRKTKLKPLLLDQSFLAGLGNIYADEALARARLHPDRTADSLDDEESRRLYDCIRTVLQEGIDAKGTSFRDYVDGEGRKGEFQEKLWVYGRGGNPCRRCGGEILREKRAGRSTHFCPRCQK 277
>gi|116333678|ref|YP_795205.1| formamidopyrimidine-DNA glycosylase [Lactobacillus brevis ATCC 367] >gi|116099025|gb|ABJ64174.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Lactobacillus brevis ATCC 367] (286 aa)
Score = 416, Expect = 4.8e-39, Identities = 102/274 (37%), Positives = 154/274 (56%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIY--NENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L    QG    TI ++E   PK+      + FT  +I+ +I+ I R+GKYL+F  + D   V HLRMEGK   +   S   K  HV+  +  D+ E+RY DTR+FG   +    E   L +  + KLG +P  E     Y+     KS++ +K  LLDQ  ++G+GNIYADE+L+ S I+P T  + LT +   ++ +N    +A A+   GTT+ ++     + G+FQ  L V+ ++   C  C  ++VKIKV  RGT+ C  CQ
  S:     1 MPELPEVETVRRGLTRLVQGA---TIAHVEVRYPKMVTP-DADVFTAELISRKIERIDRRGKYLLFRFSGDLTMVSHLRMEGKYDVQPEGSPVSKHTHVIFHL-TDNRELRYTDTRKFGRMQLVPTGEETTL-APSLGKLGPEPTAETLTLAYMVKIFGKSHKVVKPFLLDQTRIAGLGNIYADEVLWLSKINPLTPVDTLTPSQLSELRQNIIDEMALAIGGHGTTVHSFSTAFGEAGQFQNQLHVYGREGEPCERCGTELVKIKVAQRGTHFCPHCQ 273
>gi|51247145|pdb|1PJI|A Chain A, Crystal Structure Of Wild Type Lactococcus Lactis Fpg Complexed To A 1,3 Propanediol Containing Dna >gi|51247149|pdb|1PM5|A Chain A, Crystal Structure Of Wild Type Lactococcus Lactis Fpg Complexed To A Tetrahydrofuran Containing Dna >gi|75765461|pdb|1XC8|A Chain A, Crystal Structure Complex Between The Wild-Type Lactococcus Lactis Fpg (Mutm) And A Fapy-Dg Containing Dna (271 aa)
Score = 416, Expect = 5.0e-39, Identities = 100/275 (36%), Positives = 159/275 (57%)
  Q:     2 PELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           PELPEV++V   L E+  + + I +IE+  P++     +E     +  + I+ I+R+GKYLIF + +D   + HLRMEGK      D+  +K H  + ++  D ++ Y D R+FGT+ + + +  L     KK+G +P  E+FD K  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE   N+L ++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    C  C  +I KIKV GRGT+ C  CQ+K
  S:     1 PELPEVETVRREL-EKRIVGQKIISIEATYPRMVLT-GFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREK-HDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK 271
>gi|167464952|ref|ZP_02330041.1| formamidopyrimidine-DNA glycosylase [Paenibacillus larvae subsp. larvae BRL-230010] (286 aa)
Score = 415, Expect = 6.2e-39, Identities = 100/274 (36%), Positives = 152/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIF-KNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  +L E   + +TI  +E  + +I  K  + E+F   +  + I+ I R+GK+L F  T D V V HLRMEG+   +   D   +  HVL     D  ++RY D R+FGT  ++ +        + KLGL+PL+E F ++     I      IK  LL+QE + G+GNIY DE L+ + IHPET  + LT  + +K+ E     L  +V+  G++I +Y   + + G FQ  LK++ +    C  C   IVK+ V GRGT++C  CQ
  S:     1 MPELPEVETVKRTLNEL-VVGKTIEQVEVRLSRIIQKPLNIEEFALLLEGQTIERIDRRGKFLKFIFT-DYVLVSHLRMEGRYGVYLSNDPVENHTHVLFHF-TDGTDLRYKDVRQFGTMHLFPKGQEELDPPLNKLGLEPLDETFTFERFYQTIHHKTTRIKPLLLNQEYIVGVGNIYVDEALYTAGIHPETETHLLTKKELRKLHEAIVHTLQSSVDVGGSSIKSYVNGQGEMGMFQHQLKIYGRTSELCTQCGGVIVKMVVGGRGTHICPTCQ 273
>gi|169186074|ref|ZP_02846236.1| formamidopyrimidine-DNA glycosylase [Paenibacillus sp. JDR-2] >gi|169007495|gb|EDS54344.1| formamidopyrimidine-DNA glycosylase [Paenibacillus sp. JDR-2] (287 aa)
Score = 415, Expect = 7.2e-39, Identities = 103/274 (37%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD-KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEE-FDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  +L E     + I ++E  +P+I +     E F   +    I+ + R+GK+L   + +  V V HLRMEG+     +D   +   HVL   + D  ++RY D R+FGT  ++      + K + KLGL+PLE E F    LK  + K    IK  LL+QE V G+GNIY DE LF + IHPE  A+ L   ++ ++ E     LAKAV   G++I +Y   + + G FQ  L V+ +KD  C +C   I K  V GRGT+ C  CQ
  S:     1 MPELPEVETVRRTLIEL-VAGKRIASVEVKLPRIIQRPAEPEAFEMALAGRTIQTVERRGKFLRV-VMDGLVLVSHLRMEGRYGVFPSDEPVELHTHVLFHFD-DGTDLRYKDVRQFGTMHLFEPGTEFEMKPLSKLGLEPLENEAFTADALKGLLGKKTGLIKPLLLNQEYVVGLGNIYVDEALFLAGIHPERTADSLKKAEWIRLHEAIVSTLAKAVAAGGSSIKSYVNGQGEMGMFQHQLLVYGRKDEPCASCGRLIEKSVVGGRGTHTCASCQ 274
>gi|161507869|ref|YP_001577833.1| formamidopyrimidine-DNA glycosylase [Lactobacillus helveticus DPC 4571] >gi|172048344|sp|A8YWE6|FPG_LACH4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|160348858|gb|ABX27532.1| Formamidopyrimidine-DNA glycosylase [Lactobacillus helveticus DPC 4571] (276 aa)
Score = 415, Expect = 7.2e-39, Identities = 100/274 (36%), Positives = 148/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PEV++V  +L       +TI  +    PKI     +E F   +  ++I DI R  KYL+  L+++   V HLRMEGK     +D+  DK   +  I  D   +RY+D R+FG   +        +  I KLG +P   EF  +YL N +K+  + IK TLLDQ  V+G+GNIY DE+L+ + IHP + ANK+      ++ +    I+ +A++ +GTT+ ++     Q G FQ  L+V+      C  C  K  KIKVNGRGT  C  CQ
  S:     1 MPEMPEVETVRRTLIPL-IKGKTIEKVILWYPKIVAT-DHEKFLSELPGKKIIDIDRYAKYLLIRLSDNLTIVSHLRMEGKYHLTTSDAPKDKHDHVEFIFTDGTALRYNDVRKFGRMQLILTGTERQTTGIGKLGYEPNSSEFTSEYLVNGLKRKKKNIKNTLLDQSVVAGLGNIYVDEVLWRTKIHPLSQANKIPAEKVMELHDQINQIITEAIKLQGTTVHSFLNANGQVGGFQSKLQVYGHVGEPCPVCGTKFEKIKVNGRGTTFCPHCQ 272
>gi|138896290|ref|YP_001126743.1| formamidopyrimidine-DNA glycosylase [Geobacillus thermodenitrificans NG80-2] >gi|196249911|ref|ZP_03148606.1| formamidopyrimidine-DNA glycosylase [Geobacillus sp. G11MC16] >gi|134267803|gb|ABO67998.1| Formamidopyrimidine-DNA glycosidase [Geobacillus thermodenitrificans NG80-2] >gi|196210425|gb|EDY05189.1| formamidopyrimidine-DNA glycosylase [Geobacillus sp. G11MC16] (274 aa)
Score = 413, Expect = 1.3e-38, Identities = 95/275 (34%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD-KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++  +L     + +T+ +++   P I ++    E F   ++ + ++ I R+GK+L F    D + V HLRMEG+          D   HV+ +   DD E+RY D R+FGT  +Y +        + +LG +PL   F    L     K+ R +K  LLDQ  V+G GNIY DE LF + I PE  A  LTD + K++ E     + +A+   G+T+ TY   + + G FQ  L V+ +K   C  C   I K  V GRGT+ C  CQ+
  S:     1 MPELPEVETIRRTLLPL-IVGKTVGDVQIFWPNIIRHPQDPEAFAARLVGQTVRGIDRRGKFLKFLFDQD-MLVSHLRMEGRYTVADAHEPLDPHTHVVFRF-TDDSELRYRDVRKFGTMHVYAKEEGDRQPPLDQLGPEPLSPAFSPAVLAERAAKTKRTVKALLLDQTVVAGFGNIYVDESLFRAGILPERQAASLTDEEIKRLHEQMVATIGEAIMKGGSTVRTYVNTQGETGTFQHSLFVYGRKGEPCKRCGTPIEKTVVAGRGTHYCPHCQR 274
>gi|81429015|ref|YP_396015.1| formamidopyrimidine-DNA glycosylase [Lactobacillus sakei subsp. sakei 23K] >gi|90101304|sp|Q38VS5|FPG_LACSS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|78610657|emb|CAI55708.1| Formamidopyrimidine-DNA glycosylase [Lactobacillus sakei subsp. sakei 23K] (278 aa)
Score = 411, Expect = 1.9e-38, Identities = 103/277 (37%), Positives = 147/277 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   + +T++ I+    KI  N   E FT  ++ +QI  + R+GKYL+         V HLRMEGK      ++   K  HV+ +   D  ++RY DTR+FG   +           +K LG +P    F        ++K ++AIK  LLDQ+ V+G+GNIY DE L+ S IHPET AN LT  +  ++ +     L  A+ + GTT+ T+       G FQ+ L V+ KK   C  C   I KIKV  RGT+ C KCQ K+
  S:     1 MPELPEVENVRRGL-ETLAVGKTVSAIDIRWSKIIVNPD-EVFTAGLVGQQITAVDRRGKYLLIRFGEQLTVVSHLRMEGKYEVVAKEAPISKHTHVIFEF-TDGQQMRYLDTRKFGRMQLIETGQENTVAGLKDLGPEPTPTTFLKADFYQRLQKHHKAIKPLLLDQKVVTGLGNIYVDETLWLSHIHPETPANDLTRAETDRLHDEIIAELELAINHGGTTVNTFLNATGHAGAFQEMLHVYGKKGVPCERCGTPIEKIKVAQRGTHFCPKCQIKR 275
>gi|170016692|ref|YP_001727611.1| formamidopyrimidine-DNA glycosylase [Leuconostoc citreum KM20] >gi|169803549|gb|ACA82167.1| Formamidopyrimidine-DNA glycosylase [Leuconostoc citreum KM20] (280 aa)
Score = 411, Expect = 2.1e-38, Identities = 96/276 (34%), Positives = 151/276 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNE-NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   LK+   +   I  ++   PK+    S   F   ++N     I R+GKYL+  L+N    V HLRMEG+   E  +++   KH  +  E+ D+  + Y+DTRRFG   +    +  +D   + KLG +P  ++    Y+     KS + +K+ LLDQ  ++GIGNIYADE+L+ S IHPET  N L+      + +N    +A+A+++ GTT+ ++     + G+FQ  L+ + +    C+ C   + KIKV  RGT  C  CQ K
  S:     1 MPELPEVETVRRGLKKL-IIGGHIVQVKLPYPKVISGDS-NAFITGVMNASFTAIDRRGKYLLLRLSNGHTIVSHLRMEGQYSVEPREAT-PHKHTEIIFELSDNRAVFYNDTRRFGRMVLATTGHEKIDVPSLAKLGPEPTADDLSLDYMVTAFAKSKKPVKSFLLDQNQIAGIGNIYADEVLWQSKIHPETPTNSLSRTVLAVLRQNIIDEMARAIKHHGTTVHSFSNVFGEVGQFQNELQAYGRVGQPCLRCGTIMSKIKVGQRGTTFCPFCQLK 275
>gi|1169728|sp|P42371|FPG_LACLC Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|433584|emb|CAA52351.1| formamidopyrimidine-DNA-glycosylase [Lactococcus lactis] (273 aa)
Score = 409, Expect = 3.7e-38, Identities = 100/276 (36%), Positives = 161/276 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDP-LEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L E+  + + I +IE+  P++     +E     +  + I+ I+R+GKYLIF + +D   + HLRMEGK      D+  +K H  + ++  D ++ Y D R+FGT+ + + +  L     KK+G +P  +E+FD K  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE   N+L ++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    C  C  +I KIKV GRGT+ C  CQ+K
  S:     1 MPELPEVETVRREL-EKRIVGQKIISIEATYPRMVLT-GFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREK-HDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYDEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK 273
>gi|28948974|pdb|1NNJ|A Chain A, Crystal Structure Complex Between The Lactococcus Lactis Fpg And An Abasic Site Containing Dna >gi|49258485|pdb|1PJJ|A Chain A, Complex Between The Lactococcus Lactis Fpg And An Abasic Site Containing Dna. (271 aa)
Score = 409, Expect = 3.8e-38, Identities = 99/274 (36%), Positives = 158/274 (57%)
  Q:     3 ELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           ELPEV++V   L E+  + + I +IE+  P++     +E     +  + I+ I+R+GKYLIF + +D   + HLRMEGK      D+  +K H  + ++  D ++ Y D R+FGT+ + + +  L     KK+G +P  E+FD K  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE   N+L ++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    C  C  +I KIKV GRGT+ C  CQ+K
  S:     2 ELPEVETVRREL-EKRIVGQKIISIEATYPRMVLT-GFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREK-HDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK 271
>gi|169831563|ref|YP_001717545.1| formamidopyrimidine-DNA glycosylase [Candidatus Desulforudis audaxviator MP104C] >gi|169638407|gb|ACA59913.1| formamidopyrimidine-DNA glycosylase [Candidatus Desulforudis audaxviator MP104C] (276 aa)
Score = 408, Expect = 4.4e-38, Identities = 88/274 (32%), Positives = 147/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++++  L  +      +   E ++PK+    + E+F   I   +I  ++R+GKY++  L+   V ++HLRM G+L +      +  KH  + + +D   +R+ D R+FG  ++           +++LG++PL  EF  +     + +S R IK  LLDQ  ++G+GNIY DE L  + IHPE  A  L   +   +    R +LA+ V  +GT++  Y     Q+G FQ+ L+V+ KK   C  C   I +I+  GRGT+ C +CQ
  S:     1 MPELPEVETIVRDLGAR-LTGLMVERAEVLLPKVVAAPAPEEFARLIAGRKILGLSRRGKYILIELSRGWVLILHLRMTGQLVYTTVLEPF-PKHTHLVLHLDQGVLRFTDLRQFGRASLVPAREVRRVPGLRELGVEPLGAEFVKEDFIRKLARSRRMIKPLLLDQTFLTGLGNIYTDEALHRAGIHPERRAADLDTREAGTLYRAIREVLAEGVAFRGTSVQHYVDGSGQRGRFQEILRVYGKKGVPCPVCGVPIERIRCGGRGTHYCPECQ 272
>gi|149182833|ref|ZP_01861294.1| formamidopyrimidine-DNA glycosylase [Bacillus sp. SG-1] >gi|148849448|gb|EDL63637.1| formamidopyrimidine-DNA glycosylase [Bacillus sp. SG-1] (274 aa)
Score = 408, Expect = 4.8e-38, Identities = 102/275 (37%), Positives = 149/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V  +L E     + I ++    PK+ K     E+F   +  E I+ + R+GK+LI   T+    V HLRMEG+      D   +K  HV+   E D  E+RY D R+FGT  ++ +     S  + +LG +P    F   YL   + K+ RA+K  LLDQ  + G+GNIY DE LF S IHP   A  +  ++ KK+       L++AVE  G+TI +Y   + Q G FQ+ L V+ +K+ +C +C   I K    GRGT+ C  CQK
  S:     1 MPELPEVETVRRTLAEL-VTGKRIKSVSVFWPKMVKLPDEVEEFKLSLQGETIQGVDRRGKFLILQ-TDRYSLVSHLRMEGRYGVFPGDEEVEKHTHVIFHFE-DGTELRYKDVRKFGTMHLFPKGEENLSLPLSQLGPEPFSPNFTVNYLTEKLAKTERAVKAVLLDQTVLVGLGNIYVDEALFRSGIHPARKAKSVKKSEMKKLHNEIIDTLSEAVEQGGSTIRSYVNSQGQIGMFQQQLFVYGRKNEECRSCGKPIEKNVTAGRGTHFCPNCQK 274
>gi|121534306|ref|ZP_01666130.1| formamidopyrimidine-DNA glycosylase [Thermosinus carboxydivorans Nor1] >gi|121307076|gb|EAX47994.1| formamidopyrimidine-DNA glycosylase [Thermosinus carboxydivorans Nor1] (274 aa)
Score = 407, Expect = 6.1e-38, Identities = 87/275 (31%), Positives = 153/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PE+PEV+++  +L ++  + R I  ++  +P++ K  S  +F   +   +I+ + R+GKYL+F L +D V VVHLRM G+L++      +DK  H++  ++ +D  I Y D+R  GT    +  +      +  +G +PL  EF + Y +  +KK   +IK  LL+Q+ + G+GNIY DE L  + I P   A  L++++ +K+      ++ + + + GT+   Y     Q G  Q +L+V+ +K   C  C   IV+ +V GRGT+ C  CQ+
  S:     1 MPEMPEVETIRRTLADK-VVGRRIEAVKIDLPRLVKWPSVSEFKEAVTGRKIERLDRRGKYLLFRLEHDLVMVVHLRMTGRLYYVPAGYQHDKFTHIVFDLDNNDALI-YADSRTLGTLYAIHLADLGRIAGLATMGPEPLSPEFTFDYFRMMLKKRQSSIKAVLLNQQLIGGLGNIYVDESLAVAGIAPTRPAASLSEDETQKLYRAINQVIEEGIAHGGTSFRDYRDGVGQTGSHQHYLRVYGRKGQPCQRCGMPIVRTEVAGRGTHFCPICQR 274
>gi|42519527|ref|NP_965457.1| formamidopyrimidine-DNA glycosylase [Lactobacillus johnsonii NCC 533] >gi|81703799|sp|Q74IB5|FPG_LACJO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|41583816|gb|AAS09423.1| formamidopyrimidine-DNA glycosylase [Lactobacillus johnsonii NCC 533] (276 aa)
Score = 407, Expect = 6.4e-38, Identities = 98/274 (35%), Positives = 141/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PEV++V  +L       +TI  I    PKI  N + ++F   + N++I  I R GKYL+F  ++D   V HLRMEGK      D    K   +  +  D   +RY D R+FG   +        +  I+ LG +P  EEF  +Y  N + +  + IK TLLDQ  V G+GNIY DE+L+ S IHP + A  +  +    +  N    +  A + +GTT+ TY       G +Q  L+V+     +C NC   + KIKVNGRGT  C  CQ
  S:     1 MPEMPEVETVRRTLTPL-VKGKTIAKIIIWYPKIIVN-NPDEFVEKLTNKKILKIDRYGKYLLFRFSDDLTMVSHLRMEGKYHLVTPDHPKGKHEHVEFVFTDGTALRYADVRKFGRMHLVETGTEKQTTGIRHLGPEPNTEEFSVEYFINALSRKKKNIKNTLLDQTVVCGLGNIYVDEVLWQSKIHPLSSAKSIPADKIVDLYHNINHTITVATKERGTTVHTYLDANGDIGGYQNMLQVYGHAGEECNNCGTILEKIKVNGRGTTFCPHCQ 272
>gi|114567528|ref|YP_754682.1| DNA-formamidopyrimidine glycosylase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317553|sp|Q0AVE3|FPG_SYNWW Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|114338463|gb|ABI69311.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (268 aa)
Score = 405, Expect = 8.8e-38, Identities = 98/275 (35%), Positives = 155/275 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSY--EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++ ++L+E   L   I  +E     I +   Y  E+ T  II E     +R+GKYLI  + N    V HL M G+L+ ++ +++  + HV V I +D   ++ Y D RRFG   +  +     S+    LG +PL EEF  +YL+  ++    AIK  LL+Q  +SGIGNIYADE LF + I P+  A  L+  + + +    + +LAK+++ +GTT   Y   K Q GEFQ  L+V+ + +  C NC   + + ++ GR ++ C KCQ+
  S:     1 MPELPEVETIKNNLQE--ILPLRIKELEIRREDILRCRDYALEELTGQIIEEA----SRRGKYLILAVDNGLFLVFHLGMSGRLYIQEEETTVLEPHVHVIIHLDKRLKLLYQDARRFGGLWLLKDTQCFFSR----LGKEPLSEEFCPRYLEQVLQGRQTAIKNLLLNQNLISGIGNIYADEALFMAGIRPDRQAASLSVREIEGLCCGIKEVLAKSIKYRGTTFRDYRDGKRQPGEFQNHLQVYGRFNQACPNCGQPLKRSRIGGRSSHYCEKCQQ 268
>gi|116495189|ref|YP_806923.1| formamidopyrimidine-DNA glycosylase [Lactobacillus casei ATCC 334] >gi|116105339|gb|ABJ70481.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Lactobacillus casei ATCC 334] (282 aa)
Score = 403, Expect = 1.5e-37, Identities = 96/274 (35%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEK-TDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  SL      N+ IT I +   KI  N     F   I++ +I  I R+GKYL+  L+N +  + HLRMEG+ +  K  ++ +DK   +     D  ++RY D R+FG   +           + KLG +P    FD       +K+ ++ IK+ LLDQ  V+G+GNIYADE+L+ S ++P   A+ L   + K + +     L  A+   GT+  TY   +  +G FQ  L V+ ++   C  C   IVKIKV  RGT+ C  CQ
  S:     1 MPELPEVETVRRSLLPL-VKNKVITAINTNWEKILIN-GLATFQKEIVSSEITTIDRRGKYLLMRLSNGETIISHLRMEGRYYVVKDANTPFDKHDHVTFTFQDGSQLRYRDLRKFGRMRLIKTGQEDQVTALAKLGPEPTPSTFDEADFAQRLKRHHKPIKSVLLDQTVVAGVGNIYADEVLWLSRLNPLQPADTLKSKEIKTLHDAIIQELNAAIAAGGTSAHTYVDAEGNRGSFQNALHVYDREGTPCDRCGTTIVKIKVGQRGTHYCPHCQ 273
>gi|116490733|ref|YP_810277.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Oenococcus oeni PSU-1] >gi|116091458|gb|ABJ56612.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Oenococcus oeni PSU-1] (274 aa)
Score = 403, Expect = 1.5e-37, Identities = 96/275 (34%), Positives = 154/275 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNE-NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   LK+    N  I +++ I PK+  +    +F   ++   +  I R+GK+L+F L N+   V HLRMEG+   E    +   KH  +  E+++  ++ Y DTR+FG   +    N  ++ K I  +G +P+E +  + Y  N ++KS +A+K  LLDQ NV+GIGNIYADE+L+ S I P    N++++ +   + EN    LA A+EN G+T+ ++       G  Q  L  + +    C     +++KI+V  RGT  C KCQK
  S:     1 MPELPEVETVRRGLKKY-FENEKIKDLKIIYPKLL-DSDRTEFIEKVVGSTVSRIDRRGKFLLFRLDNNLTIVSHLRMEGRYSVEAAQEA-PHKHTEMIFELENGKQVFYDDTRKFGKMKLVKSGNEAVEVKSIGSMGPEPVESDLTFDYFYNRLQKSKKAVKALLLDQNNVAGIGNIYADEVLWLSEISPLRPTNEISEEEADNLRENIIRELAFAIENGGSTVHSFIDASGHTGRMQDKLHAYGRAGQPCERDGGELIKIRVAQRGTTYCPKCQK 274
>gi|46446526|ref|YP_007891.1| putative formamidopyrimidine-DNA glycosidase [Candidatus Protochlamydia amoebophila UWE25] >gi|81697648|sp|Q6MCT3|FPG_PARUW Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|46400167|emb|CAF23616.1| putative formamidopyrimidine-DNA glycosidase [Candidatus Protochlamydia amoebophila UWE25] (276 aa)
Score = 403, Expect = 1.6e-37, Identities = 89/276 (32%), Positives = 155/276 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIA---TYFFKKE-QKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV +++  LK+   + + I + E   PK     + E F   +  + I+++ R+GKY+IF L+N    +VHLRM G+  F  T  +    +V ++   ++  ++R+HDTR+FG + + ++   +    I  LG +PL   F ++  ++ +K     +K+ LLDQ  + G+GNIY DE L+ + +HP   AN++     K +  + + +L K ++ +GTT+    T++++ +  KGE Q  L V  K    C  C + I K+ V  R T++C  CQKK
  S:     1 MPELPEVHTIVQDLKQSRLIGKKIISTEIFWPKTLAVPTPEIFCQQVQGQSIQNVDRRGKYIIFQLSNQMFLIVHLRMTGRFQF-VTSQTPASPYVRIQFNFENGDQLRFHDTRKFGRWYLVSDVEEI----IGHLGPEPLLSSFTFELFEDMMKNRKTLLKSLLLDQSFIVGLGNIYVDEALWEAKLHPLIPANQINLKHLKILYHSIKYVLEKGIQARGTTLGPGRTHYYRLDGSKGEHQTLLNVFRKTGHPCPRCGHLIEKLIVAQRSTHICPICQKK 276
>gi|71894461|ref|YP_278569.1| foramidopyrimidine DNA gycosylase [Mycoplasma synoviae 53] >gi|71851249|gb|AAZ43858.1| foramidopyrimidine DNA gycosylase [Mycoplasma synoviae 53] (281 aa)
Score = 399, Expect = 4.4e-37, Identities = 107/277 (38%), Positives = 158/277 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTD--SSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKV----NGRGTYLCLKCQKKK 277
           +PE PEV  V  SL +   L + I N E +  K  KN S +DF  +  N+  K I   GK++ F   +    +VHLRMEGK F  KT     Y  KH  +   + +D  + Y+D+R FG+F   ++ N L  KEIK L    L ++ D  YL   ++ + R+IKT LLDQ+ V GIGNIYADE LFAS I P   A  L+    K + +N++ I+ ++++  G+T+ +Y       G+FQ+ LKV+ +   +C+ C + + K+K+    NGRGT  C  CQ +K
  S:     1 MPEYPEVTVVCQSLSKL-LLGKKINNCELLSEKFAKNSSVKDFEEFFNNKTFKKINNTGKFIEFIFDDKSRAIVHLRMEGKFFIRKTSDLEKYRFKHDHIYFHLGNDETLAYNDSRGFGSFETISKENKLSVKEIKNLA--NLPKDVDIDYLYKKLQNTTRSIKTILLDQKLVLGIGNIYADETLFASKIFPMEKAKNLSKAQLKTLMDNAQRIMDESIKLGGSTVHSYQSVNGIDGKFQQRLKVYGRAKLNCLECGSFVKKVKLDFKQNGRGTSYCPNCQNEK 281
>gi|153871079|ref|ZP_02000340.1| formamidopyrimidine-DNA glycosylase [Beggiatoa sp. PS] >gi|152072453|gb|EDN69658.1| formamidopyrimidine-DNA glycosylase [Beggiatoa sp. PS] (272 aa)
Score = 396, Expect = 1.2e-36, Identities = 90/274 (32%), Positives = 146/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTI---TNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++      +G    T+     I  +  K  +    +  T  + N++I+ I R+GKYL+   +N  + ++HL M G L+   +D+   K   +  +  DD+ +RYHD RRFG   ++      D   + KLG++PL   F  KYL ++ KK    +K  ++D   V GIGNIYA+E LF + IHP   A  ++   ++ +A+  + +L KA+E  GTT+  +     + G F++ L V+ +    CV C N I+  K+  R TY C  CQ
  S:     1 MPELPEVETI-----RRGIATYTVGKKIKIAIVREKRLRWAVPDILTTILPNQKIQKIHRRGKYLLLECSNGHI-LIHLGMSGSLWVLPSDTPLKKHDHIDIVFTDDFCLRYHDPRRFGCM-LWTSEPVFDHPLLVKLGIEPLSATFTGKYLHHHAKKRRIVVKNYIMDSHIVVGIGNIYANEALFLAGIHPTCAAGSISLKRYQHLAKKIKEVLHKAIEMGGTTLRNFSDSTGKPGYFKQSLCVYGRAGLACVQCHNTIIVKKIGQRATYYCPMCQ 270
>gi|81300132|ref|YP_400340.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Synechococcus elongatus PCC 7942] >gi|60416387|sp|Q08079|FPG_SYNP6 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81169013|gb|ABB57353.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Synechococcus elongatus PCC 7942] (282 aa)
Score = 394, Expect = 1.7e-36, Identities = 96/274 (35%), Positives = 152/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK----VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L +Q  L R  T  E ++ +     + E F   +   QI++  R+GKYL+  L+ +      + VHLRM G+ F+ +  +    KH  V++  + D E+R+ D R FG       +  ++S    + KLG +P   EF  +YL++ +++S R IKT LLDQ  V+GIGNIYADE LF + IHP T +++LT    +K+ E    +L  ++   GTT + +       G +     V+ +KD  C  C   I K+K+ GR ++ C +CQ
  S:     1 MPELPEVETVRRGLTQQ-TLQRVCTGGEVLLSRTIATPTPELFLVALQQTQIQEWRRRGKYLLADLSREGEPAGTWGVHLRMTGQFFWTEPATPL-TKHTRVRLRFEGDRELRFIDIRSFGQMWWVPPDRPVESVITGLSKLGPEPFAPEFTARYLRDRLRRSQRPIKTALLDQSLVAGIGNIYADESLFRTGIHPTTPSDRLTKIQAEKLREAIVEVLTASIGAGGTTFSDFRDLTGVNGNYGGQAWVYGRKDQPCRTCGTPIQKLKLAGRSSHFCPRCQ 279
>gi|21730465|pdb|1KFV|A Chain A, Crystal Structure Of Lactococcus Lactis Formamido- Pyrimidine Dna Glycosylase (Alias Fpg Or Mutm) Non Covalently Bound To An Ap Site Containing Dna. >gi|21730466|pdb|1KFV|B Chain B, Crystal Structure Of Lactococcus Lactis Formamido- Pyrimidine Dna Glycosylase (Alias Fpg Or Mutm) Non Covalently Bound To An Ap Site Containing Dna. (271 aa)
Score = 394, Expect = 1.7e-36, Identities = 98/274 (35%), Positives = 155/274 (56%)
  Q:     3 ELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           ELPEV++V   L E+  + + I +IE+  P+      +E     +  + I+ I+R+GKYLIF + +D   + HLR EGK      D+  +K H  +  +  D ++ Y D R+FGT+ + + +  L     KK+G +P  E+FD K  +  ++KS + IK  LL+Q  V+G+GNIY DE+L+ + IHPE   N+L ++    + ++   IL KA++  G++I TY       G+ Q  L+V+ K    C  C  +I KIKV GRGT+ C  CQ+K
  S:     2 ELPEVETVRREL-EKRIVGQKIISIEATYPRXVLT-GFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRXEGKYRLATLDAPREK-HDHLTXKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTY-SALGSTGKXQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK 271
>gi|119713349|gb|ABL97413.1| formamidopyrimidine-DNA glycosylase [uncultured marine bacterium EB80_02D08] (270 aa)
Score = 391, Expect = 4.4e-36, Identities = 102/274 (37%), Positives = 152/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNI--ESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ + ++++   L      I   ++  KI K     DF    I + ++ I R+ KYLIFHL+N +  ++HL M G L   K + ++  KH  V++  DD  I Y+D RRFG+  +   +NY   K IK LG +PL + F+ +      K S   IK+ L++Q+NV GIGNIYA E LF SSI P   A  L  N+ KK+  + + IL KA+   GTT+  ++      G F+  L V+ +++  C NC   I KI +N R T+ C  CQ
  S:     1 MPELPEVETTLRAIEKFQSLKIHEVKIYNRNLRWKISK-----DFESLTIGQTVESIKRRAKYLIFHLSNGQNIILHLGMSGSLRIAKNNENFFIKHDHVELIFDDERIIYNDPRRFGSMHV--TSNYKKHKLIKNLGPEPLSKNFNAESFYAACKTSKTNIKSFLMNQKNVVGIGNIYASESLFLSSISPLRDAKDLDLNECKKLVASGKKILKKAINVGGTTLKDFYSADGSPGYFKFELNVYGRENESCNNCCENISKIVINQRATFFCKSCQ 269
>gi|89211733|ref|ZP_01190080.1| Formamidopyrimidine-DNA glycolase [Halothermothrix orenii H 168] >gi|89158663|gb|EAR78364.1| Formamidopyrimidine-DNA glycolase [Halothermothrix orenii H 168] (274 aa)
Score = 389, Expect = 6.8e-36, Identities = 93/275 (33%), Positives = 160/275 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYED---FTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V+  LKE   L + +  I  ++ +  K   Y D   F   +   ++ D+ R+GKY++  L N++  V HL+M G+L   + ++ YDK  H + ++E D  ++R+++ R+FG   +  +  +  +  +  LG +PL +EF      + IK+    IK  LL+Q+ ++G+GNIYADE LF + I PE  A+ L D++ +++    R +L   ++  GT++  Y   + + GEFQ  LKV+ K   +CVNC ++I K  + GR ++ C  CQK
  S:     1 MPELPEVETVVRGLKE---LIKGV-KINKVIIRETKLLVYPDPDTFIDLVEGSRVIDVLRRGKYILIKLDNNRFLVFHLKMTGQLVVYERNNKYDKHTHFVFELE-DGRDLRFNNMRKFGRVYLVTKGEFDKAGSLADLGPEPLSDEFTVDEFADIIKRRKGNIKGLLLNQKFIAGLGNIYADEALFEAGISPERKADSLDDSEIERLYHAIRKVLKMGIKYGGTSMKDYVNARGRIGEFQNKLKVYRKTGEECVNCGHEIQKKVIRGRSSHYCPGCQK 274
>gi|163763562|ref|ZP_02170623.1| formamidopyrimidine-DNA glycosylase [Bacillus selenitireducens MLS10] >gi|160355882|gb|EDP82534.1| formamidopyrimidine-DNA glycosylase [Bacillus selenitireducens MLS10] (286 aa)
Score = 385, Expect = 2.2e-35, Identities = 97/277 (35%), Positives = 146/277 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPL-EEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V  +L E   + RTI ++    P + K     E F   +  + I+ I RKGK+L  +L +D V V HLRMEGK   ++  S   K  HV+++   D   + Y D R+FGT   + +        + K+G +P+ ++      L   +KK+ RA+K  LLDQ  V+G+GNIY DE LF + IHP   A+ L D     +       L +A++  GT+I +Y   K + G FQ+ L V+ +    C  C   I +  V GRGT+ C  CQ  +
  S:     1 MPELPEVETVRQTLTEL-LIGRTIEDVWVGWPAMIKEPDDVERFALMLTGQTIQSIGRKGKFLKLYL-DDCVLVSHLRMEGKYALKEAGSERSKHTHVVIRF-TDGTALHYADVRKFGTMHAFVKGTEEQRPPLSKVGPEPVGKDRITADELGTRLKKTTRAVKAALLDQSLVAGLGNIYVDEALFRAGIHPAVPAHTLPDKLIPVLLSAISDTLQEAIDQGGTSIRSYVNGKGEMGYFQQQLFVYGRTGEPCRKCGTPISRSVVGGRGTHTCEVCQPNR 277
>gi|159030210|emb|CAO91102.1| mutM [Microcystis aeruginosa PCC 7806] (285 aa)
Score = 384, Expect = 2.5e-35, Identities = 97/274 (35%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKI--FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L +  QG   + I   E ++ +   + NC    F   I    I +  R+GKYL+ +L N     VHLRM G+L + K  +       L     +  E+R+ DTR FG       +   +S    +KKLGL+P +  F   YL ++ +KS R IKT LLDQ  V+GIGNIYADE+LF S IHP+T AN L       + +N   +L  A+   GT+ + +       G +     V+ +   +C  C   I +IK++GR ++ C +CQ
  S:     1 MPELPEVETVRRGLNQVTQG---KKIIGGEVLLQRTLAYPNCE-ATFLQGITQTTITNWQRRGKYLLANLDNGSSIGVHLRMTGQLLWVKDTTPLPIHTRLRFFFANQQELRFVDTRTFGKIWWIAADKTPESVITGLKKLGLEPFDRNFTPDYLYSHCQKSRRPIKTFLLDQNVVAGIGNIYADEVLFKSGIHPQTAANLLKIEQIDLLTKNIISVLETAIAEGGTSFSDFLHVTGVNGNYGSMAWVYGRTGENCRLCGATIARIKLSGRSSHFCPQCQ 276
>gi|186898972|ref|ZP_02971936.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. PCC 7424] >gi|186694249|gb|EDU18861.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. PCC 7424] (277 aa)
Score = 382, Expect = 4.2e-35, Identities = 96/274 (35%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q  L + I   E ++P+      S  +F   I   +I    R+GKYL+  L       VHLRM G+L + K D SY K   L     +D E+R+ DTR FG       +   +     ++KLG++P  + F  +YL++ +K S R IK+ LLDQE V+GIGNIYADE LF S I P+ IA  LT    +K+      +L  +++  GTT + +       G +     V+ +    C  C   I ++K+ GR ++ C  CQ
  S:     1 MPELPEVETVCRGLN-QLTLGQPIEGGEVLLPRTLAYPFSIAEFWEGITGTKINLWQRRGKYLLALLDCGGYLGVHLRMTGQLLWVKRDISYPKHTRLRLFLGEDQELRFVDTRTFGKVWWIPPDQSPEKIITGLQKLGVEPFSQAFSVEYLQHKLKTSRRKIKSVLLDQEVVAGIGNIYADEALFKSGIRPDAIACSLTPQQLEKLRWAICDVLQTSIDKGGTTFSDFLSVTGVNGNYGGVAWVYGRGGESCRVCGTPIERVKLGGRSSHFCPSCQ 276
>gi|83590674|ref|YP_430683.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Moorella thermoacetica ATCC 39073] >gi|123524146|sp|Q2RHE9|FPG_MOOTA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|83573588|gb|ABC20140.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Moorella thermoacetica ATCC 39073] (274 aa)
Score = 382, Expect = 4.2e-35, Identities = 90/274 (32%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCL-NRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-EKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++  +L    CL  + I  +E   P +      E F+  +    I  + R+GKYL+ HL+ +   VVHLRM G+L F E         HV+  +      +R+ DTRRFG   +  +        ++ LG +PL+  FD   L   +    R IK  LLDQ  V+GIGNIYADE+LFA+ I P   A  L   +  ++    + +L + + N+GT+I  Y     ++G  Q+ L+V+ +    C  C   + ++++ GR T+ C +CQ
  S:     1 MPELPEVETIKRTLTP--CLREQKIARVEVYHPGVIAAPDPETFSRLLAGRIITGLDRRGKYLLVHLSGEYCLVVHLRMTGRLVFTEGAAPLAPHTHVVFSLAGGP-SLRFVDTRRFGRLYLAAKAEVETLPGLRDLGPEPLDPAFDALALAAILAGRRRPIKQVLLDQRLVAGIGNIYADEMLFAAGIDPRRPAASLNHEEVARLRGAMQRVLEQGIANRGTSIRDYVDGSGRQGSNQEHLQVYGRTGRPCPRCGQPLERVRLGGRSTHFCPRCQ 273
>gi|104774357|ref|YP_619337.1| DNA-formamidopyrimidine glycosylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122983913|sp|Q1G9A3|FPG_LACDA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|103423438|emb|CAI98311.1| DNA-formamidopyrimidine glycosylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (273 aa)
Score = 382, Expect = 4.3e-35, Identities = 92/276 (33%), Positives = 144/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PE+PEV++V  +L+    + +TI +++    K+      E F   +  +    + R  K+L+F L  D   V HLRMEGK      D+  DK   L     D   +RY D R+FG   +           +K LG++    EF   Y +  +KK +  IK+ L+ Q  V+G+GNIY DE+L+ S I+P T AN+LT +  K++       + +A +  GTT+ ++   +   G +Q+ LKV+ K+   C  C    VKIK++GRGT  CL CQK+
  S:     1 MPEMPEVETVRRTLRPL-VVGKTIDHVDIWYDKVITG-DPETFKRELKGKTFTAVDRYAKFLLFRL-GDLTVVSHLRMEGKYHLTTWDAPVDKHEHLQFAFTDGSSLRYADVRKFGRLQLVETGTEFQVTGLKNLGVEANSPEFRLDYFEKGLKKRSMNIKSLLMSQTLVAGLGNIYVDEVLWQSRINPLTPANELTKDQVKQLHSAINETIEEATKYGGTTVHSFLNAEGGAGHYQEKLKVYGKEGQPCPRCGEDFVKIKISGRGTTYCLHCQKR 273
>gi|166365259|ref|YP_001657532.1| formamidopyrimidine-DNA glycosylase [Microcystis aeruginosa NIES-843] >gi|166087632|dbj|BAG02340.1| formamidopyrimidine-DNA glycosylase [Microcystis aeruginosa NIES-843] (285 aa)
Score = 382, Expect = 4.6e-35, Identities = 97/274 (35%), Positives = 143/274 (52%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKI--FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L +  QG   + I   E ++ +   + NC    F   I    I +  R+GKYL+ +L N     VHLRM G+L + K  +       L     +  E+R+ DTR FG       +   +S    +KKLGL+P +  F   YL ++ +KS R IKT LLDQ  V+GIGNIYADE+LF S IHP+T AN L       + +N   +L  A+   GT+ + +       G +     V+ +   +C  C   I +IK++GR  + C +CQ
  S:     1 MPELPEVETVRRGLNQVTQG---QKIIGGEVLLQRTLAYPNCE-ATFLQGIAQTTITNWQRRGKYLLANLDNGSSIGVHLRMTGQLLWVKDTTPLPIHTRLRFFFANQQELRFVDTRTFGKIWWIAADKTPESVITGLKKLGLEPFDRNFTADYLYSHCQKSRRPIKTFLLDQNVVAGIGNIYADEVLFKSGIHPQTAANLLKIEQIDLLTKNIISVLETAIAEGGTSFSDFLHVTGVNGNYGAMAWVYGRNGENCRLCGATIARIKLSGRSAHFCPQCQ 276
>gi|21730608|pdb|1L1T|A Chain A, Mutm (Fpg) Bound To Abasic-Site Containing Dna >gi|21730611|pdb|1L1Z|A Chain A, Mutm (Fpg) Covalent-Dna Intermediate >gi|21730614|pdb|1L2B|A Chain A, Mutm (Fpg) Dna End-Product Structure >gi|21730618|pdb|1L2C|A Chain A, Mutm (Fpg)-Dna Estranged Thymine Mismatch Recognition Complex >gi|21730621|pdb|1L2D|A Chain A, Mutm (Fpg)-Dna Estranged Guanine Mismatch Recognition Complex (274 aa)
Score = 381, Expect = 5.5e-35, Identities = 89/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNC-SYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++  +L     + +TI ++    P I ++    E F   +I + ++ + R+GK+L F L  D   + HLRMEG+          +    +V    D  E+RY D R+FGT  +Y +        + +LG +PL   F    L     K+ R++K  LLDQ  V+G GNIY DE LF + I P   A  L+  + +++ E     + +AV   G+T+ TY   + + G FQ  L V+ ++   C  C   I K  V GRGT+ C +CQ+
  S:     1 MPELPEVETIRRTLLPL-IVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRD-ALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR 274
>gi|159897723|ref|YP_001543970.1| formamidopyrimidine-DNA glycosylase [Herpetosiphon aurantiacus ATCC 23779] >gi|159890762|gb|ABX03842.1| formamidopyrimidine-DNA glycosylase [Herpetosiphon aurantiacus ATCC 23779] (273 aa)
Score = 381, Expect = 5.8e-35, Identities = 95/274 (34%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESI-MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  SL EQ  + R    + S+  PKI    S E F   I   QI+ + R+ KYL+  L N +  +VHLRM G++     D   D+  HV+V ++ +  E+R+HD R+FG +++ + +      +  +LG +PL ++F        + +    IK TLLDQ  ++G+GNIYADE L+ + IHP   AN L  N+  ++ E  + +L  ++E++GTT+  Y       GE Q  L+ + +    C  C   I +I V  R T++C  CQ
  S:     1 MPELPEVETVRRSL-EQELVGRYFVALRSLGWPKIVDTHSPELFAEAIAQRQIQQVQRRAKYLLIELDNHETLIVHLRMTGQMLVVAADEPADRHTHVVVALD-NGRELRFHDPRKFGRWSLVDRSGVAALNQ--RLGPEPLGDDFTLDDFAQRLSRKATKIKPTLLDQSVLAGVGNIYADEALWLAKIHPLRSANSLNANEIAELFEAIKTVLRNSIEHRGTTLVNYRDAYGASGENQYHLEAYGRTGEPCRRCGTPIERIVVAQRSTHICPVCQ 272
>gi|56421263|ref|YP_148581.1| formamidopyrimidine-DNA glycosylase [Geobacillus kaustophilus HTA426] >gi|81675729|sp|Q5KWC3|FPG_GEOKA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56381105|dbj|BAD77013.1| formamidopyrimidine-DNA glycosidase [Geobacillus kaustophilus HTA426] (274 aa)
Score = 381, Expect = 6.5e-35, Identities = 90/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNC-SYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++  +L     + +TI ++    P I ++    E F   +I + ++ + R+GK+L F L  D   + HLRMEG+          +    +V    D  E+RY D R+FGT  +Y +        + +LG +PL   F    L     K+ R++K  LLDQ  V+G GNIY DE LF + I P   A  L+  + +++ E     + +AV   G+T+ TY   + + G FQ  L V+ +K   C  C   I K  V GRGT+ C +CQ+
  S:     1 MPELPEVETIRRTLLPL-IVGKTIEDVRIFWPNIIRHPRDPEAFAARMIGQTVRGLERRGKFLKFLLDRD-ALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGAFQHSLFVYGRKGEPCKRCGTPIEKTVVAGRGTHYCPRCQR 274
>gi|38492995|pdb|1R2Y|A Chain A, Mutm (Fpg) Bound To 8-Oxoguanine (Oxog) Containing Dna >gi|38492998|pdb|1R2Z|A Chain A, Mutm (Fpg) Bound To 5,6-Dihydrouracil (Dhu) Containing Dna (274 aa)
Score = 378, Expect = 1.3e-34, Identities = 88/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNC-SYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +P+LPEV+++  +L     + +TI ++    P I ++    E F   +I + ++ + R+GK+L F L  D   + HLRMEG+          +    +V    D  E+RY D R+FGT  +Y +        + +LG +PL   F    L     K+ R++K  LLDQ  V+G GNIY DE LF + I P   A  L+  + +++ E     + +AV   G+T+ TY   + + G FQ  L V+ ++   C  C   I K  V GRGT+ C +CQ+
  S:     1 MPQLPEVETIRRTLLPL-IVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRD-ALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR 274
>gi|116514451|ref|YP_813357.1| formamidopyrimidine-DNA glycosylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274817|sp|Q049F3|FPG_LACDB Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|116093766|gb|ABJ58919.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (273 aa)
Score = 377, Expect = 1.6e-34, Identities = 92/276 (33%), Positives = 143/276 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PE+PEV++V  +L+    + +TI +++    K+      E F   +  +    + R  K+L+F L  D   V HLRMEGK      D+  DK   L     D   +RY D R+FG   +           +K LG++    EF   Y +  +KK +  IK+ L+ Q  V+G+GNIY DE+L+ S I+P T AN+LT +  K++       + +A +  GTT+ ++   +   G +Q+ LKV+ K+   C  C    VKIK+ GRGT  CL CQK+
  S:     1 MPEMPEVETVRRTLRPL-VVGKTIDHVDIWYDKVITG-DPETFKRELKGKTFTVVDRYAKFLLFRL-GDLTVVSHLRMEGKYHLTTWDAPVDKHEHLQFAFTDGSSLRYADVRKFGRLQLVETGTEFQVTGLKNLGVEANSPEFRLDYFEKGLKKRSMNIKSLLMSQTLVAGLGNIYVDEVLWQSRINPLTPANELTKDQVKQLHSAINETIEEATKYGGTTVHSFLNAEGGAGHYQEKLKVYGKEGQPCPRCGEDFVKIKICGRGTTYCLHCQKR 273
>gi|37912918|gb|AAR05254.1| predicted formamidopyrimidine-DNA glycosylase [uncultured marine proteobacterium ANT32C12] (269 aa)
Score = 377, Expect = 1.7e-34, Identities = 96/274 (35%), Positives = 157/274 (57%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ + ++ +  Q  L  T  +  ++  K+ +N  +E  T    N+ I  I+R+ KY+IFHL N  + ++HL M G L   K + ++  KH   +   D+ +I Y+D RRFG+  I+  +N  + + IK LG +PL ++F+   L     KS   IK+ L++Q+NV GIGNIYA E L+ + I+P  +A+ LT  D KKI  +++ IL  A++  GTT+  ++      G F+  L  + ++  +C  CK  I K+ +N R T+ C  CQ
  S:     1 MPELPEVETTVRAINKFSQSTLKSTKIHNRNLRWKVVEN--FESLTK---NQSINKISRRAKYIIFHLDNINI-ILHLGMSGSLRISKNNDNFFLKHDHAEFIFDEEKIVYNDPRRFGS--IHLADNLDEHRLIKNLGPEPLSKDFNPNDLHKITAKSKINIKSLLMNQKNVVGIGNIYASESLYLAQINPNRVASDLTIEDCKKITLSAKKILNAAIKVGGTTLKDFYSADGSPGYFKFELNAYGREGLECKKCKTLITKVVINTRATFFCGSCQ 268
>gi|54293547|ref|YP_125962.1| hypothetical protein lpl0599 [Legionella pneumophila str. Lens] >gi|81679294|sp|Q5WYY6|FPG_LEGPL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|53753379|emb|CAH14832.1| hypothetical protein [Legionella pneumophila str. Lens] (274 aa)
Score = 374, Expect = 3.8e-34, Identities = 91/274 (33%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +K   +GC+   IT+++    K+       +       + I  ITR+GKY++ H+ +    ++HL M G L    +T +     HV + I  +   +R+ D RRFG F   +EN Y     +  LG +PL ++F+ +YL       +++IK+ ++D + V GIGNIYA E LF + IHP T A K+T  +F  +  + + IL  A+E  GTT+  ++    + G F+  LKV+ +K+  C+ C+NKI  + + GR +  C  CQ
  S:     1 MPELPEVETTKQGIKPHLEGCM---ITSVQVRNQKLRLPVPL-NLNELCEGKHITAITRRGKYILLHM-DKGYLLIHLGMSGHLRIVSQTANPQKHDHVDLHIN-NGLALRFRDPRRFGLFIYIDENPY-QHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQ 270
>gi|75907494|ref|YP_321790.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Anabaena variabilis ATCC 29413] >gi|123610190|sp|Q3MDP1|FPG_ANAVT Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|75701219|gb|ABA20895.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Anabaena variabilis ATCC 29413] (277 aa)
Score = 374, Expect = 3.9e-34, Identities = 96/274 (35%), Positives = 143/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q  LNR IT  + ++ + I    S  DF + I  + I    R+GKYL+   T+     VHLRM G+L +   D     KH  V+I  +D  E+R+ D R FG     +    ++S    + KL +DP   EF  +YL N +    R IKT LLDQ  V+G+GNIYADE LF S + PET+  ++     + +      +L  ++E  GTT + +   K   G +     V+ +    C  C + I +IK+ GR ++ C +CQ
  S:     1 MPELPEVETVRRGLN-QLTLNRKITGGDVLLHRTIAHPFSVGDFLNGITGDSISAWHRRGKYLLASTTSAAWLGVHLRMTGQLLWLNQDEPL-HKHTRVRIFFEDQQELRFVDQRTFGQMWWVSSGMAVESVITGLAKLAVDPFSPEFTVEYLANKLHNRRRPIKTALLDQSVVAGLGNIYADEALFKSGVLPETLCTEVQLKQIELLRTAIIQVLETSIEAGGTTFSNFLNVKGVNGNYGGVAWVYNRAGEPCKVCGDVIQRIKLGGRSSHFCRQCQ 276
>gi|51244765|ref|YP_064649.1| formamidopyrimidine-DNA glycosylase [Desulfotalea psychrophila LSv54] >gi|81692916|sp|Q6APT2|FPG_DESPS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|50875802|emb|CAG35642.1| probable formamidopyrimidine-DNA glycosylase [Desulfotalea psychrophila LSv54] (277 aa)
Score = 373, Expect = 5.6e-34, Identities = 88/275 (32%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGT--FTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ ++  +    C  RTI  +     ++       +       ++I  + R+GKY+   L +  + V+HL M G+L  F K  +     H   +++ ++ E RY+DTRRFG+  F    ++  L     +KLG +PL E F   YL+   +  + AIK  ++D   V GIGNIYA+E LF ++IHP      +   +++K+A   + IL  A++  G+TI+ +   K  +G FQ   KV+ KK   C +C+  I   K+ GR ++ C  CQ+
  S:     1 MPELPEVEIILRGISPLIC-GRTIVAVGGSGKQLRLPLPLPELNRDASGKEITRLERRGKYISIFLNDGGILVLHLGMTGQLGVFPKEQARAKHDHFWCRLD-NNQEFRYNDTRRFGSIRFLPAGKSRMLQESLYQKLGPEPLGETFTADYLRRAAEGKSLAIKNFIMDSHIVVGIGNIYANESLFKAAIHPARSVQSIEQEEWEKLARCIQQILLHAIDCGGSTISDFVNAKGGQGYFQMNFKVYGKKSLPCPHCQGPISSEKIGGRASFFCPSCQR 276
>gi|119713191|gb|ABL97259.1| putative formamidopyrimidine-DNA glycosylase [uncultured marine bacterium EB0_50A10] (269 aa)
Score = 372, Expect = 6.0e-34, Identities = 98/274 (35%), Positives = 157/274 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ + ++++    N+ ++NI+ +  +  +    +D      N+ IK++ R+ KY+IF L    + ++HL M G L     D +Y  KH  V+   D+ +I Y+D RRFG+  I+   +    + I  LG +PL +EF+ KYL     +S   IKT L++Q+NV GIGNIYA E L+ S ++P   ++KLT +D KK+  +S+ IL  A++  GTT+  ++      G F+  L V+ ++  DC  CK KI K  +N R TY C  CQ
  S:     1 MPELPEVETTLRAIEKFK--NQRLSNIK-VHNRNLRWKVDKDLEINSKNQIIKNLRRRAKYIIFDLDKCSI-ILHLGMSGSLRIANNDDNYFLKHDHVEFLFDNEKIIYNDPRRFGS--IHLTEDIDKHRLINHLGPEPLSKEFNSKYLLALCSRSKTNIKTLLMNQKNVVGIGNIYASETLYLSKVNPLKDSSKLTIDDCKKVVRSSKKILDAAIKVGGTTLKDFYSADGSPGYFKFKLNVYGREGLDCKRCKTKIAKTNINKRATYYCSSCQ 268
>gi|93279440|pdb|2F5N|A Chain A, Mutm Crosslinked To Undamaged Dna Sampling A:t Base Pair Ic1 >gi|93279443|pdb|2F5O|A Chain A, Mutm Crosslinked To Undamaged Dna Sampling G:c Base Pair Ic3 >gi|93279446|pdb|2F5P|A Chain A, Mutm Crosslinked To Undamaged Dna Sampling A:t Base Pair Ic2 (274 aa)
Score = 372, Expect = 6.0e-34, Identities = 88/275 (32%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNC-SYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++  +L     + +TI ++    P I ++    E F   +I + ++ + R+GK+L F L  D   + HLRMEG+          +    +V    D  E+RY D R+FGT  +Y +        + +LG +PL   F    L     K+ R++K  LLD   V+G GNIY DE LF + I P   A  L+  + +++ E     + +AV   G+T+ TY   + + G FQ  L V+ ++   C  C   I K  V GRGT+ C +CQ+
  S:     1 MPELPEVETIRRTLLPL-IVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRD-ALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR 274
>gi|66879879|ref|ZP_00404868.1| COG0266: Formamidopyrimidine-DNA glycosylase [Mycoplasma genitalium G-37] (165 aa)
Score = 372, Expect = 6.2e-34, Identities = 77/147 (52%), Positives = 104/147 (70%)
  Q:   129 SKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           + ++ KL  DPLE  FD++ +    + S R +KT +LDQ  +SGIGNIYADEILFAS I+PET+ ++LT  + + + +N+  ILAKA+  KGTTI+++ FKK+  G +Q FLKVHTKKD  C  C   IVK K+NGRG+Y CL CQK
  S:     8 AAQLNKLAFDPLEAGFDYRKIFQKAQNSKRKVKTFILDQTVISGIGNIYADEILFASKINPETMVDQLTIKEIEILCKNATKILAKAIVMKGTTISSFSFKKDHTGGYQNFLKVHTKKDQPCSVCNQLIVKKKINGRGSYFCLNCQK 154
>gi|67906503|gb|AAY82610.1| predicted formamidopyrimidine-DNA glycosylase [uncultured bacterium MedeBAC35C06] (269 aa)
Score = 371, Expect = 7.4e-34, Identities = 99/275 (36%), Positives = 163/275 (59%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ + +L  Q  + + I +++ I  +  +    +DF   I N++I  I R+ KY+IF+L+ D   ++HL M G +  +   S+  KKH  + + + D +I Y+D RRFG+  I+  +N  D   IK LG +PL  +F+ KYL N  +KS   IK  +++Q+ V G+GNIYA E LF + I+P  I N +++ D K++ ++ + IL  A+   GTT+  ++     +G F+  LKV+ +++  C +CK  I KI +N R T+ CL CQK
  S:     1 MPELPEVETTMSAL--QPFVEKKIVSVD-INNRNLRWKIEKDFEKNISNKKIISIARRAKYIIFNLS-DGFIILHLGMSGNIRIQDLKSNTYKKHDHIILYLKDKKIIYNDIRRFGS--IHFTDNAKDHFLIKNLGPEPLLSDFNKKYLFNISRKSKTNIKNFIMNQKVVVGVGNIYASEALFEARINPNMITNSISEEDCKRLVKSIKNILKIAINMGGTTLKDFYSVDGSEGYFKIKLKVYGRENKKCKSCKGVIKKIVLNQRSTFYCLDCQK 269
>gi|93279449|pdb|2F5Q|A Chain A, Catalytically Inactive (E3q) Mutm Crosslinked To Oxog:c Containing Dna Cc2 >gi|93279452|pdb|2F5S|A Chain A, Catalytically Inactive (E3q) Mutm Crosslinked To Oxog:c Containing Dna Cc1 (274 aa)
Score = 369, Expect = 1.5e-33, Identities = 87/275 (31%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNC-SYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +P+LPEV+++  +L     + +TI ++    P I ++    E F   +I + ++ + R+GK+L F L  D   + HLRMEG+          +    +V    D  E+RY D R+FGT  +Y +        + +LG +PL   F    L     K+ R++K  LLD   V+G GNIY DE LF + I P   A  L+  + +++ E     + +AV   G+T+ TY   + + G FQ  L V+ ++   C  C   I K  V GRGT+ C +CQ+
  S:     1 MPQLPEVETIRRTLLPL-IVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRD-ALISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR 274
>gi|67458634|ref|YP_246258.1| formamidopyrimidine-DNA glycosidase [Rickettsia felis URRWXCal2] >gi|75536900|sp|Q4UMW5|FPG_RICFE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|67004167|gb|AAY61093.1| Formamidopyrimidine-DNA glycosidase [Rickettsia felis URRWXCal2] (276 aa)
Score = 369, Expect = 1.5e-33, Identities = 95/274 (34%), Positives = 157/274 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD-KKHVLVKIEMDDYE-IRYHDTRRFGTFTIYN-ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++ +SLK++  +   I N+E     +    S       I N  I D+ R+ KYLI    ND   +VHL M G+  F    S+Y+ KKH  V  ++ + E + ++DTRRFG   IYN + N+L+ +    LG++PL +    +YLK+ +      IK  ++D   + G+GNIYA E L+ + IHP+ + + L D++ + + ++ R +LAKA+   GTT+  +     + G F + L V+ ++  +C+NC + I+K K +GR T+ C  CQ
  S:     1 MPELPEVETLKNSLKDK-LIELIIENVELKRDNLRYKLS-PLLASEISNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGR--FTLQPSNYETKKHDHVIFDLSNGEKLIFNDTRRFGM--IYNFKTNFLEKELFNNLGVEPLSDSLTLEYLKSKLITRKIPIKNLIMDNRIIVGVGNIYASESLYLARIHPDKLGSNLRDDEIESLIKSIREVLAKAITAGGTTLKDFVNGDNKPGYFTQQLTVYGRERQNCLNCSSTIIKTKHSGRSTFYCRTCQ 271
>gi|33239822|ref|NP_874764.1| formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|39931231|sp|Q7VDK6|FPG_PROMA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|33237348|gb|AAP99416.1| Formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (283 aa)
Score = 368, Expect = 1.7e-33, Identities = 109/275 (39%), Positives = 161/275 (58%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHL-TNDKV-----FVVHLRMEGKL--FFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI---KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   LK +   +  I ++E I P+ I      + F   II  +  + TR+GKYLI  L ++D+      +VVHLRM G+   F +KT S    KH  V+I   D  EIR+ DTR FG    +    +L +++I   KKLG +P  +EF+  YL+ ++KK  R+IK++LLDQ  V+G GNIYADE LF + I P   + KL   + KKI  +   IL  ++   GT+   +   +   G++     V+ +++  C  C  KI+K KV GRGT+ C  CQK
  S:     1 MPELPEVETVKRGLKNR-LKDFYIHDVEVITPRSISSEGGSKAFVKNIIGLKSGEWTRRGKYLICSLHSSDREEIAGWWVVHLRMTGQFQWFQKKTKSC---KHTRVRIWNKDGAEIRFVDTRNFGQMW-WISPTFLPTEKITGLKKLGPEPFSKEFNPFYLQESLKKRKRSIKSSLLDQSIVAGAGNIYADESLFQAGILPTKESKKLNKTEIKKICTSLTHILKISIGEGGTSFKDFRDLEGVNGKYGGQAWVYGRENKPCRKCGVKILKAKVAGRGTHWCPNCQK 283
>gi|167730792|emb|CAO81704.1| putative formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Candidatus Cloacamonas acidaminovorans] (267 aa)
Score = 367, Expect = 2.3e-33, Identities = 96/275 (34%), Positives = 153/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMP-KIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEVQS+I+ L E+    +TI  IE      +  NC  ED        +   I R+GKY+I  L  D   ++HLRM GKL ++ T      K+   +I +++ E+  + D R FG   I ++ N      +  LGL+P  ++F  K LK  +      IK  L+DQ+ ++G+GNIY  EIL+ + I+PE  ANK+T  +  KI + ++ +L +A++  GT+I+ Y    ++ G FQ FL+V+ K+        +K++++K  GR T+ C  CQK
  S:     1 MPELPEVQSIINDL-EKVLKGKTIKTIECYYSGTVITNCLPEDNP---FPSRALAIKRRGKYIIIMLERDNALIIHLRMTGKLIYD-TFCGEPLKYERARIILENNEVLHFIDIRTFGKIVICSQKNI--EHCLPPLGLEPFSDDFTPKALKEKMHGKKAPIKIALMDQKIIAGLGNIYVCEILYRAGINPEKPANKITRKNIVKIIQQTKEVLTEAIDKGGTSISDYRRIDDKPGSFQNFLQVYQKQ---FCPLGHKVLRLKQGGRSTFYCPICQK 267
>gi|172039237|ref|YP_001805738.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. ATCC 51142] >gi|171700691|gb|ACB53672.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. ATCC 51142] (283 aa)
Score = 366, Expect = 2.9e-33, Identities = 94/274 (34%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFV-VHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q    +TI   + ++P+      S E+F   I N       R+GKYL+  L   K ++ VHLRM G+L + K +     +H  +++  D   E+R+ D R FG       N   ++    ++KLGL+P    F   Y  + +K   R IKT LLDQ  V+GIGNIYADE LF S I P T+  +L+    K++ E    +L  A+E  GTT + +       G +     V+ + +  C  C   I +IK+ GR ++ C +CQ
  S:     1 MPELPEVETVCRGLN-QLTFGQTIRGGKVLLPRTLAYPVSIEEFLEQINNATFGQWQRRGKYLLVPLEEKKGWLGVHLRMTGQLLWVKQNEPL-SRHTRLRLFCDRSKELRFVDIRTFGKVWWVPPNQPPETIITGLQKLGLEPFSNAFSLDYFIDKLKGRQRNIKTILLDQSVVAGIGNIYADEALFKSGIRPTTLGKELSQPQVKRLREAMIEVLKTAIEEGGTTFSDFRGVTGINGNYSGVAWVYGRHNQPCRVCGTPIERIKLGGRSSHFCPQCQ 277
>gi|54296585|ref|YP_122954.1| hypothetical protein lpp0616 [Legionella pneumophila str. Paris] >gi|81679547|sp|Q5X7I9|FPG_LEGPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|53750370|emb|CAH11764.1| hypothetical protein [Legionella pneumophila str. Paris] (274 aa)
Score = 366, Expect = 3.4e-33, Identities = 90/274 (32%), Positives = 146/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFV-VHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +K    L   I     +  +  +     +       + I  ITR+GKY++ H+  DK ++ +HL M G L    +T +     HV + I  +   +R+ D RRFG F   +EN Y     +  LG +PL ++F+ +YL       +++IK+ ++D + V GIGNIYA E LF + IHP T A K+T  +F  +  + + IL  A+E  GTT+  ++    + G F+  LKV+ +K+  C+ C+NKI  + + GR +  C  CQ
  S:     1 MPELPEVETTKQGIKPH--LEGRIITTAQVRNRKLRLPVPLNLNELCEGKHITAITRRGKYILLHM--DKGYILIHLGMSGHLRIVSQTANPQKHDHVDLHIN-NGLALRFCDPRRFGLFIYIDENPY-QHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQ 270
>gi|52840799|ref|YP_094598.1| formamidopyrimidine DNA glycosylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|81680527|sp|Q5ZY18|FPG_LEGPH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|52627910|gb|AAU26651.1| formamidopyrimidine DNA glycosylase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (274 aa)
Score = 366, Expect = 3.4e-33, Identities = 89/274 (32%), Positives = 147/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +K      R IT ++ +  +  +     +       + I  ITR+GKY++ H+ +    ++HL M G L    +T +     HV + I  +   +R+ D RRFG F   +EN Y     +  LG +PL ++F+ +YL       +++IK+ ++D + V GIGNIYA E LF + IHP T A K+T  +F  +  + + IL  A+E  GTT+  ++    + G F+  LKV+ +K+  C+ C+NKI  + + GR +  C  CQ
  S:     1 MPELPEVETTKQGIKPH-LEGRMITAVQ-VRNRKLRLPVPLNLNELCQGKHITAITRRGKYILLHM-DKGYLLIHLGMSGHLRIVSQTANPQKHDHVDLHIN-NGLALRFCDPRRFGLFIYIDENPY-QHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQ 270
>gi|148360789|ref|YP_001251996.1| formamidopyrimidine DNA glycosylase [Legionella pneumophila str. Corby] >gi|148282562|gb|ABQ56650.1| formamidopyrimidine DNA glycosylase [Legionella pneumophila str. Corby] (274 aa)
Score = 364, Expect = 5.6e-33, Identities = 88/274 (32%), Positives = 147/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +K      R IT ++ +  +  +     +       + I  ITR+GKY++ H+ +    ++HL M G L    +T +     H+ + I  +   +R+ D RRFG F   +EN Y     +  LG +PL ++F+ +YL       +++IK+ ++D + V GIGNIYA E LF + IHP T A K+T  +F  +  + + IL  A+E  GTT+  ++    + G F+  LKV+ +K+  C+ C+NKI  + + GR +  C  CQ
  S:     1 MPELPEVETTKQGIKPH-LEGRMITAVQ-VRNRKLRLPVPLNLNELCQGKHITAITRRGKYILLHM-DKGYLLIHLGMSGHLRIVSQTANPQKHDHIDLHIN-NGLALRFCDPRRFGLFIYIDENPY-QHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNALTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQ 270
>gi|9971915|gb|AAG10477.1|AF279106_39 predicted formamidopyrimidine-DNA glycosylase [uncultured marine gamma proteobacterium EBAC31A08] (270 aa)
Score = 363, Expect = 6.3e-33, Identities = 90/274 (32%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ + ++K+      ++     I  +  +    + F   + ++ ++ + R+ KY+IF L+NDK  ++HL M G L   K + ++  KH  +++  D+  I Y+D RRFG+  + ++ +    K IK LG +PL + F+ K   +    S   IK+ L++Q+NV GIGNIYA E LF + IHP   AN+L  +  K++    + IL +A+E  GTT+  ++      G F+  L V+ ++   C  CK  I K  VN R T+ C  CQ
  S:     1 MPELPEVETTLRAIKK---FKGSLLKEARIHNRNLRWKVVDSFETSVKDQVVESLERRAKYIIFKLSNDKKIILHLGMSGSLRIAKNNENFFIKHDHIELIFDEERIIYNDPRRFGSMHLTSDID--KHKLIKNLGPEPLSKNFNAKDFFSGCSHSKTNIKSYLMNQKNVVGIGNIYASESLFLAKIHPLKNANELDLDACKRLVAAGKKILEQAIEVGGTTLKDFYSADGSPGYFKFKLNVYGREGEPCNKCKGTICKTIVNQRATFFCEACQ 269
>gi|86604927|ref|YP_473690.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. JA-3-3Ab] >gi|86553469|gb|ABC98427.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. JA-3-3Ab] (283 aa)
Score = 363, Expect = 7.2e-33, Identities = 88/274 (32%), Positives = 146/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L ++  L   I ++E ++P+       ++F   +    +    R+GKYL+  L +  V  VHLRM G+L + +  +     H  V++ ++  +E+R+ D R FG   +       ++    ++ LG +PL   F   Y +  ++KS R IK  LLDQ  V+G+GNIYADE LF S IHP T A +L+D    ++ E+   +L   +E +GTT+  Y   +   G +Q    V+ ++   C  C   I + K++GR  + C +CQ
  S:     1 MPELPEVETVRRDL-QRLTLGLCILSVEVLLPRTVAYPGKDEFAQGLAGSCLTQWQRRGKYLLGSLDSGAVLGVHLRMTGQLLWVQGSAPL-PIHTRVRLHLEQGWELRFVDLRTFGQMWLVPAGVEPETVIPALQSLGPEPLSPAFSEAYFQAALQKSRRPIKAALLDQSLVAGVGNIYADEALFLSGIHPSTPAAQLSDAAKSRLRESLIQVLRAGLEQRGTTLRDYRDLRGLNGNYQGQAWVYGREGDPCRLCGTPIQRSKLSGRSAHFCPRCQ 275
>gi|146328737|ref|YP_001210018.1| formamidopyrimidine-DNA glycosylase [Dichelobacter nodosus VCS1703A] >gi|166215622|sp|A5EXK6|FPG_DICNV Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|146232207|gb|ABQ13185.1| formamidopyrimidine-DNA glycosylase [Dichelobacter nodosus VCS1703A] (272 aa)
Score = 362, Expect = 9.1e-33, Identities = 86/275 (31%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFV-VHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    L+   C  +TIT ++    ++ +       +  +I+ QI +ITR+ KYLI ++  + + V VHL M G L    +T+      H+++ +  D Y +RYHD RRFG FT+++       + ++ LG++PL++      L  + +K    I + +++Q  + GIGNIYA E LF S I P+  A  L+  +   +    + +L  A+   GTT+  +       G FQ+ L V+ K    C  C N +  +K++ RGT  C  CQ+
  S:     1 MPELPEVETCKKGLRPLLC-QKTITAVDVRAARLREPLDAIALSQ-LIHCQITEITRRAKYLIININREDIAVLVHLGMSGSLRVLPQTEPIKKHDHIIITLN-DGYSLRYHDPRRFGLFTVFHAQK--PHRLLQHLGIEPLDDSCTGDVLHQHCQKRKIKINSLIMNQNIIVGIGNIYATEALFLSGIRPDRPAQTLSAAECASLMAQIKTLLTAAIARGGTTLRDFSAPDGHAGYFQQQLHVYGKSGQHCPKCGNILEDLKISNRGTVYCPHCQR 272
>gi|148828123|ref|YP_001292876.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittGG] >gi|166215626|sp|A5UI87|FPG_HAEIG Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|148719365|gb|ABR00493.1| hypothetical protein CGSHiGG_08295 [Haemophilus influenzae PittGG] (271 aa)
Score = 361, Expect = 1.2e-32, Identities = 97/276 (35%), Positives = 146/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     DS+ DK   +  +  +   +RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQDSAIDKHDHIDIVVNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTRNQCYSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKR 270
>gi|145628119|ref|ZP_01783920.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 22.1-21] >gi|145630040|ref|ZP_01785822.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 22.4-21] >gi|145640614|ref|ZP_01796197.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae R3021] >gi|144979894|gb|EDJ89553.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 22.1-21] >gi|144984321|gb|EDJ91744.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae R3021] >gi|145274540|gb|EDK14403.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 22.4-21] (271 aa)
Score = 360, Expect = 1.7e-32, Identities = 97/276 (35%), Positives = 146/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     DS+ DK   +  +  +   +RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQDSAIDKHDHIDIVVNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTRNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKR 270
>gi|46133211|ref|ZP_00156808.2| COG0266: Formamidopyrimidine-DNA glycosylase [Haemophilus influenzae R2866] >gi|145638232|ref|ZP_01793842.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittII] >gi|145272561|gb|EDK12468.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittII] (271 aa)
Score = 359, Expect = 2.0e-32, Identities = 97/275 (35%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     DS+ DK   +  +  +   +RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQDSAIDKHDHIDIVVNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTRNQCISLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLVIGQRNSFFCPKCQK 269
>gi|51891987|ref|YP_074678.1| formamidopyrimidine-DNA glycosidase [Symbiobacterium thermophilum IAM 14863] >gi|81692172|sp|Q67R59|FPG_SYMTH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|51855676|dbj|BAD39834.1| formamidopyrimidine-DNA glycosidase [Symbiobacterium thermophilum IAM 14863] (305 aa)
Score = 359, Expect = 2.2e-32, Identities = 93/274 (33%), Positives = 143/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  +L  +  + R I  +E + P+   +     F   +      DI R+GKYL+F L   ++ V HLRM G L+    ++    +H+ V   +DD  E+RY D R+FG F +           +  LG +PL  EF  + L   +   + +IK  LL+Q  V+G+GNIYADE LF + IHP   A  LT  + +++    R +L +AVE +GTT + Y   +  +G+    L+V  +    C  C   I K+ V  RGT+ C +CQ
  S:     1 MPELPEVETVRRTLCPRV-VGRRIRRVEILTPRQIYHPDPATFAADLEGAVFDDIERRGKYLLFRL-GPRILVAHLRMSGHLYVCGPEAP-RPRHLHVVFHLDDGGELRYADQRKFGGFHLLGPGGEGMPPGLANLGPEPLSPEFTPQVLAERLAGRHTSIKAALLNQALVAGLGNIYADEALFCARIHPAREAGSLTPAEVERLHGCIRRVLLRAVERRGTTFSLYRDGEGNEGDMYDELQVFDRAGEPCPVCGTPIRKVAVAQRGTHFCPRCQ 272
>gi|49473899|ref|YP_031941.1| formamidopyrimidine-DNA glycosylase [Bartonella quintana str. Toulouse] >gi|81647239|sp|Q6G0L3|FPG_BARQU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|49239402|emb|CAF25740.1| Formamidopyrimidine-DNA glycosylase [Bartonella quintana str. Toulouse] (291 aa)
Score = 358, Expect = 2.6e-32, Identities = 94/275 (34%), Positives = 153/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFE-----KTDSSYDK----KHVLVKIEMDD---YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPE----TIANK-LTDNDF-KKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E       I +I ++  +  +    E F+  ++   I ++ R+GKYL+FHL+ ++  + HL M G    E     KT S+  K     H L+ I+  D   Y + Y+D RRFG   + + N   +   +KKLGL+PL  EF  +YL+        ++K  LLDQ  ++G+GNIY  E L+ S + P+    T+A K +   +F   +A+N R ++A+A+   G+T+  Y       G FQ    V+ ++  +C  C   I +I  +GR ++ C +CQK
  S:     1 MPELPEVETVRRGL-EPVITGAKIISI-TLNRRDLRFPFPEAFSERLVGRTIMELGRRGKYLLFHLSQNETILSHLGMSGSWRIEDDLLRKTYSAAGKFVKHDHFLMDIQAKDGKVYHLTYNDVRRFGFMLLLDTNRIYEHPLLKKLGLEPLSNEFSGRYLQEAFVNKKISLKGVLLDQSIIAGLGNIYVCEALWRSRLSPQRGAFTLALKTVCAREFADSLAQNIRNVIAEAISFGGSTLRDYIRTDGSLGYFQHSFSVYGREGKECFQCGIPITRISQSGRSSFYCSQCQK 291
>gi|68249533|ref|YP_248645.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 86-028NP] >gi|81336040|sp|Q4QLW2|FPG_HAEI8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|68057732|gb|AAX87985.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 86-028NP] (271 aa)
Score = 358, Expect = 2.7e-32, Identities = 97/276 (35%), Positives = 146/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     DS+ DK   +  +  +   +RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRKPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQDSAIDKHDHIDIVVNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTRNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKR 270
>gi|152994665|ref|YP_001339500.1| formamidopyrimidine-DNA glycosylase [Marinomonas sp. MWYL1] >gi|189044664|sp|A6VSY6|FPG_MARMS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|150835589|gb|ABR69565.1| formamidopyrimidine-DNA glycosylase [Marinomonas sp. MWYL1] (272 aa)
Score = 358, Expect = 2.9e-32, Identities = 82/274 (29%), Positives = 147/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSS-YDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ +  + E   + R++  ++   PK+ +     + +  ++ E+I  ++R+GKY+  H T+    +VHL M G L+F   ++      HV      DD  +RY D RRFG   ++   ++ + + IK LG +PL + F+   L    K     IKT ++D + V G+GNIYA+E LF + I P+ +A  ++     ++ E  +++LA A++  GTT+  +     + G F++ L V+ + +  CV C   + +I+   R T  C+ CQ
  S:     1 MPELPEVETTLRGI-EPKLVGRSLARVDIRQPKL-RWLITPELSSEMVGEEITHLSRRGKYIGIH-TSKGTLIVHLGMSGSLYFVPAETPPLFHDHVDFCFADDDVWLRYTDPRRFGAI-LWTTEDWHEHELIKHLGPEPLSDMFNADMLYVRAKGRKVPIKTFIMDSKVVVGVGNIYANEALFKAGIRPDRLAGNISKARLARLVECIKVVLAAAIKQGGTTLKDFVGGDGKPGYFKQELAVYGRANKACVICSKPLKEIRQAQRSTVFCINCQ 271
>gi|42630216|ref|ZP_00155760.1| COG0266: Formamidopyrimidine-DNA glycosylase [Haemophilus influenzae R2846] >gi|148826404|ref|YP_001291157.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittEE] >gi|166215625|sp|A5UDC3|FPG_HAEIE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|148716564|gb|ABQ98774.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittEE] (271 aa)
Score = 358, Expect = 3.0e-32, Identities = 99/276 (35%), Positives = 150/276 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     +S+ DK H  + I M++ ++ RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQNSAIDK-HDHIDIVMNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTLNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKR 270
>gi|145632333|ref|ZP_01788068.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 3655] >gi|145634123|ref|ZP_01789834.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittAA] >gi|144987240|gb|EDJ93770.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 3655] >gi|145268567|gb|EDK08560.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittAA] (271 aa)
Score = 355, Expect = 5.8e-32, Identities = 99/276 (35%), Positives = 149/276 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +      S+ DK H  + I M++ ++ RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQYSAIDK-HDHIDIVMNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTRNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKR 270
>gi|16272883|ref|NP_439106.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae Rd KW20] >gi|1169727|sp|P44948|FPG_HAEIN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|1573970|gb|AAC22606.1| formamidopyrimidine-DNA glycosylase (fpg) [Haemophilus influenzae Rd KW20] (271 aa)
Score = 355, Expect = 6.1e-32, Identities = 96/276 (34%), Positives = 145/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     DS+ DK   +  +  +   +RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIY +E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQDSAIDKHDHIDIVVNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYTNESLFICGIHPLKLAKNLTRNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKR 270
>gi|118594532|ref|ZP_01551879.1| formamidopyrimidine-DNA glycosylase [Methylophilales bacterium HTCC2181] >gi|118440310|gb|EAV46937.1| formamidopyrimidine-DNA glycosylase [Methylophilales bacterium HTCC2181] (271 aa)
Score = 355, Expect = 6.2e-32, Identities = 86/275 (31%), Positives = 154/275 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI--RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     LK    L +T+  I      + +N S       + +  +  ++I +I R+ KY++   +N    ++HL M G L+    + +  KKH  V     +  +  RY+D RRFG+  ++  +N L+ + +K LG +PLE+ F+ +YL   ++  ++ IK+ ++D  NV G+GNIYA E LF + I P+  ++KLT  + K +  + + ++ KA+   G+T+  +F    + G FQ   KV+ +K  DC  C + +++I +  R ++ C +CQK
  S:     1 MPELPEVEVTCQGLKP--LLKKTVHKI------VIRNYSLRWPIPTNLSTVVEGQEILEIKRRAKYILVRFSNG-TLILHLGMSGHLYI-IPEGAKPKKHDHVDFIFGNESVILRYNDPRRFGSI-LWTTDNPLEHRLLKNLGPEPLEDGFNAEYLGIRLRAKSQCIKSAIMDGHNVVGVGNIYASEALFYAGIKPQRKSSKLTKKELKALVTSIKDVINKAIVKGGSTMNDFFDVNGENGYFQNEHKVYGRKGKDCYQCDSLVLQITIGQRSSFFCNQCQK 271
>gi|167472174|ref|ZP_02336878.1| formamidopyrimidine-DNA glycosylase [Rickettsia africae ESF-5] (273 aa)
Score = 355, Expect = 6.5e-32, Identities = 90/274 (32%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++ +SLK++  +   I N+E     +    S    T  I+N  I D+ R+ KYLI    ND   +VHL M G+   +  +    +KH  V  ++ + E + ++DTRRFG    + + + L+ +    LG++P  +    +YLK+ ++     IK  ++D   + GIGNIYA E L  + IHP+   N L D++ + + +  R +L KA+   GTT+  +     + G F K LKV+ ++   C++C + I+KIK +GR T+ C  CQ
  S:     1 MPELPEVETLKNSLKDK-LIGLIIENVELKRDNLRYKLS-PLLTTEILNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGRFTLQSANYK-TQKHDHVIFDLSNGEKLIFNDTRRFGMIYSF-KTDLLEKEFFNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGIGNIYASESLHLARIHPDKSGNDLRDDEIENLIKAIRDVLTKAITAGGTTLKDFVNGDNKPGYFTKQLKVYGREGQSCLSCSSTIIKIKHSGRSTFYCKTCQ 271
>gi|17231812|ref|NP_488360.1| formamidopyrimidine-DNA glycosylase [Nostoc sp. PCC 7120] >gi|24211709|sp|Q8YP80|FPG_ANASP Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|17133456|dbj|BAB76019.1| formamidopyrimidine-DNA glycosylase [Nostoc sp. PCC 7120] (283 aa)
Score = 354, Expect = 7.7e-32, Identities = 97/274 (35%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHL------TNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q  LNR IT  + ++ + I    S  DF + I    I    R+GKYL+  L      T+     VHLRM G+L +   D     KH  V+I  ++  E+R+ D R FG          ++S    + KL +DP   EF  +YL N +    R IKT LLDQ  V+G+GNIYADE LF S + PET+  ++     K +      +L  ++E  GTT + +   K   G +     V+ +    C  C + I +IK+ GR ++ C +CQ
  S:     1 MPELPEVETVRRGLN-QLTLNRKITGGDVLLHRTIAHPFSVGDFLNGITGSTISTWHRRGKYLLAELSASPSTTSIPWLGVHLRMTGQLLWLNQDEPL-HKHTRVRIFFEEEQELRFVDQRTFGQMWWVPPGIAVESVITGLAKLAVDPFSPEFTVEYLANKLHNRRRPIKTALLDQSVVAGLGNIYADEALFKSGVLPETLCTEVQLKQIKLLRTAIIQVLETSIEAGGTTFSNFLNVKGVNGNYGGVAWVYNRAGEPCKVCGDVIQRIKLGGRSSHFCRQCQ 282
>gi|47779378|gb|AAT38607.1| predicted formamidopyrimidine-DNA glycosylase [uncultured gamma proteobacterium eBACHOT4E07] (269 aa)
Score = 353, Expect = 1.2e-31, Identities = 88/274 (32%), Positives = 156/274 (56%)
  Q:     1 VPELPEVQSVIDSLK--EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ + ++   +   L   I +   +  K+ KN S         N+ IK+I+R+ KY++ H  ND   ++HL M GKL  +   +++ KKH  +++  D  +I ++DTRRFG+  I+   ++ + + I+ LG++PL  EF+  YL    +  N +IK  ++DQ+ V G+GNIYA E LF + I P  ++ K++  +  ++    + +L  A+   GTT+  ++     +G F   L V+ ++D +C NCK+KI K+ +  R ++ C  CQ
  S:     1 MPELPEVETTVRAISKFQNKILKEIIVHNAHLRWKVDKNIS-----QLSKNKLIKEISRRAKYILIHF-NDSSLMIHLGMSGKLRIQNIGNNFFKKHDHIELIFDKEKIVFNDTRRFGS--IHFTKSFKNHRLIENLGVEPLSREFNKDYLFEICRIKNISIKKLIMDQKVVVGVGNIYASESLFLAKIKPNRLSKKISLKECDQLTNAIKRVLRYAIRKGGTTLKDFYSADGSEGYFNLNLNVYDREDENCKNCKSKIKKVTIGQRASFFCDSCQ 268
>gi|170078422|ref|YP_001735060.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. PCC 7002] >gi|34765741|gb|AAQ82445.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. PCC 7002] >gi|169886091|gb|ACA99804.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. PCC 7002] (277 aa)
Score = 352, Expect = 1.2e-31, Identities = 90/274 (32%), Positives = 141/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYED-FTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q  LN+  T  E ++ K     +  D F   I    I+D  R+GKYL+  L++     +HLRM GK  +   D    +KH  ++  ++ D E+R+ D R FG          + S    + +LG++PL  +F    L N  +K  R +KT LLDQ  ++G+GNIYADE LF S IHP   A+ L  ++ +K+ +    +L  ++   GTT + +       G +      + +    C  C + I +IK+ GR T+ C +CQ
  S:     1 MPELPEVETVRRGLM-QISLNQQFTGAEILLRKTLAYPTDPDHFLGMIQGLFIQDWQRRGKYLLGKLSDGSTLGIHLRMTGKFLWTTPDVPV-QKHTRIRFFIEGDRELRFVDLRTFGQIWWVPAGTIVKSVITGLTRLGVEPLSPDFTADLLANFCEKRQRPMKTFLLDQSIITGLGNIYADEALFKSGIHPTRKASSLKMSEIEKLHKAIVEVLETSIAQGGTTFSDFVSTTGTNGNYGGMALTYGRTGEPCRVCSHPIERIKLGGRSTHFCPQCQ 276
>gi|113474804|ref|YP_720865.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Trichodesmium erythraeum IMS101] >gi|123352603|sp|Q117D2|FPG_TRIEI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|110165852|gb|ABG50392.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Trichodesmium erythraeum IMS101] (300 aa)
Score = 352, Expect = 1.3e-31, Identities = 101/275 (36%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHL--------------TNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI----------EMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKK-------LGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L  Q  LN+ I   E ++ +      S  DF   +  + I    R+GKYL+  L                D    VHLRM G+L +   + S   KH  V++          +  +YE+R+ D R FG             KEI K       LGL+P   EF  KYL   + K +R IKT LLDQ  ++G+GNIYADE LF S I P TI   LT+   +++      +L  A+   GTT + +   K   G +     V+++    C  C   + KIK+ GR T+ C +CQK
  S:     1 MPELPEVEIVKQGLN-QLTLNKRILGGEVLLERTLAYPISVADFLRGLEGKAIAQWHRQGKYLLAQLYKWGKKNSKLQEYENEDGWLGVHLRMTGQLLWVNPEESL-HKHTRVRLFFGHNSSGDKDSSNYELRFVDQRTFGKMW-----GVPPGKEISKVITGLQQLGLEPFSPEFSPKYLNKKLYKRHRPIKTALLDQTTIAGLGNIYADEALFLSGIRPTTICKDLTEKQIEQLHLAILKVLQTAINAGGTTFSNFLNVKGVNGNYGGVAWVYSRAGQPCRICNTPLEKIKLAGRSTHFCPQCQK 300
>gi|45644628|gb|AAS73016.1| predicted formamidopyrimidine-DNA glycosylase [uncultured marine gamma proteobacterium EBAC20E09] (269 aa)
Score = 352, Expect = 1.4e-31, Identities = 90/274 (32%), Positives = 154/274 (56%)
  Q:     1 VPELPEVQSVIDSLK--EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ + ++   E   L + I +  ++  K+ +    +     I N++++ I+R+ KY++     D   ++HL M G L  +K +++Y KKH   +    D +I ++D RRFG+  I+   N  D K IK LG++PL ++FD  YL      SN  IK  L+DQ+ + G+GNIYA E LF S+I PE I N+L+  D   ++ + + +L +A+   GTT+  ++     +G F+  L V+ +    C +C N I K  +  R +++C +CQ
  S:     1 MPELPEVETTVRAINKFENKRLLKVIIHNRNLRWKVDRIIEKK-----IDNKKVRSISRRAKYILIQF-KDLFIMLHLGMSGNLRIQKNNNNYFKKHDHAEFVFKDEKIIFNDVRRFGS--IHLTKNPYDHKLIKDLGIEPLSDQFDKDYLYRICSNSNLQIKKLLMDQKKIVGVGNIYASESLFLSNISPERICNRLSVKDCSNLSNSIKAVLNEAINMGGTTLKDFYSADGNQGYFKIKLNVYGRDGQPCNSCNNIITKKIIGQRSSFMCSECQ 268
>gi|126657399|ref|ZP_01728558.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. CCY0110] >gi|126621386|gb|EAZ92098.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. CCY0110] (278 aa)
Score = 352, Expect = 1.5e-31, Identities = 89/275 (32%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFV-VHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L  Q    +T+   + ++P+      S ++F   I N       RKGKYL+  L +DK ++ VHLRM G+L + + D     +H  +++  D   E+R+ D R FG       +   ++    ++KLG +P  + F   Y ++ +K   R IKT LLDQ  V+G+GNIYADE LF S I P T+  +L+    K++      +L  A++  GTT + +       G +     V+ + +  C  C   I +IK+ GR ++ C +CQ+
  S:     1 MPELPEVETVCRGLN-QLTFGQTVRGGKVLLPRTLAYPVSTQEFLEQIQNATFGQWQRKGKYLLVPLEDDKGWLGVHLRMTGQLLWVQQDEPL-SRHTRLRLFCDRSQELRFVDIRTFGKVWWVPPHTPPETIITGLQKLGPEPFSKAFSLDYFRDKLKGRQRNIKTILLDQSVVAGMGNIYADEALFKSGIRPTTLGKELSQPQIKELRIVMIEVLKTAIKEGGTTFSDFRGVTGINGNYSGIAWVYGRHNQPCRVCGTPIERIKLGGRSSHFCPQCQQ 278
>gi|157828891|ref|YP_001495133.1| formamidopyrimidine-DNA glycosidase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933617|ref|YP_001650406.1| formamidopyrimidine-DNA glycosylase [Rickettsia rickettsii str. Iowa] >gi|166198743|sp|A8GTA0|FPG_RICRS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|189044670|sp|B0BUU0|FPG_RICRO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157801372|gb|ABV76625.1| formamidopyrimidine-DNA glycosidase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908704|gb|ABY73000.1| formamidopyrimidine-DNA glycosylase [Rickettsia rickettsii str. Iowa] (273 aa)
Score = 352, Expect = 1.5e-31, Identities = 89/274 (32%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++ +SLK++  +   I N+E     +    S    T  I+N  I D+ R+ KYLI    ND   +VHL M G+   +  +    +KH  V  ++ + E + ++DTRRFG    + + + L+ +    LG++P  +    +YLK+ ++     IK  ++D   + G+GNIYA E L  + IHP+   N L D++ + + +  R +L KA+   GTT+  +     + G F K LKV+ ++   C++C + I+KIK +GR T+ C  CQ
  S:     1 MPELPEVETLKNSLKDK-LIGLIIENVELKRDNLRYKLSPLLATE-ILNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGRFTLQSANYK-TQKHDHVIFDLSNGEKLIFNDTRRFGMIYSF-KTDLLEKEFFNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGVGNIYASESLHLARIHPDKSGNDLRDDEIENLIKAIRDVLTKAITAGGTTLKDFVNGDNKPGYFTKQLKVYGREGQSCLSCSSTIIKIKHSGRSTFYCKTCQ 271
>gi|157804064|ref|YP_001492613.1| formamidopyrimidine-DNA glycosidase [Rickettsia canadensis str. McKiel] >gi|166198742|sp|A8EZP5|FPG_RICCK Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157785327|gb|ABV73828.1| Formamidopyrimidine-DNA glycosidase [Rickettsia canadensis str. McKiel] (273 aa)
Score = 351, Expect = 1.7e-31, Identities = 89/274 (32%), Positives = 152/274 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++ +SLK++  +   I NIE     +  N S    T  I+N  I ++ R+ KYLI    N    V+HL M G+   +  +    +KH  V  ++++ E + ++DTRRFG    + + N+L+ K    LG++PL +    +YLK+ +     AIK  ++D + + G+GN+YA E L  + IHP  +   L D++ + + ++ R +L KA+   GTT+  +     + G F + L+V+ ++   C NC + I+K K +GR T+ C  CQ
  S:     1 MPELPEVETLKNSLKDK-LIGLIIKNIELKRDNLRYNLS-PLLTTEILNTNILNVRRRAKYLIIDFGNYYSLVIHLGMSGRFTVQPANYKI-QKHDHVIFDLNNCEKLIFNDTRRFGMVYSF-KTNFLEEKFFYNLGIEPLSDLLTLEYLKSKLITRTIAIKNLIMDNKIIVGVGNLYASESLHLARIHPHKLGRNLKDDEIENLIKSIREVLTKAITAGGTTLKNFVNGDSKPGYFTQQLRVYGREGQKCFNCSSTILKTKNSGRSTFYCKTCQ 271
>gi|34581344|ref|ZP_00142824.1| formamidopyrimidine-DNA glycosidase [Rickettsia sibirica 246] >gi|28262729|gb|EAA26233.1| formamidopyrimidine-DNA glycosidase [Rickettsia sibirica 246] (273 aa)
Score = 351, Expect = 1.9e-31, Identities = 90/274 (32%), Positives = 149/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++  SLK++  +   I N+E     +    S    T  I+N  I D+ R+ KYLI    ND   +VHL M G+   +  +    +KH  V  ++ + E + ++DTRRFG    + + + L+ +    LG++P  +    +YLK+ ++     IK  ++D   + GIGNIYA E L  + IHP+   N L D++ + + +  R +L KA+   GTT+  +     + G F K LKV+ ++   C++C + I+KIK +GR T+ C  CQ
  S:     1 MPELPEVETLKHSLKDK-LIGLIIENVELKRDNLRYKLSPLLATE-ILNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGRFTLQSANYK-TQKHDHVIFDLSNGEKLIFNDTRRFGMIYSF-KTDLLEKEFFNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGIGNIYASESLHLARIHPDKSGNDLRDDEIENLIKAIRDVLTKAITAGGTTLKDFVNGDNKPGYFTKQLKVYGREGQSCLSCSSTIIKIKHSGRSTFYCKTCQ 271
>gi|86608720|ref|YP_477482.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557262|gb|ABD02219.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. JA-2-3B'a(2-13)] (279 aa)
Score = 351, Expect = 1.9e-31, Identities = 88/277 (31%), Positives = 145/277 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L ++  L   I  +E ++ +     + E F   +I  +     R+GKYL+  L +  V  VHLRM G+L + +  +     H  V++  ++ +++R+ D R FG   +      L++    ++ LG +P    F   Y +  ++KS R IK  LLDQ  V+G+GNIYADE LF S IHP T A +L+D    ++ E    +L   +E +GTT+  Y   +   G +Q    V+ ++   C  C   I ++K+ GR  + C  CQ ++
  S:     1 MPELPEVETVRQDL-QRLTLGPRILAVEVLLARTIAYPAGEMFGRSLIGTRFTQWQRRGKYLLGSLDSRAVLGVHLRMTGQLLWVQGSTPL-SAHTRVRLAFEEGWDLRFVDQRTFGQMWLVPAGVELEAVIPTLQTLGPEPFSPAFSEAYFQAALQKSRRLIKAALLDQSLVAGVGNIYADEALFLSGIHPLTPAVQLSDVAKARLREALIEVLRAGLEQRGTTLRDYRDLRGLNGNYQGQAWVYGREGDPCRLCGTPIQRMKLAGRSAHFCPHCQPQQ 278
>gi|15892961|ref|NP_360675.1| formamidopyrimidine-DNA glycosidase [Rickettsia conorii str. Malish 7] >gi|21362545|sp|Q92GT4|FPG_RICCN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|15620156|gb|AAL03576.1| formamidopyrimidine-DNA glycosidase [EC:3.2.2.23] [Rickettsia conorii str. Malish 7] (273 aa)
Score = 349, Expect = 3.0e-31, Identities = 88/274 (32%), Positives = 150/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++ +SLK++  +   I N+E     +    S    T   +N  I D+ R+ KYLI    ND   +VHL M G+   +  +    +KH  V  ++ + E + ++DTRRFG    + + + L+ + +  LG++P  +    +YLK+ ++     IK  ++D   + G+GNIYA E L  + IHP+   N L D++ + + +  R +L KA+   GTT+  +     + G F K LKV+ ++   C++C + I+KIK +GR T+ C  CQ
  S:     1 MPELPEVETLKNSLKDK-LIGLIIENVELKRDNLRYKLSPLLATE-TLNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGRFTLQSANYK-TQKHDHVIFDLSNGEKLIFNDTRRFGMIYSF-KTDLLEKEFLNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGVGNIYASESLHLARIHPDKSGNNLRDDEIENLIKAIRDVLTKAITAGGTTLKDFVNGDNKPGYFTKQLKVYGREGQSCLSCSSTIIKIKHSGRSTFYCKTCQ 271
>gi|52425999|ref|YP_089136.1| formamidopyrimidine-DNA glycosylase [Mannheimia succiniciproducens MBEL55E] >gi|52308051|gb|AAU38551.1| Nei protein [Mannheimia succiniciproducens MBEL55E] (292 aa)
Score = 348, Expect = 3.4e-31, Identities = 99/276 (35%), Positives = 147/276 (53%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++  + +    +G L   I  I    PK+    S +     I  ++I  ++R+ KYLI H T     + HL M G +         DK H  + I M++ +I RY+D RRFGT+ +++ N  LD   +  KLG +PL +EF+ +YL    +K    +K  L+D   V G+GNIYA+E LF   +HPE I  KLT      + E  +  L +A+E  GTT+  +     + G F + L+++ KK   C NC  KI  + V  R +Y C KCQKK
  S:    23 MPELPEVETAKNGITPYLEGYL---IEKIIVRQPKLRWEVSPQ--LAQISQQKITALSRRAKYLIIH-TEQGYIIGHLGMSGSVRIVSARDPVDK-HDHLDIVMNNGKIMRYNDPRRFGTW-LWSAN--LDEFHLFLKLGPEPLSDEFNAEYLFKKSRKKQTPVKNFLMDNSVVVGVGNIYANETLFMCGLHPEKITAKLTKAQCALLVEKIKQELKRAIEQGGTTLKDFLQPDGRPGYFAQELQIYGKKGAPCPNCGTKIESLVVAQRNSYFCPKCQKK 292
>gi|157373258|ref|YP_001471858.1| DNA-formamidopyrimidine glycosylase [Shewanella sediminis HAW-EB3] >gi|157315632|gb|ABV34730.1| DNA-formamidopyrimidine glycosylase [Shewanella sediminis HAW-EB3] (273 aa)
Score = 348, Expect = 4.0e-31, Identities = 91/276 (32%), Positives = 142/276 (51%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L +Q     T+ N     P         D    I+ E I+++ R+ KYL+   T+    +VHL M G L     ++  +K H  + +E+   +I R++D RRFG + ++ E        + KLG +PL++ F+  YL+  +K   +AIK  L+D   V G+GNIYA+E LFA+ IHPET A  +       +    + ILA A++  GTT+  +   + + G F + L V+ +    C  C N + +IK+  R T  C  CQ K
  S:     3 MPELPEVEVTRQGITPHLVDQQATALTVRNASLRWP-------VPDIAQQIVGETIRNVRRRAKYLLID-TDAGTTIVHLGMSGSLRIVSRNTPVEK-HDHIDLELASGKILRFNDPRRFGAW-LWCELPEEAHPLLSKLGPEPLKDGFNPTYLEQILKNKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPETQAGNVDTERLTILVTEVKQILANAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGRGGETCTQCGNLLSEIKLGQRATVFCGLCQTK 273
>gi|157964829|ref|YP_001499653.1| formamidopyrimidine-DNA glycosidase [Rickettsia massiliae MTU5] >gi|166988463|sp|A8F2H0|FPG_RICM5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157844605|gb|ABV85106.1| Formamidopyrimidine-DNA glycosidase [Rickettsia massiliae MTU5] (279 aa)
Score = 348, Expect = 4.2e-31, Identities = 86/276 (31%), Positives = 151/276 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+++ +SLK++  +   + N+E     +    S    T  I+N  I D+ R+ KYLI    ND   +VHL M G+   +  +    +KH  V  ++ + E + ++DTRRFG    + + + L+ +    LG++P  +    +YLK+ ++   R IK  ++D   + G+GNIYA E L  + IHP+   + L D++ + + ++ R +L KA+   GTT+  +     + G F + L V+ K+   C++C + I+K K +GR T+ C  CQ +
  S:     1 MPELPEVETLKNSLKDK-LIGLIVENVELKRDNLRYKLSPLLATE-ILNTNILDVRRRAKYLIIDFNNDYSLIVHLGMSGRFTLQSANYK-TQKHDHVIFDLSNGEKLIFNDTRRFGMIYSF-KTDLLEQEFFNDLGIEPFSDLLTLEYLKDKLQTRKRPIKNLIMDNRVIVGVGNIYASESLHLARIHPDKSGSDLRDDEIENLIKSIRDVLTKAITAGGTTLKDFVNGDNKPGYFTQQLTVYGKEGQSCLSCSSTIIKTKHSGRSTFYCKTCQYR 273
>gi|163812715|ref|ZP_02204379.1| formamidopyrimidine-DNA glycosylase [Dehalococcoides sp. VS] >gi|157403639|gb|EDO69695.1| formamidopyrimidine-DNA glycosylase [Dehalococcoides sp. VS] (270 aa)
Score = 347, Expect = 4.5e-31, Identities = 85/274 (31%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V + +     L + IT IE++  K    C  E +F   +   Q+ +++R+GKY+I  L+      VHL+M G L   K ++    +       +++ E + + D R+FG   +      LD+  ++KLG +PLEE+F  + L   + +    IK  LLDQ  ++G+GN+YADE LF + ++P   A+ L+  +   +    R +L KA++NKG +++TY      KG  Q    V  ++   C  C   I +  +  R  Y C  CQ
  S:     1 MPELPEVETVKNEIMPH-LLGKKITRIEALWAKTL--CPPETEFNKLVSGLQVTELSRRGKYIIISLSGGLFISVHLKMSGGLTAVKAENGQPPRFTRAVFHLENGEQVYFTDIRKFGRINLLTS---LDTI-LEKLGPEPLEEDFTPEVLSKRLSRRKGPIKAVLLDQRVLAGVGNMYADETLFKACLNPLRPADSLSKAEVINLHSAIRSVLYKAIQNKGASVSTYHRPDGSKGGAQLEFNVAHRRGESCPICGAPITRQLIRQRACYFCPHCQ 269
>gi|56750239|ref|YP_170940.1| formamidopyrimidine-DNA glycosylase [Synechococcus elongatus PCC 6301] >gi|56685198|dbj|BAD78420.1| formamidopyrimidine-DNA glycosylase [Synechococcus elongatus PCC 6301] (239 aa)
Score = 347, Expect = 4.8e-31, Identities = 81/224 (36%), Positives = 128/224 (57%)
  Q:    51 QIKDITRKGKYLIFHLTNDK----VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           QI++  R+GKYL+  L+ +      + VHLRM G+ F+ +  +    KH  V++  + D E+R+ D R FG       +  ++S    + KLG +P   EF  +YL++ +++S R IKT LLDQ  V+GIGNIYADE LF + IHP T +++LT    +K+ E    +L  ++   GTT + +       G +     V+ +KD  C  C   I K+K+ GR ++ C +CQ
  S:     7 QIQEWRRRGKYLLADLSREGEPAGTWGVHLRMTGQFFWTEPATPL-TKHTRVRLRFEGDRELRFIDIRSFGQMWWVPPDRPVESVITGLSKLGPEPFAPEFTARYLRDRLRRSQRPIKTALLDQSLVAGIGNIYADESLFRTGIHPTTPSDRLTKIQAEKLREAIVEVLTASIGAGGTTFSDFRDLTGVNGNYGGQAWVYGRKDQPCRTCGTPIQKLKLAGRSSHFCPRCQ 236
>gi|90101305|sp|Q65R59|FPG_MANSM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) (270 aa)
Score = 347, Expect = 5.2e-31, Identities = 99/276 (35%), Positives = 147/276 (53%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++  + +    +G L   I  I    PK+    S +     I  ++I  ++R+ KYLI H T     + HL M G +         DK H  + I M++ +I RY+D RRFGT+ +++ N  LD   +  KLG +PL +EF+ +YL    +K    +K  L+D   V G+GNIYA+E LF   +HPE I  KLT      + E  +  L +A+E  GTT+  +     + G F + L+++ KK   C NC  KI  + V  R +Y C KCQKK
  S:     1 MPELPEVETAKNGITPYLEGYL---IEKIIVRQPKLRWEVSPQ--LAQISQQKITALSRRAKYLIIH-TEQGYIIGHLGMSGSVRIVSARDPVDK-HDHLDIVMNNGKIMRYNDPRRFGTW-LWSAN--LDEFHLFLKLGPEPLSDEFNAEYLFKKSRKKQTPVKNFLMDNSVVVGVGNIYANETLFMCGLHPEKITAKLTKAQCALLVEKIKQELKRAIEQGGTTLKDFLQPDGRPGYFAQELQIYGKKGAPCPNCGTKIESLVVAQRNSYFCPKCQKK 270
>gi|67925991|ref|ZP_00519260.1| Formamidopyrimidine-DNA glycolase [Crocosphaera watsonii WH 8501] >gi|67852167|gb|EAM47657.1| Formamidopyrimidine-DNA glycolase [Crocosphaera watsonii WH 8501] (278 aa)
Score = 347, Expect = 5.4e-31, Identities = 92/274 (33%), Positives = 135/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK-NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK-VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q    +TI   E ++ +      S ++F   I N       R+GKYL+  L   K    VHLRM G+L + K +    +   L        E+R+ D R FG       N   ++    ++KLG +P  +EF   Y  + +K+  R IKT LLDQ  V+G+GNIYADE LF S I P T+   LT    K++ E    +L  A++  GTT + +       G +     V+ +    C  C   I KIK+ GR ++ C +CQ
  S:     1 MPELPEVETVCRGLN-QLTFGQTIEGAEVLLDRTLAYPPSSQEFLDQIQNATFDKWQRRGKYLLVPLQEKKGCLGVHLRMTGQLLWVKENEPLSRHTRLRLFCNQSQELRFVDIRTFGKVWWVPPNQPPENIITGLQKLGPEPFAKEFSIDYFIDRLKRRQRNIKTILLDQAIVAGMGNIYADEALFKSGILPTTLGKDLTPQQVKRLREAMIEVLKTAIDQGGTTFSDFRGVTGINGNYGGVAWVYGRHKQPCRVCGTPIEKIKLGGRSSHFCPQCQ 277
>gi|91205062|ref|YP_537417.1| formamidopyrimidine-DNA glycosidase [Rickettsia bellii RML369-C] >gi|157827633|ref|YP_001496697.1| formamidopyrimidine-DNA glycosidase [Rickettsia bellii OSU 85-389] >gi|166198741|sp|A8GXR0|FPG_RICB8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|123388145|sp|Q1RJY6|FPG_RICBR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|91068606|gb|ABE04328.1| Formamidopyrimidine-DNA glycosidase [Rickettsia bellii RML369-C] >gi|157802937|gb|ABV79660.1| Formamidopyrimidine-DNA glycosidase [Rickettsia bellii OSU 85-389] (273 aa)
Score = 345, Expect = 8.2e-31, Identities = 88/275 (32%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++ +SL E   +   I  +E     +    S  D    I+N  I ++ R+ KYLI    N+   +VHL M G+   +  +    K   +V    ++ ++ ++DTRRFG   IY+ +  L  K+    L L+PL + F+ +YLK+ +      IK  L+D   V G+GNIYA E L  + IHP+     L D++ K +    + +L+KA+   GTT+  +     + G F + L V+ +   +C++C + I+K K +GR T+ C  CQK
  S:     1 MPELPEVETLKNSL-ESKLIGLVIKKVEFKRDNLRYKLS-ADLADQIVNTNIINVRRRAKYLIIDFNNNHSLIVHLGMSGRFTLQPNNYEVKKHDHVVFNLSNNEKLIFNDTRRFGM--IYSFHTELLEKDFFANLALEPLSDSFELQYLKSKLMNKKVPIKNLLMDNRIVVGVGNIYASESLHLAKIHPDKFGKDLNDDEIKNLIAAVKNVLSKAIIAGGTTLKDFVNGDNKPGYFTQQLMVYARDGQECLSCSSSIIKTKHSGRSTFYCKSCQK 272
>gi|163847434|ref|YP_001635478.1| formamidopyrimidine-DNA glycosylase [Chloroflexus aurantiacus J-10-fl] >gi|187601748|ref|ZP_02987976.1| formamidopyrimidine-DNA glycosylase [Chloroflexus sp. Y-400-fl] >gi|189044586|sp|A9WDC2|FPG_CHLAA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|163668723|gb|ABY35089.1| formamidopyrimidine-DNA glycosylase [Chloroflexus aurantiacus J-10-fl] >gi|187486426|gb|EDU24399.1| formamidopyrimidine-DNA glycosylase [Chloroflexus sp. Y-400-fl] (278 aa)
Score = 345, Expect = 8.7e-31, Identities = 88/274 (32%), Positives = 146/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESI-MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKL----GLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  SL  Q    RTIT +  +  PK+    S ++F   I   +I+ I R+ K+L+  L  +    +HLRM G+L   + ++S + +HV   +++D+   + ++D R+FG   +      LD + +  L    G +PL  +F    L   ++     IK  LLDQ  ++GIGNIYA+E L+ + IHP T    LT     ++    R +L +A+ N+G+++  Y     ++G  Q+   V+ +    C  C++ I +I V  R TY C  CQ
  S:     1 MPELPEVETVARSLAPQ-LQGRTITGLAKLDWPKMLTP-SPDEFAALIAGRRIEAIGRRAKWLLLSLDGEWTLAIHLRMSGQLLVAEPETS-EARHVHFALDLDNGRRLIFNDQRKFGRVHL------LDRQGLAALDAVHGPEPLAADFTPSALAERLQNRRAPIKALLLDQHLIAGIGNIYANEALWLARIHPLTPGAMLTPEQINELHHAIRHVLQEAITNQGSSLRNYRDGYGRQGTQQEHFNVYDRAGEPCPRCQSTIERIVVAQRSTYFCPTCQ 271
>gi|149195827|ref|ZP_01872884.1| formamidopyrimidine-DNA glycosylase [Lentisphaera araneosa HTCC2155] >gi|149141289|gb|EDM29685.1| formamidopyrimidine-DNA glycosylase [Lentisphaera araneosa HTCC2155] (276 aa)
Score = 344, Expect = 1.2e-30, Identities = 88/275 (32%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNE--NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V ++L        TI +     P++ +      F      ++I  + R+ KYL+F   + K  + HL M G     K  +   KKH  + I +D D E+RY D RRFG F +     ++  D + +  LG +P +E +  +YL +  +   + IK  ++D   V GIGNIYA E LF   I P     KL   D   +  +S+ +L  A++  GTTI  +      +G F + L V+ ++  DCV C   I +I   GR ++ C  CQK
  S:     1 MPELPEVETVKNALAPY-IEGETIKSFHFYTPRLRQELDAALFNKTFSGKKITRLKRRSKYLLFEFDDQKWILSHLGMTGSWRICKL-TEERKKHEHISIRLDNDQELRYCDPRRFGEFRVITAPLDSTTDPQALSHLGPEPFDESYSQEYLWDLSRSKTKPIKNFIMDPRTVCGIGNIYASETLFRCGISPLRKTQKLRKKDCLNLINHSQSVLQSAIDAGGTTIIDFQAPDGSEGWFHQQLNVYGREGEDCVQCDKIIKRIVQAGRSSFYCPGCQK 276
>gi|78486260|ref|YP_392185.1| formamidopyrimidine-DNA glycosylase [Thiomicrospira crunogena XCL-2] >gi|123555019|sp|Q31EB2|FPG_THICR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|78364546|gb|ABB42511.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Thiomicrospira crunogena XCL-2] (280 aa)
Score = 343, Expect = 1.4e-30, Identities = 82/276 (29%), Positives = 145/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++    ++ +          ++I   I +N              +    +  I R+ KYL+   T+    ++HL M G L    + + +    H+ + +E + + +RYHD RRFG++ ++ E    +   +K LG +PL + F+ +YL   ++    AIKT +++ + V G+GNIYA+E LF S IHP   A  LT  +  K+  + + +L+ A+E  GTT+  +     + G F++ L V+ +++  C  C + I K+ +N R  Y C  CQK+
  S:     1 MPELPEVETTRKGIQPK-------VEGQAIQKIIIRNGKLRWPVDPSLVEKLPGLVVLSIKRRAKYLLLE-TDQGHLIIHLGMSGNLRVLPQHEPAVKHDHIDLLLE-NGFLLRYHDPRRFGSW-LWTEAPIQEHSLLKSLGPEPLTDAFNAEYLFQKLQGRKTAIKTFIMNNQIVVGVGNIYANESLFLSGIHPTRPAQSLTLTEATKLTAHIKTVLSAAIEQGGTTLKDFLTPDGKPGYFEQKLNVYGRENLPCPQCDSAIEKVVLNQRAAYFCSNCQKQ 272
>gi|16330976|ref|NP_441704.1| formamidopyrimidine-DNA glycosylase [Synechocystis sp. PCC 6803] >gi|2494596|sp|P74290|FPG_SYNY3 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|1653470|dbj|BAA18384.1| formamidopyrimidine-DNA glycosylase [Synechocystis sp. PCC 6803] (287 aa)
Score = 342, Expect = 2.0e-30, Identities = 89/276 (32%), Positives = 147/276 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV------FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFG-TFTIYNENNYLDSKE-IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L     L +TI   E ++ + +    S EDF   I   ++    R+GKYL+  L +++          HLRM G+L + + D     +H  V +  +  +E+R+ DTR FG  + +  +  + +    + +LG +P   +F  +YL   +K S R +K  LLDQ  V+G+GNIYADE+LF    HP   +N+++  D + I +  +  L  A+E  GT+ + Y       G +    +V+ ++   C +C   I KIK+ GR  + C +CQ K
  S:     1 MPELPEVETVCRGLNRL-TLEQTIGGGEVLLDRSLAYPVSVEDFQKQITGCRLVGWQRRGKYLLGELRSNQAPGPAGWLGCHLRMTGQLLWTERDQQ-RPRHTRVVLHFEGGWELRFVDTRTFGKVWLLPGDRPWAEVMTGLGQLGPEPFGADFTAEYLYEKLKSSRRPLKNALLDQRLVAGLGNIYADEVLFFCGFHPTMASNQVSLQDCELIHQQIQATLTAAIEAGGTSFSDYRQVTGINGNYGGMAQVYGREGEPCRHCGTVIAKIKLGGRSAHFCPQCQPK 284
>gi|58696959|ref|ZP_00372449.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont of Drosophila simulans] >gi|58536803|gb|EAL60033.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont of Drosophila simulans] (271 aa)
Score = 341, Expect = 2.5e-30, Identities = 92/274 (33%), Positives = 141/274 (51%)
  Q:     1 VPELPEVQSV----IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ +    +D +K +   N  + N     P I KN         +  + I++I R+GKY I++       ++HL M GKL + + D + +K   +V +  D+  I ++D RRFG   + N   E N+ D       G++PL +EF   YL+  +K     IK+ L+D + + G+GNIYA E LF + I P   A  LT  +++K+A   +  L+ A+   G+T+  Y       G FQ    V+ K    C  C N I  I+ NGR TY C  CQ
  S:     1 MPELPEVEVISNFLLDKIKNKQISNVIVNNWNLRAP-ITKN-----IDDMLKGKVIRNIKRRGKYTIWNTDGSMAVIIHLGMSGKLIYAEHDQAQNKHDHVVFLFSDNTSIIFNDPRRFGLVIVLNKEQEINFFDD-----FGIEPLTDEFSGDYLQELLKNKKANIKSALMDNKLIVGVGNIYASESLFRARISPLRPAKNLTYREYEKLAAEIKNTLSDAIAAGGSTLKDYAQPSGSAGYFQNNFYVYGKVQKPCKICNNIITLIRQNGRSTYFCNACQ 270
>gi|91070098|gb|ABE11022.1| formamidopyrimidine-DNA glycolase [uncultured Prochlorococcus marinus clone ASNC729] (292 aa)
Score = 340, Expect = 3.1e-30, Identities = 100/275 (36%), Positives = 153/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIM-PKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT---------------NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E      I    + E+F   ++N  I    R+GKYLI  L                N+   V+HLRM G   F + +SS+  KH  ++  + ++ E+RY D R FG     N++  L+   K +  LG +P  ++FD  YLK  I K  ++IK  LLDQ  V+GIGNIYADE L+++ I P   A  + +++  K+ E+   +L K++ + GTT + +   + + G F     V+ +   +C  C N I + K+ GR T+ C KCQK
  S:     1 MPELPEVETVRRGL-EQKLNNFIIKKVEVCRDSTIAFPINKEEFIKGLLNSLIYKWDRRGKYLIAQLKEVQNENGQFLLENSKNNGFLVIHLRMTGYFKFIE-NSSHPCKHTRIRFFDKNNNELRYIDVRSFGQMWWINKDLSLNKIVKGLGSLGPEPFSKDFDANYLKKVISKRTKSIKAILLDQTIVAGIGNIYADESLYSAGISPFREARTIKNDELIKLKESIVTVLKKSIGSGGTTFSDFRDLEGENGNFGLQTNVYRRTGKECRRCGNLIERQKITGRSTHWCPKCQK 292
>gi|94499877|ref|ZP_01306413.1| formamidopyrimidine-DNA glycosylase [Oceanobacter sp. RED65] >gi|94428078|gb|EAT13052.1| formamidopyrimidine-DNA glycosylase [Oceanobacter sp. RED65] (278 aa)
Score = 340, Expect = 3.2e-30, Identities = 83/275 (30%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK------VFVVHLRMEGKLFFEKTDSSYD-KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +   I       P++      E  T  +   +++ + R+ KYL+  +   K        ++HL M G L         D KKH    IE DD  +R++D RRFG   ++   + +DS+ ++ LG +PL + F+  Y+    +  + AIKT ++DQ  V G+GNIYA E LF + I+P+  A K++   ++++    +I+L  A+   GTT+  +     + G F + L+V+ ++   C+ C+  I +I    R T+ C KCQ+
  S:     1 MPELPEVETTRAGI-EPHIIGHQIKAFHVRQPQLRWPIPTELAT-LLTGNRVQAVRRRAKYLLIDIAAGKSEDLLGTLIIHLGMSGSLRVINAKPYPDPKKHEHFDIEFDDCLVRFNDPRRFGA-CLWQAADEVDSR-LQHLGPEPLSDTFNGDYIFAKSRGRSSAIKTFIMDQRIVVGVGNIYASESLFLAGINPKKAAGKVSKKKYQELVSAIKIVLDNAIAQGGTTLRDFTSSDGKAGYFAQELRVYGREGLGCIQCQQPIKQIVQGQRSTFYCTKCQR 278
>gi|163867542|ref|YP_001608741.1| hypothetical protein Btr_0275 [Bartonella tribocorum CIP 105476] >gi|189044583|sp|A9IN26|FPG_BART1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|161017188|emb|CAK00746.1| mutM [Bartonella tribocorum CIP 105476] (291 aa)
Score = 340, Expect = 3.3e-30, Identities = 83/275 (30%), Positives = 146/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG---------KLFFEKTDSSYDKKHVLVKIEM---DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDF------KKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E    +  I +++ +  +  +    E F+  +I  +I ++ R+ KYL+FHL+ D+  + HL M G         +  F  T       H ++ I+    D Y + Y+D RRFG   + + +       + KLGL+P+   F  +YL+        ++K  LLDQ  V+G+GNIY  E L+ S + P+  A  L             +A+N R ++++A+ + G+++  Y       G FQ    V+ ++  +C+ C   I++I  +GR ++ C +CQK
  S:     1 MPELPEVETVRRGL-ESVVTDAKIVSVQ-LNRRDLRFPFPEAFSERLIGRKILELGRRAKYLLFHLSQDETILSHLGMSGSWRIENDLLRTAFSMTSKLVKHDHFIMDIQTRNGDVYHLIYNDVRRFGFMLLVDTDKLYKHPLLNKLGLEPMSHGFSGRYLQKAFVNKKVSLKGVLLDQSIVAGLGNIYVCEALWRSRLSPQRGAFTLASKTVYARELANSLAQNIRNVISEAILSGGSSLRDYMHVDGSLGYFQHAFSVYGREGKECLQCGTPIIRILQSGRSSFYCSQCQK 291
>gi|118048578|ref|ZP_01517176.1| formamidopyrimidine-DNA glycosylase [Chloroflexus aggregans DSM 9485] >gi|117994922|gb|EAV09165.1| formamidopyrimidine-DNA glycosylase [Chloroflexus aggregans DSM 9485] (275 aa)
Score = 340, Expect = 3.5e-30, Identities = 87/274 (31%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESI-MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKL----GLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V  SL  Q  L+RTI  +  +  P++      E F   +   +I+ + R+ K+L+  L       +HLRM G L   +  ++ D  HV   +++DD   + + D R+FG   +      LDS  +  L    G +PL ++F    L   ++     IK  LLDQ  ++GIGNIYA+E L+ + IHP T    LT +    +    R++LA A+ N+G+++  Y     ++G +Q+   V+ +    C  C+  I +I V  R T+ C  CQ
  S:     1 MPELPEVETVARSLAPQ-LLSRTIVGLAKLDWPRMLTPPPPE-FAALVAGRRIEAVGRRAKWLLLTLDAGWTLAIHLRMSGHLLVAEPAAA-DAPHVHFALDLDDGRRLIFDDQRKFGRVHL------LDSTGLLALDAAHGPEPLTDDFTPAVLAERLRNRQAPIKALLLDQRLIAGIGNIYANEALWLAGIHPLTPGGTLTVDQIAALHHAIRLVLADAIANQGSSLRNYRDGYGRRGNYQEHFNVYDRVGKPCPRCQTAIERIVVAQRSTFFCPLCQ 271
>gi|88606811|ref|YP_505015.1| formamidopyrimidine-DNA glycosylase [Anaplasma phagocytophilum HZ] >gi|88597874|gb|ABD43344.1| formamidopyrimidine-DNA glycosylase [Anaplasma phagocytophilum HZ] (268 aa)
Score = 340, Expect = 3.6e-30, Identities = 86/275 (31%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ +  SL ++  + + I ++E +  +  +    +DF   +   +I  + R  KYL+  L +    V H+ M G++ +    +   +KH  V   M   Y + ++DTRRFG  T+ +   Y     ++K+G DP  E F+   L N   K+   IK+ L++   V GIGNIYA EILF ++I P    + L+  +  +I E++R +L  A+   G++I  Y       G F K  +V+ +K   C  C  +I   K  GR T+ C  CQK
  S:     1 MPELPEVEVIARSLADK-IIGQRIRDVE-VKRRDLRVRIADDFEQLVTGREICSVYRVAKYLVMQLDSGAKLVFHMGMSGRILY--MHAPVPEKHDCVVFAMQHGYSLVFNDTRRFGLVTLLDGEGY--RSLLEKMGPDPFSEAFNADCLLNMHGKAR--IKSVLMNSAVVVGIGNIYASEILFTAAILPHREVSTLSREECCRIVESTREVLKLAIATGGSSIRDYRTPTGDVGNFSKHFRVYGRKGEKCYTCGGEIQVEKQGGRSTFFCRHCQK 268
>gi|169632504|ref|YP_001706240.1| formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii SDF] >gi|169151296|emb|CAO99994.1| formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii] (274 aa)
Score = 339, Expect = 3.9e-30, Identities = 85/277 (30%), Positives = 138/277 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++   SL     LN+ + ++E   P +       D    ++ +++  + R+ KY++     D++ + HL M G     + +    +KH  + I+ +D ++RYHD RRFG     N       K I  LG +PL  +F  +YL + +K  +  IK  L+D   V G+GNIYA E LF   IHP   A  LT    +K+    + IL  A++  G+T+  Y     + G FQ+ L  + +    CVNC+  +  +K+  R +  C +CQ  K
  S:     1 MPELPEVETTKTSLFP--LLNQKVLSVEVRNPSL--RWPIPDNVQKLVGQRLIGLNRRSKYILAEFEQDQM-LWHLGMSGSFRLCQPNDEL-RKHDHLIIQFEDQQLRYHDPRRFGCILWLNPET--QGKLIDTLGPEPLSTDFHAEYLASKLKNKSVGIKIALMDNHVVVGVGNIYATESLFNVGIHPAQPAGDLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAREMCVNCETTLENLKLGQRASVFCPQCQPLK 269
>gi|167626455|ref|YP_001676955.1| DNA-formamidopyrimidine glycosylase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596456|gb|ABZ86454.1| DNA-formamidopyrimidine glycosylase [Francisella philomiragia subsp. philomiragia ATCC 25017] (289 aa)
Score = 339, Expect = 4.4e-30, Identities = 85/275 (30%), Positives = 154/275 (56%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L  +  +++ I +++    K+            + N+ +K+I R+GK+LI +L ++   ++HL M G +    T      KH  + +E+ DD  + Y+D R+FG + +      L+ + +   G++PL ++F+ +YL + +KK++R IK T++D   V G+GNIYA E LF S+I P   +N +T  + +++  + + IL KA+   GTT+  Y   + + G F + L V+ + + +C  C  KI  + +  R T+ C KCQ+
  S:    16 MPELPEVETVKRGLT-KNIISKKIKSVQINTDKLRYPVDKAQLLS-LKNKVVKNIQRRGKHLIIYLEDNLQLIIHLGMSGVVKIINTSEYNKIKHDHIILELSDDLNLVYNDPRKFGYWLVNTNKMPLEHRVLATHGVEPLTDDFNTEYLISKLKKTSRKIKQTIMDNSIVVGVGNIYASEALFDSNILPTRASNTITKKEAERLVTSIKKILDKAIAEGGTTLKDYKNTEGKPGYFTQQLNVYGRANQNCYVCSTKIESLVIAQRNTFFCKKCQR 289
>gi|169794826|ref|YP_001712619.1| formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii AYE] >gi|169147753|emb|CAM85616.1| formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii] (274 aa)
Score = 339, Expect = 4.5e-30, Identities = 85/277 (30%), Positives = 138/277 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++   SL     LN+ + ++E   P +       D    ++ +++  + R+ KY++     D++ + HL M G     + +    +KH  + I+ +D ++RYHD RRFG     N       K I  LG +PL  +F  +YL + +K  +  IK  L+D   V G+GNIYA E LF   IHP   A  LT    +K+    + IL  A++  G+T+  Y     + G FQ+ L  + +    CVNC+  +  +K+  R +  C +CQ  K
  S:     1 MPELPEVETTKTSLFP--LLNQKVLSVEVRNPSL--RWPIPDNVQKLVGQRLIGLNRRSKYILAEFEQDQM-LWHLGMSGSFRLCQPNDEL-RKHDHLIIQFEDQQLRYHDPRRFGCILWLNPET--QGKLIDTLGPEPLNTDFHAEYLASKLKNKSVGIKIALMDNHVVVGVGNIYATESLFNVGIHPAQPAGDLTLQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAGEMCVNCETTLENLKLGQRASVFCPQCQPLK 269
>gi|15603010|ref|NP_246082.1| formamidopyrimidine-DNA glycosylase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431514|sp|P57910|FPG_PASMU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|12721492|gb|AAK03229.1| Fpg [Pasteurella multocida subsp. multocida str. Pm70] (270 aa)
Score = 339, Expect = 4.7e-30, Identities = 92/276 (33%), Positives = 144/276 (52%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++  + +    +G +   I  I    PK+    S E     I  +++  ++R+ KYLI  L    + + HL M G L   +     DK   L  +  +   +RY+D RRFG + ++ E   LD   +  KLG +PL EEFD  YL    +K   A+KT L+D   V G+GNIYA+E LF  ++HP+  A  LT     ++ E  + +L+ A++  GTT+  +     + G F + L+V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETTKNGISPYLEGAI---IEKIVVRQPKLRWMVSEE--LAQITQQKVIALSRRAKYLIIQLETGYM-IGHLGMSGSLRVVEKGDLIDKHDHLDIVVNNGKVVRYNDPRRFGAW-LWTEK--LDEFPLFLKLGPEPLSEEFDSDYLWQKSRKKQTALKTFLMDNAVVVGVGNIYANETLFLCNLHPQKTAGSLTKAQCGQLVEQIKQVLSNAIQQGGTTLKDFLQPDGRPGYFVQELRVYGNKDKPCPTCGTKIESLVIGQRNSFYCPKCQKR 270
>gi|42631186|ref|ZP_00156724.1| COG0266: Formamidopyrimidine-DNA glycosylase [Haemophilus influenzae R2866] >gi|145638327|ref|ZP_01793937.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittII] >gi|145272656|gb|EDK12563.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittII] (270 aa)
Score = 338, Expect = 5.8e-30, Identities = 90/276 (32%), Positives = 140/276 (50%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++  + +    +G +   I  I    PK+    S E     I  +++  ++R+ KYLI  L    + + HL M G L   +     DK   L  +  +   +RY+D RRFG +    + N  +     KLG +PL EEFD  YL    +K   A+KT L+D   V G+GNIYA+E LF  ++HP+  A  LT     ++ E  + +L+ A++  GTT+  +       G F + L+V+  KD  C  C  KI  + +  R ++ C KCQK+
  S:     1 MPELPEVETTKNGISPYLEGAI---IEKIVVRQPKLRWMVSEE--LAQITQQKVIALSRRAKYLIIQLETGYM-IGHLGMSGSLRVVEKGDLIDKHDHLDIVVNNGKVVRYNDPRRFGAWLWTEKLN--EFPLFLKLGPEPLSEEFDSDYLWQKSRKKQTALKTFLMDNAVVVGVGNIYANETLFLCNLHPQKTAGSLTKAQCGQLVEQIKQVLSNAIQQGGTTLKDFLQPDGHPGYFVQELRVYGNKDKPCPTCGTKIESLVIGQRNSFYCPKCQKR 270
>gi|190571281|ref|YP_001975639.1| formamidopyrimidine-DNA glycosylase [Wolbachia pipientis] >gi|190357553|emb|CAQ54990.1| formamidopyrimidine-DNA glycosylase [Wolbachia pipientis] (271 aa)
Score = 337, Expect = 6.5e-30, Identities = 90/274 (32%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSV----IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ +     D +K +   N T+ N    +P I KN         +  + I DI R+GKY+I ++      ++HL M GKL + + + + +K   ++ +  D+  + ++D RRFG   + N    L+      LG++PL +EFD  YL+  +K     IK+ L++ + + G+GNIYA E LF + I P  +A  LT  + +K+A   +  L+ A+   G+T+  Y       G FQ    V+ K    C  C N I  I+ NGR TY C  CQ
  S:     1 MPELPEVEVISNFLFDKIKNKKISNVTVNNWNLRVP-ITKN-----IDDLLKGKVINDIKRRGKYIISNIDASMAVIIHLGMSGKLIYVEDNQAQNKHDHVIFLFSDNTSLIFNDPRRFGLVIVLNREQELNF--FNNLGIEPLTDEFDGHYLQKLLKNRKANIKSVLMNNKLIVGVGNIYASESLFRARISPLRLAQDLTYIECEKLAIEIKNTLSDAIAAGGSTLKDYAQPSGSAGYFQNNFYVYGKVQKPCRICNNIITLIRQNGRSTYFCNACQ 270
>gi|49475062|ref|YP_033103.1| formamidopyrimidine-DNA glycosylase [Bartonella henselae str. Houston-1] >gi|81648257|sp|Q6G4T2|FPG_BARHE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|49237867|emb|CAF27063.1| Formamidopyrimidine-DNA glycosylase [Bartonella henselae str. Houston-1] (291 aa)
Score = 337, Expect = 7.3e-30, Identities = 85/275 (30%), Positives = 147/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-----FFEKTDSSYDK----KHVLVKIEMDD---YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPE------TIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E       I ++ ++  +  +    E F+  +I   I  + R+ KYL+FHL+ ++  + HL M G       F  +  S+  K     HV++ I+  D   Y + Y+D RRFG   + +  +  +   +KKLGL+P+   F   YL+        ++K  LLDQ  V+G+GNIY  E L+ S + P+       +  +        +A+N R ++ +A+ + G+T+  Y       G FQ    V+ ++  +C++C   IV+I  +GR ++ C +CQK
  S:     1 MPELPEVETVRRGL-EPVITGAKIVSV-TLNRRDLRFPFPEAFSERLIGRTIMGLGRRAKYLLFHLSQNETILSHLGMSGSWRIEDDFLRERSSTVSKFVKHDHVVMDIQAKDGKVYHLTYNDVRRFGFMLLVDTRSLYEHPLLKKLGLEPMSNAFSGSYLQEVFVNKKISLKGVLLDQSIVAGLGNIYVCEALWRSRLSPQRGAFTLALKTECARELAASLAQNIRNVITEAISSGGSTLRDYIRTDGSLGYFQHSFSVYGREGKECLHCGIPIVRILQSGRSSFYCSQCQK 291
>gi|58617172|ref|YP_196371.1| formamidopyrimidine-DNA glycosidase [Ehrlichia ruminantium str. Gardel] >gi|58416784|emb|CAI27897.1| Formamidopyrimidine-DNA glycosidase [Ehrlichia ruminantium str. Gardel] (269 aa)
Score = 336, Expect = 8.5e-30, Identities = 89/274 (32%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V   L  +  + +TI  I+ I     +    E     +    I  I RKGKY+IF L N    V+HL M G L       +    HVL     D+  + ++D RRFG+ T+     YL+    K  G+DPL + F+ +YL +   +   +IK+ L++ + ++GIGNIY+ E LF + + P  +   ++  +   I EN + IL  ++++ G++I  Y      KG FQ +  V+ +    C  C NKI  IK +GR T+ C  CQ
  S:     1 MPELPEVEIVCKILSTK-IVGKTILKIQ-INRYDLRTQITEKLVDIVQGCYISKILRKGKYIIFILNNQYYIVIHLGMSGTLICNHDYVTMKHNHVLFFFN-DNQILVFNDPRRFGSLTLLTYKQYLEF--FKDFGIDPLSDNFNTEYLYSTFNRKT-SIKSLLMNNKIITGIGNIYSTESLFTAKVLPTKLTTNISQLECTTIVENLKNILLLSIKHGGSSIRNYISPTGTKGNFQNYFSVYNRAGLLCYICNNKISMIKQHGRNTFFCSHCQ 268
>gi|184159399|ref|YP_001847738.1| formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii ACICU] >gi|183210993|gb|ACC58391.1| Formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii ACICU] (274 aa)
Score = 336, Expect = 8.6e-30, Identities = 85/277 (30%), Positives = 137/277 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++   SL     LN+ + ++E   P +       D    ++ +++  + R+ KY++     D++ + HL M G     + +    +KH  + I+ +D ++RYHD RRFG     N       K I  LG +PL  +F  +YL   +K  +  IK  L+D   V G+GNIYA E LF   IHP   A  LT    +K+    + IL  A++  G+T+  Y     + G FQ+ L  + +    CVNC+  +  +K+  R +  C +CQ  K
  S:     1 MPELPEVETTKTSLFP--LLNQKVLSVEVRNPSL--RWPIPDNVQKLVGQRLIGLNRRSKYILAEFEQDQM-LWHLGMSGSFRLCQPNDEL-RKHDHLIIQFEDQQLRYHDPRRFGCILWLNPET--QGKLIDTLGPEPLSTDFHAEYLAFKLKNKSVGIKIALMDNHVVVGVGNIYATESLFNVGIHPAQPAGDLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAGEMCVNCETTLENLKLGQRASVFCPQCQPLK 269
>gi|152977704|ref|YP_001343333.1| formamidopyrimidine-DNA glycosylase [Actinobacillus succinogenes 130Z] >gi|171472905|sp|A6VKA1|FPG_ACTSZ Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|150839427|gb|ABR73398.1| formamidopyrimidine-DNA glycosylase [Actinobacillus succinogenes 130Z] (270 aa)
Score = 336, Expect = 8.7e-30, Identities = 95/276 (34%), Positives = 144/276 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++  + +         I  I    PK+    S E     I ++++  ++R+ KYLI H T     + HL M G +     DS  +K H  + I M++ +I RY+D RRFG +  + EN  LD   +  KLG +PL  EF+  YL    +K   A+K+ +++   V GIGNIYA+E+LF   +HPE  A K+T      + E  +  L +A+   GTT+  +     + G F + L+++ KK   C  C  KI    V  R +Y+CL CQKK
  S:     1 MPELPEVETAKNGITPY-LDGFYIEKIIVRQPKLRWEVSPE--LSQISHQKVTALSRRAKYLIIH-TAQGYIIGHLGMSGAVRIVSPDSPVNK-HDHLDIVMNNGKIMRYNDPRRFGAW-FWTEN--LDEFPLFAKLGPEPLSGEFNSDYLFKKSRKKPTAVKSFIMNNAVVVGIGNIYANEVLFQCGLHPEKPAGKITKTQAALLTETIKKELTRAIAQGGTTLKDFLQPDGKPGYFVQELQIYGKKGCPCPKCGQKIESFTVGQRNSYVCLHCQKK 270
>gi|58584846|ref|YP_198419.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75497735|sp|Q5GS47|FPG_WOLTR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|58419162|gb|AAW71177.1| Formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont strain TRS of Brugia malayi] (271 aa)
Score = 336, Expect = 8.9e-30, Identities = 90/274 (32%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSV----IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ +     D +K +     T+ N    +P        ++    I  + I +I R+GKY+I+H+ ND V  VHL M GKL + K + + +K   ++    D+  I ++D R+FG   I N+   ++       G++P  +EF+  YL+  +K     IK+ L++ + + GIGNIYA E LF + I P   A  LT  + +K+A   +  L+ A+   G+T+  Y       G FQ    V+ K    C  C N I  I+ NGR TY C  CQ
  S:     1 MPELPEVEIISNFLFDKIKNKQISGVTVNNWNLRVPIT------QNIDDVIKGKVINNIKRRGKYIIWHIDNDIVVTVHLGMSGKLIYAKGEQAQNKHDHVIFSFSDNTSIIFNDPRKFGLVIILNKEQEVNF--FNDFGIEPFTDEFNGDYLQKLLKSKKVNIKSALMNNKLIVGIGNIYASESLFRARISPLRSAQDLTYKECEKLATEIKNTLSDAIIAGGSTLKDYAQPSGSVGYFQNSFYVYGKVQKPCKICNNTITLIRQNGRSTYFCNACQ 270
>gi|126724501|ref|ZP_01740344.1| formamidopyrimidine-DNA glycosylase [Rhodobacterales bacterium HTCC2150] >gi|126705665|gb|EBA04755.1| formamidopyrimidine-DNA glycosylase [Rhodobacterales bacterium HTCC2150] (284 aa)
Score = 336, Expect = 9.2e-30, Identities = 84/275 (30%), Positives = 148/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNR----TITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFE-------KTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V      QG L      TIT  E   P + +    E+    I  +++  ++R+ KY++  L + +  ++HL M G++            +    +KH  V   MD+  ++ ++D RRFG   +   ++  +   I K+G +PL  EF+  YL   +K     IKT LLDQ+ V+G+GNIY  E+LF + + P+  A  ++      +    R +L++A+ + G+++  Y     + G FQ   KV+ ++   C+N  C  +I +I  +GR ++ C KCQ+
  S:     2 MPELPEVETV-----RQGLLGAMDGATITKAEVNRPDL-RWPFPENMAQRITGQKVLGLSRRSKYILVSLASGETLIIHLGMSGRMTVSGDPLGQFHHEHPAPQKHDHVVFHMDNGAQVTFNDPRRFGAMDLATSDDIENHWLISKIGPEPLGNEFNAPYLVERLKTRAMPIKTALLDQQIVAGLGNIYVCEVLFRAGVSPQRKAKDISAKKIGALVPIIRDVLSEAIVSGGSSLKDYRQADGELGYFQHRFKVYDREGETCLNDGCGTEISRIVQSGRSSFFCKKCQR 284
>gi|83595877|gb|ABC25239.1| formamidopyrimidine-DNA glycosylase [uncultured marine bacterium Ant4D3] (270 aa)
Score = 336, Expect = 9.4e-30, Identities = 79/275 (28%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    ++  ++ Q   +  + +     P         D    +  + ++ + R+GKYL+F   +  + + HL M G  ++   K   +Y   H  V +   +  +RY D RRFG   ++ +N  ++   +  LG +PL +EFD  +L    K   +AIK+ ++D + V G+GNIYA+E LF + IHP   A +++     K+ E+ + +L  A+E  GTT+  +   + + G F++ L+V+ +    CVNC   + + ++  R T  C  CQ+
  S:     1 MPELPEVETTRAGIMPHIQGQILQHVVVRDTRLRWPVPI------DLAAKVEGKCLRQVVRRGKYLLFEFDHGAI-IGHLGMTGSMRIVVHKEPPAY---HDHVDLVFSEVTLRYRDPRRFGC-VLWQDNPVMEHPLLASLGPEPLSDEFDMVHLLQVCKGKKQAIKSVIMDAKQVVGVGNIYANEALFMAGIHPHRQAGRISAARLGKLVESCKQVLCAAIEQGGTTLRDFVDSEGKPGYFKQQLQVYGRAGQACVNCDQALTESRIGQRSTVYCKHCQR 270
>gi|90414930|ref|ZP_01222894.1| formamidopyrimidine-DNA glycosylase [Photobacterium profundum 3TCK] >gi|90323986|gb|EAS40582.1| formamidopyrimidine-DNA glycosylase [Photobacterium profundum 3TCK] (269 aa)
Score = 336, Expect = 1.1e-29, Identities = 90/275 (32%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     + + +T I    PK+      E     I  + I+ +TR+ KYL+ H T+    +VHL M G L      S   +KH  V + +   E+ RY+D RRFG +    E   LD K + +LG +PL ++F  KYL++  K    AIK  ++D + V G+GNIYA+E LF++ IHP+  A +++        +  + +LA A+E  GTT+  +     + G F + L+V+ K    C  C N + ++K+  R +  C +CQK
  S:     1 MPELPEVEVSRMGITPH-VVGQIVTKIIVRNPKLRWPIPEE--IQQIEGQVIRKVTRRAKYLLLH-TDVGYAIVHLGMSGSLRVLPV-SIPPEKHDHVDLVLSSGEVLRYNDPRRFGAWLW--ELPDLDHKVLSQLGPEPLSDDFTAKYLQDRAKGKRTAIKQFIMDNKVVVGVGNIYANESLFSAGIHPKRAAGEISAEKIALFVDEIKSVLAFAIEQGGTTLKDFKNADGKPGYFAQELQVYGKGGKPCPRCDNPLSEMKIGQRASVFCSECQK 269
>gi|46199756|ref|YP_005423.1| formamidopyrimidine-DNA glycosylase mutM [Thermus thermophilus HB27] >gi|55981775|ref|YP_145072.1| MutM protein (formamidopyrimidine-DNA glycosylase) (Fpg) [Thermus thermophilus HB8] >gi|7531119|sp|O50606|FPG_THET8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81405496|sp|Q72HN2|FPG_THET2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|2897751|dbj|BAA24892.1| mutM [Thermus thermophilus] >gi|46197383|gb|AAS81796.1| formamidopyrimidine-DNA glycosylase mutM [Thermus thermophilus HB27] >gi|55773188|dbj|BAD71629.1| MutM protein (formamidopyrimidine-DNA glycosylase) (Fpg) [Thermus thermophilus HB8] (267 aa)
Score = 335, Expect = 1.2e-29, Identities = 83/274 (30%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQ--KGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    L+    L +T+  +    P  ++N +  +        +I ++ R+GK+L+F L      V HL M G    E T       H    + ++   + +HD RRFG        +Y +   + +LG +PL E F +      +K+S R +K  LLDQ   +G+GNIYADE LF + + P   A  LT+ + +++    R +LA+AVE  G+T++   +++     G FQ    V+ ++   C  C   + +  V GRGT+ C  CQ
  S:     1 MPELPEVETTRRRLRPL-VLGQTLRQVVHRDPARYRNTALAE------GRRILEVDRRGKFLLFALEGGVELVAHLGMTGGFRLEPT------PHTRAALVLEGRTLYFHDPRRFGRLFGVRRGDYREIPLLLRLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPARSLTEEEARRLYRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQTRHAVYGREGLPCPACGRPVERRVVAGRGTHFCPTCQ 263
>gi|163748879|ref|ZP_02156131.1| formamidopyrimidine-DNA glycosylase [Shewanella benthica KT99] >gi|161331653|gb|EDQ02458.1| formamidopyrimidine-DNA glycosylase [Shewanella benthica KT99] (271 aa)
Score = 335, Expect = 1.4e-29, Identities = 84/276 (30%), Positives = 148/276 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +  QG     +   + ++  + +N S           I+ + I+++ R+ KYL+   T+    ++HL M G L      +  +K H  + +E+   +I R++D RRFG + +++E        + KLG +PL+++F  KYL +++K   +AIK  L+D   V G+GNIYA+E LFA+ IHP+T A +L       +  + + ILA A++  GTT+  +     + G F + L V+ +    C  C N + ++++  R T  C  CQ++
  S:     1 MPELPEVE-----VTRQGITPHLVG--QEVIGLVVRNASLRWPVPQIAQQIVGQVIRNVRRRAKYLLID-TDAGTTIIHLGMSGSLRIVPKSTPVEK-HDHIDLELASGKILRFNDPRRFGAW-LWSELPEEAHPLLSKLGPEPLKDDFTPKYLFDSLKNKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPQTEAGRLDIERLTILVTDIKQILASAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTQCGNLLSEVRLGQRATVFCGICQQR 271
>gi|162447217|ref|YP_001620349.1| bifunctional formamidopyrimidine-DNA glycosylase/dephospho-CoA kinase [Acholeplasma laidlawii PG-8A] >gi|161985324|gb|ABX80973.1| bipartite protein: formamidopyrimidine-DNA glycosylase and dephospho-CoA kinase domains [Acholeplasma laidlawii PG-8A] (452 aa)
Score = 334, Expect = 1.4e-29, Identities = 104/274 (37%), Positives = 157/274 (57%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++  +L    +G + R +  +    P +  + S+E     +  ++I  + R+ KYL F L +D + V HLRMEGK F +   +    KH+ V   +   + + Y DTR+FG F + +   ++ YL  K+IK L  DP  +  D     ++  + ++ IK  LLDQ  + GIGNIYA+EIL+ S IHP      ++ ++ K +  NS ++L KA+E  GTTI T F     KGEFQ+ L VH K    C  C  KI+K ++ GRGTY+C KCQ
  S:     1 MPELPEVETIRRNLNTVLEGEIIREV--LVYYRPIVSNDASFET---KLKGQRIHKVEREAKYLKFIL-DDYLLVSHLRMEGKYFMDAPLN----KHIHVVFNLSSGHTLSYEDTRKFGRFELVDIKYKDTYL--KDIKGLAKDP--DTLDLNTFYSSFNQRSKTIKEILLDQSIIGGIGNIYANEILYLSKIHPAKKGFLISKDEAKTLLNNSNLVLNKAIEMGGTTIDT-FESLGHKGEFQQELNVHGKTGEICKVCGTKIIKFQLKGRGTYICPKCQ 265
>gi|13096238|pdb|1EE8|A Chain A, Crystal Structure Of Mutm (Fpg) Protein From Thermus Thermophilus Hb8 >gi|13096239|pdb|1EE8|B Chain B, Crystal Structure Of Mutm (Fpg) Protein From Thermus Thermophilus Hb8 (266 aa)
Score = 334, Expect = 1.5e-29, Identities = 83/273 (30%), Positives = 136/273 (49%)
  Q:     2 PELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQ--KGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           PELPEV++    L+    L +T+  +    P  ++N +  +        +I ++ R+GK+L+F L      V HL M G    E T       H    + ++   + +HD RRFG        +Y +   + +LG +PL E F +      +K+S R +K  LLDQ   +G+GNIYADE LF + + P   A  LT+ + +++    R +LA+AVE  G+T++   +++     G FQ    V+ ++   C  C   + +  V GRGT+ C  CQ
  S:     1 PELPEVETTRRRLRPL-VLGQTLRQVVHRDPARYRNTALAE------GRRILEVDRRGKFLLFALEGGVELVAHLGMTGGFRLEPT------PHTRAALVLEGRTLYFHDPRRFGRLFGVRRGDYREIPLLLRLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPARSLTEEEARRLYRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQTRHAVYGREGLPCPACGRPVERRVVAGRGTHFCPTCQ 262
>gi|113460292|ref|YP_718352.1| formamidopyrimidine-DNA glycosylase [Haemophilus somnus 129PT] >gi|123131889|sp|Q0I0X6|FPG_HAES1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|112822335|gb|ABI24424.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Haemophilus somnus 129PT] (270 aa)
Score = 334, Expect = 1.6e-29, Identities = 96/276 (34%), Positives = 146/276 (52%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYE--DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +    +G +   I  I    PK+    S E   F H     +I ++TR+ KYLI H T     + HL M G +     D+  +K H    I M++ ++ RY+D RRFG +     NN  +     KLG +PL E F+  YL    ++ + A+KT L+D   V G+GNIYA+EILF   +HP+ IA  LT    +++    + +L +A+E  GTT+  +     + G F + L V+  KD  C  C  KI  I +  R ++ C +CQKK
  S:     1 MPELPEVETTLKGVSPYLKGFI---IEKIVVRNPKLRWEVSKELSTFKHV----KILNLTRRAKYLIIH-TEQGYIIGHLGMSGSVRIVPHDNPVNK-HDHFDIVMNNGKLLRYNDARRFGAWLW--TNNLSEFHLFFKLGPEPLSETFNSTYLFKKSRQKSTALKTFLMDNSVVVGVGNIYANEILFLCGLHPQKIAKTLTKKQAEQLVFTIKQVLNEAIEQGGTTLKDFLQPDGRPGYFAQKLLVYGNKDKPCPRCGTKIKSIIIGQRNSFFCPQCQKK 270
>gi|42520959|ref|NP_966874.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|81652197|sp|Q73G10|FPG_WOLPM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|42410700|gb|AAS14808.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont of Drosophila melanogaster] (271 aa)
Score = 334, Expect = 1.8e-29, Identities = 90/274 (32%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSV----IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ +    +D +K +   N  + N     P I KN         +  + I++I R+GKY I++       ++HL M GKL +   D   +K   +V +  D+  I ++D RRFG   + N+    D       G++PL +EF   YL+  +K     IK+ L+D +++ G+GNIYA E LF + I P   A  LT  + +K+A   +  L+ A+   G+T+  Y       G FQ    V+ K    C  C N I  I+ NGR TY C  CQ
  S:     1 MPELPEVEVISNFLLDKIKNKQISNVIVNNWNLRAP-ITKN-----IDDMLKGKVIRNIKRRGKYTIWNTDGSVAVIIHLGMSGKLIYADHDQMRNKHDHVVFLFSDNTSIIFNDPRRFGLVIVLNKEQETDF--FSDFGIEPLTDEFSGDYLQELLKNKKVNIKSALMDNKSIVGVGNIYASESLFRARISPLRSAKNLTYRECEKLAAEIKNTLSDAIAAGGSTLKDYAQPSGSAGYFQNNFYVYGKVQKPCKICNNIITLIRQNGRSTYFCNACQ 270
>gi|170717422|ref|YP_001783367.1| formamidopyrimidine-DNA glycosylase [Haemophilus somnus 2336] >gi|189044662|sp|B0UUX0|FPG_HAES2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|168825551|gb|ACA30922.1| formamidopyrimidine-DNA glycosylase [Haemophilus somnus 2336] (270 aa)
Score = 333, Expect = 2.0e-29, Identities = 96/276 (34%), Positives = 146/276 (52%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYE--DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++ +  +    +G +   I  I    PK+    S E   F H     +I ++TR+ KYLI H T     + HL M G +     D+  +K H    I M++ ++ RY+D RRFG +     NN  +     KLG +PL E F+  YL    ++ + A+KT L+D   V G+GNIYA+EILF   +HP+ IA  LT    +++    + +L +A+E  GTT+  +     + G F + L V+  KD  C  C  KI  I +  R ++ C +CQKK
  S:     1 MPELPEVETTLKGVSPYLKGFI---IEKIVVRNPKLRWEVSKELSTFKHV----KILNLTRRAKYLIIH-TEQGYIIGHLGMSGSVRIVPHDNPVNK-HDHFDIVMNNGKLLRYNDARRFGAWLW--TNNLSEFHLFFKLGPEPLSETFNSTYLFKKSRQKSTALKTFLMDNSVVVGVGNIYANEILFLCGLHPQKIAKTLTKKQTEQLVFTIKQVLNEAIEQGGTTLKDFLQPDGRPGYFAQKLLVYGNKDKPCPRCGTKIKSIIIGQRNSFFCPQCQKK 270
>gi|90023321|ref|YP_529148.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Saccharophagus degradans 2-40] >gi|123395478|sp|Q21EE3|FPG_SACD2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|89952921|gb|ABD82936.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Saccharophagus degradans 2-40] (271 aa)
Score = 333, Expect = 2.2e-29, Identities = 89/275 (32%), Positives = 135/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +     L        S+  +  +     D    I N+ ++ I R+GKYL+    N  V + HL M G L   K D      H  V I    +  +RY D RRFG     NE   L+ K +  LG +PL + F+  YL +  +K ++++KT ++D + V G+GNIYA+E LF S+IHP   A KL+           + +LAKA+E  GTT+  +     + G F + L V+ +    C  C+  + + K+  R T  C  CQK
  S:     1 MPELPEVETTRRGILPH--LEGKRVKAVSVRNRSLRWPIPADLAQQIQNKTLRTIHRRGKYLLLEFANGHV-IWHLGMSGSLRIIKADEP-PMVHDHVDIAFGGNLALRYTDPRRFGAVLWTNEA-ILEHKLLNHLGPEPLTDAFNSAYLFDKSRKRSQSVKTWIMDSKVVVGVGNIYANEALFNSAIHPLKAAGKLSQKQCDIFCSEIKSVLAKAIEQGGTTLRDFVGGDGKPGYFAQELNVYGRGGKACKKCRKPLTEKKLGQRTTVYCTHCQK 271
>gi|71083113|ref|YP_265832.1| formamidopyrimidine-DNA glycosylase [Candidatus Pelagibacter ubique HTCC1062] >gi|71062226|gb|AAZ21229.1| Formamidopyrimidine-DNA glycosylase [Candidatus Pelagibacter ubique HTCC1062] (287 aa)
Score = 333, Expect = 2.4e-29, Identities = 100/275 (36%), Positives = 148/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-------------SYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCV--NCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V  SL ++  L         I  +  +      F   + N+ IK +TR  KYLI + ++    ++HL M G +   K ++             S  KKH  V+I      + Y+D RRFG F  + EN     K    LG +P  + F+ +YL        + IK+ LLDQ+ VSGIGNIYA EILF   I+P T A+KLT  D KKI   S+ +L +A++  G++I  +     + G FQK  +V+ +++  C+   C  KI KI ++ R T+ C  CQK
  S:     1 MPELPEVEIVKQSLSKK--LEHKKIKKIIITNRNLRFKIPLKFEELLKNKIIKKVTRFSKYLILNFSDQSFCLIHLGMSGTVHLIKKNNISKFTNTSFYNSPSLPKKHNHVEIHFKGLRVIYNDPRRFGFFK-FIENKKELEKRFSHLGPEPFFKNFNLEYLIGYFTNKKKDIKSFLLDQKFVSGIGNIYASEILFLCKINPITYASKLTKQDCKKIITYSKSVLNRAIKKGGSSIRDFKNITGKSGNFQKEFRVYQRENLSCLRTKCNGKIQKIFISNRSTFFCNTCQK 287
>gi|91762461|ref|ZP_01264426.1| Formamidopyrimidine-DNA glycosylase [Candidatus Pelagibacter ubique HTCC1002] >gi|91718263|gb|EAS84913.1| Formamidopyrimidine-DNA glycosylase [Candidatus Pelagibacter ubique HTCC1002] (287 aa)
Score = 332, Expect = 2.9e-29, Identities = 100/275 (36%), Positives = 148/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-------------SYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCV--NCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V  SL ++  L         I  +  +      F   + N+ IK +TR  KYLI + ++    ++HL M G +   K ++             S  KKH  V+I      + Y+D RRFG F  + EN     K    LG +P  + F+ +YL        + IK+ LLDQ+ VSGIGNIYA EILF   I+P T A+KLT  D KKI   S+ +L +A++  G++I  +     + G FQK  +V+ +++  C+   C  KI KI ++ R T+ C  CQK
  S:     1 MPELPEVEIVKQSLSKK--LEHKKIKKIIITNRNLRFKIPLKFEELLKNKIIKKVTRFSKYLILNFSDQSFCLIHLGMSGTVHLIKKNNINKFTNTSFYNSPSLPKKHNHVEIHFKGLRVIYNDPRRFGFFK-FIENKKELEKRFSHLGPEPFFKNFNLEYLIGYFTNKKKDIKSFLLDQKFVSGIGNIYASEILFLCKINPITYASKLTKQDCKKIITYSKSVLNRAIKKGGSSIRDFKNITGKSGNFQKEFRVYQRENLSCLRTKCNGKIQKIFISNRSTFFCNTCQK 287
>gi|120556654|ref|YP_961005.1| formamidopyrimidine-DNA glycosylase [Marinobacter aquaeolei VT8] >gi|166215632|sp|A1U749|FPG_MARAV Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|120326503|gb|ABM20818.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Marinobacter aquaeolei VT8] (270 aa)
Score = 332, Expect = 3.0e-29, Identities = 86/275 (31%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +    C  +TI  +      I +N S       D   ++  + I+ + R+ KYL  HL    V +VHL M G L    TD S    H  V++ + ++  +R++D RRFG +    + N      I  LG +PL E+F+  +L    ++    +K+ ++D   V G+GNIYA+E LF + IHP+  A +++ + + K+AE  R  L+ A+   GTT+  +     + G F + L V+ K    C  C   + +I++N R T  C +CQ+
  S:     1 MPELPEVETTRQGIAPH-CEGQTIQRV------IVRNPSLRWPVPADLAEHLEGKTIRAVERRAKYLFLHLETGSV-IVHLGMSGSLRV-ITDDSPAMTHDHVELVLGNHRRLRFNDPRRFGCWLWTTDWN--RHPLISALGPEPLSEDFNGAWLFRLSRQKQTPVKSFIMDNHVVVGVGNIYANEALFKAGIHPKRKAGRISLDRYHKLAEAIRETLSAAILMGGTTLRDFVNSDGKPGYFAQSLLVYGKAGAPCTECNTPLKEIRMNNRSTVYCPRCQR 270
>gi|91791579|ref|YP_561230.1| formamidopyrimidine-DNA glycosylase [Shewanella denitrificans OS217] >gi|123166575|sp|Q12SR9|FPG_SHEDO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|91713581|gb|ABE53507.1| formamidopyrimidine-DNA glycosylase [Shewanella denitrificans OS217] (271 aa)
Score = 332, Expect = 3.2e-29, Identities = 88/276 (31%), Positives = 142/276 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +  QG     +   ++++  I +N S      D  H I+ + I  + R+ KYL+   T   + +VHL M G L     ++  +K   +  +  +   +R++D RRFG +  Y    E + L    + KLG +PL E F+   L   +K   +AIK  L+D   V G+GNIYA+E LFA+ IHPE+ A K+       +    + ILA+A++  GTT+  +     + G F + L V+ +    C +C N + +I++  R T  C  CQ K
  S:     1 MPELPEVE-----VTRQGIAPYLVD--QTVVELIVRNASLRWPVPDLAHNIVGQTILSVRRRAKYLLID-TEAGITIVHLGMSGSLRILPRNTPVEKHDHIDLVLANGRMLRFNDPRRFGAWLWYELPEEAHPL----LAKLGPEPLSEAFNPLQLLTALKGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPESEAGKIDIEKLTLLVVEVKQILAQAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGSKSCTHCGNLLSEIRLGQRTTVFCGLCQTK 271
>gi|151570294|gb|EDN35948.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. novicida GA99-3549] (274 aa)
Score = 331, Expect = 3.3e-29, Identities = 87/275 (31%), Positives = 149/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   +++ I +IE    K+      +     I N+ +K I R+GK+LI  + +D   ++HL M G  K+      +     H++V +  D+  + Y+D R+FG + +   +  L+ + +   G++PL  +F+  YL + +K+++R IK T++D   V G+GNIYA E LF S+I P   +N +T  +   +  + + IL KA+   GTT+  Y   + + G F + L V+ + D  C  C  KI  + +  R T+ C KCQK
  S:     1 MPELPEVETVKRGLIKT-IIDKKIFDIEINTDKLRYPIDKDQLVK-IKNKVVKQIQRRGKHLIIFIEDDLQLIIHLGMSGIIKVIDSTKYNKIKHDHIVVTLS-DNLSLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNDQQCYVCNTKIQSLVIAQRNTFFCKKCQK 274
>gi|50083930|ref|YP_045440.1| formamidopyrimidine-DNA glycosylase [Acinetobacter sp. ADP1] >gi|81695930|sp|Q6FE90|FPG_ACIAD Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|49529906|emb|CAG67618.1| formamidopyrimidine-DNA glycosylase [Acinetobacter sp. ADP1] (272 aa)
Score = 331, Expect = 3.3e-29, Identities = 88/277 (31%), Positives = 141/277 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++   SL     LN+ + +++ +     +    ED +  +  +++  + R+ KY++     D++ + HL M G  F   T +   +KH  + +  DD  E+RYHD RRFG     NE +   SK +  LG +PL E+F+  YL   +K     IK  L+D   V G+GNIYA E LF   IHP   A+ L+      + +  + IL  A+E  G+T+  Y     + G FQ+ L  + +    CVNC+  +  +K+  R +  C +CQ  K
  S:     1 MPELPEVETTKTSLLP--LLNQRVKSVQ-VRDSRLRWPIPEDISR-LAGQRLTSLKRRSKYILAEFETDQM-LWHLGMSGS-FRVATAADELRKHDHLILTFDDGTELRYHDPRRFGCILWLNEES--QSKLLNPLGPEPLSEDFNADYLYQKLKSKQVGIKIALMDNHVVVGVGNIYATESLFNLGIHPAQPASSLSKPQILALVQEIKRILKFAIELGGSTLRDYTNAMGENGYFQQTLLAYGRAGEMCVNCETPLENLKLGQRASVFCPQCQPLK 270
>gi|57239162|ref|YP_180298.1| formamidopyrimidine-DNA glycosidase [Ehrlichia ruminantium str. Welgevonden] >gi|58579116|ref|YP_197328.1| formamidopyrimidine-DNA glycosidase [Ehrlichia ruminantium str. Welgevonden] >gi|57161241|emb|CAH58159.1| formamidopyrimidine-DNA glycosylase [Ehrlichia ruminantium str. Welgevonden] >gi|58417742|emb|CAI26946.1| Formamidopyrimidine-DNA glycosidase [Ehrlichia ruminantium str. Welgevonden] (269 aa)
Score = 331, Expect = 3.4e-29, Identities = 88/274 (32%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V   L  +  + +TI  I+ I     +    E     +    I  I RKGKY+IF L N    V+HL M G L       +    HVL     D+  + ++D RRFG+ T+     YL+    K  G+DPL + F+ +YL ++  +   +IK+ L++ + ++GIGNIY+ E LF + + P  +   ++  +   I EN + IL  ++++ G++I  Y      KG FQ +  V+ +    C  C NKI  IK + R T+ C  CQ
  S:     1 MPELPEVEVVCKILSTK-IVGKTILKIQ-INRYDLRTQITEKLADIVQGCYISKILRKGKYIIFILNNQYYIVIHLGMSGTLICNHDYITMKHNHVLFFFN-DNQILVFNDPRRFGSLTLLTYEQYLEF--FKDFGIDPLSDNFNTEYLYSSFNRKT-SIKSLLMNNKIITGIGNIYSTESLFMAKVLPTKLTTNISQLECTTIVENLKNILLLSIKHGGSSIRNYISPTGTKGNFQNYFSVYNRAGLLCYICNNKISMIKQHSRSTFFCSHCQ 268
>gi|54307427|ref|YP_128447.1| formamidopyrimidine-DNA glycosylase [Photobacterium profundum SS9] >gi|81697553|sp|Q6LVN0|FPG_PHOPR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|46911847|emb|CAG18645.1| putative formamidopyrimidine-DNA glycosylase [Photobacterium profundum SS9] (269 aa)
Score = 331, Expect = 3.7e-29, Identities = 89/275 (32%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     + +T+T I    PK+      E     I  + I+ +TR+ KYL+ H T+    +VHL M G L      S   +KH  V + +   E+ RY+D RRFG +     +  LD K + +LG +PL  +F  +YL+   K    AIK  ++D + V G+GNIYA+E LF++ IHP+  A +++        +  + +LA A+E  GTT+  +     + G F + L+V+ K    C  C N + ++K+  R +  C +CQK
  S:     1 MPELPEVEVSRMGITPH-MVGQTVTKIIVRNPKLRWPIPEE--IQQIEGQVIRKVTRRAKYLLLH-TDVGYAIVHLGMSGSLRILPA-SIPPEKHDHVDLVLSSGEVLRYNDPRRFGAWLWGLPD--LDHKVLSQLGPEPLSNDFTAEYLQERAKGKRTAIKQFIMDNKVVVGVGNIYANESLFSAGIHPKRAAGEISPEKIALFVDEIKSVLAFAIEQGGTTLKDFKNADGKPGYFAQELQVYGKGGKPCPRCDNPLSEMKIGQRASVFCSECQK 269
>gi|99034656|ref|ZP_01314602.1| hypothetical protein Wendoof_01000584 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (349 aa)
Score = 331, Expect = 3.8e-29, Identities = 90/274 (32%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSV----IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ +    +D +K +   N  + N     P I KN         +  + I++I R+GKY I++       ++HL M GKL +   D   +K   +V +  D+  I ++D RRFG   + N+    D       G++PL +EF   YL+  +K     IK+ L+D +++ G+GNIYA E LF + I P   A  LT  + +K+A   +  L+ A+   G+T+  Y       G FQ    V+ K    C  C N I  I+ NGR TY C  CQ
  S:    79 MPELPEVEVISNFLLDKIKNKQISNVIVNNWNLRAP-ITKN-----IDDMLKGKVIRNIKRRGKYTIWNTDGSVAVIIHLGMSGKLIYADHDQMRNKHDHVVFLFSDNTSIIFNDPRRFGLVIVLNKEQETDF--FSDFGIEPLTDEFSGDYLQELLKNKKVNIKSALMDNKSIVGVGNIYASESLFRARISPLRSAKNLTYRECEKLAAEIKNTLSDAIAAGGSTLKDYAQPSGSAGYFQNNFYVYGKVQKPCKICNNIITLIRQNGRSTYFCNACQ 348
>gi|186684064|ref|YP_001867260.1| formamidopyrimidine-DNA glycosylase [Nostoc punctiforme PCC 73102] >gi|186466516|gb|ACC82317.1| formamidopyrimidine-DNA glycosylase [Nostoc punctiforme PCC 73102] (291 aa)
Score = 331, Expect = 3.8e-29, Identities = 94/274 (34%), Positives = 138/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTN---DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q  LN+ IT  + ++ + I    S  +F   I    I    R+GKYL+  L++        VHLRM G+L +   D     KH  V++   D  E+R+ D R FG          ++S    + KL  DP   EF  +YL + +K   R IKT LLDQ  V+G+GNIYADE LF S I PET+   L     + +      +L  ++E  GTT + +   K   G +     V+ +    C  C   I +I++ GR ++ C +CQ
  S:     1 MPELPEVETVRKGLN-QLTLNQEITGGDVLLNRTIAYPFSVGEFVDGIEKNAIATWHRRGKYLLAELSSPCSTSWLGVHLRMTGQLLWLHRDEPL-HKHTRVRLFFGDQQELRFVDQRTFGKIWWVPPGVAVESIITGLAKLAADPFSPEFSVEYLASKLKNRRRPIKTALLDQSVVAGLGNIYADEALFKSGILPETLCIDLQLKQIELLRTAIIQVLETSIEAGGTTFSNFLNVKGTNGNYGGVAWVYNRAGEPCRVCGMPIQRIRLAGRSSHFCSECQ 279
>gi|93005206|ref|YP_579643.1| formamidopyrimidine-DNA glycosylase [Psychrobacter cryohalolentis K5] >gi|92392884|gb|ABE74159.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Psychrobacter cryohalolentis K5] (307 aa)
Score = 330, Expect = 4.5e-29, Identities = 98/274 (35%), Positives = 158/274 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFH---LTND-------------KVFVVHLRMEGKLFFEKTDSSYDKKH---VLVKIEMDDYE--IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKS-----------------NRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++   SL     L + +TN++   PK+    S  D    +I+  +  + R+ KYLI +   L +D             K  ++HL M G L  +   +S  +KH   ++  I  DD +  + Y+D RRFG+  I    +Y D K +  LG +PL ++F   YL   I++S                  RAIK+ +++Q+ V G+GNIYA E L+ S IHP T ANK++ +    +  + + IL KA++  G+T+  +     Q G FQ+ L V+ ++   C +C + +  IK+NGR +  C  CQ
  S:     1 MPELPEVETTKTSLTP--LLGQKVTNVQVFQPKL--RWSMPDNLSDLIDYTLDSVERRAKYLILNFIPLADDGISSSVEPRNLQPKQLLIHLGMSGSLQ-QHHHTSDKRKHDHLIMSFIGADDTQTQLHYYDPRRFGS--ILWLEDYGD-KLLNHLGPEPLSDDFTADYLYYLIQRSEQSIQTQSSKVIKKQPIKRAIKSVIMEQQAVVGVGNIYATESLYLSGIHPATPANKISYDQIVILVAHIKTILQKAIKLGGSTLRDFTVADGQTGYFQQTLNVYGRQGETCPHCDSVLENIKLNGRASVYCPVCQ 304
>gi|148656079|ref|YP_001276284.1| formamidopyrimidine-DNA glycosylase [Roseiflexus sp. RS-1] >gi|166198744|sp|A5UUN1|FPG_ROSS1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|148568189|gb|ABQ90334.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Roseiflexus sp. RS-1] (273 aa)
Score = 330, Expect = 4.6e-29, Identities = 84/275 (30%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESI-MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNY--LDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEVQ   DSL  Q  +   I  +E +   ++ +  S ++F   +   Q+    R+ K+++  L       +HLRM G L  +  D+  DK  H++++++ D  ++ + D R+FG   + + +    LD+      G +PL   F  + L   ++   RAIK  LLDQ  ++GIGNIYADE L+ + IHP   A+ L+ ++   + +  R  L +A+ N G+T+  Y      +G  Q     + ++   C  C   I+K  V  RGT+ C +CQ+
  S:     1 MPELPEVQLAADSLGVQ-IVGARIVRVERLDWTRMVETPSPDEFITLLAGRQVHGWGRRAKWILLFLDGGWTLALHLRMSGSLTVQPADAPPDKHTHLVLRLD-DGRQVFFRDPRKFGRARLLDADGRAALDAAH----GDEPLSNAFTVERLAELLRGRKRAIKPLLLDQAVIAGIGNIYADEALWRARIHPLRPASDLSADEVAALHDGIRAALRQALTNGGSTLRDYRNSYGTRGTNQDHFNAYDREGQPCPRCGATIIKTVVAQRGTHYCPECQR 273
>gi|62261847|gb|AAX78021.1| unknown protein [synthetic construct] (309 aa)
Score = 330, Expect = 4.6e-29, Identities = 86/275 (31%), Positives = 150/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   +++ I +IE    K+      +     I N+ +K+I R+GK+LI  + +D   ++HL M G  K+      +     H++V +  D+  + Y+D R+FG + +   +  L+ + +   G++PL  +F+  YL + +K+++R IK T++D   V G+GNIYA E LF S+I P   +N +T  +   +  + + IL KA+   GTT+  Y   + + G F + L V+ + +  C  C  KI  + +  R T+ C KCQK
  S:    27 MPELPEVETVKRGLIKT-IIDKKIFDIEINTDKLRYPIDKDQLVK-IKNKVVKEIQRRGKHLIIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLS-DNLSLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK 300
>gi|90408782|ref|ZP_01216927.1| formamidopyrimidine-DNA glycosylase [Psychromonas sp. CNPT3] >gi|90310126|gb|EAS38266.1| formamidopyrimidine-DNA glycosylase [Psychromonas sp. CNPT3] (270 aa)
Score = 330, Expect = 4.6e-29, Identities = 81/274 (29%), Positives = 143/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    L +   L + IT I+ I  +  +     D + +++ +++  I R+ KYL+ +  N    ++HL M G L     ++   +KH       D   +RY D RRFG       + Y   K +  LG++PL E+F  +YL +  K+    +K  ++DQ+ V+G+GNIYA E LF S++ P   A++++   ++++    + +L  A+E  GTT+  +     + G FQ+ L ++ K    C +C+  +  IK+ GR +  C  CQ
  S:     1 MPELPEVETTRRGLSKY-ILAKKITRID-IRQRQLRWEIPTDLSVHLVQKELLSIDRRAKYLLLNF-NSGTLLIHLGMSGSLRVCNLNTP-PEKHDHADFIFDSCLLRYTDPRRFGAILWLGSDPYA-HKLLSHLGVEPLTEQFSGEYLHHLSKRRKLPVKQFIMDQKVVTGVGNIYATEALFLSALRPTRSASQISLARYQRLVLEIKKVLILAIEQGGTTLKDFVGGDGKPGYFQQTLHIYGKAGAPCPSCQKPLDAIKLAGRNSVFCAHCQ 269
>gi|71064918|ref|YP_263645.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Psychrobacter arcticus 273-4] >gi|90101313|sp|Q4FUU7|FPG_PSYA2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|71037903|gb|AAZ18211.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Psychrobacter arcticus 273-4] (309 aa)
Score = 330, Expect = 4.9e-29, Identities = 93/274 (33%), Positives = 158/274 (57%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFH---LTNDKV-------------FVVHLRMEGKLFFEKTDSSYDKK---HVLVKI---EMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKS-----------------NRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++   SL     L + +TN++   PK+    S  D    +++  +  + R+ KYLI +   L +D +              +VHL M G L  ++ + + DK+   H+++     +    ++ Y+D RRFG+     E  Y D K +  LG +PL + F   YL + I++S                  RAIK+ +++Q+ V G+GNIYA E L+ S IHP T AN+++      +  + + IL KA++  G+T+  +     Q G FQ+ L V+ ++   C +C++ +  IK+NGR +  C  CQ
  S:     1 MPELPEVETTKTSLAP--LLGQKVTNVQVFQPKL--RWSIPDNLADLVDYTLDSVERRAKYLILNFIPLADDGISSTVQPRNLQPRQLLVHLGMSGSL--QQHNHASDKRKHDHLIMSFIGADSTQTQLHYYDPRRFGSILWLEE--YGD-KLLNHLGPEPLSDAFTADYLYHLIQRSRQSIQTQNSKSIKKQPIKRAIKSVIMEQQAVVGVGNIYATESLYLSGIHPATPANEVSYAQIVILVAHIKTILQKAIKLGGSTLRDFTVADGQTGYFQQTLNVYGRQGNACPHCESTLENIKLNGRASVYCPLCQ 304
>gi|151571746|gb|EDN37400.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. novicida GA99-3548] (274 aa)
Score = 330, Expect = 5.4e-29, Identities = 87/275 (31%), Positives = 150/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   +++ I +IE    K+      +     I N+ +K+I R+GK+LI  + +D   ++HL M G  K+      +     H++V +  D+  + Y+D R+FG + +   +  L+ + +   G++PL  +F+  YL + +K+++R IK T++D   V G+GNIYA E LF S+I P   +N +T  +   +  + + IL KA+   GTT+  Y   + + G F + L V+ + D  C  C  KI  + +  R T+ C KCQK
  S:     1 MPELPEVETVKRGLIKT-IIDKKIFDIEINTDKLRYPIDKDQLVK-IKNKVVKEIQRRGKHLIIFIEDDLQLIIHLGMSGIIKVIDSTKYNKIKHDHIVVTLS-DNLFLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNDQQCYVCNTKIQSLVIAQRNTFFCKKCQK 274
>gi|123967891|ref|YP_001008749.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. AS9601] >gi|166198730|sp|A2BPD1|FPG_PROMS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|123198001|gb|ABM69642.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. AS9601] (292 aa)
Score = 330, Expect = 5.4e-29, Identities = 101/275 (36%), Positives = 149/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESI-MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT---------------NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E      +    + E+F   + N  I    R+GKYLI  L                N+   VVHLRM G   F + +SS   KH  V+  + ++ E+RY D R FG     N +  L+   K +  LG +P  ++F+  YLK  I K  ++IK  LLDQ  V+GIGNIYADE L+++ I P   A  +  N+  K+ E+   +L K++ + GTT + +   + + G F     V+ +   +C  C N I + K+ GR T+ C KCQK
  S:     1 MPELPEVETVRRGL-EQKLNNFIIKKVEICRYSTVAFPTNKEEFIKGLRNSLIYKWDRRGKYLIAQLKEVQNEHTQLPLENSQNNGFLVVHLRMTGYFKFIE-NSSNPCKHTRVRFFDKNNNELRYIDVRSFGQMWWINNDLSLNKIIKGLGSLGPEPFSKDFNANYLKKVISKRTKSIKAILLDQTIVAGIGNIYADESLYSAGISPFREARTIKKNELIKLKESIVTVLKKSIGSGGTTFSDFRDLEGENGNFGLQTNVYRRTGKECRKCGNLIERQKITGRSTHWCPKCQK 292
>gi|170724448|ref|YP_001758474.1| formamidopyrimidine-DNA glycosylase [Shewanella woodyi ATCC 51908] >gi|169809795|gb|ACA84379.1| formamidopyrimidine-DNA glycosylase [Shewanella woodyi ATCC 51908] (271 aa)
Score = 329, Expect = 5.6e-29, Identities = 90/276 (32%), Positives = 141/276 (51%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q V   L +Q     T+ N     P         D    I+ + I+ + R+ KYL+   T+    +VHL M G L    T+ +  +KH  + + +   +I R++D RRFG +  Y     +D+  +  KLG +PL + F+  YL  ++K   +AIK  L+D   V G+GNIYA+E LFA+ IHP+  A K+       +    + ILA A++  GTT+  +   + + G F + L V+ +    C  C N + +IK+  R T  C  CQ +
  S:     1 MPELPEVEVTRQGVSPYLIDQEVTGLTVRNASLRWP-------VPDLAQQIVGQTIRSVHRRAKYLLID-TDAGTTIVHLGMSGSLRV-VTELTPVEKHDHIDLSLASGKILRFNDPRRFGAWLWYELP--IDAHPLLSKLGPEPLTDAFNPSYLFESLKGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPQMEAGKVDQERLIILVSEVKQILANAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGRGGESCTQCGNLLSEIKLGQRATVFCGLCQTR 271
>gi|56707813|ref|YP_169709.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] >gi|89256827|ref|YP_514189.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica] >gi|110670284|ref|YP_666841.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis FSC198] >gi|115315213|ref|YP_763936.1| DNA-formamidopyrimidine glycosylase [Francisella tularensis subsp. holarctica OSU18] >gi|118497202|ref|YP_898252.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. novicida U112] >gi|134302414|ref|YP_001122384.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis WY96-3418] >gi|167009866|ref|ZP_02274797.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica FSC200] >gi|194323501|ref|ZP_03057278.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. novicida FTE] >gi|81677082|sp|Q5NGY3|FPG_FRATT Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56604305|emb|CAG45326.1| Formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] >gi|89144658|emb|CAJ79982.1| Formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica LVS] >gi|110320617|emb|CAL08709.1| Formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis FSC 198] >gi|115130112|gb|ABI83299.1| DNA-formamidopyrimidine glycosylase [Francisella tularensis subsp. holarctica OSU18] >gi|118423108|gb|ABK89498.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. novicida U112] >gi|134050191|gb|ABO47262.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134253918|gb|EBA53012.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica 257] >gi|151568552|gb|EDN34206.1| hypothetical protein FTBG_00064 [Francisella tularensis subsp. tularensis FSC033] >gi|157122670|gb|EDO66799.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica FSC022] >gi|194322356|gb|EDX19837.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. novicida FTE] (274 aa)
Score = 329, Expect = 5.7e-29, Identities = 86/275 (31%), Positives = 150/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   +++ I +IE    K+      +     I N+ +K+I R+GK+LI  + +D   ++HL M G  K+      +     H++V +  D+  + Y+D R+FG + +   +  L+ + +   G++PL  +F+  YL + +K+++R IK T++D   V G+GNIYA E LF S+I P   +N +T  +   +  + + IL KA+   GTT+  Y   + + G F + L V+ + +  C  C  KI  + +  R T+ C KCQK
  S:     1 MPELPEVETVKRGLIKT-IIDKKIFDIEINTDKLRYPIDKDQLVK-IKNKVVKEIQRRGKHLIIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLS-DNLSLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK 274
>gi|156502993|ref|YP_001429058.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|156253596|gb|ABU62102.1| formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. holarctica FTNF002-00] (274 aa)
Score = 329, Expect = 5.9e-29, Identities = 86/275 (31%), Positives = 150/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   +++ I +IE    K+      +     I N+ +K+I R+GK+LI  + +D   ++HL M G  K+      +     H++V +  D+  + Y+D R+FG + +   +  L+ + +   G++PL  +F+  YL + +K+++R IK T++D   V G+GNIYA E LF S+I P   +N +T  +   +  + + IL KA+   GTT+  Y   + + G F + L V+ + +  C  C  KI  + +  R T+ C KCQK
  S:     1 MPELPEVETVKRGLIKT-IIDKKIFDIEINTDKLRYPIDKDQLVK-IKNKVVKEIQRRGKHLIIFIKDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLS-DNLSLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLVSSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK 274
>gi|156743763|ref|YP_001433892.1| formamidopyrimidine-DNA glycosylase [Roseiflexus castenholzii DSM 13941] >gi|189044671|sp|A7NQM8|FPG_ROSCS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|156235091|gb|ABU59874.1| formamidopyrimidine-DNA glycosylase [Roseiflexus castenholzii DSM 13941] (283 aa)
Score = 329, Expect = 6.4e-29, Identities = 88/274 (32%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESI-MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKL----GLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEVQ   DSL  Q    R I  +E +   ++ +  S ++F   +   Q++   R+ K+++  L +     +HLRM G L     ++  DK  H+ +++E D  +I + D R+FG   +      LDS  +  L    G +PL + F  + L + ++   RAIK  LLDQ  ++GIGNIYADE L+ + IHP   A  L+  +   + +  R  L +A+ N G+T+  Y       G  Q+    + ++   C  C   I+K  V  RGT+ C  CQ
  S:     1 MPELPEVQHTADSLGIQIAGAR-IARVERLDWTRMVETPSPDEFIRLLTGRQVRGWDRRAKWILLFLDDGWTLALHLRMSGSLTVHPAEAQPDKHTHLALRLE-DGRQIFFLDPRKFGRARL------LDSAGLAALDAAHGDEPLSDAFTVERLASLLRNRKRAIKPLLLDQSVIAGIGNIYADEALWRARIHPLRPAADLSAAEVAALHDGIRAALRQALANGGSTLRDYRNSYGAGGTNQEHFNAYDREGRPCPRCGATIIKTVVAQRGTHYCPACQ 272
>gi|149180839|ref|ZP_01859341.1| hypothetical protein BSG1_00370 [Bacillus sp. SG-1] >gi|148851358|gb|EDL65506.1| hypothetical protein BSG1_00370 [Bacillus sp. SG-1] (270 aa)
Score = 329, Expect = 6.5e-29, Identities = 84/275 (30%), Positives = 152/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLD--SKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPE+++  + L E+  LN+ I+ +E    K   N   ++FTH + N  IK +TR+ K+L+FHL ND V ++HL + G +F+    S  +K    ++I +    +  Y    R G   +Y +   LD  +KE+  LG +P+   F  +   +   K   ++KTTL++Q  ++GIGN Y+DEI F ++I P    N+L+ ++ +++ ++ + IL  A+ + G      F      G +    +V+ ++   C+ C ++I+K K++ + T+ C  CQK
  S:     1 MPELPEMENYKNLLSER-ILNKQISEVEIGREKSI-NVPVDEFTHLVKNRTIKKVTRRAKHLLFHLDNDVVLLLHLMLGGWMFY---GSEQEKPDRTIQIRLSFGIQHLYFIGLRLGYLHLYKD---LDEAAKELDDLGPEPITPPFSVEQFLDLAGKRRGSLKTTLVNQRFLAGIGNCYSDEICFHAAIMPGRKFNELSQHETRQLFQSMQFILNDAIASGGYMEEPLFPGDNLTGGYNSKCRVYDREGEPCIRCGSQIIKDKISSKKTFYCGNCQK 270
>gi|119509416|ref|ZP_01628564.1| formamidopyrimidine-DNA glycosylase [Nodularia spumigena CCY9414] >gi|119465822|gb|EAW46711.1| formamidopyrimidine-DNA glycosylase [Nodularia spumigena CCY9414] (280 aa)
Score = 328, Expect = 7.4e-29, Identities = 90/274 (32%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT---NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++   L  Q  L++ IT  + ++ + I    S + FT  II   I    R+GKYL+  LT         VHLRM G+L +   +     KH  V++   D+ E+R+ D R FG          +++    + KL +DP   EF  +YL + ++   R IKT LLDQ  V+G+GNIYADE LF S I P T+   L     + +      +L  ++   GTT + +   +   G +     V+ +    C  C   I +IK+ GR ++ C +CQ
  S:     1 MPELPEVETIRRGLN-QLTLHQKITGGDVLLDRTIAYPLSVDKFTPKIIGSAIASWHRRGKYLLAELTPSPQTHWLGVHLRMTGQLLWVNQNEPL-HKHTRVRLFFGDEQELRFVDQRTFGQMWWVPPGVAVETIMTGLAKLAVDPFSPEFTVEYLASKLQNRRRPIKTALLDQSVVAGLGNIYADEALFKSGILPVTLCIDLQLEQIQSLHTTIIQVLETSIAAGGTTFSNFLNVQGVNGNYGGVAWVYNRSGEPCRVCSTPIQRIKLAGRSSHFCPQCQ 279
>gi|126695693|ref|YP_001090579.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. MIT 9301] >gi|166198727|sp|A3PB53|FPG_PROM0 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|126542736|gb|ABO16978.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. MIT 9301] (292 aa)
Score = 328, Expect = 8.3e-29, Identities = 98/275 (35%), Positives = 150/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS-YEDFTHYIINEQIKDITRKGKYLIFHLT---------------NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E          S  E+F   + N  I    R+GKYLI  L                N+   VVHLRM G   F + +S++  KH  ++  + ++ E+RY D R FG     N++  ++   K +  LG +P  ++F+  YLK  I K  ++IK  LLDQ  V+GIGNIYADE L+++ I P   A  +  N+  K+ ++  I+L K++ + GTT + +   + + G F     V+ +   +C  C N I + K+ GR T+ C  CQK
  S:     1 MPELPEVETVRRGL-EQKLNNFIIKKVEVCRDSTVAYPSNKEEFIKGLKNSLIYKWDRRGKYLIAQLKEVQNENTEFPLENSQNNGFLVVHLRMTGYFKFIE-NSTHPCKHTRIRFFDKNNNELRYVDVRSFGQMWWINKDLSINKVIKGLGSLGPEPFSKDFNANYLKEAISKRTKSIKAILLDQTIVAGIGNIYADESLYSAGISPFREARTIKKNELIKLKKSIVIVLKKSIGSGGTTFSDFRDLEGENGNFGLQTNVYRRTGRECRKCGNLIERQKITGRSTHWCPNCQK 292
>gi|187932021|ref|YP_001892006.1| Formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712930|gb|ACD31227.1| Formamidopyrimidine-DNA glycosylase [Francisella tularensis subsp. mediasiatica FSC147] (274 aa)
Score = 328, Expect = 8.4e-29, Identities = 86/275 (31%), Positives = 150/275 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG--KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   +++ I +IE    K+      +     I N+ +K+I R+GK+LI  + +D   ++HL M G  K+      +     H++V +  D+  + Y+D R+FG + +   +  L+ + +   G++PL  +F+  YL + +K+++R IK T++D   V G+GNIYA E LF S+I P   +N +T  +   +  + + IL KA+   GTT+  Y   + + G F + L V+ + +  C  C  KI  + +  R T+ C KCQK
  S:     1 MPELPEVETVKRGLIKT-IIDKKIFDIEINTDKLRYPIDKDQLVK-IKNKVVKEIQRRGKHLIIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLS-DNLSLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLISSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK 274
>gi|114778708|ref|ZP_01453520.1| Formamidopyrimidine-DNA glycolase [Mariprofundus ferrooxydans PV-1] >gi|114551070|gb|EAU53632.1| Formamidopyrimidine-DNA glycolase [Mariprofundus ferrooxydans PV-1] (271 aa)
Score = 327, Expect = 1.0e-28, Identities = 83/274 (30%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V   L E   + R I  +    P +       D    +   +I  + R+ KYL+  +++ +V V HL M G+     ++ S  K H  V+I++DD   +RY D RRFG   +   +   +      LG +PL + F+  YL    +     IKT ++D   V G+GNIYA E LF + IHP   A ++       +A + R +L +A+   G+TI+ +     + G F    +V+ +K   C+ C   I +I+ +GR ++ C++CQ
  S:     1 MPELPEVEVVRTGL-EPCLIGRRILTVTCHRPSL--RYPLPDMGS-LSGSRIVAVRRRSKYLLIEVSDGRVLVWHLGMTGQFHVLGSEVSAGK-HEHVRIDLDDGTSLRYRDARRFGYAGLLAADQLAEHPWFATLGPEPLGDAFNGAYLAELCRGRKAPIKTVIMDAHVVVGVGNIYAAESLFRAGIHPGRAAGRIAGARLDLLASSIRDVLREAISAGGSTISDFVRADGRPGYFAHAFQVYGRKGQPCLVCGEGIRRIQQSGRSSFYCIRCQ 270
>gi|148652194|ref|YP_001279287.1| formamidopyrimidine-DNA glycosylase [Psychrobacter sp. PRwf-1] >gi|148571278|gb|ABQ93337.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Psychrobacter sp. PRwf-1] (307 aa)
Score = 327, Expect = 1.2e-28, Identities = 89/274 (32%), Positives = 148/274 (54%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIF--------------HLTNDKVFVVHLRMEGKLFFEKTDSSYDKK---HVLVKIEMDD----YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNI-----------------KKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++   SLK    L + +  ++   PK+       D  H +    ++ + R+ KYLI               ++ + K  ++HL M G L  ++     DK+   H++++ + DD     ++ YHD RRFG    +++      K    LG++PL+++F   YL + I                 K  +R IK  ++DQE V G+GNIYA E LF S IHP T A++L+     ++ +  + IL +++   G+T+  +       G FQ+ L V+ K    C  C   I K+ + GR +  C  CQ
  S:     1 MPELPEVETTKTSLKP--LLKKQVAQVDVYQPKL--RWPVPDDIHRLQGYTLQQVERRAKYLILQFQRLPSQSGAKTANMPDTKSIIIHLGMSGSL--QQFPVGTDKRKHDHLIMQYKADDTKPAIQLHYHDPRRFGAILWFDD---YAEKLFDHLGIEPLDDQFSGDYLFDKIHRVAENAIRSCHNKPLLKPISRPIKAVIMDQEVVVGVGNIYATESLFLSGIHPITPADQLSKVQLAELVKYIKEILKRSITQGGSTLKDFTVASGTTGYFQQTLLVYGKYKSPCPTCGAGIDKVVITGRASTFCPTCQ 303
>gi|119492791|ref|ZP_01623877.1| formamidopyrimidine-DNA glycosylase [Lyngbya sp. PCC 8106] >gi|119452944|gb|EAW34116.1| formamidopyrimidine-DNA glycosylase [Lyngbya sp. PCC 8106] (301 aa)
Score = 326, Expect = 1.4e-28, Identities = 93/275 (33%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLI------FHLTNDKV---------------FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L  Q   N+TI   E ++ +   +  S ++F   +  + I    R+GKYL+      F+  +D                   VHLRM G+L +   D     KH  V++   +  E+R+ D R FG       N  +      ++KLG +P  EEF  KYL     +  R IKT LLDQ+ V+G+GNIYADE LF S I P T   +LT    + +      +L  A++  GTT+  +       G +     V+ +    C  C+  I ++K+ GR  + C +CQK
  S:     1 MPELPEVETVKRGLN-QVSRNQTIQGGEVLLKRTLAHPVSIDEFITGLSGQAIAGWYRRGKYLLAEFSTQFNPNSDDSQNLEFSDLQTFSNGGLAVHLRMTGQLLWVSQDEPL-SKHTRVRLFFPNRQELRFVDQRTFGQMWGIPPNVEVSKIVTGLQKLGHEPFSEEFSIKYLTTQFYRRQRPIKTALLDQKLVAGVGNIYADETLFLSGISPTTRCAELTPAQIETLHAQLVQVLKTAIDAGGTTVRNFLNVAGVNGNYAGQAWVYNRAGQPCRVCQTPIERLKLAGRSAHFCPRCQK 298
>gi|119475393|ref|ZP_01615746.1| formamidopyrimidine-DNA glycosylase [marine gamma proteobacterium HTCC2143] >gi|119451596|gb|EAW32829.1| formamidopyrimidine-DNA glycosylase [marine gamma proteobacterium HTCC2143] (282 aa)
Score = 326, Expect = 1.4e-28, Identities = 82/275 (29%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +    QG   R +  +    PK+ +       +  I N +I  + R+ KYL+  L N  + ++HL M G L   + ++      HV   ++ D   +R+ D RRFG       +  + S  +  LG +PL  +FD   L    +     +KT L+D +NV G+GNIYA+E LFA+ I P   + +++   ++ +A+  + +LA+A+E  GTT+  +     + G F++ LKV+ +    CV C   +++I++  R T  C  CQ+
  S:    12 MPELPEVETTRRGISPYVQG---RIVKQLVVRQPKL-RWLIPPQLSSLIKNRKILSVERRAKYLLLRLDNGSI-IIHLGMSGSLRIIDASEPPMAHDHVDFVLD-DGVAMRFTDPRRFGCVLWQGASEPIHSL-LASLGPEPLSLDFDGDLLYQRSRGRKAPVKTFLMDNKNVVGVGNIYANEALFAAGIKPNRASGRISRQRYQVLADQVKKVLAQAIEQGGTTLRDFVGGDGKPGYFKQALKVYGRGGKPCVICDQHLIEIRLGQRSTVYCRHCQR 282
>gi|194539498|ref|YP_002074548.1| formamidopyrimidine-DNA glycosylase [Vibrio sp. Ex25] >gi|151938053|gb|EDN56896.1| formamidopyrimidine-DNA glycosylase [Vibrio sp. Ex25] (269 aa)
Score = 325, Expect = 1.7e-28, Identities = 87/275 (31%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     + +TI +     PK+  +   E     +  + I+ I+R+ KYL+   TN    +VHL M G L     D     KH  V +++   +I RY+D RRFG +             +  +G +PL EEF+ +Y+    K    A+K  ++D + V G+GNIYA+E LF S IHP   A KLT  ++  + EN ++ L  A+   GTT+  +     + G F + L V+ K    C  C  ++ ++K+  R T+ C +CQK
  S:     1 MPELPEVEVSRMGISPH-MVGQTIQSFTFRTPKLRWDIPIE--LKKLEGQVIRAISRRAKYLLIE-TNTGTAIVHLGMSGSLRVLDADFP-PAKHDHVDLKLSSGKILRYNDPRRFGAWLWCAPGE--SHAVLANMGPEPLTEEFNAEYVAEKAKNKRVAVKQFIMDNKVVVGVGNIYANESLFKSRIHPSRPAGKLTSQEWGGLVENIKMTLEIAITQGGTTLKDFAQADGKPGYFAQELLVYGKAGEPCPECGERLQELKIGQRNTFFCSECQK 269
>gi|57233872|ref|YP_182098.1| formamidopyrimidine-DNA glycosylase [Dehalococcoides ethenogenes 195] >gi|57224320|gb|AAW39377.1| formamidopyrimidine-DNA glycosylase [Dehalococcoides ethenogenes 195] (270 aa)
Score = 325, Expect = 1.7e-28, Identities = 83/274 (30%), Positives = 141/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V + +     L + IT +E++  K    C  E +F   +   Q+  ++R+GKY+I  L+      VHL+M G L   K ++    +       +++ E + + D R+FG   +      LD+  ++KLG +PLE +F  + L   +      IK  LLDQ+ ++G+GN+YADE LF + ++P   A+ L+  +  K+    + +L KA++NKG +++TY      KG  Q    V  ++   C  C   I +  +  R  Y C  CQ
  S:     1 MPELPEVETVKNEIMPH-LLGKKITRMEALWAKTL--CPPETEFNKLVSGLQVTGLSRRGKYIIISLSGGLFISVHLKMSGGLTAVKAETEQFPRFTRAVFHLENGEQVYFTDIRKFGRINLLTS---LDTI-LEKLGPEPLEGDFTPEVLGKRLSGRKGPIKAVLLDQKVLAGVGNMYADEALFKACLNPLRPADSLSKAEVTKLHSAIQSVLHKAIQNKGASVSTYHRPDGSKGGAQLEFNVAHRRGEVCPECGAPINRQLIRQRACYYCPHCQ 269
>gi|124025133|ref|YP_001014249.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. NATL1A] >gi|166198728|sp|A2C0H4|FPG_PROM1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|123960201|gb|ABM74984.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. NATL1A] (282 aa)
Score = 325, Expect = 1.8e-28, Identities = 96/275 (34%), Positives = 147/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVF-----VVHLRMEGKL-FFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E+   +  I  IE +  + I  N   + F   + N  + +  R+GKYLI  L   + F     VVHLRM G+    EK       KH  V+  E    E+R+ D R FG       +  +      IK+LG +P  ++F+  YL+  +KK  R+IK+ LLDQ  V+G+GNIYADE LF + I+P+T +  L  N+ K++  +   IL  ++   GTT + +   +   G +     V+ +   +C  C  KI++ K+ GR T+ C  CQK
  S:     1 MPELPEVETVRKGL-EKLLNDFYIERIEVLKERSIASNGGSKSFIDNVKNSYLGNWERRGKYLIGSLLTKEKFSKGFLVVHLRMTGQFKLLEK--EVLACKHTRVRFFEERGRELRFIDIRNFGQMWHVPSSRSVPEIVSGIKRLGPEPFSDDFNSHYLEEYLKKKTRSIKSALLDQRTVAGVGNIYADETLFDAGINPKTESRNLKSNELKRLCNSLIKILNISIGEGGTTFSDFRDLEGGNGNYGGQALVYRRSGKNCKKCGEKILREKICGRSTHWCPNCQK 282
>gi|183597227|ref|ZP_02958720.1| hypothetical protein PROSTU_00470 [Providencia stuartii ATCC 25827] >gi|188023541|gb|EDU61581.1| hypothetical protein PROSTU_00470 [Providencia stuartii ATCC 25827] (269 aa)
Score = 325, Expect = 2.1e-28, Identities = 91/275 (33%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDIT--------RKGKYLIFHLTNDKVFVVHLRMEGKL---FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++       +G     + N  +I   I +N        + ++EQIK ++        R+ KYL+  L N  + ++HL M G L     E  +  +D   +++K   D   +RY D RRFG +   ++     S+ +  LG +PL +EF+ +YL     K   AIK  L+D + V G+GNIYA+E LFA+ I PE I + LT      + +  + +L +++E  GTT+  +     + G F + L V+ KK   C+ C   I+ IK   R T+ C +CQK
  S:     1 MPELPEVET-----SRRGIEPHLVGN--TICYAIVRNSRLR----WPVSEQIKSLSDEMILSVQRRAKYLLIELKNGWI-IIHLGMSGSLRILLEELPEEKHDHVDLVLK---DGKVLRYTDPRRFGAWLWCDDLE--TSRVLSHLGPEPLSDEFNAQYLFEQAGKRKIAIKPWLMDNKVVVGVGNIYANEALFAAGISPEKITHTLTLEQSIDLVQQIKKVLQRSIEQGGTTLKDFLQSDGKPGYFAQELFVYGKKGEPCLICGTPILSIKQGQRSTFYCPQCQK 269
>gi|88658566|ref|YP_507413.1| formamidopyrimidine-DNA glycosylase [Ehrlichia chaffeensis str. Arkansas] >gi|88600023|gb|ABD45492.1| formamidopyrimidine-DNA glycosylase [Ehrlichia chaffeensis str. Arkansas] (270 aa)
Score = 324, Expect = 2.3e-28, Identities = 88/274 (32%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V  +L  Q  L +TI +IE +     +    ++     +N  +  + RKGKY++  L+N    V+HL M G L + ++     K  HV+     ++  I ++D RRFG   +   + Y++    K  G+D L +EF+  YL N   K    IK+ L++ + V+GIGNIY+ E LF + I P      L+  +   I +  + IL  ++EN G++I  Y      +G FQ    V+ +    C  C + I+ IK NGR T+ C  CQ
  S:     1 MPELPEVEIVCRALSSQ-ILGKTILDIE-VNRYDLRVPVTQNLCDIAVNSSVFQVLRKGKYIVLVLSNQYYLVIHLGMSGNLIYSESYIKQKKHNHVIFHFSNNNLLI-FNDPRRFGIVILLTYSQYIEF--FKNFGVDALSDEFNTNYLYNTSNKRC-TIKSLLMNNKFVTGIGNIYSTESLFLAGIAPNRFVKDLSIIECNNIIDGVKNILLYSIENGGSSIKDYTSPFGIRGTFQNHFLVYNRTRQQCYKCNSSILVIKQNGRSTFFCPYCQ 269
>gi|127514618|ref|YP_001095815.1| formamidopyrimidine-DNA glycosylase [Shewanella loihica PV-4] >gi|166198750|sp|A3QJA8|FPG_SHELP Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|126639913|gb|ABO25556.1| formamidopyrimidine-DNA glycosylase [Shewanella loihica PV-4] (271 aa)
Score = 324, Expect = 2.6e-28, Identities = 85/276 (30%), Positives = 139/276 (50%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L +Q     T+ N     P         +    I+ + I+ I R+ KYL+   T+    +VHL M G L      +  +K H  + +E+   ++ R++D RRFG + ++ E        + KLG +PL+  F+  YL   ++   +A+K  L+D   V G+GNIYA+E LFA+ IHP+T A ++       +    + ILA+A++  GTT+  +     + G F + L V+ +    C  C N + +IK+  R T  C  CQ +
  S:     1 MPELPEVEVTRQGISPHLLDQQVTGLTVRNASLRWP-------VPEVAQQIVGQTIRGIRRRAKYLLLD-TDAGTTIVHLGMSGSLRILPKSTPVEK-HDHIDLELASGKVLRFNDPRRFGAW-LWCELPEAAHPLLAKLGPEPLQSGFNVDYLAKALEGKKKAVKLCLMDNHIVVGVGNIYANEALFAAGIHPQTEAGRIDRERLTVLVAEVKQILAQAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTQCGNLLSEIKLGQRATVFCGLCQPR 271
>gi|124548567|ref|ZP_01707187.1| formamidopyrimidine-DNA glycosylase [Shewanella putrefaciens 200] >gi|146294967|ref|YP_001185391.1| formamidopyrimidine-DNA glycosylase [Shewanella putrefaciens CN-32] >gi|124508380|gb|EAY52477.1| formamidopyrimidine-DNA glycosylase [Shewanella putrefaciens 200] >gi|145566657|gb|ABP77592.1| formamidopyrimidine-DNA glycosylase [Shewanella putrefaciens CN-32] (271 aa)
Score = 323, Expect = 2.8e-28, Identities = 86/276 (31%), Positives = 136/276 (49%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L EQ   +  I N     P         D   +II + I+ + R+ KYL+   T+    +VHL M G L     ++  +K   +  +  +   +R++D RRFG + ++ E        + KLG +PL   F+   L   +    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+ +     +    + ILA A++  GTT+  +   + + G F + L V+ +    C NC N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGIAPFLIEQTVSDLVIRNGSLRWP-------VPDIAKHIIGQTIRQVRRRAKYLLID-TDAGTTIVHLGMSGSLRILPHNTPVEKHDHIDLVLANGRILRFNDPRRFGAW-LWCELPEEAHPLLAKLGPEPLTNAFNVNQLATALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDNERLSLLVAEVKQILAHAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGRGGETCTNCGNLLSEIRLGQRTTVFCSICQTR 271
>gi|167622081|ref|YP_001672375.1| formamidopyrimidine-DNA glycosylase [Shewanella halifaxensis HAW-EB4] >gi|189044677|sp|B0TN04|FPG_SHEHH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|167352103|gb|ABZ74716.1| formamidopyrimidine-DNA glycosylase [Shewanella halifaxensis HAW-EB4] (271 aa)
Score = 323, Expect = 2.9e-28, Identities = 86/275 (31%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +  QG     I N   +   I +N S      +    II + I+++ R+GKYL+   T+    +VHL M G L      +  +K   +  +      +R++D RRFG + ++ E        + KLG +PL + F+  YL   +    +AIK  L+D   V G+GNIYA+E LFA+ IHP+  A K+     + +    + ILA A++  GTT+  +     + G F + L V+ +    C  C + + +IK+  R T  C  CQK
  S:     1 MPELPEVE-----VTRQGVSPYLIDN--QVTDLIVRNPSLRWPVPEIAKQIIGQTIRNVRRRGKYLLID-TDAGTTIVHLGMSGSLRILPASTPVEKHDHIDLVLASGKALRFNDPRRFGAW-LWCELPEQAHPLLSKLGPEPLTDAFNAPYLLAALANKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPQAEAGKVDAERIEILVSEVKQILASAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTQCGHLLSEIKLGQRATVFCSLCQK 270
>gi|58698441|ref|ZP_00373350.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535033|gb|EAL59123.1| formamidopyrimidine-DNA glycosylase [Wolbachia endosymbiont of Drosophila ananassae] (265 aa)
Score = 323, Expect = 3.1e-28, Identities = 78/223 (34%), Positives = 118/223 (52%)
  Q:    52 IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           I++I R+GKY I++       ++HL M GKL + + D + +K   +V +  D+  I ++D RRFG   + N   E N+ D       G++PL +EF   YL+  +K     IK+ L+D + + G+GNIYA E LF + I P   A  LT  +++K+A   +  L+ A+   G+T+  Y       G FQ    V+ K    C  C N I  I+ NGR TY C  CQ
  S:    44 IRNIKRRGKYTIWNTDGSMAVIIHLGMSGKLIYAEHDQAQNKHDHVVFLFSDNTSIIFNDPRRFGLVIVLNKEQEINFFDD-----FGIEPLTDEFSGDYLQELLKNKKANIKSALMDNKLIVGVGNIYASESLFRARISPLRPAKNLTYREYEKLAAEIKNTLSDAIAAGGSTLKDYAQPSGSAGYFQNNFYVYGKVQKPCKICNNIITLIRQNGRSTYFCNACQ 264
>gi|156936197|ref|YP_001440113.1| formamidopyrimidine-DNA glycosylase [Enterobacter sakazakii ATCC BAA-894] >gi|166215624|sp|A7MQ97|FPG_ENTS8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|156534451|gb|ABU79277.1| hypothetical protein ESA_04096 [Enterobacter sakazakii ATCC BAA-894] (269 aa)
Score = 322, Expect = 3.6e-28, Identities = 87/275 (31%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++       +G     +   E+I+  + +N        D  H + ++ I  + R+ KYL+  L  D   ++HL M G L     +   +K H  V + M + ++ RY D RRFG +    E   L+   +   LG +PL + F+  YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L++ + + +A+  + +L +++E  GTT+  +     + G F + L+V+ ++   C  C   I+  K   R TY C +CQK
  S:     1 MPELPEVET-----SRRGIEPHLVG--ETILHAVVRNGRLRWPVSDEIHALSDKPILSVQRRAKYLLLELP-DGWIIIHLGMSGSLRILPEERPAEK-HDHVDLVMSNGKVLRYTDPRRFGAWLWTRE---LEGHNVLAHLGPEPLSDAFNGAYLREKCAKKKVAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSEKECELLAQAIKAVLLRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGREGEPCRVCGTPILAGKHAQRRTYWCRRCQK 269
>gi|116625750|ref|YP_827906.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Solibacter usitatus Ellin6076] >gi|122252077|sp|Q01RU9|FPG_SOLUE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|116228912|gb|ABJ87621.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Solibacter usitatus Ellin6076] (264 aa)
Score = 322, Expect = 3.7e-28, Identities = 80/276 (28%), Positives = 141/276 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V+ SL     + R I   E    +I +    +  +  +   +I  I R GK+++  +      ++HL M GKL           KH    +  D   + + D+R+FG    Y+E      K + +LG +P+E  F+      ++K+    IK+ LL+Q  + G+GNIYADE LF + IHP+ + +++     +K+ +    +L +A+E  G++I+ Y   + + G FQ   +V+ +    C+NCK  I ++ V  R ++ C  CQK+
  S:     1 MPELPEVETVVRSLAP--LVGRRIATAEFRNLRILRGGDPDLMSARLAGRKILSIKRYGKFIVAVIEGGGHLMIHLGMTGKLLLGGPSG----KHTHAVLTFDRGTLLFDDSRQFGCIE-YSEEF---PKRVARLGPEPMEISFE--DFAADLKRRKTRIKSLLLNQTFIRGVGNIYADEALFRAGIHPQALTSRIRIERARKLYDAIGEVLTEAIEAGGSSISDYVDAEGRSGFFQFSHRVYQRTGEPCLNCKTPIRRVIVTQRSSHFCPHCQKR 264
>gi|119943846|ref|YP_941526.1| formamidopyrimidine-DNA glycosylase [Psychromonas ingrahamii 37] >gi|166198736|sp|A1SR12|FPG_PSYIN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|119862450|gb|ABM01927.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Psychromonas ingrahamii 37] (270 aa)
Score = 322, Expect = 4.3e-28, Identities = 82/274 (29%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +     +N+++ N+     ++      +D    I ++ +  I R+ KYL+F+ T+    ++HL M G L     +S   KKH    +   D  +RY D RRFG   ++      DS  + KLG +PL ++F+ KYL     K    +K  ++DQ+ V+G+GNIYA E LF S I P   A  +++  ++ +    + IL +A++  GTT+  +     + G FQ+ L+V+ K    C +C+  +  +K+  R +  C +CQ
  S:     1 MPELPEVETSRKGISPH-LINKSVQNVVLRHTQLRWKIP-QDLLSDIKDKILLSIDRRAKYLLFNFTSG-TLLIHLGMSGSLRICPLNSP-PKKHDHADLIFADCLLRYTDPRRFGAI-LWLGLTPEDSPLLNKLGPEPLNDDFNAKYLYQQATKRKLPVKQFIMDQKVVTGVGNIYATEALFNSGISPIRAAGNISEKRYQILVTEIKEILQQAIKQGGTTLKDFVGSDGKPGYFQQTLQVYGKTGQQCPSCETPLKAVKLAARASVYCPECQ 269
>gi|116072678|ref|ZP_01469944.1| Formamidopyrimidine-DNA glycolase [Synechococcus sp. BL107] >gi|116064565|gb|EAU70325.1| Formamidopyrimidine-DNA glycolase [Synechococcus sp. BL107] (278 aa)
Score = 321, Expect = 5.1e-28, Identities = 92/275 (33%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT-NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L ++   +  I  IE    + I      E F   +    +   +R+GKYL+  L  N   + VHLRM G+  +  T ++    H  V+    ++ E+R+ D R FG      E N LDS    +K+LG +P  + F   YLK  +K S R IKT LLDQ  V+G+GNIYADE LFA+ I P + + KLT     ++ +    +L  ++   GTT + +   +   G +     V+ +    C  C   I++ K++GR T+ C  CQ+
  S:     1 MPELPEVETVRRGLADR-LESFEIAEIEVCRARAIASPGGVERFVAGLKGAMVGAWSRRGKYLMAQLEPNRGSWGVHLRMTGQFQWHATPAA-PCSHTRVRFWNQNNEELRFVDLRSFGEMWWIPEGNDLDSVMTGLKRLGPEPFSDAFTGAYLKQRLKGSARPIKTALLDQSLVAGVGNIYADESLFAAGIPPLSPSGKLTIEQLVRLRDELVNVLHISIGVGGTTFSDFRDLEGVNGNYGGQSWVYRRSGQPCRKCGTPIIREKLSGRSTHWCPSCQR 278
>gi|33860886|ref|NP_892447.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|39931224|sp|Q7V2X4|FPG_PROMP Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|33633828|emb|CAE18787.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (292 aa)
Score = 321, Expect = 5.4e-28, Identities = 99/275 (36%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHL------TNDK---------VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNE----NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E      +       DF   + N  +    R+GKYLI  L       ND          V VVHLRM G   F  T ++  K   +   + ++ E+RY D R FG      +    NN +  K +  LG +P  E F+  YLK  I    R+IK+ LLDQ  ++GIGNIYADE L+++ I P   A  +  N+ K++      +L K++   GTT + +   + + G F     V+ +    C  CKN I + K++GR T+ C KCQK
  S:     1 MPELPEVETVRRGL-EQKLKNFIIKRVEICRESTVAYPIDKIDFIEGLQNSLLYKWNRRGKYLIAELKKTVSNNNDANEISFVENGVLVVHLRMTGYFTFNNTLTNPCKHTRIRLFDNNNNELRYIDVRSFGQMWWVRDGLSPNNII--KGLGTLGPEPFSESFNVNYLKKVISNKTRSIKSILLDQTIIAGIGNIYADESLYSAGISPFREARTINKNEIKRLRRAVVDVLKKSIGAGGTTFSDFRDLEGENGNFGLQTNVYRRTGKKCRQCKNLIERQKISGRSTHWCRKCQK 292
>gi|29829206|ref|NP_823840.1| formamidopyrimidine-DNA glycosylase [Streptomyces avermitilis MA-4680] >gi|39931257|sp|Q82JU0|FPG_STRAW Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|29606312|dbj|BAC70375.1| putative formamidopyrimidine-DNA glycosylase [Streptomyces avermitilis MA-4680] (286 aa)
Score = 321, Expect = 6.0e-28, Identities = 80/275 (29%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK--NCSYEDFTHYIINEQIKDITRKGKYLIFHL-TNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD---YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L E+   +RT+ ++E + P+  +      EDF H +   ++   +R+GKYL   L T D   + HL M G+L  +  D + D++H+ +++   D    E+R+ D R FG  ++++         I  +  DPL+  FD       +++    +K  LLDQ  +SG+GNIYADE L+ + IH E      T     ++  + R ++  A+   GT+  + +     + G F + L  + ++   C  C   + +     R +Y C KCQ+
  S:     1 MPELPEVEVVRRGL-ERWVAHRTVADVEVLHPRAVRRHTAGGEDFAHRLKGRRVGVPSRRGKYLWLPLETTDTAVLAHLGMSGQLLVQPHDCA-DERHLRIRVRFADALGTELRFVDQRTFGGLSLHDTTPDGLPDVIAHIARDPLDPLFDDAAFHEALRRKRTTVKRALLDQSLISGVGNIYADEALWRARIHYERPTAGFTRPRTAELLGHVRDVMNAALAVGGTSFDSLYVNVNGESGYFDRSLDAYGREGLPCRRCATPMRRRPWMNRSSYFCPKCQR 280
>gi|56459356|ref|YP_154637.1| formamidopyrimidine DNA glycosylase [Idiomarina loihiensis L2TR] >gi|81678420|sp|Q5QZC1|FPG_IDILO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56178366|gb|AAV81088.1| Formamidopyrimidine DNA glycosylase [Idiomarina loihiensis L2TR] (270 aa)
Score = 320, Expect = 6.6e-28, Identities = 79/275 (28%), Positives = 152/275 (55%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +       RTI +++    ++       +  H +    ++ ++R+ KYL+   T++   ++HL M GKL     ++++  KH  + IE D+ + +R +D RRFG   +Y+E++    + + +LG +PL + F+  YL    +  ++++KT L+D + V G+GNIYA+E LF + I+P+  A K++   ++K+    +  LA A+E  GTT+  +       G F + L+V+ +    C+ C N++ ++++  R T  C +CQ+
  S:     1 MPELPEVEVSRLGISPH-IEGRTIKSVKVHDKRL--RWPVPETVHKVEGHVLRSVSRRSKYLLLQ-TDNGCLILHLGMSGKLRVVPAETTH-YKHDHIDIEFDNGQTLRLNDPRRFGAL-LYSESDVSGHELLSQLGPEPLTDAFNIDYLFERSRGRSQSVKTFLMDNKVVVGVGNIYANEALFKAGINPKRAAGKISKVRYQKLVPIIKETLASAIELGGTTLKDFTQVDGNPGYFAQKLQVYGRGGKLCMVCSNRLKEVRLGQRSTVYCTQCQR 270
>gi|88801019|ref|ZP_01116568.1| formamidopyrimidine-DNA glycosylase [Reinekea sp. MED297] >gi|88776222|gb|EAR07448.1| formamidopyrimidine-DNA glycosylase [Reinekea sp. MED297] (282 aa)
Score = 320, Expect = 6.6e-28, Identities = 86/270 (31%), Positives = 143/270 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIE--------SIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLC 270
           +PELPEV++    + E    NRTI+ +          I P++      +D+T    ++++  ++R+ KY++  L      +VHL M G L     D +   KH  V +E+D+   +RY+D RRFG + +Y E      + I  LG +PL ++F   YL    +K    IK+ ++D   V G+GNIYA+E LF S I+P  +A K+T  + +++  N + +LA A+   GTT+  +     + G F + L V+ +    C  C   I +++ N R T  C
  S:     1 MPELPEVETTCRGI-EPHLNNRTISRVTVRDARLRWPIPPEL------DDWTR---DQRVLGVSRRSKYILIQLERG-TLIVHLGMSGSLRVLLDDPT-PGKHDHVDVELDNGVRLRYNDPRRFGAW-LYTEAPLEQHELIAHLGPEPLTDDFSVDYLWAMSRKRKTKIKSFIMDARIVVGVGNIYANEALFLSGIYPHKLAGKITRAECERLVANIKQVLALAINQGGTTLRDFVGGDGKPGYFAQSLNVYGRSGELCRQCGTVIRELRTNNRSTCFC 266
>gi|59801038|ref|YP_207750.1| formamidopyrimidine-DNA glycosylase [Neisseria gonorrhoeae FA 1090] >gi|75507393|sp|Q5F8Z9|FPG_NEIG1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|59717933|gb|AAW89338.1| formamidopyrimidine-DNA glycosylase [Neisseria gonorrhoeae FA 1090] (275 aa)
Score = 320, Expect = 6.7e-28, Identities = 87/275 (31%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYE---DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +    +G        +E+++ +  K   ++   D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E + L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C+ C   +VK  +  RGT+ C  CQK
  S:     1 MPELPEVETTLRGIAPHIEG------KTVEAVILRQLK-LRWQINPDLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEERHPL----LEKLGPEPLSEAFCTDYLYAGLKAQKRAVKLALMDNTVVVGVGNIYANESLFRAGISPHRPANRLKKKECAVLVETVKAVLQRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCLRCGGLVVKETLGQRGTFYCTNCQK 275
>gi|114769647|ref|ZP_01447257.1| formamidopyrimidine-DNA glycosylase [alpha proteobacterium HTCC2255] >gi|114549352|gb|EAU52234.1| formamidopyrimidine-DNA glycosylase [alpha proteobacterium HTCC2255] (289 aa)
Score = 320, Expect = 6.9e-28, Identities = 88/275 (32%), Positives = 146/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-----EKTD--------SSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDC--VNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V+  L E   + + I   +   P + +    E+ +  +I  +I  + R+ KY++  L + +  ++HL M G++       E  D         S   KH  V ++M     I ++D RRFG   + +  N  D K IK LG +PL  EF+  YL + +K     IK+ LLDQ  VSG+GNIY  E L+ + I+P+ ++ K++      +    R +L +A+   G+++  +       G FQ    V+ ++   C  VNC   I +I  +GR ++ C KCQK
  S:     1 MPELPEVETVMRGL-EPVMMGQKIRYADIRRPDL-RWPFPENMSQRLIGAKIVRLHRRSKYILCDLDSGETLLIHLGMSGRMTISHAGNESEDLLGNFQYKPSIPAKHDHVILDMQGGARISFNDARRFGAMDLIDTKNLFDHKLIKSLGPEPLGNEFNTPYLYSKLKGKAAPIKSALLDQRIVSGLGNIYVCESLWRAGINPKRLSGKVSRKKIDVLVPFIRDVLREAISAGGSSLRDHRQANGDLGYFQHSFAVYGREGKKCNSVNCSELIKRIIQSGRSSFYCSKCQK 289
>gi|157963915|ref|YP_001503949.1| formamidopyrimidine-DNA glycosylase [Shewanella pealeana ATCC 700345] >gi|189044678|sp|A8HA27|FPG_SHEPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157848915|gb|ABV89414.1| formamidopyrimidine-DNA glycosylase [Shewanella pealeana ATCC 700345] (271 aa)
Score = 320, Expect = 7.3e-28, Identities = 84/276 (30%), Positives = 139/276 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +  QG     I N  ++   I +N S      +    II + I+++ R+ KYL+   T+    +VHL M G L      +  +K   +  +      +R++D RRFG + ++ E        + KLG +PL + F+  YL  ++    +AIK  L+D   V G+GNIYA+E LFA+ IHP+  A K+     + +    + ILA A++  GTT+  +     + G F + L V+ +    C  C + + +IK+  R T  C  CQ++
  S:     1 MPELPEVE-----VTRQGVSPYLIDN--TVTDLIVRNPSLRWPVPEIAKQIIGQTIRNVRRRAKYLLID-TDAGTTIVHLGMSGSLRILPATTPAEKHDHIDLVLASGKALRFNDPRRFGAW-LWCELPEQAHPLLSKLGPEPLTDAFNAPYLLESLANKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPQAEAGKVDAERIEILVSEVKQILAGAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGKTCTQCGHMLSEIKLGQRATVFCSLCQQR 271
>gi|163840518|ref|YP_001624923.1| formamidopyrimidine-DNA glycosylase [Renibacterium salmoninarum ATCC 33209] >gi|162953994|gb|ABY23509.1| formamidopyrimidine-DNA glycosylase [Renibacterium salmoninarum ATCC 33209] (308 aa)
Score = 320, Expect = 7.8e-28, Identities = 90/276 (32%), Positives = 148/276 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHL-------TNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM---DDY--EIRYHDTRRFGTFTI-------------YNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNK-----IVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+ V   L++   + RTI N++ + P+  +      EDF   +   +I  ++R+GK+L   L             V HL M G++  +  + + D+KH+ V+I+    DD   E+R+ D R FG   +               ++    + E   +  DPL+  F      N +K S   IK  LLDQ  +SG+GNIYADE L+ASS+H  T A +L+     ++  N R ++  ++   GTT  + +       G F++ L V+ +++  C  C++      I +     R +YLC  CQ K
  S:     1 MPELPEVEVVRRGLQKL-VVGRTIENVQVLDPRSIRRHLLGVEDFRAQLAGNRIGSVSRRGKFLWLSLFYPADGHATGTALVTHLGMSGQMLMQDPEHA-DEKHLKVRIDFGPDDDLAKELRFVDQRIFGGMFVSELVPTADGLPGGLGDDQPWIAAEAAHIAKDPLDPNFSLSDFANLLKGSKIGIKRVLLDQARISGVGNIYADESLWASSLHYATPAGQLSFTQLDELIRNVRKVMEASLAVGGTTFDSLYVNVNGASGYFERSLNVYGRENKPCYRCQDNGLLTLIRRAPFMNRSSYLCPVCQPK 307
>gi|145637250|ref|ZP_01792911.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittHH] >gi|145269502|gb|EDK09444.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae PittHH] (251 aa)
Score = 319, Expect = 8.8e-28, Identities = 93/256 (36%), Positives = 138/256 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNK 256
           +PELPEV++ +  +      N TI  +    PK+    S E  T  + N +I D+TR+ KYLI H T     + HL M G +     DS+ DK H  + I M++ ++ RY+D RRFG + ++ EN  LD   +  KLG +PL +EF+ +YL    ++ + A+KT L+D   V G+GNIYA+E LF   IHP  +A  LT N    +    + +L KA+   GTT+  +     + G F + L V+  KD  C  C  K
  S:     1 MPELPEVETALRGISPY-LKNFTIEKVVVRQPKLRWAVSEELIT--LKNVKIVDLTRRAKYLIIH-TEKGYIIGHLGMSGSVRIVPQDSAIDK-HDHIDIVMNNGKLLRYNDPRRFGAW-LWTEN--LDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAVVVGVGNIYANESLFICGIHPLKLAKNLTRNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQPDGRPGYFAQELLVYGNKDKPCPKCGRK 250
>gi|94265145|ref|ZP_01288909.1| DNA-formamidopyrimidine glycosylase [delta proteobacterium MLMS-1] >gi|94267032|ref|ZP_01290675.1| DNA-formamidopyrimidine glycosylase [delta proteobacterium MLMS-1] >gi|93452266|gb|EAT02912.1| DNA-formamidopyrimidine glycosylase [delta proteobacterium MLMS-1] >gi|93454384|gb|EAT04685.1| DNA-formamidopyrimidine glycosylase [delta proteobacterium MLMS-1] (343 aa)
Score = 319, Expect = 8.8e-28, Identities = 94/275 (34%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLF-FEKTDSSYDKKHVLVKIEMD----------------------DYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEE-EFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCK------------------------NKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L E     R I NIE+    + +           +   I  + R+ KYL+ HL N  + V+HL M GKL+    T+      H+++K+  D                       +E+R++D RRFG   +Y     +    +  LG +PL++ +F   YL    ++    IK  L+D   V GIGNIYA+EILFA+ I P   A +L      ++   +R IL +A+   GTTIA +     Q G FQ  L V+ +    C  C                           I +    GR T+ C +CQK
  S:    22 MPELPEVEVVRRGL-EPLVTGRRIDNIETSGLSLRRPVPLAALRELAVGAVITGVERRAKYLLLHLDNGALLVIHLGMTGKLYPAATTEPPRKHDHLVIKMGTDLFFTSATPETTPGMLVKNKSVPIFEVRFNDCRRFGLVAVYGSEEAVAPPLLVGLGPEPLDKRQFTAAYLHRCCRQRRTPIKNLLMDNRVVVGIGNIYANEILFAAGISPFAPAARLGRLRAGRLVAAARQILTRAIAAGGTTIADFANAAGQAGYFQVQLAVYGRHGTPCPRCAPDDGADQPPAAGATAAKKVAKGAAPMIERRMQAGRATFFCPRCQK 343
>gi|120596900|ref|YP_961474.1| formamidopyrimidine-DNA glycosylase [Shewanella sp. W3-18-1] >gi|166198752|sp|A1RE25|FPG_SHESW Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|120556993|gb|ABM22920.1| formamidopyrimidine-DNA glycosylase [Shewanella sp. W3-18-1] (271 aa)
Score = 319, Expect = 1.0e-27, Identities = 87/276 (31%), Positives = 135/276 (48%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L EQ  ++  I N     P         D    II + I+ + R+ KYL+   T+    +VHL M G L     D+  +K   +  +  +   +R++D RRFG + ++ E        + KLG +PL   F+ K L   +    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + ILA A++  GTT+  +     + G F + L V+ +    C +C N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGIAPYLVEQTVIDLVIRNGSLRWP-------VPDIAKQIIGQVIRQVRRRAKYLLID-TDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAW-LWCELPEEAHPLLAKLGPEPLTNAFNVKQLAAALTGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTSCGNLLSEIRLGQRTTVFCGICQTR 271
>gi|21223929|ref|NP_629708.1| formamidopyrimidine-DNA glycosylase [Streptomyces coelicolor A3(2)] >gi|7531122|sp|Q9ZBQ6|FPG_STRCO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|4007732|emb|CAA22416.1| formamidopyrimidine-DNA glycosylase [Streptomyces coelicolor A3(2)] (286 aa)
Score = 318, Expect = 1.1e-27, Identities = 79/275 (28%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTN-DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD---YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L E+   +RT+ ++E + P+  +      +DF H + + +I   +R+GKYL   L + D+  + HL M G+L  +  ++  +K H+ +++   D    E+R+ D R FG  ++++ +       I  +  DPL+  FD +   + +++    IK  LLDQ  +SG+GNIYADE L+ + +H E     LT     ++  + R ++  A+   GT+  + +     + G F + L  + ++   C  C   + +     R +Y C KCQ+
  S:     1 MPELPEVEVVRRGL-ERWAAHRTVADVEVLHPRAVRRHVAGPDDFAHRLKDHRIGTPSRRGKYLWLPLEDTDQAVLAHLGMSGQLLVQPHETPAEK-HLRIRVRFADALGTELRFVDQRTFGGLSLHDTSADGLPDVIAHIARDPLDPLFDDEAFHHALRRKRTTIKRALLDQSLISGVGNIYADEALWRARLHYERPTATLTRPRTTELLGHVRDVMNAALAVGGTSFDSLYVNVNGESGYFDRSLDAYGREGMPCRRCATPMRRRPWMNRSSYFCPKCQR 280
>gi|108805342|ref|YP_645279.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Rubrobacter xylanophilus DSM 9941] >gi|108766585|gb|ABG05467.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Rubrobacter xylanophilus DSM 9941] (286 aa)
Score = 318, Expect = 1.2e-27, Identities = 82/274 (29%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-----EKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++ + L+     +R I   E   P + +    E+F   +   ++    R+ K+L+  L   +  V  L++ G+L       E  DS      V++ + +D    +   D   F    +  E     ++ +  LG +P  EEF  +YLK  +      IK  LLDQ  +SGIGNIYADEIL+ + + P   A+ L++ +++++    R  LA  +E++GTT+  Y     + GE Q  L+V  +    C  C  ++V+ +V GR T+ C +CQ
  S:     1 MPELPEVETIKNDLRGLVVGSR-IERAEVREPALVEQPPQEEFVRRLGGARVTGARRRAKHLVVELDTGEALVFQLKIGGQLLLVPPVEEPEDS------VMLVLSLDGGRRLLLRDQTGFSRARLLGEKEL--AERLSGLGPEPFSEEFTVRYLKERLGSRRAQIKPLLLDQSLISGIGNIYADEILYDARLSPRRRASSLSEEEWERLYAAIRSNLAAGIEHRGTTVRLYRDVLGRAGEHQNHLRVFERHGGPCPRCGAEVVRERVGGRPTHYCPRCQ 271
>gi|168220127|ref|ZP_02645359.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Agona str. SL483] (269 aa)
Score = 318, Expect = 1.3e-27, Identities = 89/275 (32%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLRQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|77166106|ref|YP_344631.1| DNA-formamidopyrimidine glycosylase [Nitrosococcus oceani ATCC 19707] >gi|90101306|sp|Q3J7U5|FPG_NITOC Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|76884420|gb|ABA59101.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Nitrosococcus oceani ATCC 19707] (271 aa)
Score = 318, Expect = 1.3e-27, Identities = 77/274 (28%), Positives = 141/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   + E   + R I  +      I +            T  +I +    + R+GKYL+   T   + ++HL M G L    T++ + K   L  +  +   +R++D RRFG+ + + + N L    ++ LG +PLE  FD  YL  + +    ++K  +++   V+G+GNIYA+E LF + IHP   A+++    ++++AE ++ +L  A++  GTT+  +     + G F   L+++ +    C  C   I   ++  R +Y C +CQ
  S:     1 MPELPEVETVRRGI-EPHLVGRQIHTV------IVRESRLRWPIPLSLTQNLIGQSFLAVGRRGKYLLLSCTQGTI-ILHLGMSGSLRLVTTNTPHGKHDHLDIVLNNGRCLRFNDPRRFGSVS-WTQANPLHHPLLEILGPEPLESLFDGHYLFKHSRHRRTSVKAFIMNHRIVAGVGNIYANEALFLAGIHPRRSASRIGLARYQRLAETTKTVLYNAIQAGGTTLRNFLTSDGKPGYFANQLQIYGRSAHPCPICGTPIRLERIGQRASYYCTQCQ 270
>gi|194445857|ref|YP_002042976.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194404520|gb|ACF64742.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (269 aa)
Score = 317, Expect = 1.4e-27, Identities = 89/275 (32%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A+  + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTAECDLLAQVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|168464966|ref|ZP_02698858.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195632352|gb|EDX50836.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (269 aa)
Score = 317, Expect = 1.4e-27, Identities = 89/275 (32%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPTEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|161505738|ref|YP_001572850.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189044673|sp|A9MKN9|FPG_SALAR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|160867085|gb|ABX23708.1| hypothetical protein SARI_03914 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (269 aa)
Score = 317, Expect = 1.4e-27, Identities = 88/275 (32%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   +V  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEAQPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKRKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSKEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPVVATKHAQRATFYCRHCQK 269
>gi|73749072|ref|YP_308311.1| formamidopyrimidine-DNA glycosylase [Dehalococcoides sp. CBDB1] >gi|147669837|ref|YP_001214655.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Dehalococcoides sp. BAV1] >gi|73660788|emb|CAI83395.1| formamidopyrimidine-DNA glycosylase [Dehalococcoides sp. CBDB1] >gi|146270785|gb|ABQ17777.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Dehalococcoides sp. BAV1] (270 aa)
Score = 317, Expect = 1.4e-27, Identities = 82/274 (29%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V + +     L + I  +E++  K    C  E DF        +  ++R+GKY+I  L++     VHL+M G L   + ++    +       +++ E + + D R+FG  T+      LDS  ++KLG +PLEE F      + +      IK  LLDQ+ ++G+GN+YADE LF + ++P   A  L+  + +++    + +L KA++NKG +++TY      KG  Q    V  ++   C  C   I +  +  R  Y C +CQ
  S:     1 MPELPEVETVKNEIMPH-LLGKKIIRMEALWAKTL--CPPEADFNALASGTCVTGLSRRGKYIIISLSSGLFISVHLKMSGGLTAIRAENGQAPRFTRAIFHLENGEQVYFTDIRKFGRITLLAG---LDSV-LEKLGPEPLEETFTAGVFWHRLSGRKGPIKAVLLDQKVLAGVGNMYADEALFKACLNPLRSAESLSMAEVERLHSAIQSVLHKAIQNKGASVSTYHRPDGSKGGAQLEFNVAHRRGESCPVCGAPITRQLIRQRACYFCPRCQ 269
>gi|159036824|ref|YP_001536077.1| formamidopyrimidine-DNA glycosylase [Salinispora arenicola CNS-205] >gi|189044672|sp|A8M661|FPG_SALAI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157915659|gb|ABV97086.1| formamidopyrimidine-DNA glycosylase [Salinispora arenicola CNS-205] (287 aa)
Score = 317, Expect = 1.5e-27, Identities = 81/276 (29%), Positives = 137/276 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM--DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L  Q    R I  +E   P+  +        F   ++   ++D+ R+GKYL   L +    + HL M G+L  +   ++ D+ H+ V+     D  E+R+ D R FG  ++      + + EI  +  DPL+ EF        +++    +K  LLDQ  +SG+GNIYADE L+ + +H    A+ LT     ++  + R +L +A++  GT+  A Y     + G F + L V+ + D  C  C   + +     R +Y C +CQ +
  S:     1 MPELPEVETVRQGLA-QWVTGRRIAEVEVRHPRAIRRHPAGAAHFADVLVGTTVRDVRRRGKYLWLPLDSGDAVIGHLGMSGQLLLQP-GAAPDEAHLRVRFRFADDGPELRFVDQRTFGGLSVSAGGAEMPT-EIAHIARDPLDPEFSEAAFVAALRRRRTEVKRALLDQTLLSGVGNIYADEALWRARLHGARPADGLTGPAALRLLGHVRDVLGEAIKEGGTSFDALYVNVNGESGYFDRALNVYGRADQPCRRCGTPVRREAFMNRSSYSCPRCQPR 278
>gi|91226564|ref|ZP_01261288.1| formamidopyrimidine-DNA glycosylase [Vibrio alginolyticus 12G01] >gi|91189038|gb|EAS75320.1| formamidopyrimidine-DNA glycosylase [Vibrio alginolyticus 12G01] (252 aa)
Score = 317, Expect = 1.6e-27, Identities = 76/224 (33%), Positives = 118/224 (52%)
  Q:    52 IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           I+ I+R+ KYL+   TN    +VHL M G L     D     KH  V +++   +I RY+D RRFG +             +  +G +PL EEF+ +Y+    K    A+K  ++D + V G+GNIYA+E LF S IHP   A KLT  +++ + EN ++ L  A+   GTT+  +     + G F + L V+ K    C  C  ++ ++K+  R T+ C +CQK
  S:    32 IRAISRRAKYLLIE-TNTGTAIVHLGMSGSLRVLDADFP-PAKHDHVDLKLSSGKILRYNDPRRFGAWLWCAPGE--SHAVLANMGPEPLTEEFNAEYVAEKAKNKRVAVKQFIMDNKVVVGVGNIYANESLFKSRIHPSRPAGKLTSQEWRLLVENIKMTLEIAITQGGTTLKDFAQADGKPGYFAQELLVYGKPGEPCPECGERLQELKIGQRNTFFCSECQK 252
>gi|46143899|ref|ZP_00133897.2| COG0266: Formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209444|ref|YP_001054669.1| formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae L20] >gi|166215606|sp|A3N3S8|FPG_ACTP2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|126098236|gb|ABN75064.1| Formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae L20] (273 aa)
Score = 317, Expect = 1.6e-27, Identities = 87/274 (31%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVK-IEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNG-RGTYLCLKCQ 274
           +PELPEV++ +  + E     + I  I     K+    +  D   ++   +I  ++R+ KYLI H T   + ++HL M G L   + +     KH  V  I  D   +RY+D R+FG + ++ +N     + I +LG +PL E F   YL    +    A+K  +++ + V G+GNIYA E LF + +HPE  A  LT+   +++ +  + +LAKA+   GTT+  +     + G F + L+V+ +KD  C +C   I++ KV G R +Y C  CQ
  S:     1 MPELPEVETSLRGV-EPYLHGKIIKQIVVRTQKL--RWAVSDELQHMQGAKIVALSRRAKYLILHTTQGDI-LIHLGMSGSLGILQENQQPAGKHDHVDLITQDGMVLRYNDPRKFGCW-LWTKNAE-QHELITRLGPEPLSESFTAAYLFARSRNKTVAVKNFIMNNDIVVGVGNIYACESLFMAELHPELAAQNLTEKQCERLVKVIKEVLAKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYGRKDEACNDC-GTIIEAKVIGQRNSYFCPHCQ 269
>gi|167555563|ref|ZP_02348581.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (269 aa)
Score = 317, Expect = 1.6e-27, Identities = 89/275 (32%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDKIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|168232573|ref|ZP_02657631.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194472197|ref|ZP_03078181.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194458561|gb|EDX47400.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (269 aa)
Score = 317, Expect = 1.7e-27, Identities = 90/275 (32%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIK------KLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG         +L +KE++       LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGA--------WLWTKELEGHNVLVHLGPEPLSDEFNGEYLRQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRICGTPIVATKHAQRATFYCRHCQK 269
>gi|16762583|ref|NP_458200.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144072|ref|NP_807414.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415616|ref|YP_152691.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167541940|ref|ZP_02337516.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|168224862|ref|ZP_02650093.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168235331|ref|ZP_02660389.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168818444|ref|ZP_02830444.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194734471|ref|YP_002116661.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|21362542|sp|Q8Z2H2|FPG_SALTI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81677677|sp|Q5PC09|FPG_SALPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|25289586|pir||AG0971 formamidopyrimidine-DNA glycosylase STY4068 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504888|emb|CAD03267.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139709|gb|AAO71274.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129873|gb|AAV79379.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|194709973|gb|ACF89194.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (269 aa)
Score = 317, Expect = 1.7e-27, Identities = 89/275 (32%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|149922617|ref|ZP_01911045.1| formamidopyrimidine-DNA glycosylase [Plesiocystis pacifica SIR-1] >gi|149816503|gb|EDM76000.1| formamidopyrimidine-DNA glycosylase [Plesiocystis pacifica SIR-1] (286 aa)
Score = 317, Expect = 1.7e-27, Identities = 85/276 (30%), Positives = 141/276 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDF--THYIINEQIKDIT-----RKGKYLIFHLTN----DKVFVVHLRMEGKLFFEKTDSS-YDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+SV   L       R  T +  +    F   + +++   H  + EQ++  T     R+GKY+++H+      + V ++HL M G+    + D    D  H +     DD ++R+ D RRFG   +       + + +  LG +PL E+FD   L+  + KS RA++  LLDQ  V+GIGNIYA E  F + ++P   A  L+   + K+A+   ++L + V N GTT+  +     + G  Q  L+V+ +    C  C  ++       R   +C +CQ K
  S:     1 MPELPEVESVRRGLARA----RLKTPVVKLWRSSFNLRTGKNWLRKHEGL-EQLRGATPGPVRRRGKYILWHMQGADEGELVLLIHLGMSGRCGVARADQPIVDHTHFIATFA-DDRQLRFVDPRRFGGLKVGTRETIYEREPVAALGPEPLSEDFDGAVLEAALGKSKRALRDALLDQRAVAGIGNIYAVEACFEARLNPLRPAASLSRRSWSKLADALVLVLERGVRNGGTTLKDFRNVVGEVGRNQDDLRVYGRGGEPCPRCGRRLADFVSQNRSGVMCTRCQPK 282
>gi|165977434|ref|YP_001653027.1| formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165877535|gb|ABY70583.1| formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (273 aa)
Score = 317, Expect = 1.8e-27, Identities = 87/274 (31%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVK-IEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNG-RGTYLCLKCQ 274
           +PELPEV++ +  + E     + I  I     K+    +  D   ++   +I  ++R+ KYLI H T   + ++HL M G L   + +     KH  V  I  D   +RY+D R+FG + ++ +N     + I +LG +PL E F   YL    +    A+K  +++ + V G+GNIYA E LF + +HPE  A  LT+   +++ +  + +LAKA+   GTT+  +     + G F + L+V+ +KD  C +C   I++ KV G R +Y C  CQ
  S:     1 MPELPEVETSLRGV-EPYLHGKIIKQIVVRTQKL--RWAISDELQHMQGAKIVALSRRAKYLILHTTQGDI-LIHLGMSGSLGILQENQQPAGKHDHVDLITQDGTVLRYNDPRKFGCW-LWTKNAE-QHELITRLGPEPLSESFTAAYLFARSRNKTVAVKNFIMNNDIVVGVGNIYACESLFMAGLHPELAAQNLTEKQCERLVKVIKEVLAKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYGRKDEACNDC-GTIIEAKVIGQRNSYFCPHCQ 269
>gi|157412690|ref|YP_001483556.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. MIT 9215] >gi|166988462|sp|A8G2Y9|FPG_PROM2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157387265|gb|ABV49970.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. MIT 9215] (293 aa)
Score = 316, Expect = 1.9e-27, Identities = 99/275 (36%), Positives = 146/275 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKI--FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT----------------NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E        F N   EDF   + N  +    R+GKYLI  L                 N+   +VHLRM G   F   +S+   KH  +++ +  + E+RY D R FG      E    +   K +  LG +P  ++FD  YLK  I K  ++IK  LLDQ  V+GIGNIYADE L+++ I P   A  +  N+  K+ E+   +L  ++ + GTT + +   + + G F     V+ +   +C  C N I + K++GR T+ C KCQK
  S:     1 MPELPEVETVRRGL-EQKLNNFIIKKVEVCRDSTVAFPN-KKEDFIGGLNNSLLYKWNRRGKYLIAELKKLGNENGRFPLEKFSKNNGFLIVHLRMTGYFKF-INNSAQPCKHTRIRVFDNKNNELRYIDVRSFGQMWWIKEGLSPNKIIKGLGSLGPEPFSKDFDEIYLKKVISKRTKSIKAILLDQTIVAGIGNIYADESLYSAGISPFREARTIKKNELIKLKESIVTVLKNSIGSGGTTFSDFRDLEGENGNFGLQTNVYRRTGKECRKCGNLIERKKISGRSTHWCPKCQK 293
>gi|167549026|ref|ZP_02342785.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (269 aa)
Score = 315, Expect = 2.4e-27, Identities = 89/275 (32%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTAECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|146309771|ref|YP_001174845.1| formamidopyrimidine-DNA glycosylase [Enterobacter sp. 638] >gi|166988461|sp|A4W514|FPG_ENT38 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|145316647|gb|ABP58794.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Enterobacter sp. 638] (269 aa)
Score = 315, Expect = 2.6e-27, Identities = 87/275 (31%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   H + ++ +  + R+ KYL+  L  D   ++HL M G L     +   +K H  V + M + ++ RY D RRFG +    E   L+   +   LG +PL E F+ +YLK    K    IK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L++ + + + +  + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSNE--IHTLSDKPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRILSEELPAEK-HDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSEAFNAEYLKARCAKKKTPIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSEQECEILVKVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVASKHAQRATFYCRQCQK 269
>gi|123965595|ref|YP_001010676.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. MIT 9515] >gi|166198729|sp|A2BUV8|FPG_PROM5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|123199961|gb|ABM71569.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. MIT 9515] (293 aa)
Score = 315, Expect = 2.7e-27, Identities = 100/275 (36%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLI----------------FHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKK----LGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E      +      +DF   + N  I    R+GKYLI                  L N+   VVHLRM G   F K  +S  K   +   + ++ E+RY D R FG      E   L  K I K    LG +P  E+F+  YL   I    R+IK+ LLDQ  V+GIGNIYADE L+++ I P   A  +  ++  K+      +L K++   GTT + +   + + G F     V+ +    C  CKN I + K++GR T+ C KCQK
  S:     1 MPELPEVETVRKGL-EQKLKNFIIKRVEICRESTVAYPIDKQDFVKGLQNSLINKWDRRGKYLIAKLKKADRNHTYIENEMSLKNNGSLVVHLRMTGYFTFNKNPTSPCKHTRIRLFDNNNNELRYIDVRSFGQMWWVREG--LSPKNIIKGLGALGPEPFSEKFNISYLTKIILNKTRSIKSILLDQTIVAGIGNIYADESLYSAGISPFREARTIEKHELIKLRIAIIEVLKKSIGAGGTTFSDFRDLEGENGNFGLQTNVYRRTGKKCHACKNLIERQKISGRSTHWCRKCQK 293
>gi|15677162|ref|NP_274315.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis MC58] >gi|9911065|sp|P55044|FPG_NEIMB Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|7226536|gb|AAF41671.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis MC58] (275 aa)
Score = 315, Expect = 2.7e-27, Identities = 86/275 (31%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +       +T+  +     K+    +  D    +   Q+    R+ KYL+       V ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT+ C  CQK
  S:     1 MPELPEVETTLRGIAPH-IEGKTVEAVVLRQLKLRWQIN-PDLGEILSGRQVLSCGRRAKYLLIRFQTG-VLLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEAFCADYLYARLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLQRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPRCGGLVVKETLGQRGTFYCPNCQK 275
>gi|92115085|ref|YP_575013.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Chromohalobacter salexigens DSM 3043] >gi|91798175|gb|ABE60314.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Chromohalobacter salexigens DSM 3043] (281 aa)
Score = 315, Expect = 3.0e-27, Identities = 81/275 (29%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +       R I  I    P++ +    +D    ++  +I ++ R+ KYL+  +      + HL M G L   +      +KH  V + ++   I RYHD RRFG F  + + + LD   + +LG +PL  +FD + L    +K   A+K  L+D   V G+GNIYA E LF + I P   A +++   ++++AE +R +LA A+   GTT+  +     + G F + L V+ + D  C  C   +  + +  R +  C  CQ+
  S:    11 MPELPEVETTRRGIAPH-VEGREIREIIVRQPRL-RTPVPDDLADTLVGHRIGELGRRAKYLLMPV-GAGTLLWHLGMSGSLRLARL-GDLPRKHDHVDLVLEGGAILRYHDPRRFG-FVDWLQGSPLDDPRLARLGPEPLSPDFDGERLYRLSRKRRVAVKPFLMDNAVVVGVGNIYASEALFLAGIDPRRAAGRISRERYERLAEAARDVLAAAITQGGTTLRDFVSGTGEPGYFAQRLNVYGRHDAPCRRCGELLRLVTLGQRASVFCPHCQR 281
>gi|95929141|ref|ZP_01311885.1| formamidopyrimidine-DNA glycosylase [Desulfuromonas acetoxidans DSM 684] >gi|95134639|gb|EAT16294.1| formamidopyrimidine-DNA glycosylase [Desulfuromonas acetoxidans DSM 684] (272 aa)
Score = 314, Expect = 3.1e-27, Identities = 80/275 (29%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L +   + + I ++     ++      E     +  E +  + R+ KYL+  +   +V ++HL M G L +  +D    +KH  V I      +R+HD RRFG   +         + +  LG +PL ++FD ++L    +    AIK+ L++   V G+GNIYA+E LF S + P+  + +LTD     + +  + +LA+A++  GTT+  +     Q G FQ+ L V+ + +  C+ C   I + ++  R T+ C +CQK
  S:     1 MPELPEVETVCAGLHDL-VVGQQIVDVRVYESRLRYPVPME-LADVLSGETVVSLRRRAKYLLMDI-GPQVVILHLGMSGSLRW-VSDGQTPQKHDHVDIVFSGGCLRFHDPRRFG-LIVLAPPPVEQHRLLAHLGPEPLSDDFDGQWLFEKSRGRRIAIKSLLMENRVVVGVGNIYANESLFLSGMAPKKTSGELTDQQCVILVDKIKKVLAEAIKAGGTTLQDFVNGHGQPGYFQQKLYVYGRDEQPCLICGTMIERCRIGQRSTFYCPECQK 270
>gi|56552083|ref|YP_162922.1| formamidopyrimidine-DNA glycosylase [Zymomonas mobilis subsp. mobilis ZM4] >gi|59802555|sp|Q9X3X1|FPG_ZYMMO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56543657|gb|AAV89811.1| formamidopyrimidine-DNA glycosylase [Zymomonas mobilis subsp. mobilis ZM4] (270 aa)
Score = 314, Expect = 3.2e-27, Identities = 81/275 (29%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ I  L E   +   I +++ +     +     D    +I   I  ++R+ KY I     D   + HL M G+  ++    +++K    V    +++ +  +D RRFG+  +  +N  L+    + +G +PL   F+ +YL+  +  S+  IK  LLDQ+ V+GIGNIYA E L  + IHP+  +  L  ++   +  + + IL KA+   G+T+  Y     + G F    KV+ K+   C  C + I +  + GR T+LC  CQK
  S:     1 MPELPEVETTIRGLSEV-LMGEKIIDVK-VRRASLRRPIPSDIQERLIGSTIISLSRRAKYGIIVNDRDDALIFHLGMSGR--WKINPENFEKHDHFVLQTKNNFIVSLYDPRRFGSLDLVKKNQLLEWSYFRNIGPEPLTGNFNPEYLQKKLFSSSAPIKKILLDQKVVAGIGNIYACEALHQAKIHPQRPSKNLNFDEITSLVFSIKNILQKAIAEGGSTLKDYARPNGELGYFSTKFKVYGKEGEQC-ECGHTIERYTLGGRSTFLCSSCQK 270
>gi|153094993|gb|EDN75556.1| DNA-formamidopyrimidine glycosylase [Mannheimia haemolytica PHL213] (274 aa)
Score = 314, Expect = 3.3e-27, Identities = 87/275 (31%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL--FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +     + +TI  I    PK+    S E     +   +I  + R+ KYLI   T+    +VHL M G L    E+      K   +  I  +   +RY+D R+FG +    +    D + ++KLG +PL  +F   YL    +K   A KT ++  E V G+GNIYA E LF + IHPE  A  LT    +++ +  + +L KA+   GTT+  +     + G F + L+V+ +K   C +C   I    +  R TY C KCQ+
  S:     1 MPELPEVETSVRGVSPY-LVGQTIEQIIVRQPKLRWTVSPE--LSQMAGAKITAVERRAKYLIIR-TDKGDILVHLGMSGSLGILQERQQKEIGKHDHVDLITQNGTILRYNDPRKFGCWLWAEKAE--DHELLRKLGPEPLSNDFTADYLFAKSRKKTTACKTFIMTNEVVVGVGNIYACESLFMAGIHPELAAQNLTKKQCERLVKTIKEVLTKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYGRKGETCNDCGKPIETKVIGQRNTYFCPKCQR 271
>gi|153834860|ref|ZP_01987527.1| formamidopyrimidine-DNA glycosylase [Vibrio harveyi HY01] >gi|148868731|gb|EDL67808.1| formamidopyrimidine-DNA glycosylase [Vibrio harveyi HY01] (269 aa)
Score = 314, Expect = 3.3e-27, Identities = 86/275 (31%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     + +TI       PK+  +   E     +  + I++I+R+ KYL+   T++   +VHL M G L     D     KH  V +++ + ++ RY+D RRFG +     N       +  +G +PL EEF+  Y+    K    A+K  ++D + V G+GNIYA+E LF S IHP   A KLT  +++ + EN +  L  A++  GTT+  +     + G F + L V+ K    C  C   + + K+  R T+ C +CQK
  S:     1 MPELPEVEVSRMGISPH-MIGQTIKAFVFRTPKLRWDIPQE--LKKLEGQVIRNISRRAKYLLIE-TDEGTAIVHLGMSGSLRVLDADFP-PAKHDHVDLKLSNGKVLRYNDPRRFGAWLWSAPNE--PHAVLGHMGPEPLTEEFNADYVAEKAKGKRVAVKQFIMDNKIVVGVGNIYANESLFKSRIHPTRPAGKLTKKEWQLLVENIKATLEIAIQQGGTTLKDFAQADGKPGYFAQELLVYGKAGEPCPECGEALQEQKIGQRNTFFCGECQK 269
>gi|16767011|ref|NP_462626.1| formamidopyrimidine-DNA glycosylase [Salmonella typhimurium LT2] >gi|167994347|ref|ZP_02575439.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168241905|ref|ZP_02666837.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168260520|ref|ZP_02682493.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194451470|ref|YP_002047758.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|6016042|sp|O54326|FPG_SALTY Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|2842793|gb|AAC01773.1| MutMST [Salmonella typhimurium] >gi|16422294|gb|AAL22585.1| formamidopyrimidine DNA glycosylase [Salmonella typhimurium LT2] >gi|194409774|gb|ACF69993.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (269 aa)
Score = 314, Expect = 3.4e-27, Identities = 89/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L     ++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LPEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|161870169|ref|YP_001599339.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis 053442] >gi|161595722|gb|ABX73382.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis 053442] (275 aa)
Score = 314, Expect = 3.5e-27, Identities = 86/275 (31%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +       +T+  +     K+    +  D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT+ C  CQK
  S:     1 MPELPEVETTLRGIAPH-IEGKTVEAVVLRQLKLRWQIN-PDLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEAFCTDYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK 275
>gi|15794404|ref|NP_284226.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis Z2491] >gi|9910674|sp|P57014|FPG_NEIMA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|121052326|emb|CAM08656.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis Z2491] (275 aa)
Score = 314, Expect = 3.5e-27, Identities = 86/275 (31%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +       +T+  +     K+    +  D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT+ C  CQK
  S:     1 MPELPEVETTLRGIAPH-IEGKTVEAVVLRQLKLRWQIN-PDLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGRSDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEAFCTDYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK 275
>gi|121635008|ref|YP_975253.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis FAM18] >gi|120866714|emb|CAM10466.1| formamidopyrimidine-DNA glycosylase [Neisseria meningitidis FAM18] (280 aa)
Score = 314, Expect = 3.6e-27, Identities = 86/275 (31%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +       +T+  +     K+    +  D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT+ C  CQK
  S:     6 MPELPEVETTLRGIAPH-IEGKTVEAVVLRQLKLRWQIN-PDLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEAFCADYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK 280
>gi|972980|gb|AAB01505.1| putative formamidopyrimidine-DNA glycosylase; similar to Escherichia coli fpg gene, Swiss-Prot Accession Number P05523 [Neisseria meningitidis serogroup B] >gi|1586496|prf||2204218A formamidopyrimidine-DNA glycosylase (275 aa)
Score = 314, Expect = 3.7e-27, Identities = 86/275 (31%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +       +T+  +     K+    +  D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT+ C  CQK
  S:     1 MPELPEVETTLRGIAPH-IEGKTVEAVVLRQLKLRWQIN-PDLGEILSGRQVLSCGRRAKYLIVRFQKG-ILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEAFCADYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK 275
>gi|177667327|ref|ZP_02942929.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. PCC 8801] >gi|172073759|gb|EDT59181.1| formamidopyrimidine-DNA glycosylase [Cyanothece sp. PCC 8801] (282 aa)
Score = 314, Expect = 3.7e-27, Identities = 84/274 (30%), Positives = 132/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN-CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK-----VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E     + I + E ++P+   +  S ++F   I      +  R+GKYL+  L  +         VHLRM G+L +            L     ++ E+R+ D R FG           ++    +KKLG++P  ++F   Y    +    R IKT LLDQE V+G+GNIYADE LF S +HP T+   L     +++      +L  A+E  GTT + +       G +     V+ +    C  C   I ++K+ GR  + C +CQ
  S:     1 MPELPEVETVCRGLNELTS-GKVIKDAEVLLPRSLASPSSVDEFLSNIRGVIFGEWQRRGKYLLGTLVKESGEAAGWLGVHLRMTGQLLWVNQSEPLQIHTRLRLFCGENKELRFVDIRTFGKVWCVPPKTTPETIITGLKKLGVEPFSDDFSDDYFTTKLNGRQRNIKTLLLDQEIVAGLGNIYADEALFKSGVHPTTLGKNLKPQQIEQLRIAIIEVLETAIEKGGTTFSDFKGVTGINGNYGGTAWVYGRTGEPCRVCGTSIERLKLGGRSAHFCPRCQ 281
>gi|72383541|ref|YP_292896.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus str. NATL2A] >gi|90101309|sp|Q46H41|FPG_PROMT Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|72003391|gb|AAZ59193.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus str. NATL2A] (282 aa)
Score = 313, Expect = 4.1e-27, Identities = 94/275 (34%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVF-----VVHLRMEGKL-FFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E+   +  I  IE +  + I  N   + F   + N  +    R+GKYLI  L   + F     VVHLRM G+    EK       KH  V+  +    E+R+ D R FG       +  +      IK+LG +P  ++F+  YL+  +KK  R+IK+ LLDQE V+G+GNIYADE LF + I+P+  +  L   + K++  +   IL  ++   GTT + +   +   G +     V+ +   +C  C  KI++ K+ GR T+ C  CQK
  S:     1 MPELPEVETVRKGL-EKLLNDFYIERIEVLKERSIASNGGSKSFIVSVKNSYLGSWERRGKYLIGSLLTKEKFSKGFLVVHLRMTGQFKLLEK--EVLACKHTRVRFFDERGRELRFIDIRNFGQMWHVPSSRSIPEIVSGIKRLGPEPFSDDFNSHYLEEYLKKKTRSIKSALLDQETVAGVGNIYADETLFDAGINPKKESRNLKSTELKRLCNSLVKILNISIGEGGTTFSDFRDLEGINGNYGGQAWVYRRSGKNCKKCGEKILREKICGRSTHWCPNCQK 282
>gi|145593839|ref|YP_001158136.1| formamidopyrimidine-DNA glycosylase [Salinispora tropica CNB-440] >gi|189044675|sp|A4X4F8|FPG_SALTO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|145303176|gb|ABP53758.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Salinispora tropica CNB-440] (287 aa)
Score = 313, Expect = 4.2e-27, Identities = 82/276 (29%), Positives = 137/276 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM--DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++V   L  Q   +R I  ++ + P+  +        F   +    ++D+ R+GKYL   L +    V HL M G+L  +   ++ D+ H+ V+     D  E+R+ D R FG  ++      L + EI  +  DPL+ EF        +++    IK  LLDQ  +SG+GNIYADE L+ + +H     + LT     ++  + R +L +AV+  GT+  A Y     + G F + L V+ + D  C  C   + +     R ++ C +CQ +
  S:     1 MPELPEVETVRQGLA-QWVTDRRIAEVQVLHPRAVRRHAAGAAHFADVLRETTVRDVRRRGKYLWLPLDSGDAVVGHLGMSGQLLLQPA-AAPDETHLRVRFRFADDGPELRFVDQRTFGGLSVSAGGAELPT-EIAHIARDPLDPEFSDATFVAALRRRRTEIKRALLDQTLLSGVGNIYADEALWRARLHGTRPTDGLTGPAVLRLLGHVRDVLGEAVKEGGTSFDALYVNVNGESGYFDRALNVYGRADQPCRRCGEPVRREAFMNRSSFSCPRCQPR 278
>gi|110602479|ref|ZP_01390559.1| formamidopyrimidine-DNA glycosylase [Geobacter sp. FRC-32] >gi|110546807|gb|EAT60153.1| formamidopyrimidine-DNA glycosylase [Geobacter sp. FRC-32] (271 aa)
Score = 313, Expect = 4.9e-27, Identities = 83/275 (30%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTI-TNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++  ++  Q    R I TN+ +      ++    +    ++ + I  + R+GKYL+       + + HL M G L+  K  S + K   L  +    Y +R+ D RRFGT  I+ +N+ L    +   G +PLE EF   YL     +    IK  ++D   V+GIGNIYA+E LF + I P+T A+ L+ +    + +  + +L  AVE   + I +    +  +G F     ++ KK   C  C + I  +++ GR T+ C  CQK
  S:     1 MPELPEVETIRRAVGPQVRGKRIIHTNVRATK---LRHPLPPELDRLLVGQLIVAMDRRGKYLLLRCKGGTI-IFHLGMTGMLYLVKASSPHGKHDHLDLVLDGSYILRFTDPRRFGTI-IWTDNDPLQHPLLVAHGPEPLEAEFSASYLYLKRHRRKIPIKQLIMDSRVVAGIGNIYANESLFRAGIAPQTSASDLSPDKDLLLVDAIKGVLTDAVEAGTSNIESALTGERPQGYFPYEFSIYGKKGRPCPKCGSAIRMMRLGGRSTFFCPLCQK 271
>gi|168473229|ref|ZP_02702252.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (269 aa)
Score = 313, Expect = 5.0e-27, Identities = 89/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L     ++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LPEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTAECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|68536282|ref|YP_250987.1| formamidopyrimidine-DNA glycosylase [Corynebacterium jeikeium K411] >gi|90101301|sp|Q4JUY8|FPG_CORJK Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|68263881|emb|CAI37369.1| mutM [Corynebacterium jeikeium K411] (288 aa)
Score = 313, Expect = 5.1e-27, Identities = 81/275 (29%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFT--------------IYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L+E   + R  T+++   P+  ++   E     + +  +  + R+GK+L      D +  VHL M G++   +        HV ++  + D  E+ + D R FG +               + +  N+L  + +  +  DPLE  FD +     +K    A+KT LL+QE VSGIGNIYADE LF + + P   A  L+     ++ +++  ++  A+E  GT+  + +       G F + L V+ +    C  C   I ++ V GR T+ C  CQ+
  S:     1 MPELPEVEVVRRGLEEH-LVGRRFTDVQVCHPRAVRSGEPEVLVSSLRDATVTAVKRRGKFLWLDFGEDFLLQVHLGMSGQMLVAEP-GQVQSPHVRIRAGLSDGRELCFVDQRTFGEWRLEKAVPDPWAAGAGVASPKNFL-PQNVSHIAADPLEAVFDAQAAVARMKSKRAAVKTVLLNQEVVSGIGNIYADEALFLAGVRPRRSAALLSRPTLHRVLQSAAEVMECALEQGGTSFDSLYVNVNGASGYFSRSLNVYGRGGEPCKRCGAPIKRVVVGGRSTHYCATCQR 288
>gi|89094942|ref|ZP_01167873.1| formamidopyrimidine-DNA glycosylase [Oceanospirillum sp. MED92] >gi|89080808|gb|EAR60049.1| formamidopyrimidine-DNA glycosylase [Oceanospirillum sp. MED92] (270 aa)
Score = 312, Expect = 5.7e-27, Identities = 81/275 (29%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIIN-EQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +     + +T+T +    P +       DF    +  +QI  + R+GKY++  +    V ++HL M G L   ++D+    KH  V   + D   +R  D RRFG+     +  +   + + KLG +PL E F+ +YLK+       AIK  ++D + V G+GNIYA E LFA++I P   A  ++    + +    + +L+ A+E  GTT+  +     + G F++ L V+ +K   CV C   + ++++  R T  C  CQ+
  S:     1 MPELPEVETTCRGISPH-TVKKTVTELVIRNPNL--RWPVPDFLESRVQGKQINSVGRRGKYILLQMDEGDV-MIHLGMSGSLRMVRSDTP-PLKHDHVDFCLSDGNALRLTDPRRFGSVLWQPKGEH--HELLYKLGPEPLSEGFNAEYLKSCCDGRKVAIKQLIMDSQVVVGVGNIYATEALFAAAIDPRRAAGNISRARLENLVVEIKKVLSAAIEQGGTTLKDFVGGDGKPGYFKQELSVYGRKGEPCVKCMAPLTEVRLGQRATVFCKHCQR 270
>gi|163803273|ref|ZP_02197152.1| formamidopyrimidine-DNA glycosylase [Vibrio campbellii AND4] >gi|159172910|gb|EDP57748.1| formamidopyrimidine-DNA glycosylase [Vibrio campbellii AND4] (269 aa)
Score = 312, Expect = 5.8e-27, Identities = 87/275 (31%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTF--TIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     +  TI       PK+  +   E     +  + I +I+R+ KYL+   T+    +VHL M G L     D     KH  V +++ + +I RY+D RRFG +  +  NE++ +    +  +G +PL EEF+  Y+    K    A+K  ++D + V G+GNIYA+E LF + IHP   A KLT  +++ + EN +  L  A++  GTT+  +     + G F + L+V+ K+   C  C   I  +K+  R T+ C +CQ+
  S:     1 MPELPEVEVSRMGISPH-MVGETIKAFVFRTPKLRWDIPQE--LKKLEGQVILNISRRAKYLLIE-TDAGTAIVHLGMSGSLRVLDADFPA-AKHDHVDLKLSNGKILRYNDPRRFGAWLWSAPNESHAV----LGHMGPEPLTEEFNADYVAEKAKGKRVAVKQFIMDNKVVVGVGNIYANESLFKTHIHPIRPAGKLTMKEWRLLVENIKATLEIAIQQGGTTLKDFAQADGKPGYFAQELQVYGKEGEQCPECGTIIESVKIGQRNTFFCPQCQQ 269
>gi|158335652|ref|YP_001516824.1| formamidopyrimidine-DNA glycosylase [Acaryochloris marina MBIC11017] >gi|189044582|sp|B0C5D4|FPG_ACAM1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|158305893|gb|ABW27510.1| formamidopyrimidine-DNA glycosylase [Acaryochloris marina MBIC11017] (284 aa)
Score = 312, Expect = 6.2e-27, Identities = 89/274 (32%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV-----FVVHLRMEGKLFFEKTDSSYDKKHVLVKIE-MDDYEIRYHDTRRFGTFTIYNENNYLDSKEI----KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E+  +   I   E + P+ I    S + F   + +       R+GKYL+  L+           VHLRM G+L +   D    +KH  V++  +++ E+R+ D R FG           D K++    +KLG +P  EEF   Y   +++   R+IK+ LLDQ  V+G+GNIYADE LF S I P T  ++L     +++      +L+ ++   GTT + +   K   G +     V+ ++   C  C   I +IK+ GR T+ C +CQ
  S:     1 MPELPEVETVRLGL-EKVTVGMQIMGGEVLYPRTIAHPQSPQVFIQGLQDATFLSWMRRGKYLLSQLSFSTQQPSGWLGVHLRMTGQLLWVAQDEPV-QKHTRVRLFFVNNRELRFVDQRTFGQMWWVAPTE--DPKQVISGLQKLGPEPFSEEFSVDYFWESLQGRKRSIKSALLDQALVAGVGNIYADEALFMSEIRPTTACHQLQTEQVQRLRTAIIEVLSTSIGAGGTTFSDFRDLKGVNGNYGGMAWVYGRQGQPCRTCGQTIERIKLVGRSTHFCPQCQ 281
>gi|190151346|ref|YP_001969871.1| Formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189916477|gb|ACE62729.1| Formamidopyrimidine-DNA glycosylase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (273 aa)
Score = 312, Expect = 6.6e-27, Identities = 86/274 (31%), Positives = 143/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVK-IEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNG-RGTYLCLKCQ 274
           +PELPEV++ +  + E     + I  I     K+    +  D   ++   +I  ++R+ KYLI H T   + ++HL M G L   + +     KH  V  I  D   +RY+D R+FG + ++ +N     + I +LG +PL E F   YL    +    A+K  +++ + V G+GNIYA E LF + +HPE  A  LT+   +++ +  + +LAKA+   GTT+  +     + G F + L+V+ +K   C +C   I++ KV G R +Y C  CQ
  S:     1 MPELPEVETSLRGV-EPYLHGKIIKQIVVRTQKL--RWAVSDELQHMQGAKIVALSRRAKYLILHTTQGDI-LIHLGMSGSLGILQENQQPAGKHDHVDLITQDGMVLRYNDPRKFGCW-LWTKNAE-QHELITRLGPEPLSESFTAAYLFARSRNKTVAVKNFIMNNDIVVGVGNIYACESLFMAGLHPELAAQNLTEKQCERLVKVIKEVLAKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYGRKGEACNDC-GTIIEAKVIGQRNSYFCPHCQ 269
>gi|167554430|ref|ZP_02348169.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (252 aa)
Score = 311, Expect = 7.4e-27, Identities = 78/234 (33%), Positives = 125/234 (53%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:    22 DEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTAECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 252
>gi|161616806|ref|YP_001590771.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|189044674|sp|A9MVN0|FPG_SALPB Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|161366170|gb|ABX69938.1| hypothetical protein SPAB_04625 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (269 aa)
Score = 311, Expect = 7.9e-27, Identities = 88/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L    +++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL +EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   I   K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQGDGKPGYFAQELQVYGRKGEPCRVCGTPIAATKHAQRATFYCRHCQK 269
>gi|89076362|ref|ZP_01162695.1| putative formamidopyrimidine-DNA glycosylase [Photobacterium sp. SKA34] >gi|89047933|gb|EAR53524.1| putative formamidopyrimidine-DNA glycosylase [Photobacterium sp. SKA34] (269 aa)
Score = 311, Expect = 7.9e-27, Identities = 84/275 (30%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     +++T+  I    P++       +    I  + I+ +TR+ KYL+   T+    +VHL M G L      +  +K H  V + +   E+ RY+D RRFG +    E   +    ++K+G +PL +EF+ ++L    +    AIK  ++D   V G+GNIYA+E LFA+ IHP+  A K++     K+ E  + +LA A++  GTT+  +     + G F + L+V+ K    C  C   + + K+  R T  C  CQK
  S:     1 MPELPEVEVSRMGISPH-VIDQTVKQIIIRNPRL--RWPIPEAIKAIEGQVIRGVTRRAKYLLLE-TDVGYAIVHLGMSGSLRVLPVGAPVEK-HDHVDLVLTSGEVLRYNDPRRFGAWLW--EEKGVTHPVLEKMGPEPLSDEFNVEHLHQKAQGKRTAIKQFIMDNHVVVGVGNIYANESLFAAGIHPKRAAGKISLARMTKLVEEIKSVLAFAIKQGGTTLKDFKNADGKPGYFAQELQVYGKAGKPCPKCGKTLSEAKIGQRATVFCSDCQK 269
>gi|157149253|ref|YP_001456571.1| formamidopyrimidine-DNA glycosylase [Citrobacter koseri ATCC BAA-895] >gi|166215620|sp|A8ARM2|FPG_CITK8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157086458|gb|ABV16136.1| hypothetical protein CKO_05093 [Citrobacter koseri ATCC BAA-895] (269 aa)
Score = 311, Expect = 7.9e-27, Identities = 86/275 (31%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L  D   ++HL M G L     +   +K H  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+  YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHANVRNGRLRWPVSEE--IYRLSDKPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRILPEELPAEK-HDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDDFNGAYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSQVECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVAAKHAQRATFYCRQCQK 269
>gi|84386871|ref|ZP_00989895.1| formamidopyrimidine-DNA glycosylase [Vibrio splendidus 12B01] >gi|84378161|gb|EAP95020.1| formamidopyrimidine-DNA glycosylase [Vibrio splendidus 12B01] (269 aa)
Score = 310, Expect = 9.9e-27, Identities = 83/274 (30%), Positives = 146/274 (53%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     +   I ++    PK+  +   E     +  + I+ I+R+ KYL+   T+    +VHL M G L     D     KH  V +++ + ++ RY+D RRFG + +++  + + +  +   G +PL ++F+  Y+     K   A+K  ++D + V G+GNIYA+E LF+S IHP   ANK+T  ++  + E  + +LA A++  GTT+  +     + G F + L+V+ K    C NC+  I ++K+  R T+ C +CQ
  S:     1 MPELPEVEVSRMGISPH-LVGEKIKSLTFRTPKLRWDIPQE--LKRLEGQVIRSISRRAKYLLIE-TDMGTAIVHLGMSGSLRVLDADFP-PAKHDHVDLKLTNGKVLRYNDPRRFGAW-LWSAPDEIHTVLLGS-GPEPLTDDFNADYISEKAAKRKVAVKQFIMDNKVVVGVGNIYANEALFSSRIHPLRPANKITQAEWTLLTEEIKQVLATAIKQGGTTLKDFAQADGKPGYFAQELQVYGKAGEKCPNCEALIQELKIGQRNTFFCEECQ 268
>gi|62182219|ref|YP_218636.1| formamidopyrimidine-DNA glycosylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|75505480|sp|Q57IA7|FPG_SALCH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|62129852|gb|AAX67555.1| formamidopyrimidine DNA glycosylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (269 aa)
Score = 310, Expect = 9.9e-27, Identities = 89/275 (32%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L     L+  I N     P         D  + + +  +  + R+ KYL+  L  D   ++HL M G L     ++   +KH  V + M + +I RY D RRFG +    E   L+   +   LG +PL  EF+ +YL+    K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  +   +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C  CQK
  S:     1 MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWP-------VSDEIYRLSDTPVLSVQRRAKYLLLELP-DGWIIIHLGMSGSLRI-LPEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSGEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRHCQK 269
>gi|48474237|sp|Q8VW76|FPG_PASPI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|16904663|dbj|BAB71962.1| formamidopyrimidine-DNA glycosylase homolog [Photobacterium damselae subsp. piscicida] (269 aa)
Score = 310, Expect = 1.0e-26, Identities = 86/275 (31%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKE--IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     L++T+T+I      + +N        D  + I  + I  + R+ KYL+   T     +VHL M G L      ++  +KH  V + +   EI RY+D RRFG +        +D+K   + KLG +PL + F   YL+   K    AIK  ++D   V G+GNIYA+E LF++ IHP+  A ++T      + +  + +LA A++  GTT+  +     + G F + L+V+ K    C  C  ++ ++K+  R T  C +CQ+
  S:     1 MPELPEVEVTRLGITPH-VLHQTVTDI------VIRNGRLRWPIPDDINQIKQQPITKVRRRAKYLLLD-TPVGSAIVHLGMSGSLRVLPAGTA-PEKHDHVDLALSSGEILRYNDPRRFGAWLW----QPVDTKHHVLAKLGPEPLTDVFTADYLQQKAKGKRTAIKQFIMDNHIVVGVGNIYANESLFSAGIHPQKAAGEVTPQALTVLVDEIKAVLAFAIQQGGTTLKDFKNADGKPGYFAQELQVYGKGGLPCPKCGTELAEVKIGQRATVYCSQCQQ 269
>gi|50119109|ref|YP_048276.1| formamidopyrimidine-DNA glycosylase [Pectobacterium atrosepticum SCRI1043] >gi|81693474|sp|Q6DAV4|FPG_ERWCT Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|49609635|emb|CAG73068.1| formamidopyrimidine-DNA glycosylase [Erwinia carotovora subsp. atroseptica SCRI1043] (269 aa)
Score = 310, Expect = 1.1e-26, Identities = 89/274 (32%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKE----IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +     +  TI   E    ++    S E  +  + +E +  + R+ KYL+  LT+  + +VHL M G L     + S  +KH  V + MD  ++ RY D RRFG +       + DS E    +  LG +PLE EF   YL    +    AIK  ++D + V G+GNIYA E LFA+ IHP+  A  L +ND   +    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C   I   K   R T+ C +CQ
  S:     1 MPELPEVETSRRGISPY-LVGHTILYAEVRNARLRWPVSAEILS--LSDEPVLSVRRRAKYLLIELTHGWI-IVHLGMSGSLRI-LPEYSEPEKHDHVDLVMDSGKVLRYTDPRRFGAWL------WTDSLETSSVLAHLGPEPLEAEFFADYLYQASRGKKTAIKQWIMDNKVVVGVGNIYASESLFAAGIHPDRAAGSLNENDADVLVRVIKQVLQLSIEQGGTTLRDFLQSDGKPGYFAQELRVYGRNGEPCRTCGTPIETAKHGQRSTFFCRRCQ 268
>gi|24376198|ref|NP_720242.1| formamidopyrimidine-DNA glycosylase [Shewanella oneidensis MR-1] >gi|29611714|sp|Q8E8D9|FPG_SHEON Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|24351249|gb|AAN57685.1|AE015904_8 formamidopyrimidine-DNA glycosylase [Shewanella oneidensis MR-1] (271 aa)
Score = 310, Expect = 1.1e-26, Identities = 84/276 (30%), Positives = 137/276 (49%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTF---TIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L +Q  ++  + N     P         +    II + I+ + R+ KYL+   T+    +VHL M G L     D+  +K   +  +  +   +R++D RRFG +    +  E + L    ++KLG +PL + F+   L  ++    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + ILA A++  GTT+  +     + G F + L V+ +    C  C N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGITPYLVDQTVVDLIVRNPSLRWP-------VPELAKQIIGQTIRQVRRRAKYLLID-TDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAWLWCQLPEEAHPL----LEKLGPEPLTDAFNVNQLAASLAGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTQCGNLLSEIRLGQRTTVFCSICQPR 271
>gi|109648467|ref|ZP_01372366.1| Formamidopyrimidine-DNA glycolase [Desulfitobacterium hafniense DCB-2] >gi|109639764|gb|EAT49320.1| Formamidopyrimidine-DNA glycolase [Desulfitobacterium hafniense DCB-2] (272 aa)
Score = 309, Expect = 1.3e-26, Identities = 79/274 (28%), Positives = 135/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD---KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PE+++  + L +   L++ I   E I      N   ++F  ++ +  I+ + R GKYLI  L++ K    H+ ++G++++E      +   + H+  +++  D+ I +    R G   +   +     KE   LGLDPL+ EF      N +      IK  L+DQ+N+SGIGN Y++EILFA+ I PE     LTD +  ++      +L +A+   G     +    +  G    + KV+ +    C+ C   I +  V GR  Y CL CQ
  S:     1 MPEIPEMETYKNYL-QLSVLDKRIVGTE-ITRARSTNVPTDEFVRWVQDTSIEQVLRYGKYLILALSSGKALCAHMMLDGRMYYEVAGEPVELPGRSHI--RLKFADHSILHFCDLRLGYLKLLAPSQVDAIKE--GLGLDPLDAEFSLAAFLNILSGKRGMIKPLLMDQKNISGIGNAYSNEILFAAGILPERKTPTLTDGERDRLYGVIPDLLQQAIAKGGYIEEPFASWDKLSGGMIPYFKVYDRTGQPCLQCGEPIKQKTVGGRNAYYCLTCQ 271
>gi|78212042|ref|YP_380821.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Synechococcus sp. CC9605] >gi|78196501|gb|ABB34266.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. CC9605] (278 aa)
Score = 309, Expect = 1.3e-26, Identities = 88/274 (32%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK-VFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L ++  ++  I  +E   P+ I      ++F   +    +    R+GKYL+  L  +  V+ VHLRM G+  + +  S    KH  V++    + E+R+ D R FG          ++     + +LG +P   +F   YLK  +K S+R IKT LLDQ  V+G GNIYADE LFAS I P T A +L     +++ +    +L  ++   GTT + +   +   G +     V+ +    C NC   I + K++GR T+ C  CQ
  S:     1 MPELPEVETVRRGLADR-LVDFKIAQVEVCRPRAIASPGGPDEFVAGLCGTTVGQWHRRGKYLMTALEPESGVWGVHLRMTGQFQWHEQPSE-PCKHTRVRLWNSKEEELRFVDVRSFGEMWWVPPGQAIEEVITGLTRLGPEPFSADFSASYLKQKLKGSSRPIKTALLDQALVAGAGNIYADESLFASGIAPFTPAGQLNLQQLERLRDALVNVLTISIGAGGTTFSDFRDLEGVNGNYGGQAWVYRRGGEPCRNCGTTIQREKLSGRSTHWCPTCQ 277
>gi|119773259|ref|YP_925999.1| DNA-formamidopyrimidine glycosylase [Shewanella amazonensis SB2B] >gi|166198747|sp|A1S1S3|FPG_SHEAM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|119765759|gb|ABL98329.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Shewanella amazonensis SB2B] (271 aa)
Score = 309, Expect = 1.3e-26, Identities = 82/276 (29%), Positives = 137/276 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +      NR    +E++   I +N +      +    I+ + I  + R+ KYL+   T     +VHL M G L     ++  +K   +  +  +   +R++D RRFG + +++E        ++KLG +PL   F   YL+  +K   +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + IL +A++  GTT+  +     + G F + L V+ +    C  C + + +I++  R T  C  CQ K
  S:     1 MPELPEVEVTRQGIAPHLEGNR----VEAL---IVRNANLRWPVPELAQNIVGQTILGVRRRAKYLLID-TQAGTTIVHLGMSGSLRVLPKNTPVEKHDHIDLVMQNGRVLRFNDPRRFGAW-LWSELPEAAHPLLEKLGPEPLSAAFHADYLQAALKGKKKAIKLCLMDNAIVVGVGNIYANEALFAAGIHPEAEAGKVDAERLTLLTAEVKTILTQAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTECGHLLSEIRLGQRTTVFCSLCQTK 271
>gi|156972979|ref|YP_001443886.1| formamidopyrimidine-DNA glycosylase [Vibrio harveyi ATCC BAA-1116] >gi|166198756|sp|A7MSN3|FPG_VIBHB Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|156524573|gb|ABU69659.1| hypothetical protein VIBHAR_00657 [Vibrio harveyi ATCC BAA-1116] (269 aa)
Score = 309, Expect = 1.4e-26, Identities = 87/275 (31%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     + +TI       PK+  +   +     +  + I++I+R+ KYL+   T++   +VHL M G L     D     KH  V +++ + +I RY+D RRFG +     N       +  +G +PL EEF+  Y+    K    AIK  ++D + V G+GNIYA+E LF S IHP   A KLT  +++ + EN +  L  A++  GTT+  +     + G F + L V+ K    C  C   + + K+  R T+ C  CQK
  S:     1 MPELPEVEVSRMGISPH-MIGQTIKAFVFRTPKLRWDIPQK--LKKLEGQVIRNISRRAKYLLIE-TDEGTAIVHLGMSGSLRVLDADFP-PAKHDHVDLKLTNGKILRYNDPRRFGAWLWSAPNE--PHAVLGHMGPEPLTEEFNADYVAEKAKGKRVAIKQFIMDNKIVVGVGNIYANESLFKSRIHPTRPAGKLTKKEWQLLVENIKATLEIAIQQGGTTLKDFAQADGKPGYFAQELLVYGKAGEPCPECGEALQEQKIGQRNTFFCGVCQK 269
>gi|82779125|ref|YP_405474.1| formamidopyrimidine-DNA glycosylase [Shigella dysenteriae Sd197] >gi|90101317|sp|Q329M2|FPG_SHIDS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81243273|gb|ABB63983.1| formamidopyrimidine DNA glycosylase [Shigella dysenteriae Sd197] (269 aa)
Score = 308, Expect = 1.6e-26, Identities = 86/275 (31%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L    T+    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRI-LTEGLPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWAKE---LEGHNVLAHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|78778719|ref|YP_396831.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus str. MIT 9312] >gi|123554638|sp|Q31CK0|FPG_PROM9 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|78712218|gb|ABB49395.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus str. MIT 9312] (293 aa)
Score = 308, Expect = 1.7e-26, Identities = 99/275 (36%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIM-PKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT----------------NDKVFVVHLRMEGKLFFEKTDSSYDK-KHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L EQ   N  I  +E      +      E+F   + N  +    R+GKYLI  L                 N+   VVHLRM G  +F+  D+S    KH  +++ +  + E+RY D R FG      E    +   K +  LG +P  + FD KYLK  I K  ++IK  LLDQ  V+GIGNIYADE L+++ I P   A  +  N+   + E+   +L K++ + GTT + +   + + G F     V+ +   +C  C N I K K+ GR T+ C  CQK
  S:     1 MPELPEVETVRRGL-EQKLNNFIIKKVEVCRNSTVAFPTEKEEFIKGLQNSLLYKWDRRGKYLIAELKKIENENIKFPLKKLRQNNGFLVVHLRMTG--YFKFIDNSTQPCKHTRIRVFDKKNNELRYIDVRSFGQMWWIKEGLSPNKIIKGLGSLGPEPFSKNFDEKYLKKVISKRKKSIKAILLDQTIVAGIGNIYADESLYSAGISPFRAAKTIKKNELINLKESIVNVLKKSIGSGGTTFSDFRDLEGENGNFGLQTNVYRRTGKECRKCGNLIEKQKIAGRSTHWCPNCQK 293
>gi|108805235|ref|YP_645172.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Rubrobacter xylanophilus DSM 9941] >gi|108766478|gb|ABG05360.1| formamidopyrimidine-DNA glycosylase [Rubrobacter xylanophilus DSM 9941] (278 aa)
Score = 308, Expect = 1.7e-26, Identities = 80/274 (29%), Positives = 138/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPE   + + ++      R +   E   P +  N   E+F+  +    ++   R+GK ++       V +VHL + G++      +  D+ +  V +E +   +        G F +Y      +   + +LG DP  E F   YL    ++   A+K  LLDQ  V+G+GNIY DE+LFA+ +HP   A+ L++ + + I   +R IL +A+E +GTT  +Y     + G +Q+ L+V  +    C +C  +I K++V GRGT++C  CQ
  S:     1 MPELPETTVISEDIRRLAA-GRRVLRAEVFRPDV-TNVPPEEFSGRLRGRVLEGTGRRGKLIVLDF-GGVVGLVHLVISGRVLRLPAWTEPDRLNTAV-LEFEGGPVLSFAKLWLGYFHLYEPERVGEHPLLARLGPDPFSEGFTPGYLARAFRRR-AAVKGLLLDQSVVAGLGNIYVDEVLFAARVHPLRRADTLSEEEIRAIHAATRKILRRAIELRGTTFDSYHDAFGESGGYQRELRVFARAGKPCPSCGARIAKLRVAGRGTHVCPACQ 269
>gi|110643876|ref|YP_671606.1| formamidopyrimidine-DNA glycosylase [Escherichia coli 536] >gi|122957892|sp|Q0TBH4|FPG_ECOL5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|110345468|gb|ABG71705.1| formamidopyrimidine-DNA glycosylase [Escherichia coli 536] (269 aa)
Score = 308, Expect = 1.7e-26, Identities = 85/275 (30%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++   + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVEAIRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|126664537|ref|ZP_01735521.1| formamidopyrimidine-DNA glycosylase [Marinobacter sp. ELB17] >gi|126630863|gb|EBA01477.1| formamidopyrimidine-DNA glycosylase [Marinobacter sp. ELB17] (270 aa)
Score = 307, Expect = 2.0e-26, Identities = 86/275 (31%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +   L+ Q   +  + N     P        ED    +  E I+ + R+ KYL  +L +  V +VHL M G L    TD S    H  V++ +     +RY+D RRFG +     +N      I  LG +PL  EF+  YL    +  + A+K+ ++D   V G+GNIYA+E LF + IHP   A +++ + + ++ E  +  L  A+   GTT+  +     Q G F + L V+ +    C  C+ K+ +I++N R T  C +CQ+
  S:     1 MPELPEVETTRRGIAPHLEGQTVRSVGVRNGRLRWP------VPEDLAVRLEGEVIRSVERRAKYLFLNLDSGSV-IVHLGMSGSLRI-ITDDSAALTHDHVELTLHSGVRLRYNDPRRFGCWLW--SSNPSTHPLIASLGPEPLAPEFNGAYLFRRSRGKSTAVKSFIMDGHVVVGVGNIYANEALFGAGIHPRRQAGRISLSRYHRLVEVIQETLTAAILMGGTTLRDFVNSDGQPGYFAQSLLVYGRGGQPCPECQAKLREIRMNQRATVYCTRCQR 270
>gi|121602138|ref|YP_989473.1| formamidopyrimidine-DNA glycosylase [Bartonella bacilliformis KC583] >gi|166215609|sp|A1UU20|FPG_BARBK Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|120614315|gb|ABM44916.1| formamidopyrimidine-DNA glycosylase [Bartonella bacilliformis KC583] (291 aa)
Score = 307, Expect = 2.2e-26, Identities = 84/275 (30%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFE----KTDSSYDKK-----HVLVKIEMDD---YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDND------FKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+     +R I+   S+  K  +    E F+  +    I  ++R+ KYL+FHL+ ++  V HL M G    E    +   SY  K     H ++  +  +   Y + Y+D+RRFG   + +     +   ++ LGL+P++      YL+        ++K  LLDQ  V+G+GNIY  E L+ S + PE  A  L           K +A+N   ++++A+ + G+++  Y       G FQ    V+ ++  +C  C   IV+I  +GR ++ C +CQK
  S:     1 MPELPEVETVRRGLEPVLMGSRIIS--VSLGCKNLRFPFPESFSERLTGRIIIKLSRRAKYLLFHLSQNETIVSHLGMSGSWRVEDDLLRKKHSYMGKLVAHDHFIMSFQATNGKIYRLIYNDSRRFGFMLLADTMRLYEHPLLRNLGLEPIDNAVSGAYLQKAFINKKTSLKAALLDQSIVAGLGNIYVCEALWRSYLSPERRALTLASKSAHACELAKCLAQNICDVISEAIFSGGSSLRDYVHIDGSLGYFQHCFSVYGREGKECSRCGMHIVRIVQSGRSSFYCPQCQK 291
>gi|53802792|ref|YP_115459.1| formamidopyrimidine-DNA glycosylase [Methylococcus capsulatus str. Bath] >gi|81680673|sp|Q602J1|FPG_METCA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|53756553|gb|AAU90844.1| formamidopyrimidine-DNA glycosylase [Methylococcus capsulatus str. Bath] (271 aa)
Score = 307, Expect = 2.2e-26, Identities = 71/234 (30%), Positives = 121/234 (51%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           D    +   ++ D+ R+GKYL+    ++   + HL M G L   K      +KH  V +  + D  +RYHD RRFG   ++          +  LG +PL++ FD  +L       N A+K+ ++D   V+G+GNIYA+E LF + IHP   A K++   ++ + E+   +LA ++E  GTT+  +  +    G F++ L+V+ +    C  C   I  +++  R TY C +CQ+
  S:    40 DLGETLTGRRLTDVRRRGKYLLLDF-DEGTLIAHLGMSGSLRICKPGFP-PRKHDHVDLVFEGDICLRYHDPRRFGCL-LWTAEPPERHPLLAALGPEPLDKAFDGAHLHRLAAGRNTAVKSFIMDSRVVAGVGNIYANEALFRAGIHPARPAGKISLARYRNLGEHIAEVLAASIEQGGTTLRDFVNESGAPGYFKQVLRVYDRAGQPCRVCGEPIRCVRLGQRATYYCPRCQR 271
>gi|119503521|ref|ZP_01625604.1| formamidopyrimidine-DNA glycosylase [marine gamma proteobacterium HTCC2080] >gi|119460583|gb|EAW41675.1| formamidopyrimidine-DNA glycosylase [marine gamma proteobacterium HTCC2080] (269 aa)
Score = 307, Expect = 2.2e-26, Identities = 84/275 (30%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITN-------IESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    ID      C+ R +         IE  +P +               ++I    R+ KYL+  L +    +VHL M G L      S+    H  V I ++D   +RY+D RRFG+  I   +   D   ++ LG +PL  +FD  +L    +    A+K  L+D   V G+GNIYA+E LF + I P   A K++   ++++AE  +++LA A+E  GTT+  +     + G F + L+V+ + +  C  C  ++ +I++  R +  C  CQ+
  S:     1 MPELPEVETTRRGIDPHAVDRCIERVVIRNAQLRWPIEDGLPAL------------AAGQRILRTRRRAKYLLIDLEH-HTLMVHLGMSGSLRIMPA-STPPMFHDHVDIVLNDGNCLRYNDPRRFGSLHILTSD---DHALLRHLGPEPLSNDFDGVWLYEAARGRKAAVKQFLMDGRIVVGVGNIYANEALFMAGIRPTRSAGKISLIRYQRLAEAVKVLLAAAIERGGTTLRDFVGGDGKPGYFAQELRVYGRGNQLCRACSGRLQEIRLGNRSSVFCPACQR 269
>gi|83643461|ref|YP_431896.1| formamidopyrimidine-DNA glycosylase [Hahella chejuensis KCTC 2396] >gi|123535001|sp|Q2SPF3|FPG_HAHCH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|83631504|gb|ABC27471.1| formamidopyrimidine-DNA glycosylase [Hahella chejuensis KCTC 2396] (271 aa)
Score = 306, Expect = 2.6e-26, Identities = 79/275 (28%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKK-HVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +       R I  +    P++       D       + + ++TR+ KYL+ +L +D++ + HL M G L     ++   K  HV + +E  D  +RY+D RRFG   + N     +   +K LG +PL ++F  + L    ++    +KT L+DQ  V G+GNIYA+E LF + I P   A +++   ++ +AE  R +L+ A+   G T+  +     + G FQ+ L+ + +    C  C+ ++ +IK+  R +  C  CQ+
  S:     1 MPELPEVETTRRGVAPH-ITGRKILQVNIYEPRLRWPVPM-DLPAAAQGKTVLNVTRRAKYLLINLGDDEL-LFHLGMSGNLRIVAPETPRMKHDHVDILLE-GDITLRYNDPRRFGCLLLLNPPTQ-EHPLLKHLGPEPLSDQFSGELLYKRSRQRKSPVKTFLMDQAIVVGVGNIYANEALFLAGIRPTRAAGEVSLKRYQVLAEAVRKVLSDAINMGGATLRDFVGGDGKPGYFQQTLRAYGRGGQPCTVCQTELKEIKLGQRTSVFCPSCQR 271
>gi|90580917|ref|ZP_01236719.1| formamidopyrimidine-DNA glycosylase [Vibrio angustum S14] >gi|90437988|gb|EAS63177.1| formamidopyrimidine-DNA glycosylase [Vibrio angustum S14] (269 aa)
Score = 306, Expect = 2.8e-26, Identities = 83/275 (30%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     +++T+  I    P++       +    I  + I+ +TR+ KYL+   T+    +VHL M G L      +  +K H  V + +   E+ RY+D RRFG +    E   +    ++K+G +PL ++F+ +YL    +    AIK  ++D   V G+GNIYA+E LFA+ IHP+  A K++     K+    + +LA A++  GTT+  +     + G F + L+V+ K    C  C   + + K+  R T  C  CQK
  S:     1 MPELPEVEVSRMGISPH-VIDQTVKQIIIRNPRL--RWPIPEAIKAIEGQVIRGVTRRAKYLLLE-TDVGYAIVHLGMSGSLRVLPVGTPVEK-HDHVDLVLTSGEVLRYNDPRRFGAWLW--EEKGVTHPVLEKMGPEPLSDDFNVEYLHEKAQGKRTAIKQFIMDNHVVVGVGNIYANESLFAAGIHPKRAAGKISLARMTKLVAEIKSVLAFAIKQGGTTLKDFKNADGKPGYFAQELQVYGKAGKPCPKCGKALSEAKIGQRATVFCSDCQK 269
>gi|91775039|ref|YP_544795.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Methylobacillus flagellatus KT] >gi|123254763|sp|Q1H3I3|FPG_METFK Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|91709026|gb|ABE48954.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Methylobacillus flagellatus KT] (279 aa)
Score = 305, Expect = 3.4e-26, Identities = 80/275 (29%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITN-----------IESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     L  +  +  T+T            I S +P++                ++ ++ R+GKY+I    +    ++HL M G+L   ++D+ + +KH    +   D  + R  D RRFG   ++  +   +   +K LG +PL+E F+ ++L+  I+  +  IKT ++D   V G+GNIYA E LF + IHPET A  LT    +++ E  ++ L  A++  G+++  +F      G FQ+   V+ +    C  C+  I  +++  R T+ C  CQ+
  S:     1 MPELPEVEVTRRGL--EPLIGATVTQAVIRQPAMRWPIPSHLPQVLHGA------------RLLELRRRGKYIIARFESG-CLILHLGMSGRLCLLESDT-FPEKHDHFDLHFADGRVMRMRDPRRFGA-VLWAGDQPDEHSLLKVLGQEPLDEAFNGEFLQQAIRTRSSPIKTVIMDSHLVVGVGNIYASESLFRAGIHPETPARALTLAQCRRLVEEVKLTLQDALQAGGSSLRDFFGADGNPGYFQQTYFVYGRTGQPCRVCQTPIAVLRLGQRSTFYCPACQQ 270
>gi|193063825|ref|ZP_03044912.1| formamidopyrimidine-DNA glycosylase [Escherichia coli E22] >gi|194430623|ref|ZP_03063077.1| formamidopyrimidine-DNA glycosylase [Escherichia coli B171] >gi|192930540|gb|EDV83147.1| formamidopyrimidine-DNA glycosylase [Escherichia coli E22] >gi|194411335|gb|EDX27703.1| formamidopyrimidine-DNA glycosylase [Escherichia coli B171] (269 aa)
Score = 305, Expect = 3.4e-26, Identities = 85/275 (30%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V++ M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVELVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|26250281|ref|NP_756321.1| formamidopyrimidine-DNA glycosylase [Escherichia coli CFT073] >gi|29611716|sp|Q8FC87|FPG_ECOL6 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|26110711|gb|AAN82895.1|AE016769_10 Formamidopyrimidine-DNA glycosylase [Escherichia coli CFT073] (269 aa)
Score = 305, Expect = 3.5e-26, Identities = 85/275 (30%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL    +K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDDFNGEYLHQKCEKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|152979915|ref|YP_001354814.1| formamidopyrimidine-DNA glycosylase [Janthinobacterium sp. Marseille] >gi|166215629|sp|A6T2R7|FPG_JANMA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|151279992|gb|ABR88402.1| formamidopyrimidine-DNA glycosylase [Janthinobacterium sp. Marseille] (273 aa)
Score = 305, Expect = 4.1e-26, Identities = 76/224 (33%), Positives = 118/224 (52%)
  Q:    52 IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN------ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           ++   R+GKYL+ H  +    ++HL M G L    +D    KKH    +E+    +R  D RRFG    +       EN+ L    ++ LG++PLE  F  ++L    +  + AIK  LL  + V G+GNIYA E LF + I+P+T A+++    ++++AE  R ILA A+E  G+T+  +     Q G FQ+    + +    C  CK  I +I    R T+ C  CQK
  S:    50 VRSTGRRGKYLLIHF-DHGTLIIHLGMSGHLRILPSDVP-PKKHDHFDLEIGPQLLRLTDPRRFGAVLWHAAEDGSIENHLL----LRTLGVEPLEAAFSAQWLYQQTRNRSSAIKQVLLAGDIVVGVGNIYASESLFQARINPKTPAHRIGLARYERLAEAIRQILAAAIEQGGSTLKDFIGVNGQSGYFQQNYFCYARTGEPCRICKTPIRQIVQGQRSTFYCPNCQK 273
>gi|78185409|ref|YP_377844.1| formamidopyrimidine-DNA glycolase [Synechococcus sp. CC9902] >gi|78169703|gb|ABB26800.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Synechococcus sp. CC9902] (278 aa)
Score = 304, Expect = 4.9e-26, Identities = 89/275 (32%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT-NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L ++   +  I  IE    + I      + F   +    +   +R+GKYL+  L  N   + VHLRM G+  +  T ++    H  V+     + E+R+ D R FG      E + LDS    +K+LG +P  + F   YLK  +K S R IKT LLDQ  ++G+GNIYADE LFA+ I P + + KLT     ++ +    +L  ++   GTT + +   +   G +     V+ +    C  C   I + K++GR T+ C  CQ+
  S:     1 MPELPEVETVRRGLADR-LESFEIAEIEVCRARAIASPGGVDHFVAGLKGATVGAWSRRGKYLMAQLEPNRGSWGVHLRMTGQFQWHATPAA-PCSHTRVRFWNQHNEELRFVDLRSFGEMWWIPEGDDLDSVMTGLKRLGPEPFSDAFTGAYLKQRLKGSARPIKTALLDQSLIAGVGNIYADESLFAAGIPPLSPSGKLTIEQLIRLRDELVNVLHISIGVGGTTFSDFRDLEGVNGNYGGQSWVYRRSGQPCRKCGTPISREKLSGRSTHWCPSCQR 278
>gi|16131506|ref|NP_418092.1| formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Escherichia coli str. K-12 substr. MG1655] >gi|89110376|ref|AP_004156.1| formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Escherichia coli W3110] >gi|157163116|ref|YP_001460434.1| formamidopyrimidine-DNA glycosylase [Escherichia coli HS] >gi|170083143|ref|YP_001732463.1| formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Escherichia coli str. K12 substr. DH10B] >gi|194435950|ref|ZP_03068053.1| formamidopyrimidine-DNA glycosylase [Escherichia coli 101-1] >gi|120475|sp|P05523|FPG_ECOLI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166988460|sp|A8A697|FPG_ECOHS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|41481|emb|CAA29431.1| unnamed protein product [Escherichia coli] >gi|466773|gb|AAB18612.1| formamidopyrimidine-DNA glycosylase [Escherichia coli] >gi|1790066|gb|AAC76659.1| formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Escherichia coli str. K-12 substr. MG1655] >gi|85676407|dbj|BAE77657.1| formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Escherichia coli W3110] >gi|157068796|gb|ABV08051.1| formamidopyrimidine-DNA glycosylase [Escherichia coli HS] >gi|169890978|gb|ACB04685.1| formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase [Escherichia coli str. K12 substr. DH10B] >gi|194425493|gb|EDX41477.1| formamidopyrimidine-DNA glycosylase [Escherichia coli 101-1] (269 aa)
Score = 304, Expect = 5.3e-26, Identities = 85/275 (30%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|15804176|ref|NP_290215.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 EDL933] >gi|15833764|ref|NP_312537.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. Sakai] >gi|30065089|ref|NP_839260.1| formamidopyrimidine-DNA glycosylase [Shigella flexneri 2a str. 2457T] >gi|56480390|ref|NP_709414.2| formamidopyrimidine-DNA glycosylase [Shigella flexneri 2a str. 301] >gi|74314131|ref|YP_312550.1| formamidopyrimidine-DNA glycosylase [Shigella sonnei Ss046] >gi|82545998|ref|YP_409945.1| formamidopyrimidine-DNA glycosylase [Shigella boydii Sb227] >gi|91213151|ref|YP_543137.1| formamidopyrimidine-DNA glycosylase [Escherichia coli UTI89] >gi|110807687|ref|YP_691207.1| formamidopyrimidine-DNA glycosylase [Shigella flexneri 5 str. 8401] >gi|117625909|ref|YP_859232.1| formamidopyrimidine-DNA glycosylase [Escherichia coli APEC O1] >gi|157158292|ref|YP_001465115.1| formamidopyrimidine-DNA glycosylase [Escherichia coli E24377A] >gi|168709311|ref|ZP_02741588.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4045] >gi|168735141|ref|ZP_02767418.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4115] >gi|168748717|ref|ZP_02773739.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4113] >gi|168753459|ref|ZP_02778466.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4401] >gi|168759732|ref|ZP_02784739.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4501] >gi|168766055|ref|ZP_02791062.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4486] >gi|168772399|ref|ZP_02797406.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4196] >gi|168779790|ref|ZP_02804797.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4076] >gi|168785511|ref|ZP_02810518.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC869] >gi|168791146|ref|ZP_02816153.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4042] >gi|170018135|ref|YP_001723089.1| formamidopyrimidine-DNA glycosylase [Escherichia coli ATCC 8739] >gi|170684053|ref|YP_001745935.1| formamidopyrimidine-DNA glycosylase [Escherichia coli SMS-3-5] >gi|187731323|ref|YP_001882332.1| formamidopyrimidine-DNA glycosylase [Shigella boydii CDC 3083-94] >gi|188491930|ref|ZP_02999200.1| formamidopyrimidine-DNA glycosylase [Escherichia coli 53638] >gi|191167823|ref|ZP_03029629.1| formamidopyrimidine-DNA glycosylase [Escherichia coli B7A] >gi|191170358|ref|ZP_03031911.1| formamidopyrimidine-DNA glycosylase [Escherichia coli F11] >gi|194430989|ref|ZP_03063282.1| formamidopyrimidine-DNA glycosylase [Shigella dysenteriae 1012] >gi|195936196|ref|ZP_03081578.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4024] >gi|122421890|sp|Q1R4V8|FPG_ECOUT Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|122957052|sp|Q0SYG3|FPG_SHIF8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166215623|sp|A1AHG8|FPG_ECOK1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166988459|sp|A7ZTI6|FPG_ECO24 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|189044588|sp|B1IZF8|FPG_ECOLC Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|54037117|sp|P64149|FPG_SHIFL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|54040771|sp|P64148|FPG_ECO57 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|90101316|sp|Q31UZ1|FPG_SHIBS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|90101318|sp|Q3YVZ7|FPG_SHISS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|12518391|gb|AAG58779.1|AE005591_3 formamidopyrimidine DNA glycosylase [Escherichia coli O157:H7 EDL933] >gi|13363985|dbj|BAB37933.1| formamidopyrimidine DNA glycosylase [Escherichia coli O157:H7 str. Sakai] >gi|30043350|gb|AAP19071.1| formamidopyrimidine DNA glycosylase [Shigella flexneri 2a str. 2457T] >gi|56383941|gb|AAN45121.2| formamidopyrimidine DNA glycosylase [Shigella flexneri 2a str. 301] >gi|73857608|gb|AAZ90315.1| formamidopyrimidine DNA glycosylase [Shigella sonnei Ss046] >gi|81247409|gb|ABB68117.1| formamidopyrimidine DNA glycosylase [Shigella boydii Sb227] >gi|91074725|gb|ABE09606.1| formamidopyrimidine DNA glycosylase [Escherichia coli UTI89] >gi|110617235|gb|ABF05902.1| formamidopyrimidine DNA glycosylase [Shigella flexneri 5 str. 8401] >gi|115515033|gb|ABJ03108.1| formamidopyrimidine-DNA glycosylase [Escherichia coli APEC O1] >gi|157080322|gb|ABV20030.1| formamidopyrimidine-DNA glycosylase [Escherichia coli E24377A] >gi|169753063|gb|ACA75762.1| formamidopyrimidine-DNA glycosylase [Escherichia coli ATCC 8739] >gi|170521771|gb|ACB19949.1| formamidopyrimidine-DNA glycosylase [Escherichia coli SMS-3-5] >gi|187428315|gb|ACD07589.1| formamidopyrimidine-DNA glycosylase [Shigella boydii CDC 3083-94] >gi|187771367|gb|EDU35211.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4196] >gi|188016969|gb|EDU55091.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4113] >gi|188487129|gb|EDU62232.1| formamidopyrimidine-DNA glycosylase [Escherichia coli 53638] >gi|189002553|gb|EDU71539.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4076] >gi|189358964|gb|EDU77383.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4401] >gi|189364460|gb|EDU82879.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4486] >gi|189369599|gb|EDU88015.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4501] >gi|189374639|gb|EDU93055.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC869] >gi|190902166|gb|EDV61909.1| formamidopyrimidine-DNA glycosylase [Escherichia coli B7A] >gi|190909166|gb|EDV68752.1| formamidopyrimidine-DNA glycosylase [Escherichia coli F11] >gi|194420444|gb|EDX36520.1| formamidopyrimidine-DNA glycosylase [Shigella dysenteriae 1012] (269 aa)
Score = 304, Expect = 5.4e-26, Identities = 85/275 (30%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|21730426|pdb|1K82|A Chain A, Crystal Structure Of E.Coli Formamidopyrimidine-Dna Glycosylase (Fpg) Covalently Trapped With Dna >gi|21730427|pdb|1K82|B Chain B, Crystal Structure Of E.Coli Formamidopyrimidine-Dna Glycosylase (Fpg) Covalently Trapped With Dna >gi|21730428|pdb|1K82|C Chain C, Crystal Structure Of E.Coli Formamidopyrimidine-Dna Glycosylase (Fpg) Covalently Trapped With Dna >gi|21730429|pdb|1K82|D Chain D, Crystal Structure Of E.Coli Formamidopyrimidine-Dna Glycosylase (Fpg) Covalently Trapped With Dna (268 aa)
Score = 303, Expect = 6.4e-26, Identities = 85/274 (31%), Positives = 142/274 (51%)
  Q:     2 PELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 PELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 268
>gi|39933164|ref|NP_945440.1| formamidopyrimidine-DNA glycosylase [Rhodopseudomonas palustris CGA009] >gi|81564483|sp|Q6NDM1|FPG_RHOPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|39652789|emb|CAE25528.1| formamidopyrimidine-DNA glycosylase [Rhodopseudomonas palustris CGA009] (291 aa)
Score = 303, Expect = 6.8e-26, Identities = 85/275 (30%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLK---EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-----------SYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPE----TIANKL---TDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+   E   ++R + + E++   + K     DF   +  + +  + R+ KYL+  L++  V ++HL M G     + D            S D+ H  V  EM     + ++D RRFG   ++  +       +K LG +PL   FD   L         ++K  LLDQ  V+G+GNIY  E LF + + P+    T+AN+    TD+   ++ E  R +L +A++  G+++  +     + G FQ   KV+ ++   C  C   + +   NGR T+ C KCQK
  S:     1 MPELPEVETVRRGLQPAMEGFRIDRAVAHRENLRFPLQK-----DFVARLTGQTVTGLGRRAKYLLADLSSGDVLLMHLGMSGSFRVVEADGETRPGEFHYPRSEDRTHDHVVFEMASGARVVFNDPRRFGFMKVFPRSEIETEPHLKGLGPEPLGNAFDASLLAKACAGKQTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPKRKASTLANRKDEPTDHAV-RLTEAIREVLGEAIKAGGSSLRDHRQTSGELGYFQHAFKVYDREGEPCPTCGGTVQRFVQNGRSTFWCPKCQK 291
>gi|193070399|ref|ZP_03051341.1| formamidopyrimidine-DNA glycosylase [Escherichia coli E110019] >gi|192956338|gb|EDV86799.1| formamidopyrimidine-DNA glycosylase [Escherichia coli E110019] (269 aa)
Score = 303, Expect = 7.4e-26, Identities = 83/275 (30%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI  + +++          +  + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATI--LRAVVRNGRLRWPVSEELYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|37522976|ref|NP_926353.1| formamidopyrimidine-DNA glycosylase [Gloeobacter violaceus PCC 7421] >gi|39931205|sp|Q7NFW7|FPG_GLOVI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|35213979|dbj|BAC91348.1| formamidopyrimidine-DNA glycosylase [Gloeobacter violaceus PCC 7421] (284 aa)
Score = 302, Expect = 7.7e-26, Identities = 82/277 (29%), Positives = 137/277 (49%)
  Q:     1 VPELPEVQSV----IDSLKEQGCLNRTITNIESIM----PKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV+++    +  L  +  +   +   +S+     P IF     E     I ++++    R+GKYL+ +        VHLRM G+L +   ++  +  H  V+I M   +E+R+ D R FG   +       +     + +LG +P  E FD  YL       N+ +K+ LLDQ+ V+G+GNIYADE LF+S IHP      L     +++      +L   +  +G T+  Y   +   G +     V+ +K   C  C   I +I++ GR T+ C  CQ+ +
  S:     1 MPELPEVETLRRDLLIHLPGERVVGVEVLRSDSVGYPADPAIF----IEQMQGQIFSDRM---LRRGKYLLLYFARGAALGVHLRMSGRLLWRCGEAPLEP-HTRVRIPMASGHELRFEDMRVFGRLWLIPVGVPPERVMGGLTRLGPEPFAEMFDGPYLAGRFAGRNQPVKSALLDQQLVAGVGNIYADEALFSSGIHPALPVGGLDAAALERLHRAVVKVLEAGIAQRGATLRNYTDAQGINGNYAGTAWVYGRKGQPCRVCNTPIERIRLAGRSTHFCPTCQRAQ 280
>gi|113954166|ref|YP_729781.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. CC9311] >gi|113881517|gb|ABI46475.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. CC9311] (290 aa)
Score = 301, Expect = 1.0e-25, Identities = 92/274 (33%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNR----TITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHL------------TNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V      +G  NR     I+++E    + I      E F   ++N ++ +  R+GKYL   L             +   + VHLRM G+  + + D+    KH  V+       E+R+ D R F        +  ++S    +KKLG +P  ++F  +YL+   K S R+IK  LLDQ  V+G GNIYADE LFA+ I P+T A +L     +K+ E    IL  ++   GTT + +   +   G +     V+ +    C  C   I +IK+ GR T+ C  CQ
  S:     1 MPELPEVETV-----RRGLANRLDQFVISDLEVCRDRAIASPGGPECFESGLLNCRVGNWMRRGKYLYSELYRPGSAEANSAEESAGYWGVHLRMTGQFQWIEDDTP-PCKHTRVRFWNAKGQELRFVDLRSFAEMWWVPPDTAVESIITGLKKLGPEPFSQDFKTQYLQERFKGSTRSIKAALLDQSIVAGTGNIYADESLFAAGICPQTPAGQLNRKQLEKLRECLIEILELSIGAGGTTFSDFRDLEGVNGNYGGQAAVYRRTGQPCPKCGKAIERIKLAGRSTHWCSSCQ 288
>gi|126734088|ref|ZP_01749835.1| formamidopyrimidine-DNA glycosylase [Roseobacter sp. CCS2] >gi|126716954|gb|EBA13818.1| formamidopyrimidine-DNA glycosylase [Roseobacter sp. CCS2] (283 aa)
Score = 301, Expect = 1.0e-25, Identities = 84/275 (30%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSV---IDSLKE-----QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFE-KTDSSYDK------KHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   I  + E     Q  +NR   ++    P              +  +++  + R+ KY++  L + +  ++HL M G++     T   +        KH  V   MDD   I ++D RRFG   +       D   I+ LG +PL   F+  YL   +K  N  IK+ LLDQ  VSG+GNIY  E+LF + IHP   A +++      +    R +L++A+   G+++  Y     + G FQ   +V+ ++   CV   C   I +I  +GR ++ C +CQ+
  S:     1 MPELPEVETVKAGIAPVMEGHVIAQADVNRP--DLRWPFPA--------QMAKRLTGKRVLGLRRRSKYILVDLDSAETLLIHLGMSGRMLISGHTVGEFHHPHPVPAKHDHVVFHMDDGARITFNDARRFGAMDLMETATQDDHWLIRDLGPEPLGNAFNESYLIERLKGRNTPIKSALLDQRIVSGLGNIYVCEVLFRAGIHPARKAGRISAARVATLVPLIRDVLSEAIAAGGSSLRDYRQSDGELGYFQHVFQVYDREGEPCVTPGCDRTITRIVQSGRSSFFCPQCQR 283
>gi|149173447|ref|ZP_01852077.1| formamidopyrimidine-DNA glycosylase [Planctomyces maris DSM 8797] >gi|148847629|gb|EDL61962.1| formamidopyrimidine-DNA glycosylase [Planctomyces maris DSM 8797] (282 aa)
Score = 301, Expect = 1.1e-25, Identities = 84/274 (30%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNC-----------SYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEG-KLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI--ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKN-KIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++++  ++E          +E    K F+NC             +      +N+ +  + R+ K +I  L N   FV+  RM G  L  +  D+ + +    ++       + + D R  GT  + +          +KLG D LE       LK  + K++RAIK  LLDQ+ V+GIGN+YA E+L  S IHPE  A++L+  + + + +  + IL  A+  +G+T+   TY     Q G +Q   +V+ +++ +C +CK  +IV+I    R T+ C  CQ
  S:     1 MPELPEVETMVRGIREA---------VEGRKIKDFRNCPCPCKPISMKPGIKSIRTKALNQTVTSVRRRAKRVILDLENGYSFVIEPRMTGLMLLSDPPDTGHLRLEWTLQKGRSSRSLWFWDRRGLGTVQLLSRKEQELVLGPQKLGPDALE--ITANELKQRLAKTSRAIKVALLDQKMVAGIGNLYASEMLHQSRIHPERTADQLSTAEIRSLHKAMQQILKTAIRYEGSTLGDGTYRNALNQSGGYQNQHQVYGQEEKNCPSCKGAQIVRIVQAQRSTFFCPCCQ 278
>gi|6016043|sp|P95744|FPG_SYNEN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|1781316|emb|CAA71333.1| formamidopyrimidine-DNA glycosylase [Synechococcus elongatus] (284 aa)
Score = 300, Expect = 1.4e-25, Identities = 85/274 (31%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSK--EIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E   L + I ++E ++ + I      + F  ++ + +I+   R+GKYL+  L +    V+HLRM G+L +  T       H  V+       E+R+ D R FG       +  +      +  L  +PL E F   +L   +    R+IKT LLDQ  V+G+GNIYADE LF S +HP   A+ LT    +++      +L + +   GTTI T+       G +     V+ +K   C  C   I ++++ GR ++ C +CQ
  S:     1 MPELPEVETVRRGL-ELVTLKQPIVDVEVLLARSIALPKEPQAFIEHLRDRRIEQWQRRGKYLLATLDDGSRLVIHLRMSGQLLWLTTPQP-PCPHTRVRWFFPTRAELRFVDQRTFGRCWWLPPDCRVAEAIPALATLAPEPLSEAFTVAFLAARLAHCRRSIKTALLDQSIVAGMGNIYADESLFLSGLHPTQSAHTLTPEQVQRLHGVICQVLREGIAAGGTTIRTFMSPAGVNGHYGGQAWVYGRKGEACRVCGTTIERLRLAGRSSHYCPQCQ 276
>gi|159902905|ref|YP_001550249.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. MIT 9211] >gi|159888081|gb|ABX08295.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. MIT 9211] (286 aa)
Score = 300, Expect = 1.4e-25, Identities = 95/274 (34%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK---------VFVVHLRMEGKLFFE-KTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI---KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E+   N  I N+E +  + I  N     F   + +      +R+GKYLI  L  +            VVHLRM G  +FE   ++     H  V+       EIR+ D R FG    +   N L S+ I   K LG +P  ++F+ +YLK  +K   R+IK++LLDQ  ++G+GNIYADE LF + I P   +  L   + KK+ ++   IL  ++   GTT + +   +   G +  +  V+ +    C  C   I K KV GR T+ C  CQ
  S:     1 MPELPEVETVRKGL-EKRLKNFYIDNVEVLSERSIASNGGSNVFIFNLKDLVFGRWSRRGKYLIASLCKESDLIEEIPSGTLVVHLRMTG--YFEWHQNTKAPCTHTRVRFWNKKGSEIRFIDIRNFGQMW-WIPPNKLPSEVINGLKNLGPEPFSKDFNPEYLKYCLKGRKRSIKSSLLDQSILAGVGNIYADESLFEAGITPIKASGDLNGCELKKLCKSLTRILKASIGKGGTTFSDFRDLEGLNGTYGGYAWVYRRNQKPCRKCGTLIEKTKVAGRSTHWCPNCQ 285
>gi|167367350|ref|ZP_02301492.1| formamidopyrimidine-DNA glycosylase [Rhodopseudomonas palustris TIE-1] (324 aa)
Score = 300, Expect = 1.6e-25, Identities = 85/275 (30%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLK---EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-----------SYDKKHVLVKIEM-DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPE----TIANKL---TDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+   E   ++R + + E++   + K     DF   +  + +  + R+ KYL+  L++  V ++HL M G       D            S D+ H  V  EM     + ++D RRFG   ++  +       +K LG +PL   FD   L         ++K  LLDQ  V+G+GNIY  E LF + + P+    T+AN+    TD+   ++ E  R +L +A++  G+++  +     + G FQ   KV+ ++   C  C   + +   NGR T+ C KCQK
  S:    34 MPELPEVETVRRGLQPAMEGFRIDRAVAHRENLRFPLQK-----DFAARLTGQTVTGLGRRAKYLLADLSSGDVLLMHLGMSGSFRVIGADGETTPGEFHYPRSEDRTHDHVVFEMASGARVVFNDPRRFGFMKVFPRSEIETEPHLKGLGPEPLGNAFDASLLAKACAGKQTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPKRKASTLANRKEEPTDHAV-RLTEAIREVLGEAIKAGGSSLRDHRQTSGELGYFQHAFKVYDREGKPCPTCGGTVQRFVQNGRSTFWCPKCQK 324
>gi|160900861|ref|YP_001566443.1| formamidopyrimidine-DNA glycosylase [Delftia acidovorans SPH-1] >gi|160366445|gb|ABX38058.1| formamidopyrimidine-DNA glycosylase [Delftia acidovorans SPH-1] (276 aa)
Score = 300, Expect = 1.6e-25, Identities = 80/275 (29%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF---EKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFT-IYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+    +   Q    R    IES+                +    +  + R+GKYL+  L+ + + ++HL M G L F    +        H    ++     +R HD RRFG    +  E++    + +  LG++PL++ F ++  +  +K S   IK  LL+   V G+GNIYA E+LF + I P   A ++     +++ E  R +LA AVE  GTT+  +       G FQ   KV+ ++   C +C + +  ++   R TY C +CQK
  S:     1 MPELPEVEVTRRAFAAQIAGAR----IESVALGKPLRWPLGIAPELLAGRDVHGVRRRGKYLLMELS-EGLLMLHLGMSGSLRFVAPHEAPLGPAGTHDHFDLQTSKGLLRLHDPRRFGAVMYVAAESDPWARRLLDHLGMEPLDDSFSFETFRAGLKASRTPIKQLLLNGSVVVGVGNIYASEVLFMARIAPTQPACEVGPRKVRRLFEEIRRVLALAVEQGGTTLRDFSAPDGMAGHFQLQAKVYGREGLPCTHCGSPVQMLRQGQRSTYFCARCQK 274
>gi|145296036|ref|YP_001138857.1| formamidopyrimidine-DNA glycosylase [Corynebacterium glutamicum R] >gi|166215621|sp|A4QFD9|FPG_CORGB Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|140845956|dbj|BAF54955.1| hypothetical protein [Corynebacterium glutamicum R] (286 aa)
Score = 299, Expect = 1.7e-25, Identities = 84/277 (30%), Positives = 145/277 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTN--------DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV+ V   L++   +  TI +   + P+  +N      +    I   ++    R+GK+L   L +        D   +VHL M G++  ++ D+     H+  KIE+D+  E+ + D R FG + +    + +D   + +  +  D L+E  D+  +  N+K     IK  LL+QE VSGIGNIYADE+L+ + IHP   A++L+    +++ +  + ++ KA+   GT+  A Y       G F   L  + +    C  C  +IV+     RG++ C  CQK++
  S:     1 MPELPEVEVVRRGLEDH-MVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRGKFLWLELIDAPSGETRPDLGLLVHLGMSGQMLIKEPDAPI-SPHLRAKIELDNGDEVWFVDQRTFGYWWL---GDLVDGVPERVSHIATDVLDESADFSAIARNLKSRKSEIKRLLLNQEIVSGIGNIYADEMLWQAKIHPLQRADRLSLARLEELLQAGKDVMTKALAQGGTSFDALYVNVNGNSGYFSLSLNAYGQTGEPCGRCGTQIVRENFMNRGSHYCPNCQKRR 286
>gi|171464197|ref|YP_001798310.1| formamidopyrimidine-DNA glycosylase [Polynucleobacter necessarius STIR1] >gi|171193735|gb|ACB44696.1| formamidopyrimidine-DNA glycosylase [Polynucleobacter necessarius STIR1] (278 aa)
Score = 299, Expect = 1.9e-25, Identities = 86/276 (31%), Positives = 137/276 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD--KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI--KKLGLDPLEEEFDWKY----LKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +       R ++ ++ I  ++ +     + T  +  + +  I R+GKYL+  + +    ++HL M G L   +   S D  K H  V +E     +R HD R+FG    + ++     K I  +KLG++P   EF  +     L    +K + A+K  LL  + V G+GNIY  E LF + IHP   A KLT     ++A+  R IL KA+E  G+++  +       G F    KV+ +K   C  CK  I ++    R TY C +CQK+
  S:     1 MPELPEVEVTRLGIAPH-LEGRKVSAVKIIDGRL-RWPVPANLTKTLPGQTVNGIERRGKYLLLEM-DTGYLLIHLGMTGTL---RVLPSSDPLKTHDRVTLEFGKLSLRLHDPRKFGAVLWHPKSKGPIKKFILLQKLGVEPFSSEFSGELGAEILYQTSRKRSVAVKQFLLAGQAVVGVGNIYCSESLFEAGIHPAKAAGKLTRPQCSRLAKAVRSILKKAIEAGGSSLKDFVNSDGDPGHFMVQTKVYDRKGLPCKVCKTPISQMVQGQRTTYFCSQCQKR 278
>gi|94266953|ref|ZP_01290604.1| DNA-formamidopyrimidine glycosylase [delta proteobacterium MLMS-1] >gi|93452358|gb|EAT02983.1| DNA-formamidopyrimidine glycosylase [delta proteobacterium MLMS-1] (342 aa)
Score = 299, Expect = 1.9e-25, Identities = 91/275 (33%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLF-FEKTDSSYDKKHVLVKIEMD----------------------DYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLE-EEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNC-----------------------KNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L E     R I ++E+    + +           +   I  + R+ KYL+  L N  + V+HL M GKL+    T+      H+++K+  D                       +E+R++D RRFG   +Y     +    +  LG +PL+ ++F   YL    ++    IK  L+D   V GIGNIYA+EILFA+ I P T A ++      ++   +R IL +A+   GTTIA +     Q G FQ  L V+ +    C  C                       K  I +    GR T+ C +CQ+
  S:    22 MPELPEVEVVRRGL-EPLVTGRRIDSVEASGLSLRRPVPLAALCELAVGAVITGVERRAKYLLLQLDNGSLVVIHLGMTGKLYPAATTEPPRKHDHLVIKMGTDLFFTSTTPEATPGMLVKNKSVPIFEVRFNDCRRFGLVAVYGPGEAVAPPLLVGLGPEPLDKQQFTAAYLHRCCRQRRTPIKNLLMDNRVVVGIGNIYANEILFAAGISPFTSAARIGRRRAGRLVAAARQILTRAIAAGGTTIADFANAAGQAGYFQVQLAVYGRHGTPCPRCAPGYADHPPAAGAATTKKVAKGVKPVIERQIQAGRATFFCPRCQR 342
>gi|186457874|ref|ZP_02968184.1| formamidopyrimidine-DNA glycosylase [bacterium Ellin514] >gi|184205529|gb|EDU02578.1| formamidopyrimidine-DNA glycosylase [bacterium Ellin514] (284 aa)
Score = 299, Expect = 2.0e-25, Identities = 82/275 (29%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV-----FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQK-GEF------------QKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ ++  L      N+ IT++E    K+    +  D    +   +   ++R+GKYL+F L + ++      + HL M G+++    ++    KH  V + +      + DTR FG FT       LD++ +  LG +P   EF  +Y  + +K+S + +K  LLDQ  V+G+GNIYA E L+ + I P+  + K+     K + +  + +L +A++  G+T+   F   E K G F            Q+ L V+ +    C  C   I +     R T+ C +CQ+
  S:     1 MPELPEVEILVRHLAPL-ITNKKITDVEIRRSKVLAPTTASDLEEALTGARFTHLSRRGKYLLFFLKSPRMQCPLQLLGHLGMTGRMYLLPKNAGL-PKHAAVILGLGRERFVFEDTRYFGRFT-------LDTRSLAALGPEPWSPEFTDEYFHHALKRSTQPVKVKLLDQSLVAGVGNIYASEALYRAGISPKLSSRKIKPIQAKHLRKAIQEVLEQAIQC-GSTLPLDFVGIEGKNGHFYYGSAGDSSEFYQERLLVYDRLGQSCGKCGAGIKRFVQAARSTFYCPRCQR 283
>gi|170766560|ref|ZP_02901013.1| formamidopyrimidine-DNA glycosylase [Escherichia albertii TW07627] >gi|170123998|gb|EDS92929.1| formamidopyrimidine-DNA glycosylase [Escherichia albertii TW07627] (269 aa)
Score = 299, Expect = 2.0e-25, Identities = 84/275 (30%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E +     N+ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +        L+   +   LG +PL ++F+ +YL     K   AIK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +    + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEEIYRSS--NQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEERP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLW---TRALEGHNVLAHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLVRMIKTVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 269
>gi|119717504|ref|YP_924469.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Nocardioides sp. JS614] >gi|166215641|sp|A1SLU7|FPG_NOCSJ Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|119538165|gb|ABL82782.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Nocardioides sp. JS614] (295 aa)
Score = 298, Expect = 2.3e-25, Identities = 83/274 (30%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD----YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V   L E+  L  TI  ++ + P+  +        F   +   +I+   R+GKYL   L N    + HL M G+L  +  D+  D++H+ V++ ++      E+R+ D R FG  ++      L   EI  +  DPL+ EFD       +++    +K  LLDQ  +SG+GNIYADE L+ + IH E   ++LT    +++  ++R ++  A+   GT+  A Y     + G F + L  + ++   C  C   I ++    R +Y C  CQ
  S:     1 MPELPEVEVVRAGL-ERHVLGATIARVDVLHPRPVRRDLRGPAGFAAALTGRRIEAARRRGKYLWLPLDNGDALLGHLGMSGQLLVQPPDAP-DERHLRVRLALEGADEGRELRFVDQRMFGGLSVSAGGADL-PPEIAHIARDPLDPEFDDDDFVRRVRRRTSGVKRQLLDQNLISGVGNIYADEALWRARIHGERPGDRLTATRVRELLAHAREVMLAALGEGGTSFDALYVNVNGESGYFDRSLHAYGREGEACERCGTPIRRVAFMNRSSYFCPVCQ 278
>gi|22299109|ref|NP_682356.1| formamidopyrimidine-DNA glycosylase [Thermosynechococcus elongatus BP-1] >gi|24636849|sp|P59065|FPG_SYNEL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|22295291|dbj|BAC09118.1| formamidopyrimidine-DNA glycosylase [Thermosynechococcus elongatus BP-1] (284 aa)
Score = 298, Expect = 2.4e-25, Identities = 85/274 (31%), Positives = 136/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSK--EIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L E   L + I ++E ++ + I      + F  ++ +  I+   R+GKYL+  L +    V+HLRM G+L +  T       H  V+       E+R+ D R FG       +  +      +  L  +PL E F   +L   +    R+IKT LLDQ  V+G+GNIYADE LF S +HP   A+ LT    +++      +L + +   GTTI T+       G +     V+ +K   C  C   I ++++ GR ++ C +CQ
  S:     1 MPELPEVETVRRGL-ELVTLKQPIVDVEVLLARSIALPKEPQAFIEHLRDRAIEQWQRRGKYLLATLDDGSRLVIHLRMSGQLLWLTTPQP-PCPHTRVRWFFPTRAELRFVDQRTFGRCWWLPPDCRVAEAIPALATLAPEPLSEAFTVAFLAARLAHCRRSIKTALLDQSIVAGMGNIYADESLFLSGLHPTQSAHTLTPEQVQRLHGVICQVLREGIAAGGTTIRTFMSPAGVNGHYGGQAWVYGRKGEACRVCGTTIERLRLAGRSSHYCPQCQ 276
>gi|56476195|ref|YP_157784.1| formamidopyrimidine-DNA glycosylase [Azoarcus sp. EbN1] >gi|81677551|sp|Q5P728|FPG_AZOSE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56312238|emb|CAI06883.1| Formamidopyrimidine-DNA glycosylase [Azoarcus sp. EbN1] (271 aa)
Score = 298, Expect = 2.4e-25, Identities = 76/276 (27%), Positives = 131/276 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     ++      RT+T +E   P++ +     D    ++ E+++ + R+ KYL+    +  V +VHL M G L     D      H  V +      +R  D RRFG   +++  + L    +  LG +PLE  F   +L    +    +IK TL+D   V G+GNIYA E LF + IHP   A  +      ++  + R  L  A++  G+T+  +     + G FQ+   V+ ++   C  C   + ++ +  R T+ C +CQ++
  S:     1 MPELPEVEITCRGIRPL-VAGRTLTALEVRNPRLRQPVP-ADLAQTLVGERLQGVRRRAKYLLLDFPHGSV-LVHLGMSGSLRVVSADEPAGV-HDHVDLVFGAEALRLRDPRRFG-LVLWHAGDGLSHPLLAALGREPLERGFTGAWLHEATRGVRLSIKQTLMDAHRVVGVGNIYASESLFRARIHPLAPAGAIGPQRLARLVASVRETLLAAIDAGGSTLRDFVGGDGRAGYFQQQYFVYGREGLACRVCATPVRRVVIGQRSTFFCPRCQRR 271
>gi|148238875|ref|YP_001224262.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. WH 7803] >gi|147847414|emb|CAK22965.1| Formamidopyrimidine-DNA glycosylase [Synechococcus sp. WH 7803] (283 aa)
Score = 298, Expect = 2.4e-25, Identities = 85/275 (30%), Positives = 145/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNR----TITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK------VFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V      +G  NR     I +IE +  + +      +     +  +++   +R+GKYL+  L + +      V+ VHLRM G+  +  T +    +H  V++      E+R+ D R FG      +N  +D+    +++LG +P  EEF+  YL+  +K S R+IK  LLDQ  V+G GNIYADE LFA+ I P   A +L   + +++      +L  ++   GTT + +   +   G +     V+ +    C+ C   I + ++ GR T+ C  CQ+
  S:     1 MPELPEVETV-----RRGLANRLQSFVIDDIEVLRDRAVASPGGPQALRLGLRGQKVGAWSRRGKYLVAQLHDPQTGHCNGVWGVHLRMTGQFQWHPTPTE-PCRHTRVRLWNTAGEELRFVDLRSFGEMWFVPQNVSIDAVMTGLQRLGPEPFSEEFNATYLEQKLKGSTRSIKAALLDQAVVAGAGNIYADESLFAAGIAPHRKAGELNLPELERLCTCLVDVLEMSIGAGGTTFSDFRDLEGVNGNYGGQASVYRRTGQPCLACGTPIERQRLGGRSTHWCPVCQR 283
>gi|89896847|ref|YP_520334.1| hypothetical protein DSY4101 [Desulfitobacterium hafniense Y51] >gi|89336295|dbj|BAE85890.1| hypothetical protein [Desulfitobacterium hafniense Y51] (272 aa)
Score = 298, Expect = 2.5e-25, Identities = 78/274 (28%), Positives = 133/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD---KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PE+PE+++  + L ++  L + I   E I      N   ++F  ++ +  I+ + R GKYLI  L++ K    H+ ++G++++E      +   + H+  +++  D+ I +    R G   +   +     KE   LGLDPL+ EF        +      IK  L+DQ+N+SGIGN YA+EILFA+ I PE     LTD + +++      +L + +   G     +    +  G      KV+ +    C+ C   I +  V GR  Y CL CQ
  S:     1 MPEIPEMETYKNYL-QRSVLGKRIVGTE-ITRARSTNVPTDEFVRWVQDTSIEQVLRYGKYLILALSSGKALCAHMMLDGRMYYEVAGEPVELPGRSHI--RLKFADHSILHFCDLRLGYLKLLEPSQVDAIKE--GLGLDPLDAEFSLAAFLKILSGKRGMIKPLLMDQKNISGIGNAYANEILFAAGILPERKTPTLTDGEKERLYGVIPDLLQQGIAKGGYIEEPFAPWDKLSGGMIPHFKVYDRTGQPCLQCGEPIQQKIVGGRNAYYCLTCQ 271
>gi|114565074|ref|YP_752588.1| formamidopyrimidine-DNA glycosylase [Shewanella frigidimarina NCIMB 400] >gi|114336367|gb|ABI73749.1| formamidopyrimidine-DNA glycosylase [Shewanella frigidimarina NCIMB 400] (271 aa)
Score = 298, Expect = 2.7e-25, Identities = 86/276 (31%), Positives = 137/276 (49%)
  Q:     1 VPELPEVQ----SVIDSLKEQGCLNRTITN--IESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +   L EQ      + N  +   +P I +N         I+ ++I ++ R+ KYL+   T+  + +VHL M G L     ++  +K   +  +  +   +R++D RRFG +  Y    E + L    + KLG +PL   F    L+  +    +AIK  L+D   V G GNIYA+E LFA+ IHPE  A  +       +    + ILA A+E  GTT+  +     + G F + L V+ +    C  C N + +IK+  R T  C  CQ++
  S:     1 MPELPEVEVTRLGISPYLIEQTVSELIVRNASLRWPVPAIAQN---------IVGQRITNVRRRAKYLLID-TDAGMTIVHLGMSGSLRILPRNTPIEKHDHIDLVLENGRMLRFNDPRRFGAWLWYELPEEAHPL----LSKLGPEPLSPHFTPLQLQAALAGKKKAIKLCLMDNHIVVGAGNIYANEALFAAGIHPEAAAGSIDLERLTILVSEVKQILAHAIEQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTACGNLLSEIKLGQRTTVFCGLCQQR 271
>gi|126651390|ref|ZP_01723597.1| hypothetical protein BB14905_12510 [Bacillus sp. B14905] >gi|126591919|gb|EAZ86002.1| hypothetical protein BB14905_12510 [Bacillus sp. B14905] (290 aa)
Score = 297, Expect = 2.9e-25, Identities = 92/274 (33%), Positives = 142/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIE----------SIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV---FVVHLRMEGKLFF----EKTDSSYDKKHVLVKIEMDD--YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEE-EFDWKYLKNNIKK-SNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V+ +LK +    RTI +++               I K    + F   +    I  I R+ KY+ FHL  D+V    V HL M G  F     E  D +  +KH+    +M D  Y I Y D RRFG      +    D   + K+  +P +E   D+   K+ + K  N+A+K  ++D + VSG GNIYA E LFA  IHP    N++++   + + E    +L +++E  G+TI+ Y     + G  Q  LK++ KK   C  C+    ++ + GR +  C  CQ
  S:     1 MPELPEVEGVVQALKPK-VEGRTIQHVQLSERVHFSFSEGKQCIVKQAEPDAFELTLSEMTITKIERRAKYIFFHLFKDEVPYVLVSHLGMTGAWFVVNSPEDIDEAKFQKHIHATFKMADGGYLI-YSDIRRFGELRFLAKIE--DHVPLTKMAPEPFDELACDFFITKSTLPKYENKAVKEVIMDGQVVSGCGNIYATEALFAQKIHPARKMNRISEKRKRALFEEIVAVLRQSIEAGGSTISDYRNINGEAGSMQNRLKMYGKK--ICPACETATSQMTIGGRTSVFCPNCQ 289
>gi|62422981|ref|ZP_00378156.1| COG0266: Formamidopyrimidine-DNA glycosylase [Brevibacterium linens BL2] (307 aa)
Score = 297, Expect = 2.9e-25, Identities = 86/275 (31%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS--------YEDFTHYIINEQIKDITRKGKYLIFHLTNDKV-------------FVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEM--DDYEIRYHDTRRFGTFTI---YNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+SV   + E      TIT  E I P+I    S         + F   +   +I    R+GK++   L  D                +VHL M G+L   +  D  +     ++++E   +  ++R+ D R FG   +    +    L       +  DPLE  F+       + +    +K+ LLDQ  VSGIGNIYADE LF + IHP  I  +   +    + +++  +++ A+   GT+  A Y     + G F + L V+ +   +CV C  +I K+ + GRG++ C  CQK
  S:     1 MPELPEVESVRVGVHEWTA-GTTITGAEVIDPRILGTTSQRRIDASAVDGFIAAVTGRRIIAAERRGKFMWLTLGEDLGAGPAAEPAAPELSLLVHLGMSGQLRVHDAADEIHRHTRAILRLERGSESLQLRFIDQRIFGHLGVQPLVHAYGRLVPASANHIAADPLEPAFEPGLALEQLARKRTVVKSALLDQSLVSGIGNIYADEALFRAGIHPLAIPARTRKSRLAAVLDSATRVMSDALAVGGTSFDALYVNVNGESGYFDRALLVYGRGGQECVRCGTEIEKMTIGGRGSHFCPNCQK 302
>gi|114799193|ref|YP_761947.1| formamidopyrimidine-DNA glycosylase [Hyphomonas neptunium ATCC 15444] >gi|114739367|gb|ABI77492.1| formamidopyrimidine-DNA glycosylase [Hyphomonas neptunium ATCC 15444] (297 aa)
Score = 297, Expect = 3.6e-25, Identities = 79/275 (28%), Positives = 135/275 (49%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL---------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L    +G   R I  +E     + +    E F   +   +I  + R+ K+L  HL+  +V V+HL M G+          F           HV+  +E  +  + Y+D RRFG   ++    +L    +  +G +PL   F   YL   ++     IK  LLDQ+ ++G+GNIY  E LF S I P+ ++  +      ++A     ++A+A+   G++I+ +       G FQ    V+ ++   C +C  +I +I  +GR T+ C  CQ+
  S:    17 MPELPEVETVRRGLAPVMEG---RRIVKLEQRRADL-RFSLPERFAERLSGARIDRLARQAKFLAAHLSTGEVLVMHLGMTGRFTIGGQMPGEFHYGAGGIAAHDHVVFHMEGGE-TVTYNDPRRFGFMELWPAATFLAYPRLMTMGPEPLSNGFSHAYLDEALRGKAAPIKAALLDQKVIAGLGNIYVCEALFRSGISPKRLSKTIPGQRAARLAPAINAVIAEAIAAGGSSISDFAATDGALGYFQHRFDVYDREGQACKSCGMEIKRIVQSGRSTFYCPSCQR 297
>gi|56416891|ref|YP_153965.1| formamidopyrimidine-DNA glycosylase [Anaplasma marginale str. St. Maries] >gi|56388123|gb|AAV86710.1| formamidopyrimidine-DNA glycosylase [Anaplasma marginale str. St. Maries] (269 aa)
Score = 297, Expect = 3.7e-25, Identities = 75/275 (27%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPE + VI        + R +  + ++  +  +    +DF   ++  +I+ + R  +YL+F L+  +  + HL M G++          +KH  V + +D  + + ++D RRFG   + N   Y +     ++G DPL  EF+ +YL   ++ S   +K+ L++   V+GIGNIYA EILF + + P    + ++  + + I   ++  L  A+   G+TI  Y       G FQ+   V+ +    C  C  +I+  +  GR T+ C  CQ+
  S:     3 MPELPEAE-VISRFFASKAVGRHVEGV-TVYRRDLRVRIADDFESAVVGRKIESVCRISRYLVFVLSRGERVMFHLGMSGRM--AHVRPYVREKHDHVALLLDGGFHVVFNDPRRFGAVLLVNFQAYENIAS--RIGPDPLSAEFNAEYL---MRPSKACVKSVLMNNAIVAGIGNIYASEILFRAGVLPMRAMSSISYAECEGIVRETKATLQLAINTGGSTIRDYKIPTGAAGGFQQHFMVYQRAGQPCNVCGARILSERRGGRSTFFCALCQR 269
>gi|169191073|ref|ZP_02850945.1| DNA-(apurinic or apyrimidinic site) lyase [Paenibacillus sp. JDR-2] >gi|169002284|gb|EDS49175.1| DNA-(apurinic or apyrimidinic site) lyase [Paenibacillus sp. JDR-2] (271 aa)
Score = 296, Expect = 3.8e-25, Identities = 84/277 (30%), Positives = 134/277 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIY------NENNYLDSKE----IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPE++     L E   +   IT  E    K   N S E F   ++   I  + R+GK+L+FHL N K  V+HL + G LFF   +   D+    V++           T RF T  +Y         +++  KE    + +LG DP ++    +  K    K   A+KT L+DQ  +SGIGN YADEI FA+ I P+     LTD  ++++ E+   +L +A+   G             G +    +V+ +    C  C   I + +++ R  ++C  CQK++
  S:     1 MPELPEMEHYRLRLSEL-IIGSPITGTEVTRDKSI-NISAEQFEAELVGRTIWFVERRGKHLLFHLDNGKRLVLHLMLGGTLFFGSEEERPDRT---VQV-----------TIRFATGNLYFIGLRLGYLHFMSVKEADAKLSELGPDPFDKRLTLERFKARFNKKRGALKTALVDQHVLSGIGNCYADEIAFAAKIRPDAKIPSLTDETWERVYESMHSVLKEAISKGGYMEQPLTAGDAITGGYNDHCQVYDRGGEPCFVCGTAIEQFEISSRKAFVCPVCQKEQ 271
>gi|111023482|ref|YP_706454.1| formamidopyrimidine-DNA glycosylase [Rhodococcus sp. RHA1] >gi|123045457|sp|Q0S2E0|FPG_RHOSR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|110823012|gb|ABG98296.1| DNA-formamidopyrimidine glycosylase [Rhodococcus sp. RHA1] (292 aa)
Score = 296, Expect = 4.0e-25, Identities = 79/274 (28%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV-FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTI---YNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V   L E+  +  +I +++ + P+  +       D    +  E+I    R+GKYL   L    V  VVHL M G++  +  +   +K H+ ++  +D   ++R+ D R FG + +    + +  L    +  +  DPL+  FD       ++  +  +K  LLDQ  VSGIGNIYADE L+ + IH   + ++L+    +++   ++ ++ +A+   GT+  A Y     + G F + L  + ++D  C  C   I + K   R ++ C KCQ
  S:     1 MPELPEVEVVRRGL-ERHIVGASIDSVDILHPRAIRRHLPGAADLAGQLTGERIASADRRGKYLWLVLEPSTVALVVHLGMSGQMLVQPPELPTEK-HLRIRARLDSGLDLRFVDQRTFGGWALAPLVDVDGSLVPDSVAHIARDPLDPRFDLAATVKVVRGKHTEVKRALLDQTVVSGIGNIYADEALWRARIHGNRLTDRLSGPKVREVLTAAQEVMREALTQGGTSFDALYVNVNGESGYFDRSLSAYGQEDRPCPRCGTAIRREKFMNRSSFSCPKCQ 280
>gi|168716763|ref|ZP_02749040.1| formamidopyrimidine-DNA glycosylase [Escherichia coli O157:H7 str. EC4206] (270 aa)
Score = 296, Expect = 4.0e-25, Identities = 85/275 (30%), Positives = 144/275 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNI-KKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + ++ +  + R+ KYL+  L    + ++HL M G L     +    +KH  V + M + ++ RY D RRFG +    E   L+   +   LG +PL ++F+ +YL     K+  R IK  L+D + V G+GNIYA E LFA+ IHP+ +A+ L+  + + +A   + +L +++E  GTT+  +     + G F + L+V+ +K   C  C   IV  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDQPVLSVQRRAKYLLLELPEGWI-IIHLGMSGSLRILPEELP-PEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKE---LEGHNVLAHLGPEPLSDDFNGEYLHQKCAKEKKRTIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK 270
>gi|149184948|ref|ZP_01863265.1| formamidopyrimidine-DNA glycosylase [Erythrobacter sp. SD-21] >gi|148831059|gb|EDL49493.1| formamidopyrimidine-DNA glycosylase [Erythrobacter sp. SD-21] (271 aa)
Score = 295, Expect = 5.1e-25, Identities = 76/275 (27%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCK-NKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  L    QG    TIT +    P + +     D    +    +  ++R+ KY + H + D   V HL M G+    + D + D+KH  + IE   +    +D RRFG+  +      +  K    LG +PL ++   ++L+   +   +AIK  LLDQ  V+G+GNIY  E L+ + IHP     K+T    +++    + +L +++ + G+T+  +       G F     V+ ++   C +     I +I   GR T+ C  CQ+
  S:     1 MPELPEVETTVRGLARFLQG---ETITRVTVNRPDMRRPFP-PDLVQALTGASVTHLSRRAKYGLIHTSRDHAMVFHLGMSGRW---RIDPAEDEKHDHLVIETAGHRFALNDPRRFGSVDLMTSGELVTWKPFAALGPEPLGDDLTPEHLREATRGRKQAIKLLLLDQSIVAGLGNIYVCEALWHAGIHPRKAGGKVTMPQLRRLVPAIKDVLERSIRDGGSTLRDFAQPDGNLGYFATRFHVYGREGEPCHHEDGGTIRRIVQGGRSTWFCPVCQR 271
>gi|90415302|ref|ZP_01223236.1| formamidopyrimidine-DNA glycosylase [marine gamma proteobacterium HTCC2207] >gi|90332625|gb|EAS47795.1| formamidopyrimidine-DNA glycosylase [marine gamma proteobacterium HTCC2207] (268 aa)
Score = 295, Expect = 5.1e-25, Identities = 83/275 (30%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQS------------VIDSLK-EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++            VID L+   G L   +T               +  +     + +  ITR+ KYL+  L    + ++HL M G L      S   +KH  +++ M +   +RYHD RRFG + +++++ Y    ++  LG +PL ++F  K L    +K   AIK  ++D   V G+GNIYA E LF   I P+  A +++   ++++A + + +LA A+   GTT+  +     + G FQ+ L V+ +    CV+C   +  I++  R +  C  CQ+
  S:     1 MPELPEVETTLRGVAPHIVDQVIDQLRVYNGSLRWPVT---------------QGISELTQGQLVVAITRRAKYLLVELERGTM-MIHLGMSGSLRLVDR-SEPRRKHDHIEMLMANGACLRYHDPRRFGAW-LWSDSGY---PQLDHLGPEPLTDDFTGKRLFELSRKRKMAIKPFIMDNRTVVGVGNIYASEALFRGGIRPDRAAGRVSLQRYEELAGHIKEVLASAITQGGTTLRDFVNGNGEPGYFQQTLMVYGRGGEPCVHCDKPLKDIRLGQRSSVFCPACQR 268
>gi|152972481|ref|YP_001337627.1| formamidopyrimidine-DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166215630|sp|A6TFM6|FPG_KLEP7 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|150957330|gb|ABR79360.1| formamidopyrimidine-DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (269 aa)
Score = 295, Expect = 5.4e-25, Identities = 83/275 (30%), Positives = 142/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   +  TI +      ++    S E   + + +  +  + R+ KYL+  L  D   +VHL M G L     +   +K H  V + M + ++ RY D RRFG +        L+   +   LG +PL + F+  YL+    K   AIK  L+D + V G+GNIYA E LF++ IHP+ +A+ L+  + +++ +  +++L +++E  GTT+  +     + G F + L+V+ +K   C  C   +V  K   R T+ C +CQK
  S:     1 MPELPEVETSRRGI-EPHLVGATILHAVVRNGRLRWPVSEE--IYRLSDVPVLSVRRRAKYLLLELP-DGWIIVHLGMSGSLRILSEELPAEK-HDHVDLVMSNGKVLRYTDPRRFGAWLW---TRTLEGHPVLAHLGPEPLSDAFNADYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAGIHPDRLASSLSREECEQLVKVIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRICGMPVVGTKHAQRATFYCRQCQK 269
>gi|145590096|ref|YP_001156693.1| formamidopyrimidine-DNA glycosylase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048502|gb|ABP35129.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Polynucleobacter sp. QLW-P1DMWA-1] (278 aa)
Score = 295, Expect = 5.5e-25, Identities = 91/276 (32%), Positives = 135/276 (48%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN------ENNYLDSKEIKKLGLDPLEEEFDWKY----LKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+     +    QG   RTI+ I+ I  ++ +    +     +  ++I+ I R+GKYL+  L      ++HL M G L    +     K H  V  E     +R HD R+FG    +       E+N L    + KLG++P    F+ +     L    +K + A+K  LL  + V G+GNIY  E LF + IHP   A KLT     ++A   R IL KA++  G+T+  +       G F    KV+ +K   C  CK  I +I    R TY C  CQK+
  S:     1 MPELPEVEVTKLGIAPHLQG---RTISAIKVIDGRL-RWPVPKSLPQILPGQKIQSIARRGKYLLLELEKG-CLLIHLGMTGTLRVLPSSEPL-KLHDRVTFEFGRLSLRLHDPRKFGAVLWHPKIKGPVESNPL----LLKLGVEPFSSAFEGELGTGILYQASRKRSVAVKQFLLAGQAVVGVGNIYCSESLFEAGIHPAKAAGKLTRPQCSRLASAVRSILKKAIDAGGSTLKDFVNSDGDPGHFTVQSKVYDRKGLPCKVCKTPIQQIVQGQRSTYFCPVCQKR 278
>gi|54026154|ref|YP_120396.1| formamidopyrimidine-DNA glycosylase [Nocardia farcinica IFM 10152] >gi|81679878|sp|Q5YS09|FPG_NOCFA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|54017662|dbj|BAD59032.1| putative formamidopyrimidine-DNA glycosylase [Nocardia farcinica IFM 10152] (294 aa)
Score = 294, Expect = 6.6e-25, Identities = 83/268 (30%), Positives = 134/268 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTN---------DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIY---NENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTY 268
           +PELPEV+ V   L E     R +  +    P+  +       D    +   +++   R+GKYL               D   VVHL M G++  +   +  +K H  ++  +DD  E+R+ D R FG + +      +  L  + +  +  DPL+  FD + +   I+  N  IK  LLDQ  VSGIGNIYADE L+ + I+   +A+ LT    +++    R ++ +A+   GT+  A Y     Q G F++ L V+ ++D  C  C   IV+ K   R +Y
  S:     1 MPELPEVEVVRRGLAEH-VAGRVVGAVTITHPRSVRRHLAGSADLAARMTGRRVRAAQRRGKYLWLTFDEPGAADETALDAALVVHLGMSGQMLVQPAAAPVEK-HAHIRAALDDGSELRFVDQRTFGGWALAPLAEVDGSLVPEPVAHIARDPLDPRFDAESVVAAIRAKNSEIKRVLLDQTVVSGIGNIYADESLWRAGINGNRLASGLTRPAVRRLLAEVRAVMLEALAAGGTSFDALYVNVNGQSGYFERALAVYGRQDEPCRRCGAPIVREKFMNRSSY 282
>gi|38234118|ref|NP_939885.1| formamidopyrimidine-DNA glycosylase [Corynebacterium diphtheriae NCTC 13129] >gi|81698520|sp|Q6NGH4|FPG_CORDI Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|38200380|emb|CAE50068.1| Putative formamidopyrimidine-DNA glycosylase [Corynebacterium diphtheriae] (296 aa)
Score = 294, Expect = 7.1e-25, Identities = 84/274 (30%), Positives = 145/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS--YEDFTHYIINEQIKDITRKGKYLIFHLTN---------DKVFVVHLRMEGKLFFEKTDSS-YDKKHVLVKIEMDD----YEIRYHDTRRFGTF--TIYNENNY-LDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V   L     L  TIT++    P+  +       +    +   ++  I R+GK+L F LT           +  +VHL M G++  +  +S+ +  + +   I   D    +E+ + D R FG +  T + E  +    ++I  +  D L+ +   + L   I+K N  IK  LL+QE VSGIGNIYADE+L+A+ IHP+T A+ L+      + E+ + ++  A++  GT+  + +     Q G F   L  + ++   C  C + I++ K   R ++ C +CQ
  S:     1 MPELPEVEVVRRGLTPY-VLGATITDVAVEHPRSIRTIEGGAAELIGSLQGREVTRIGRRGKFLWFELTGHGDYACGFPQQGLLVHLGMSGQMLIKTQNSALHPHRRIRTTIVRSDAQECFELWFVDQRTFGYWAPTTFVETAHGCVPEQITHIARDLLDPQLKRENLARLIRKKNSEIKRVLLNQEIVSGIGNIYADEMLWAARIHPQTPASHLSVAQLSNLLEHGQRVMNAALDQGGTSFDSLYVNVNGQSGYFDVSLHAYGQQGQACDRCGSNIIREKFANRSSHFCPRCQ 293
>gi|90101295|sp|Q6ML45|FPG_BDEBA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) (270 aa)
Score = 294, Expect = 7.2e-25, Identities = 80/275 (29%), Positives = 130/275 (47%)
  Q:     1 VPELPEVQSVIDSL----KEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L    K+Q  L +       +M K  +          ++ + +  I R+ KYL+   T     + HL M G              H+ +     D  + Y D RRFG F    +   L   ++  LG +PLE EF+   L   ++  + A+K  L+DQ+ V G+GNIYA E LFA+ I P   A KL+      +    + IL+++++  G++I+ +     + G FQ   +V+ +    CV C  ++    + GR T+ C +CQK
  S:     1 MPELPEVEVVRRGLETILKDQPILEKV-----ELMRKDLREPIPAKKISTLVGQPLTSIERRAKYLLL-WTPKGAMLSHLGMTGTWRVAVPGDERLHDHIYLHFS-GDLRLAYRDPRRFGCFDFVQDP--LKHPKLADLGPEPLEAEFNGPLLWEKLRGKDVALKVALMDQKVVVGVGNIYASEALFAAGIKPTLPARKLSLERASLLVGEIKKILSQSIKAGGSSISDFAQASGESGYFQTSFRVYGRDKEPCVTCGQQVKSKVLGGRNTFWCSRCQK 270
>gi|42523639|ref|NP_969019.1| hypothetical protein Bd2176 [Bdellovibrio bacteriovorus HD100] >gi|39575845|emb|CAE80012.1| fpg [Bdellovibrio bacteriovorus HD100] (271 aa)
Score = 294, Expect = 7.2e-25, Identities = 80/275 (29%), Positives = 130/275 (47%)
  Q:     1 VPELPEVQSVIDSL----KEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L    K+Q  L +       +M K  +          ++ + +  I R+ KYL+   T     + HL M G              H+ +     D  + Y D RRFG F    +   L   ++  LG +PLE EF+   L   ++  + A+K  L+DQ+ V G+GNIYA E LFA+ I P   A KL+      +    + IL+++++  G++I+ +     + G FQ   +V+ +    CV C  ++    + GR T+ C +CQK
  S:     2 MPELPEVEVVRRGLETILKDQPILEKV-----ELMRKDLREPIPAKKISTLVGQPLTSIERRAKYLLL-WTPKGAMLSHLGMTGTWRVAVPGDERLHDHIYLHFS-GDLRLAYRDPRRFGCFDFVQDP--LKHPKLADLGPEPLEAEFNGPLLWEKLRGKDVALKVALMDQKVVVGVGNIYASEALFAAGIKPTLPARKLSLERASLLVGEIKKILSQSIKAGGSSISDFAQASGESGYFQTSFRVYGRDKEPCVTCGQQVKSKVLGGRNTFWCSRCQK 271
>gi|150423738|gb|EDN15680.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae AM-19226] (269 aa)
Score = 294, Expect = 8.0e-25, Identities = 82/274 (29%), Positives = 136/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     +  TI ++    PK+      E     +  + I  I R+ KYLI   T     +VHL M G L     D    K   +  +      +RY+D RRFG +     +   +S E+  +LG +PL E F+ +Y+ +  +    A+K  ++D   V G+GNIYA+E LF S +HP  +AN L+ ++++ +  N + +L  A++  GTT+  +     + G F + L+V+ K    C +C   I + K+  R T+ C +CQ
  S:     1 MPELPEVEVSRLGISPH-LVGGTIQSLVLRTPKLRWPIPQE--LKQLEGQTILAIHRRAKYLIIE-TAVGSAIVHLGMSGSLRILDGDFPAAKHDHVDLVMTSGKRLRYNDPRRFGAWLWCAPD---ESHEVLGRLGPEPLTEAFNAEYMMDKARNKRIAVKAFIMDNAAVVGVGNIYANESLFTSRLHPLRLANSLSLDEWQTLVANIKQVLQVAIKQGGTTLKDFTQSDGKPGYFAQELQVYGKAKQPCPHCGEPICEQKIAQRNTFFCPQCQ 268
>gi|149376939|ref|ZP_01894694.1| formamidopyrimidine-DNA glycosylase [Marinobacter algicola DG893] >gi|149358831|gb|EDM47300.1| formamidopyrimidine-DNA glycosylase [Marinobacter algicola DG893] (274 aa)
Score = 293, Expect = 8.3e-25, Identities = 82/275 (29%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK---VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    +    C NRTIT + ++     +     +    I    I  + R+ KYL+  +++       +VHL M G L    TD S    H  V++ +D+   +R++D RRFG + +++E    D   +   LG +PL  EF+ + L    +     +K  ++D   V G+GNIYA+E LF + IHP   A +++ + + ++ E  R  L+ A+   GTT+  +     + G F + L V+ +    C  C + + +I++N R T  C KCQ+
  S:     1 MPELPEVETTRRGIAPH-CENRTITQV-TVRDGRLRWPVPGNLAELIEGSVIHTVDRRAKYLLIGVSSANAAGTLIVHLGMSGSLRV-ITDQSAPLLHDHVELTLDNGIRLRFNDPRRFGCW-LWSETP--DQHPLLASLGPEPLAPEFNGRLLYRLSRSKKTPVKPFIMDNHVVVGVGNIYANEALFKAGIHPRRAAGRISLDRYNRLVEAIRETLSAAILMGGTTLRDFVNSDGKPGYFAQSLLVYGRNGEFCRECGHPLKEIRMNQRSTVYCGKCQR 274
>gi|19553271|ref|NP_601273.1| formamidopyrimidine-DNA glycosylase [Corynebacterium glutamicum ATCC 13032] >gi|161486717|ref|YP_226310.2| formamidopyrimidine-DNA glycosylase [Corynebacterium glutamicum ATCC 13032] >gi|24211704|sp|Q8NNV7|FPG_CORGL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|21324843|dbj|BAB99466.1| Formamidopyrimidine-DNA glycosylase [Corynebacterium glutamicum ATCC 13032] (286 aa)
Score = 293, Expect = 8.6e-25, Identities = 82/277 (29%), Positives = 144/277 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTN--------DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV+ V   L++   +  TI +   + P+  +N      +    I   ++    R+GK+L   L +        D   +VHL M G++  ++ D+     H+  K+E+D+  E+ + D R FG + +    + +D   + +  +  D L+E  D+  +  N+K     IK  LL+QE VSGIGNIYADE+L+ + IHP   A++L+    +++ +  + ++ KA+   GT+  A Y       G F   L  + +    C  C   I++     RG++ C  CQK++
  S:     1 MPELPEVEVVRRGLEDH-MVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRGKFLWLELIDAPSGETRPDLGLLVHLGMSGQMLIKEPDAPI-SPHLRAKVELDNGDEVWFVDQRTFGYWWL---GDLVDGVPERVSHIATDVLDESADFSAIARNLKSRKSEIKRLLLNQEIVSGIGNIYADEMLWQAKIHPLQRADRLSLARLEELLQAGKDVMTKALAQGGTSFDALYVNVNGNSGYFALSLNAYAQTGEPCGRCGTLIIRESFMNRGSHYCPNCQKRR 286
>gi|86147282|ref|ZP_01065597.1| formamidopyrimidine-DNA glycosylase [Vibrio sp. MED222] >gi|85834997|gb|EAQ53140.1| formamidopyrimidine-DNA glycosylase [Vibrio sp. MED222] (269 aa)
Score = 293, Expect = 8.7e-25, Identities = 81/274 (29%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     +  TI  +    PK+  +   E     +  + I+ I+R+ KYL+   T+    +VHL M G L     D     KH  V +++ + +I RY+D RRFG + +++  + + +  +   G +PL ++F+  Y+    +K   A+K  ++D + V G+GNIYA+E LF+S I+P   A+K+T  ++  + +  + +L  A+   GTT+  +     + G F + L+V+ K    C NC+  I ++K+  R T+ C  CQ
  S:     1 MPELPEVEVSRMGISPH-LVGETIKTLTFRTPKLRWDIPQE--LKKLEGQVIRSISRRAKYLLIE-TDTGTAIVHLGMSGSLRVLDADFP-PAKHDHVDLKLTNGKILRYNDPRRFGAW-LWSAPDEIHTVLLGS-GPEPLTDDFNADYIAEKAEKRKVAVKQFIMDNKVVVGVGNIYANEALFSSRINPLRSASKVTKQEWLLLTKEIKQVLTTAIRQGGTTLKDFAQADGKPGYFAQELQVYGKAGEQCPNCEELIQELKIGQRNTFYCSSCQ 268
>gi|33151884|ref|NP_873237.1| formamidopyrimidine-DNA glycosylase [Haemophilus ducreyi 35000HP] >gi|39931237|sp|Q7VN67|FPG_HAEDU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|33148105|gb|AAP95626.1| formamidopyrimidine-DNA glycosylase [Haemophilus ducreyi 35000HP] (274 aa)
Score = 293, Expect = 9.3e-25, Identities = 85/274 (31%), Positives = 134/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNE-NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ +  + E     +TI  I    PK+    S E     +   +I  ++R+ KYLI H     + +VHL M G L     +  +   KH  V +  +   I RY+D R+FG +    +  NY     I KLG +PL + F   YL    +    A+K  +++ + V G+GNIYA E LF + +HPE  A  LT+    ++    + +L KA+   GTT+  +     + G F + L+V+ +K  +C  C   I    +  R +Y C  CQ
  S:     1 MPELPEVETCLRGI-EPYLAGQTIQQIVIRTPKLRWPISAE--LCAMSGAKILALSRRAKYLIIHTERGDI-LVHLGMSGSLTLLNSSQPTKASKHDHVDLITEAGIILRYNDPRKFGAWLWAKQAENY---PLITKLGPEPLSDTFTSDYLFKKSRNKTVAVKNFIMNNDIVVGVGNIYASESLFMAGVHPELAAQNLTEKQCVQLRNVIQAVLTKAIIQGGTTLKDFTQPDGKPGYFAQVLQVYGRKGEECRECGTLIQAKVIGQRNSYFCPDCQ 270
>gi|126642855|ref|YP_001085839.1| formamidopyrimidine-DNA glycosylase [Acinetobacter baumannii ATCC 17978] (208 aa)
Score = 292, Expect = 1.1e-24, Identities = 68/203 (33%), Positives = 101/203 (49%)
  Q:    75 HLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKKK 277
           HL M G     + +    +KH  + I+ +D ++RYHD RRFG     N       K I  LG +PL  +F  +YL + +K  +  IK  L+D   V G+GNIYA E LF   IHP   A  LT    +K+    + IL  A++  G+T+  Y     + G FQ+ L  + +    CVNC+  +  +K+  R +  C +CQ  K
  S:     4 HLGMSGSFRLCQPNDEL-RKHDHLIIQFEDQQLRYHDPRRFGCILWLNPET--QGKLIDTLGPEPLSTDFHAEYLASKLKNKSVGIKIALMDNHVVVGVGNIYATESLFNVGIHPAQPAGDLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAMGENGYFQQTLLAYGRAGEMCVNCETTLENLKLGQRASVFCPQCQPLK 203
>gi|4511987|gb|AAD21547.1| formamidopyrimidine-DNA glycosylase [Zymomonas mobilis] (252 aa)
Score = 292, Expect = 1.3e-24, Identities = 70/234 (29%), Positives = 119/234 (50%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           D    +I   I  ++R+ KY I     D   + HL M G+  ++    +++K    V    +++ +  +D RRFG+  +  +N  L+    + +G +PL   F+ +YL+  +  S+  I+  LLDQ+ V+GIGNIYA E L  + IHP+  +  L  ++   +  + + IL KA+   G+T+  Y     + G F    KV+ K+   C  C + I +  + GR T+LC  CQK
  S:    22 DIQERLIGSTIISLSRRAKYGIIVNDRDDALIFHLGMSGR--WKINPENFEKHDHFVLQTKNNFIVSLYDPRRFGSLDLVKKNQLLEWSYFRNIGPEPLTGNFNPEYLQKKLFSSSAPIREILLDQKVVAGIGNIYACEALHQAKIHPQRPSKNLNFDEITSLVFSIKNILQKAIAEGGSTLKDYARPNGELGYFSTKFKVYGKEGEQC-ECGHTIERYTLGGRSTFLCSSCQK 252
>gi|33866493|ref|NP_898052.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Synechococcus sp. WH 8102] >gi|39931216|sp|Q7U4V2|FPG_SYNPX Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|33633271|emb|CAE08476.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Synechococcus sp. WH 8102] (278 aa)
Score = 291, Expect = 1.4e-24, Identities = 88/274 (32%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLT-NDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L ++  L   I  +E    + I  +     F   +   ++   +R+GKYL+  L  N  ++ VHLRM G+ F    + S    H  V+    + +E+R+ D R FG       +  L      + +LG +P  E F   YLK  +K S+R IKT LLDQ  V+G+GNIYADE LF++ I P T A +LT    +++  +   +L  ++   GTT + +   +   G +     V+ +    C  C   I + K++GR T+ C  CQ
  S:     1 MPELPEVETVRRGLADRLSLFE-IERVEVCRSRAIASSGGVAAFLVGLTGARVGTWSRRGKYLMAALEPNRGIWGVHLRMTGQ-FQWIEEPSTPCTHTRVRFWNANGHELRFVDVRSFGEMWWVPPDVELTVGIPGLARLGPEPFSEAFSAPYLKRQLKNSSRPIKTALLDQALVAGVGNIYADESLFSAGIPPLTPAGRLTLAQLERLRSSLVEVLTTSIGAGGTTFSDFRDLEGVNGNYGGQAWVYRRGGEPCRRCGTIIRRDKLSGRSTHWCPTCQ 277
>gi|110835444|ref|YP_694303.1| formamidopyrimidine-DNA glycosylase [Alcanivorax borkumensis SK2] >gi|122959249|sp|Q0VLB7|FPG_ALCBS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|110648555|emb|CAL18031.1| formamidopyrimidine-DNA glycosylase [Alcanivorax borkumensis SK2] (269 aa)
Score = 291, Expect = 1.5e-24, Identities = 81/275 (29%), Positives = 149/275 (54%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNG-RGTYLCLKCQK 275
           +PELPEV++ +  ++   QG + +++T  E   P++    S  +  + + +  +  + R+ KYL+  L + ++ ++HL M G L     D    +KH  V + +D  ++ R++D RRFG+      +       ++ LG +PL + F+ ++L    +    A+K+ ++D   V G+GNIYA E LF + IHP   A +++   ++ +AE  + +LA+A+E  GTT+  +     Q G F + L V+ +    CV C + I+K   +G R T  C +CQ+
  S:     1 MPELPEVETTLRGIRPHLQGRILKSVTVRE---PRLRWPVS--EAIYALRDCPVVALRRRAKYLLIELEHGQL-LIHLGMSGTLRVVDMDLPL-RKHDHVDLLLDSGKVLRFNDPRRFGSVLFQGGDQ--PHSLLQSLGPEPLSDSFNGQWLFARSRGRKVAVKSFIMDNATVVGVGNIYAQESLFMAGIHPSRAAGRISLARYQALAEAIKRVLAQAIEAGGTTLKDFTRADGQPGYFAQSLNVYGRAGQPCVQC-DAILKADRHGQRSTAYCPQCQR 269
>gi|167856318|ref|ZP_02479048.1| Formamidopyrimidine-DNA glycosylase [Haemophilus parasuis 29755] >gi|167852548|gb|EDS23832.1| Formamidopyrimidine-DNA glycosylase [Haemophilus parasuis 29755] (274 aa)
Score = 291, Expect = 1.6e-24, Identities = 87/275 (31%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL--FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNG-RGTYLCLKCQK 275
           +PELPEV++ +  +     + + I  I    PK+    S E  T  +    I +I R+ KYLI   T+    +VHL M G L     K + + DK   +  I  +   +RY+D R+FGT+    +     ++ +  LG +PL E F   YL    +    A+K  +++   V G+GNIYA E LF + IHPE  A  LT    +++    + +L KA+   GTT+  +     + G F + L+V+ +K  +C +C   I++ KV G R ++ C KCQ+
  S:     1 MPELPEVETSMRGISPY-LVGQKIKEIIVRQPKLRWAVSSELST--MQGATIIEIYRRAKYLIIQ-TDKGDILVHLGMSGSLGILSVKENKAIDKHDHIDLITENGVILRYNDPRKFGTWLWAEQAE--TAELLANLGPEPLSEAFTSGYLFEKSRNKTVAVKNFIMNNAIVVGVGNIYACESLFMAGIHPELAAQNLTAKQCERLVTVIKEVLTKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYGRKGEECNDC-GSIIEAKVIGQRNSFYCPKCQR 271
>gi|186475088|ref|YP_001856558.1| formamidopyrimidine-DNA glycosylase [Burkholderia phymatum STM815] >gi|184191547|gb|ACC69512.1| formamidopyrimidine-DNA glycosylase [Burkholderia phymatum STM815] (276 aa)
Score = 291, Expect = 1.6e-24, Identities = 81/275 (29%), Positives = 130/275 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKT--DSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIY--NENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  ++   P + +      F   +    ++ + R+GKYL+F + ++  F+VHL M G L   +         KH  V    DD+ +R+ D RRFG    +  +  + LD   +  LG++P    F    L    +    ++K  LL  E V G+GNIYA E LF + I P T A +++   +  +A+  R+ LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPYVAGRRVERVDVRTPAL-RWPIPPGFARLLHGRLVRKVERRGKYLLFEI-DEGWFIVHLGMTGTLRVLRNVPHPPAAAKHDHVDWIFDDFILRFRDPRRFGAVLWHPRSAGDVLDHPLLADLGVEPFAPSFSGALLHRKTRGRKVSVKQALLAGEIVVGVGNIYASESLFRAGIRPTTPAGRISLVRYDLLADAVRVTLAAAIEKGGSTLRDFVGSNGESGYFQLDYFVYDRAGQPCRVCGTPIKQIVQGQRSTYYCPTCQR 276
>gi|39996100|ref|NP_952051.1| formamidopyrimidine-DNA glycosylase [Geobacter sulfurreducens PCA] >gi|81702906|sp|Q74EG5|FPG_GEOSL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|39982865|gb|AAR34324.1| formamidopyrimidine-DNA glycosylase [Geobacter sulfurreducens PCA] (271 aa)
Score = 291, Expect = 1.7e-24, Identities = 79/275 (28%), Positives = 128/275 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++ +  +       R +T + +   K+      E     +    I+ + R+ KYL+     D   ++HL M G L      S   K   L  +  D   +R+ D R+FG   ++  ++ L    + +LG +P    F+  YL +  +K N AIK  L+D   V G+GNIYA+E LF + IHPE  A  L++ D   +A     +L  A+    TT+  +   +   G F+    V+ +    C  C   I +I++  R T+ C  CQK
  S:     1 MPELPEVETTLRGIAPH-VTGRRVTAVTARAAKLRLPIPPE-LGERLTGRVIERVERRAKYLLLR-CGDGTAIIHLGMTGTLRVAPAGSPPGKYDHLDLVLDDGRTLRFRDPRKFG-LVLWTGSDPLAHPLLAQLGPEPFPPLFNGSYLFSRSRKRNAAIKLLLMDNRIVVGVGNIYANEALFRARIHPERAAGSLSEEDCATLATAVGDVLRDAIAEGDTTLHEFIATEVPSGYFRINPAVYGQTGKPCTVCGTPIARIRLGNRSTWFCPVCQK 271
>gi|148976962|ref|ZP_01813617.1| formamidopyrimidine-DNA glycosylase [Vibrionales bacterium SWAT-3] >gi|145963836|gb|EDK29096.1| formamidopyrimidine-DNA glycosylase [Vibrionales bacterium SWAT-3] (258 aa)
Score = 290, Expect = 1.8e-24, Identities = 71/223 (31%), Positives = 127/223 (56%)
  Q:    52 IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           I+ I+R+ KYL+   T+    +VHL M G L     D     KH  V +++ + ++ RY+D RRFG + +++  + + S  +   G +PL ++F+  Y+    +K   A+K  ++D + V G+GNIYA+E LF++ IHP   ANK+T  ++  + +  + +LA A++  GTT+  +     + G F + L+V+ K    C +C+  I ++K+  R T+ C +CQ
  S:    38 IRAISRRAKYLLIE-TDTGTAIVHLGMSGSLRVLDADFP-AAKHDHVDLKLTNGKVLRYNDPRRFGAW-LWSAPDEVHSVLLGS-GPEPLTDDFNADYIAEKAEKRKVAVKQFIMDNKVVVGVGNIYANEALFSARIHPLRSANKVTKAEWILLTDEIKQVLATAIKQGGTTLKDFSQADGKPGYFAQELQVYGKAGEKCPSCEALIQELKIGQRNTFYCEECQ 257
>gi|149192220|ref|ZP_01870436.1| formamidopyrimidine-DNA glycosylase [Vibrio shilonii AK1] >gi|148833951|gb|EDL50972.1| formamidopyrimidine-DNA glycosylase [Vibrio shilonii AK1] (269 aa)
Score = 290, Expect = 1.9e-24, Identities = 81/275 (29%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTF--TIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     L+ TI  I     ++      E   H +  + I  I R+ KYL+   T+    +VHL M G L   +     +K   +  +  +   +RY+D RRFG +      E++ L    +   G +PL EEF   ++    +    A+KT +++  NV G+GNIYA E LF++ IHP T A K+T   ++ +    + +LA+A+   GTT+  +     + G F + L+V+ + +  C  C   I ++K+  R T+ C  CQ+
  S:     1 MPELPEVEVSRLGISPH-LLDETIKEIVVRQRQLRWLIPQE--IHQLHGQAITSIRRRAKYLLID-TDKGTAIVHLGMSGSLRVLENPPEAEKHDHVDLVLSNGKVMRYNDPRRFGAWLWCAPGESHEL----LANCGPEPLTEEFCADWMSEKARNKRVAVKTFIMNNANVVGVGNIYACESLFSAGIHPTTPAYKVTLTQWQLLVSEIKRVLAQAITQGGTTLKDFSQSDGKPGYFAQELQVYGRANEPCHQCGEPIEQMKIGQRNTFFCSHCQQ 269
>gi|114571613|ref|YP_758293.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Maricaulis maris MCS10] >gi|114342075|gb|ABI67355.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Maricaulis maris MCS10] (287 aa)
Score = 290, Expect = 1.9e-24, Identities = 81/275 (29%), Positives = 134/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSY---EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-------------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L       R I  ++   P    N  Y   E F   +   +++ I R+ KYL+F L + +  + HL M G+              F     ++    HV+ + E     +RY+D RRFG   ++   +    K +  LG +P   EF   YL   +      IKT LLDQ  V+G+GNIY  E L  S I P  ++  +     +++A + R ++ +A+E  G+++  +       G FQ   +V+ +    C    C  +I ++  +GR T+ C  CQ+
  S:     1 MPELPEVETVRRGLVP-ALEGRRILAVDVNRP----NLRYPFPERFAARLAGRRVEAIDRRAKYLLFRLDSGETMIGHLGMSGRFSIEVEGEVAQPGDFVHAAPANPKHDHVVFRAE-GGVVVRYNDPRRFGYMELFPTADEASHKTLGALGPEPHGNEFSGAYLGEVLAGRRTPIKTALLDQSIVAGLGNIYVCEALHRSGISPRRVSASIPGARAERLARDVRDVIVEAIEAGGSSLKDFASTDGALGYFQHGFRVYDRLGAPCPTPGCVGEIQRLVQSGRSTWFCSSCQR 287
>gi|82701716|ref|YP_411282.1| formamidopyrimidine-DNA glycosylase [Nitrosospira multiformis ATCC 25196] >gi|123544992|sp|Q2YBI1|FPG_NITMU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|82409781|gb|ABB73890.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Nitrosospira multiformis ATCC 25196] (272 aa)
Score = 290, Expect = 2.1e-24, Identities = 77/275 (28%), Positives = 131/275 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   +   G   R I  +    P +       +    +   +I+ +TR+GKYL+         ++HL M G L       +   +KH  + + +D    +R+ D RRFG   ++   N  D   +  LG +PL E FD K L +  +  + +IK  L++   V G+GNIYA+E LF + I P   A ++       +A+  +  L +A+E  G+++  +       G FQ+   V+++    C  C   I +I+   R ++ C +CQK
  S:     1 MPELPEVEVVRRGIA-SGLEGRKIAGLTVRNPNL--RWPVPELERTLCGLEIRTVTRRGKYLLLD-CGAGTLILHLGMSGSLRLLALAANIAPQKHDHIDLLLDKGMVLRFRDPRRFGA-VLWTTGNATDHPLLSHLGPEPLTEAFDGKLLYSKTRNRSASIKEVLMNSRIVVGVGNIYANEALFLAGIDPANAAGRIGARRCAGLAQAIKETLGRAIEAGGSSLRDFVGSDGNPGYFQQQYWVYSRTGQPCRKCGTNIEQIRQGQRSSFYCPRCQK 272
>gi|25028531|ref|NP_738585.1| formamidopyrimidine-DNA glycosylase [Corynebacterium efficiens YS-314] >gi|29611717|sp|Q8FP17|FPG_COREF Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|23493816|dbj|BAC18785.1| putative DNA-formamidopyrimidine glycosylase [Corynebacterium efficiens YS-314] (285 aa)
Score = 290, Expect = 2.2e-24, Identities = 83/275 (30%), Positives = 141/275 (51%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSY--EDFTHYIINEQIKDITRKGKYLIFHLTNDKV---------FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L+E   + RTI +   + P+  +N +    +    +   ++    R+GK+L   L  D V          +VHL M G++  +  D++ +  H+  + E+DD  E+ + D R FG + +    + +  + +  +  D L++  D   L   +K  N  IK  LL+QE VSGIGNIYADE+L+ + IHP   A++++      + E  R ++ +A++  GT+  A Y       G F   L  + +    C  C   I +     RG++ C +CQK
  S:     1 MPELPEVEVVRRGLEEH-MVGRTIVSAAVVHPRTARNQAGGGAEIEANLTGLRVGATNRRGKFLWLEL--DDVAQQAPSGLGLLVHLGMSGQMLVKSPDATLNP-HLRARAELDDGNEVWFVDQRTFGYWWLGELVDGVPGR-VSHIARDLLDDALDIPALAAVLKTKNTEIKRLLLNQEIVSGIGNIYADEMLWEAGIHPRQKASRISLTRLVALLEAGREVMTRALDQGGTSFDALYVNVNGASGYFSLSLNAYGQAGKPCARCGTPIARETFMNRGSHFCNRCQK 283
>gi|84498323|ref|ZP_00997120.1| formamidopyrimidine-DNA glycosylase [Janibacter sp. HTCC2649] >gi|84381823|gb|EAP97706.1| formamidopyrimidine-DNA glycosylase [Janibacter sp. HTCC2649] (290 aa)
Score = 289, Expect = 2.7e-24, Identities = 84/276 (30%), Positives = 134/276 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTND----KVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEM--DDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+ V   L +   + R I        ++ +       D    I+   I    R+GKYL   L +D       + HL M G+L  E  D+  D+KH+  +      D E+R+ D R FG F + +  +     +I+ +  DP E  +D   +   IK S+ AIK  +L Q  VSGIGNIYADE L+ + +H E  ++ LT     ++ +++R ++A A+   GT+  A Y       G F + L  + ++   C  C   I +     R ++ C  CQ +
  S:     1 MPELPEVEVVRRGLADH-VVGRRIATAAFTGARVARRHVPGPIDLAERIVGLDITQARRRGKYLWLVLGHDGEPVHGLIAHLGMSGQLLVEAADAP-DEKHLHARFTFADGDPELRFVDQRTFGGFALDDLADDGVPHQIRHIAPDPFELAYDQVAVVRRIKASDSAIKRMILHQGVVSGIGNIYADEALWRAKVHGERPSSSLTKPVIARVLDHAREVMAAALIEGGTSFDALYVNVNGASGYFDRSLHAYGQEGEPCARCGTPIRREHFMNRSSFSCPTCQPR 283
>gi|169829548|ref|YP_001699706.1| formamidopyrimidine-DNA glycosylase [Lysinibacillus sphaericus C3-41] >gi|168994036|gb|ACA41576.1| Formamidopyrimidine-DNA glycosylase [Lysinibacillus sphaericus C3-41] (290 aa)
Score = 288, Expect = 3.3e-24, Identities = 89/274 (32%), Positives = 143/274 (52%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIE----------SIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV---FVVHLRMEGKLFF----EKTDSSYDKKHVLVKIEMDD--YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEE-EFDWKYLKNNIKK-SNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+ V+ +LK +    RTI +++               I K    + F   +    I  I R+ KY+ FHL  D+V    V HL M G  F     E  + +  +KH+    +M D  Y I Y D RRFG      +    D   + K+  +P +E   ++   K+ + K +N+A+K  ++D + +SG GNIYA E LFA  IHP    N++++   + + E    +L +++E  G+TI+ Y     + G  Q  LK++ KK   C  C+    ++ + GR +  C  CQ
  S:     1 MPELPEVEGVVQALKPK-VEGRTIQHVQLSERVHFSFSEGKQCIVKQAEPDAFELTLSEMTITKIERRAKYIFFHLLKDEVPYVLVSHLGMTGAWFVVNSPEDINEAKFQKHIHATFKMADGGYLI-YSDIRRFGELRFLAKIE--DHIPLTKMAPEPFDELACEFFITKSTLPKYANKAVKEVIMDGQVISGCGNIYATEALFAQKIHPARKMNRISEKRKRALFEEIVAVLRQSIEAGGSTISDYRNINGEAGSMQNRLKMYGKK--ICPACETATSQMTIGGRTSSFCPNCQ 289
>gi|113972208|ref|YP_736001.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Shewanella sp. MR-4] >gi|117922515|ref|YP_871707.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Shewanella sp. ANA-3] >gi|123129981|sp|Q0HDC3|FPG_SHESM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166198751|sp|A0L2N2|FPG_SHESA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|113886892|gb|ABI40944.1| formamidopyrimidine-DNA glycosylase [Shewanella sp. MR-4] >gi|117614847|gb|ABK50301.1| formamidopyrimidine-DNA glycosylase [Shewanella sp. ANA-3] (271 aa)
Score = 288, Expect = 3.6e-24, Identities = 86/276 (31%), Positives = 137/276 (49%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTF---TIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L EQ  ++  I N     P         +    II + I+ + R+ KYL+   T+    +VHL M G L     D+  +K   +  +  +   +R++D RRFG +    +  E + L    ++KLG +PL + F+   L   +    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + ILA A++  GTT+  +   + + G F + L V+ +    C  C N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGIAPHLVEQTVVDLVIRNASLRWP-------VPELAKQIIGQTIRQVRRRAKYLLID-TDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAWLWCQLPEEAHPL----LEKLGPEPLTDAFNVNQLAAALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGRGGETCTQCGNLLSEIRLGQRTTVFCGICQTR 271
>gi|149908605|ref|ZP_01897267.1| putative formamidopyrimidine-DNA glycosylase [Moritella sp. PE36] >gi|149808439|gb|EDM68376.1| putative formamidopyrimidine-DNA glycosylase [Moritella sp. PE36] (270 aa)
Score = 287, Expect = 4.5e-24, Identities = 69/224 (30%), Positives = 122/224 (54%)
  Q:    52 IKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD-KKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +  + R+ KYL+   T     ++HL M G L     DSS   +KH  V I ++  + +R +D RRFG+  ++   + L+ K +  LG +PL ++F  + L +  +     +K+ L+D   V G+GNIYA+E LF++ I+P+  A  ++   +K + E  +++LAKA+   GTT+  +     + G F + L+V+ K    C  C  ++  +K+  R T  C +CQ+
  S:    49 VTSVRRRAKYLLLE-TEKGTIIIHLGMSGSL--RVLDSSVAVEKHDHVDIVLNSGKCLRLNDPRRFGS-VLWQVGDVLEHKLLASLGPEPLTDDFTAQRLFDRSRSRKVPVKSFLMDNHIVVGVGNIYANEALFSAGINPKRAAGNVSLQRYKVLVEEVKLVLAKAIAQGGTTLKDFTQTDGKPGYFVQELQVYGKAGKPCPKCGEELKAMKIGQRNTIYCNQCQR 270
>gi|187477042|ref|YP_785066.1| formamidopyrimidine-DNA glycosylase [Bordetella avium 197N] >gi|123514466|sp|Q2KYB7|FPG_BORA1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|115421628|emb|CAJ48138.1| formamidopyrimidine-DNA glycosylase [Bordetella avium 197N] (275 aa)
Score = 287, Expect = 4.6e-24, Identities = 85/276 (30%), Positives = 132/276 (47%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIY-NENNYLDSKEIK-KLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGE-FQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++    ID +     L R +     +   I       D    + +  +    R+GKYL+    +  V +VHL M G L     D +  +KH  V    D   +R HD RRFG    + N +  +++  +   LG++P +  FD K+L ++ +    A+K  LL    V G+GNIYA E LF + I P T A KL+    +++A+  R  LA A+ + G+T+  Y     + G  F     V+ +    C  C   I ++    R TY C  CQK+
  S:     1 MPELPEVETTRRGIDPVITGQTLRRLVVREPRMRWPI-----PADLPSLLTDRPVLATGRRGKYLLLRFEHG-VQIVHLGMSGSLRRVAMDEA-PRKHDHVDWVFDHAILRLHDPRRFGAVLWHPNTDGPVEAHPLLIGLGIEPFDPRFDGKWLHDHFRDKRVAVKQALLAGHAVVGVGNIYASECLFRAGIDPRTPAGKLSRPRCERLAQAVRATLADALASGGSTLRDYVGASGEPGAYFAIHAAVYERAGLACRVCGTPIRRLVQGQRATYFCPHCQKR 275
>gi|149115063|ref|ZP_01841810.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS223] >gi|160877565|ref|YP_001556881.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS195] >gi|189044676|sp|A9KW47|FPG_SHEB9 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|146865078|gb|EDK50426.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS223] >gi|160863087|gb|ABX51621.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS195] (271 aa)
Score = 287, Expect = 5.3e-24, Identities = 86/276 (31%), Positives = 135/276 (48%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L EQ  ++  I N     P         D    II + I+ + R+ KYL+   T+    +VHL M G L     D+  +K   +  +  +   +R++D RRFG + ++ E        + KLG +PL   F+   L   +    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + ILA A++  GTT+  +     + G F + L V+++    C +C N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGIAPFLVEQTVVDLVIRNGSLRWP-------VPDIAKQIIGQVIRQVRRRAKYLLID-TDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAW-LWCELPEEAHPLLAKLGPEPLTNAFNVTQLAAALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNADGKPGYFAQKLHVYSRGGETCTSCGNLLSEIRLGQRTTVFCGICQTR 271
>gi|144898444|emb|CAM75308.1| formamidopyrimidine-DNA glycosylase [Magnetospirillum gryphiswaldense MSR-1] (314 aa)
Score = 286, Expect = 5.5e-24, Identities = 84/275 (30%), Positives = 128/275 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKE---IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIV------KIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L      +R I  +E+  P + K     DF   +   +++ + R+ KYL+ HL +    + HL M G +   K  +     H  V+   DD   + Y D RRFG   +      LD      +  LG +PL  +F  K L   +     +IK  LLDQ  V+G+GNIY  E LF S I P   A  L   +  K+    R +L +A+   G+++  +     + G FQ    V+ +    C  C   I       +I  +GR T+ C K Q+
  S:    37 MPELPEVETVARGLAAVWPGHRFI-RVEARRPDLRKPLP-ADFAARLTGRRVESVGRRAKYLLVHLDDGLTLLGHLGMSGAMVISKGRNEPPGPHDHVEFVSDDGTMVTYRDPRRFGLMDLT-----LDPSTHPLLAHLGPEPLGPDFHEKALAQTLDGKGASIKAALLDQNVVAGLGNIYVSESLFLSGIDPTRAAGSLKPREINKLVPAIRAVLERAIAAGGSSLKDHVQPNGELGYFQHSFTVYDRAGEACPGCDCDIARTGGIQRIVQSGRSTFYCAKKQR 314
>gi|117620578|ref|YP_854697.1| formamidopyrimidine-DNA glycosylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166215607|sp|A0KEN2|FPG_AERHH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|117561985|gb|ABK38933.1| formamidopyrimidine-DNA glycosylase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (270 aa)
Score = 286, Expect = 5.6e-24, Identities = 69/229 (30%), Positives = 121/229 (52%)
  Q:    47 IINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +++  I  ++R+ KYL+   T+    ++HL M G L      +  +K H  V IE+ + ++ R +D RRFG   ++          + KLG +PL + F+  YL+   K  + AIKT L+D + V G+GNIYA+E L+A+ IHP+  A  ++      +    + +LA+A+   GTT+  +     + G F + L+V+ +    C +C   + +I++  R T  C  CQ+
  S:    44 LVDLTIHRVSRRAKYLLLE-TDFGTAILHLGMSGSLRVLDIGTPAEK-HDHVDIELANGKLLRLNDPRRFGAL-LWTREPAEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQVVVGVGNIYANEALYAAGIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFTSADGKPGYFVQQLQVYGRGGQPCFHCHTLLSEIRLGQRTTVFCSHCQR 270
>gi|37528666|ref|NP_932011.1| formamidopyrimidine-DNA glycosylase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|39931200|sp|Q7MY36|FPG_PHOLL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|36788105|emb|CAE17229.1| formamidopyrimidine-DNA glycosylase (FAPY-DNA glycosylase) [Photorhabdus luminescens subsp. laumondii TTO1] (269 aa)
Score = 286, Expect = 5.8e-24, Identities = 79/274 (28%), Positives = 132/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++       +G     + N+  I   + +N        +    + ++ +  I R+ KYL+  L N  + +VHL M G L     +   +K   +  +  D   +RY D RRFG +     ++      +  LG +PL ++F+  YL          IK  L+D + V G+GNIYA+E LF + I P+  A  LT+ +   +AE  + +L +++E  GTT+  +     + G F + L V+ +    C  C  +I  IK+  R T+ C  CQ
  S:     1 MPELPEVET-----SRRGIEPHLVGNV--IQYAVVRNGRLRWPVAEEIMKLSDQLVLSIQRRAKYLLIELANGWI-IVHLGMSGSLRILPEERPAEKHDHVDLVMADGKVLRYTDPRRFGAWLW--SDDLERCSVLAHLGPEPLSDDFNGFYLYTRSSNKKTLIKPWLMDNKLVVGVGNIYANEALFTAHIQPDRPAQTLTEREAHLLAETIKKVLQRSIERGGTTLRDFLQSDGKPGYFAQELFVYGRAGEPCRICGEQIESIKLGQRSTFFCRHCQ 268
>gi|114049458|ref|YP_740008.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Shewanella sp. MR-7] >gi|123130915|sp|Q0HPK4|FPG_SHESR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|113890900|gb|ABI44951.1| formamidopyrimidine-DNA glycosylase [Shewanella sp. MR-7] (271 aa)
Score = 286, Expect = 6.6e-24, Identities = 85/276 (30%), Positives = 137/276 (49%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTF---TIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L EQ  ++  + N     P         +    II + I+ + R+ KYL+   T+    +VHL M G L     D+  +K   +  +  +   +R++D RRFG +    +  E + L    ++KLG +PL + F+   L   +    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + ILA A++  GTT+  +   + + G F + L V+ +    C  C N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGIAPHLVEQTVVDLIVRNASLRWP-------VPELAKQIIGQTIRQVRRRAKYLLID-TDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAWLWCQLPEEAHPL----LEKLGPEPLTDAFNVNQLAAALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGRGGETCTQCGNLLSEIRLGQRTTVFCGICQTR 271
>gi|126172330|ref|YP_001048479.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS155] >gi|153002820|ref|YP_001368501.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS185] >gi|166198748|sp|A3CYP7|FPG_SHEB5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166198749|sp|A6WUE9|FPG_SHEB8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|125995535|gb|ABN59610.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS155] >gi|151367438|gb|ABS10438.1| formamidopyrimidine-DNA glycosylase [Shewanella baltica OS185] (271 aa)
Score = 285, Expect = 7.1e-24, Identities = 86/276 (31%), Positives = 135/276 (48%)
  Q:     1 VPELPEV----QSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV    Q +   L EQ  ++  I N     P         D    II + I+ + R+ KYL+   T+    +VHL M G L     D+  +K   +  +  +   +R++D RRFG + ++ E        + KLG +PL + F+   L   +    +AIK  L+D   V G+GNIYA+E LFA+ IHPE  A K+       +    + ILA A++  GTT+  +     + G F + L V+ +    C +C N + +I++  R T  C  CQ +
  S:     1 MPELPEVEVTRQGIAPFLVEQTVVDLVIRNGSLRWP-------VPDIAKQIIGQVIRQVRRRAKYLLID-TDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILRFNDPRRFGAW-LWCELPEEAHPLLAKLGPEPLTQAFNVAQLAAALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFTNADGKPGYFAQKLHVYGRGGETCTSCGNLLSEIRLGQRTTVFCGICQTR 271
>gi|46201678|ref|ZP_00208205.1| COG0266: Formamidopyrimidine-DNA glycosylase [Magnetospirillum magnetotacticum MS-1] (279 aa)
Score = 285, Expect = 7.2e-24, Identities = 81/274 (29%), Positives = 133/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMD-DYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNK-----IVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L  Q    R   ++E+    + +    +DF   +   +++ + R+ KYL+  L +  V + HL M G++      ++    H  V+   D    +   D RRFG FT+           +  +G +PL++ FD K L   +K  +  IKT LLDQ  V+G+GNIY  E LF + I P   A  LT  +  ++    + +L +AV   G+T+  +     + G FQ   +V+ ++   C +C        I +I   GR T+ C K Q
  S:     1 MPELPEVETVARGLA-QVWDGRRFVSVETRRSGL-RVPFPKDFAQRLTGRRVESVGRRAKYLVVRLDDGLVMLGHLGMSGRMTIGALRNAPPGPHDHVEWVTDAGISVTLTDPRRFGLFTLCEAGELAAHPLLAGIGPEPLDDSFDAKVLAQALKGKSGPIKTVLLDQRTVAGLGNIYVCESLFRARISPLRPAGSLTKAETGRLVPLIKAVLTEAVAAGGSTLKDHARPDGELGYFQHSFQVYGREGEACPDCPGAPQCGGISRITQAGRSTFYCAKRQ 278
>gi|153826318|ref|ZP_01978985.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MZO-2] >gi|194537213|ref|YP_002072359.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae V51] >gi|125621826|gb|EAZ50153.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae V51] >gi|149739887|gb|EDM54074.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MZO-2] (269 aa)
Score = 285, Expect = 8.4e-24, Identities = 80/274 (29%), Positives = 134/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     +  TI ++    PK+      E     +  + I  I R+ KYLI         +VHL M G L     D    K   +  +      +RY+D RRFG +     +   +S E+  +LG +PL E F+ +Y+ +  +    A+K  ++D   V G+GNIYA+E LF S +HP   A+ L+  +++ +  N + +L  A++  GTT+  +     + G F + L+V+ K    C++C   I + K+  R T+ C +CQ
  S:     1 MPELPEVEVSRLGISPH-LVGGTIQSLVLRTPKLRWPIPQE--LKQLEGQTILAIHRRAKYLIIETAVGNA-IVHLGMSGSLRILDGDFPAAKHDHVDLVMTSGKRLRYNDPRRFGAWLWCAPD---ESHEVLGRLGPEPLTEAFNAEYMMDKARNKRIAVKAFIMDNAAVVGVGNIYANESLFTSRLHPLRPAHSLSLEEWQTLVANIKQVLQVAIKQGGTTLKDFTQSDGKPGYFAQELQVYGKAKQPCLHCGEPICEQKIAQRNTFFCPQCQ 268
>gi|163698324|ref|ZP_02117187.1| DNA-formamidopyrimidine glycosylase [Methylobacterium nodulans ORS 2060] >gi|162435346|gb|EDQ45927.1| DNA-formamidopyrimidine glycosylase [Methylobacterium nodulans ORS 2060] (297 aa)
Score = 285, Expect = 8.7e-24, Identities = 75/277 (27%), Positives = 136/277 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL---------------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTD------NDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCV--NCKNKIVKIKVNGRGTYLCLKCQKKK 277
           +PELPEV++V   L E   +    +++    P + +    E F   +  ++++ ++R+ KYL+  L++ +  ++HL M G+                + E   +     HV   +  +   + Y+D RRFG   +         +    +G++PL  E   + +    +     +K  LLDQ  ++G+GNIY  E L  + +HPET A  L D         + +AE  R +L +AV   G+T+  Y      KG FQ   +V+ ++   C    C+  + ++  +GR T+ C  CQ  +
  S:     1 MPELPEVETVRRGL-EPALVGACFSHVHLARPDL-RFPLPERFAARLTGQRVEALSRRAKYLVADLSSGEALIMHLGMSGRFDVVLPDGRQVSPGDFYLEGAGARAKHDHVSFALS-NGARVTYNDVRRFGFMDLVPAAELATCRHFAGMGIEPLGNELSGEAVARLFRGRRTPLKAALLDQRLIAGLGNIYVCEALHRARLHPETPAGALADAAGRPTKAARLLAEVIRDVLTEAVAAGGSTLRDYVHTDGTKGAFQHAFRVYDREGLACTARGCRGVVRRVVQSGRSTFFCEVCQPAR 297
>gi|158312992|ref|YP_001505500.1| formamidopyrimidine-DNA glycosylase [Frankia sp. EAN1pec] >gi|158108397|gb|ABW10594.1| formamidopyrimidine-DNA glycosylase [Frankia sp. EAN1pec] (291 aa)
Score = 284, Expect = 1.0e-23, Identities = 79/276 (28%), Positives = 137/276 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK--------VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD--YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQ-KGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+ V   L E+G + RT+  +E    +  +      + F   ++ + +    R+GKYL   LT  +          + HL M G+L     DS  D+ H+ V+    D   E+R+ D R FG   + +    L +  I  +  DPL  +FD +   + +++    +K  LLDQ  +SG+GNIYADE L+A+ +H       +T  +  ++ +  R ++  A+   GT+    +   E   G F++ L+V+ +    C  C + I +     R ++ C  CQ +
  S:     1 MPELPEVEVVRRGL-ERGVVGRTVAEVEVHHLRAVRRHLAGADHFAASLVGQTVATARRRGKYLWLGLTPSEPGGPAVGDALLGHLGMSGQLLVVPADSP-DQVHLRVRFRFTDEGRELRFVDQRTFGGLAVVSGGAELPAP-IAHIAPDPLSVDFDPERFADALRRRRTGLKRALLDQTLISGVGNIYADEGLWAARLHYARPTETVTRAEALRLLDAVRTVMTAALAAGGTSFDRLYVSTEGVSGLFERSLEVYGRGGQACSRCASTIRRDAFMNRSSFSCPACQPR 286
>gi|151337011|gb|ABS00947.1| MutM [Thermus aquaticus] (200 aa)
Score = 284, Expect = 1.0e-23, Identities = 65/203 (32%), Positives = 107/203 (52%)
  Q:    73 VVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQ--KGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           VVHL M G    EKT       H   +  ++D  + +HD RRFG   +     Y +   + +LG +PL  EF  +     +++S + +K  LLDQ   +G+GNIYADE LF + + P  +  ++++ +  ++ +  R +LA+AV   G+T++   +++     G FQK   V+ +    C  C   I K  V GRGT+ C +CQ+
  S:     2 VVHLGMTGGFRLEKT------PHTRAEFLLEDGVLHFHDPRRFGRIWVVERGAYGEIPLLARLGPEPLSPEFRPEAFLLGLRRSRKPLKALLLDQTLAAGVGNIYADEALFRAGLSPFRLGREVSEEEALRLFQALREVLAEAVALGGSTLSDRTYQQPDGLPGGFQKRHAVYGRTGLPCPRCGAPIAKGVVAGRGTHYCPRCQR 200
>gi|91781717|ref|YP_556923.1| formamidopyrimidine-DNA glycosylase [Burkholderia xenovorans LB400] >gi|122970731|sp|Q145W8|FPG_BURXL Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|91685671|gb|ABE28871.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Burkholderia xenovorans LB400] (276 aa)
Score = 284, Expect = 1.0e-23, Identities = 80/275 (29%), Positives = 128/275 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEK--TDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIY--NENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  +E   P + +     D    +    ++ + R+GKYL+F + +   F+VHL M G L   +         KH  V    D++ +RY D RRFG    +     + L+   +  LG++P    F    +    +    ++K  LL  E V G+GNIYA E LF + I P T A +++   +  +A+  R+ LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPYVSGRKVERVEVRTPAL-RWPIPADLAKTLRGRVVRKVERRGKYLLFEI-DAGWFIVHLGMTGTLRVLRHVPHPPAAAKHDHVDWIFDEFILRYRDPRRFGAVLWHPREAGDVLEHPLLAGLGVEPFSPAFSGALMHRLTRGRKVSVKQALLAGEIVVGVGNIYASESLFRAGIRPATAAGRVSLVRYDLLADAVRVTLAAAIEKGGSTLRDFVGSNGESGYFQLDYFVYDRAGLPCRVCGTPIKQIVQGQRSTYFCPTCQR 276
>gi|39931196|sp|Q7MPS3|FPG_VIBVY Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) (269 aa)
Score = 283, Expect = 1.3e-23, Identities = 83/274 (30%), Positives = 133/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKK-HVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     LN+TI ++    PK+      E     +  + I+ I R+ KYLI   T+    +VHL M G L     D    K  HV +K+  +   +RY+D RRFG +         D   +  +G +PL + FD +Y+    +    A+K  ++D + V G+GNIYA E LF S I P      L+  +++++  + +  L  A+E  GTT+  +     + G F + L+V+ K    C  C   I ++K+  R T+ C  CQ
  S:     1 MPELPEVEVSRMGITPH-LLNQTIQSLIFRTPKLRWVIPSE--LKKLQGQVIRHIGRRAKYLIIE-TDVGSAIVHLGMSGSLRVLDADFPAGKHDHVDLKLS-NGKVLRYNDPRRFGAWLYAAPGE--DHDVLGNIGPEPLTDAFDGQYMFEKAQGKRVAVKQFIMDNKIVVGVGNIYASESLFRSRILPTRATMSLSAEEWQRLVSHIKQTLQTAIEQGGTTLKDFSQADGKPGYFAQELQVYGKAGESCPECGEAIQELKIGQRNTFYCSYCQ 268
>gi|37678473|ref|NP_933082.1| formamidopyrimidine-DNA glycosylase [Vibrio vulnificus YJ016] >gi|37197213|dbj|BAC93053.1| formamidopyrimidine-DNA glycosylase [Vibrio vulnificus YJ016] (294 aa)
Score = 283, Expect = 1.3e-23, Identities = 83/274 (30%), Positives = 133/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKK-HVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     LN+TI ++    PK+      E     +  + I+ I R+ KYLI   T+    +VHL M G L     D    K  HV +K+  +   +RY+D RRFG +         D   +  +G +PL + FD +Y+    +    A+K  ++D + V G+GNIYA E LF S I P      L+  +++++  + +  L  A+E  GTT+  +     + G F + L+V+ K    C  C   I ++K+  R T+ C  CQ
  S:    26 MPELPEVEVSRMGITPH-LLNQTIQSLIFRTPKLRWVIPSE--LKKLQGQVIRHIGRRAKYLIIE-TDVGSAIVHLGMSGSLRVLDADFPAGKHDHVDLKLS-NGKVLRYNDPRRFGAWLYAAPGE--DHDVLGNIGPEPLTDAFDGQYMFEKAQGKRVAVKQFIMDNKIVVGVGNIYASESLFRSRILPTRATMSLSAEEWQRLVSHIKQTLQTAIEQGGTTLKDFSQADGKPGYFAQELQVYGKAGESCPECGEAIQELKIGQRNTFYCSYCQ 293
>gi|77972446|ref|ZP_00828012.1| COG0266: Formamidopyrimidine-DNA glycosylase [Yersinia frederiksenii ATCC 33641] (269 aa)
Score = 283, Expect = 1.3e-23, Identities = 81/274 (29%), Positives = 132/274 (48%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L  Q  L   + N     P         D    + ++ +  + R+ KYL+  L    + +VHL M G L    ++ +  +KH  V + + + +I RY D RRFG +      +   S  +  LG +PL +EF   YL    +     +K  L+D + V G+GNIYA E LFA+ I PE  A  LT+++  ++    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C + I   K   R T+ C  CQ
  S:     1 MPELPEVETSRRGIEPYLAGQTILYAVVRNARLRWP-------VSDEILALSDQPVLSVQRRAKYLLIELKTGWI-IVHLGMSGSLRI-LSEETEPEKHDHVDLVISNGKILRYTDPRRFGAWLW--AKDLETSNVLAHLGPEPLSDEFTTNYLFEKSRNKRTVVKQWLMDNKIVVGVGNIYASESLFAAGILPERAAGSLTESEIARLVATIKAVLLHSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGEPCRQCGHLIEIAKHGQRSTFFCRHCQ 268
>gi|146284319|ref|YP_001174472.1| formamidopyrimidine-DNA glycosylase [Pseudomonas stutzeri A1501] >gi|166198735|sp|A4VRM9|FPG_PSEU5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|145572524|gb|ABP81630.1| formamidopyrimidine-DNA glycosylase [Pseudomonas stutzeri A1501] (270 aa)
Score = 283, Expect = 1.3e-23, Identities = 80/275 (29%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    ++      R    +       +     ED    +  ++I+ + R+ KYL+         +VHL M G L   +    +   +HV + +E     +RY D RRFG     +E   L    +  LG +PL E+FD   L    +  + A+K  ++D   V G+GNIYA E LFA+ I P   A  ++   + K+ E  R ILA A+E  GTT+  +     + G FQ+ L V+ +    C +C + + +I++  R +  C +CQ+
  S:     1 MPELPEVETTRRGIEPHLVGQRVSRVLVRDRRLRWP--IPEDLDVRLSGQRIEAVERRAKYLLIR-AESGTLIVHLGMSGSLRLVDAASPAAKHEHVDILLE-SGQALRYTDPRRFGAMLWSDEP--LAHVLLASLGPEPLGEDFDGDRLYRLSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAAGIDPRRPAGSISRARYLKLGEEIRRILAMAIERGGTTLRDFVGGDGKPGYFQQELFVYGRGGEFCKSCGSTLREIRLGQRASVYCSRCQR 270
>gi|84684525|ref|ZP_01012426.1| Formamidopyrimidine-DNA glycolase [Rhodobacterales bacterium HTCC2654] >gi|84667504|gb|EAQ13973.1| Formamidopyrimidine-DNA glycolase [Rhodobacterales bacterium HTCC2654] (283 aa)
Score = 283, Expect = 1.4e-23, Identities = 80/275 (29%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKT-------DSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+     +R I   E +  +  +    E     +    +  + R+ KY++  L  ++  ++HL M G++    T       +    +KH  V ++MD    I  +D RRFG   ++          I  LG +PL  EF+  YL   +   N  IK+ LLDQ  V+G+GNIY  E L+ + IHP   A +++      +    R +LA+A+   G+++  Y     + G FQ   +V+ ++   C    C+ KI +I  +GR ++ C  CQ+
  S:     1 MPELPEVETVRRGLEPVMTGHR-IARAE-VRREGLRWPFPERMAERLTGATVLGLRRRSKYILADLDTNETCLIHLGMSGRILISGTTLGKFHHEHPATEKHDHVVLDMDGGARITLNDARRFGVMDLFTTGTGDLHPLIAALGPEPLGNEFNEGYLIAKLAGKNTPIKSALLDQRIVAGLGNIYVCEALYRAGIHPARKAGRISAARIASLVPIIRDVLAEAIAAGGSSLRDYRQADGELGYFQHTFRVYDQEGQPCKTPECQAKIARIVQSGRSSFYCPTCQR 283
>gi|83720571|ref|YP_441036.1| formamidopyrimidine-DNA glycosylase [Burkholderia thailandensis E264] >gi|167579767|ref|ZP_02372641.1| formamidopyrimidine-DNA glycosylase [Burkholderia thailandensis TXDOH] >gi|167617843|ref|ZP_02386474.1| formamidopyrimidine-DNA glycosylase [Burkholderia thailandensis Bt4] >gi|123538059|sp|Q2T1B3|FPG_BURTA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|83654396|gb|ABC38459.1| formamidopyrimidine-DNA glycosylase [Burkholderia thailandensis E264] (276 aa)
Score = 283, Expect = 1.5e-23, Identities = 79/275 (28%), Positives = 134/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK--KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKE---IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  ++ +   + +     DF   + + ++  + R+GKYL+F + +   F+VHL M G L     D+      KH  V    D++ +R+ D RRFG   +++  +  D +    +  LG++P    F    L    +    ++K  LL  + V G+GNIYA E LF + I P T A +++   ++++A+  R  LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPFVAGRRVERVD-VRTAMLRWPVPADFAEMLRSREVLGVERRGKYLLFEV-DAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWVFDEFVLRFRDPRRFGA-VLWHPRDAGDVRAHPLLASLGVEPFSAAFSGALLFKRTRGRTVSVKQALLAGDIVVGVGNIYASESLFRAGIRPTTAAGRVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNGESGYFQLDCFVYDRAGEPCRVCGAPIRQIVQGQRSTYYCPNCQR 276
>gi|85860946|ref|YP_463148.1| formamidopyrimidine-DNA glycosylase [Syntrophus aciditrophicus SB] >gi|85724037|gb|ABC78980.1| formamidopyrimidine-DNA glycosylase [Syntrophus aciditrophicus SB] (311 aa)
Score = 282, Expect = 1.6e-23, Identities = 84/274 (30%), Positives = 139/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-EKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNE----NNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++   L+ Q   +  I     +  K+ K          +    I  +TR GK ++  L + +   +HLRM G+L + EK D      H    +++    I   D RRF T ++  +    N  +D+       L P   E     LK      +R+IK+ L+DQ  + GIGNIYA EIL+ + ++P      LT  D++++      +L+KAV  +GT+I+ +      KGE+QK L+V+ ++   C +C   I ++++ GRGT+ C  CQ
  S:    51 MPELPEVETLCRQLR-QKVPHAKIKGTFILDSKLGK-------LDNLKGRGIASVTRLGKRIVLGLDDGRSLEIHLRMTGRLLWQEKPDIGEKPPHSRFILDLTPGRIIIVDPRRFATLSLVADAAKGNAAVDA-------LKPGCPE----ALKEKGCNRSRSIKSFLMDQSIIGGIGNIYACEILYRAGLNPLRRTADLTSEDWRRVGSAMVEVLSKAVVCRGTSISDWRDLFGCKGEYQKELRVYGREGKKCPHCGGIIQRVRLLGRGTWFCPNCQ 310
>gi|124520543|ref|ZP_01695673.1| Formamidopyrimidine-DNA glycolase [Bacillus coagulans 36D1] >gi|124497499|gb|EAY45057.1| Formamidopyrimidine-DNA glycolase [Bacillus coagulans 36D1] (267 aa)
Score = 282, Expect = 1.6e-23, Identities = 79/274 (28%), Positives = 132/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPE+++    L       RTITN   I  +   N     F   + N++I+ I+R  KYLIF L N    ++HL + G +FF K +   D+  + +++   D  + +    R G   +          E +K+G + L+  F    L+  +++    +KT L +QE ++GIGN Y+DEIL+ + + P+  A  L +    ++ E+ R IL K +E  G           + G +Q +  VH ++D  C  C   I K +++   TY C  CQ
  S:     1 MPELPEMETYKTWLASL-IGGRTITN-AMIQREKSINIPAGKFMKAVTNQKIQSISRCAKYLIFQLENGSCLLLHLMLGGWMFFGKEEDKPDRT-IQIQLSFGDRHL-FFIGLRLGYLHLLTPEAV--QAEFEKIGPELLDLHFTLAVLQQRMQQRRGILKTVLTNQEVLAGIGNRYSDEILWHAQLRPDQKAGHLDNQQLARLYESIRFILQKGIEQGGYMEHPLHKGDGKTGCYQMY--VHGREDEPCPRCSTPIRKKEISSHKTYFCPYCQ 266
>gi|145301060|ref|YP_001143901.1| formamidopyrimidine-DNA glycosylase [Aeromonas salmonicida subsp. salmonicida A449] >gi|166215608|sp|A4STD1|FPG_AERS4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|142853832|gb|ABO92153.1| formamidopyrimidine-DNA glycosylase [Aeromonas salmonicida subsp. salmonicida A449] (270 aa)
Score = 282, Expect = 1.6e-23, Identities = 69/229 (30%), Positives = 121/229 (52%)
  Q:    47 IINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +++  I  ++R+ KYL+   T+     +HL M G L      +  +K H  V IE+ + ++ R +D RRFG   ++          + KLG +PL + F+ +YL+   K  + AIKT L+D   V G+GNIYA+E L+A+ IHP+  A  ++    + +    + +LA A++  GTT+  +     + G F + L+V+ +    C +C   + +I++  R T  C  CQ+
  S:    44 LVDLTIHRVSRRAKYLLLE-TDFGTADLHLGMSGSLRVLNIGTPAEK-HDHVDIELANGKLLRLNDPRRFGAL-LWTREPAEAHALLAKLGPEPLTDAFNAEYLQGRAKGRSTAIKTFLMDNHVVVGVGNIYANEALYAAGIHPKRAAGNISAERLETLVAEIKRVLASAIQQGGTTLKDFTSADGKPGYFVQQLQVYGRGGQACFHCHTLLSEIRLGQRTTVFCSHCQR 270
>gi|110677612|ref|YP_680619.1| formamidopyrimidine-DNA glycosylase [Roseobacter denitrificans OCh 114] >gi|122973136|sp|Q16DL0|FPG_ROSDO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|109453728|gb|ABG29933.1| formamidopyrimidine-DNA glycosylase [Roseobacter denitrificans OCh 114] (283 aa)
Score = 282, Expect = 1.6e-23, Identities = 79/275 (28%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLK---EQGCLNRTITNIESI---MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLF--------FEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCV--NCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L    E   + R   N   +    P         D    +  ++++ + R+ KY++  L + +  +VHL M G++         F  +  + +K   +V    ++  I ++D RRFG   +    +    K +  LG +PL  +F   +L    K  N  +K+ LLDQ  VSG+GNIY  E LF + IHP   A K++      +    R +LA+A+E  G+++  +     + G FQ    V+ ++   C    C  +I +I  +GR ++ C +CQ+
  S:     1 MPELPEVETVRRGLTPAMEGVVIARADVNRPDLRWPFPA--------DMAARLTGKRVERLRRRSKYILMDLDSGETLLVHLGMSGRMLVSGDPLGQFVHSHPAPEKHDHVVFHMANNARITFNDPRRFGAMDLMETASADTHKLLSVLGPEPLGNDFHESHLIEAFKNRNSPVKSVLLDQRIVSGLGNIYVCEALFRAKIHPIRKAGKISGARVATLVPIIREVLAEAIEAGGSSLRDFKQADGELGYFQHSFDVYGREGAPCKGEGCTGQIKRIVQSGRSSFYCAQCQR 283
>gi|153214741|ref|ZP_01949586.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae 1587] >gi|153800805|ref|ZP_01955391.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MZO-3] >gi|153831394|ref|ZP_01984061.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae 623-39] >gi|124115177|gb|EAY33997.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae 1587] >gi|124123636|gb|EAY42379.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MZO-3] >gi|148873126|gb|EDL71261.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae 623-39] (269 aa)
Score = 282, Expect = 1.7e-23, Identities = 81/274 (29%), Positives = 134/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     +  TI ++    PK+      E     +  + I  I R+ KYLI   T     +VHL M G L     D    K   +  +      +RY+D RRFG +     +   +S E+  +LG +PL E F+ +Y+ +  +    A+K  ++D   V G+GNIYA+E LF S +HP   A+ L+  +++ +  N + +L  A++  GTT+  +     + G F + L+V+ K    C +C   I + K+  R T+ C +CQ
  S:     1 MPELPEVEVSRLGISPH-LVGGTIQSLVLRTPKLRWPIPQE--LKQLEGQTILAIHRRAKYLIIE-TAVGSAIVHLGMSGSLRILDGDFPAAKHDHVDLVMTSGKRLRYNDPRRFGAWLWCAPD---ESHEVLGRLGPEPLTEAFNAEYMMDKARNKRIAVKAFIMDNAAVVGVGNIYANESLFTSRLHPLRPAHSLSLEEWQSLVANIKQVLQVAIKQGGTTLKDFTQSDGKPGYFAQELQVYGKAKQPCPHCGEPICEQKIAQRNTFFCPQCQ 268
>gi|93117325|gb|ABE99580.1| fpg [Neisseria meningitidis] (255 aa)
Score = 282, Expect = 1.7e-23, Identities = 75/226 (33%), Positives = 113/226 (50%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGT 267
           D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    K  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT
  S:    28 DLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGKPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEVFCADYLYARLKTQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLQRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGT 255
>gi|93117321|gb|ABE99578.1| fpg [Neisseria meningitidis] (258 aa)
Score = 282, Expect = 1.7e-23, Identities = 75/226 (33%), Positives = 113/226 (50%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGT 267
           D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    K  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT
  S:    31 DLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGKPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEVFCADYLYARLKTQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLQRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGT 258
>gi|187922596|ref|YP_001894238.1| formamidopyrimidine-DNA glycosylase [Burkholderia phytofirmans PsJN] >gi|187713790|gb|ACD15014.1| formamidopyrimidine-DNA glycosylase [Burkholderia phytofirmans PsJN] (276 aa)
Score = 282, Expect = 1.7e-23, Identities = 78/275 (28%), Positives = 129/275 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEK--TDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIY--NENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  ++   P + +     D    +    ++ + R+GKYL+F + +   F+VHL M G L   +         KH  +    D++ +RY D RRFG    +     + L+   +  LG++P    F    +    +    ++K  LL  E V G+GNIYA E LF + I P T A +++   ++ +A+  R+ LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPYVSGRKVERVDVRTPAL-RWPIPADLAKTLRGHVVRKVERRGKYLLFEI-DAGWFIVHLGMTGTLRVLRHVPHPPAAAKHDHIDWIFDEFILRYRDPRRFGAVLWHPREAGDVLEHPLLASLGVEPFSPAFSGALMHRLTRGRKVSVKQALLAGEIVVGVGNIYASESLFRAGIRPTTAAGRVSLVRYELLADAVRVTLAAAIEKGGSTLRDFVGSNGESGYFQLDYFVYDRAGLPCRVCGTPIKQIVQGQRSTYFCPTCQR 276
>gi|67154866|ref|ZP_00416611.1| Formamidopyrimidine-DNA glycolase [Azotobacter vinelandii AvOP] >gi|67088999|gb|EAM08465.1| Formamidopyrimidine-DNA glycolase [Azotobacter vinelandii AvOP] (282 aa)
Score = 282, Expect = 1.8e-23, Identities = 71/235 (30%), Positives = 124/235 (52%)
  Q:    41 EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           ED    +  ++I+ + R+ KYL+         + HL M G L   E    +   +HV + +E     +RY D RRFG   +    + L+ + +++LG +PL E+FD + L    +  + A+K  ++D   V G+GNIYA E LFA+ I P   A  ++   ++++AE  R ILA+A+E  GTT+  +     + G FQ+ L V+ +    C  C + + ++++  R +  C +CQ+
  S:    51 EDLDVRLSGQRIEAVERRAKYLLIR-AEAGTLIGHLGMSGSLRLVEAGLPAVRHEHVDILLE-SGLALRYTDPRRFGA--LLWSADPLEHELLRRLGPEPLGEDFDGERLYRLSRGKSVAVKPFIMDNAVVVGVGNIYASEALFAAGIDPRRAAGSVSRARYRRLAEEIRRILAQAIECGGTTLRDFVGGDGKPGYFQQTLLVYGRGGEFCKVCGSTLHEVRLGQRASVYCGRCQR 282
>gi|30250471|ref|NP_842541.1| formamidopyrimidine-DNA glycolase [Nitrosomonas europaea ATCC 19718] >gi|39931259|sp|Q82S12|FPG_NITEU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|30139312|emb|CAD86464.1| Formamidopyrimidine-DNA glycolase [Nitrosomonas europaea ATCC 19718] (271 aa)
Score = 282, Expect = 1.9e-23, Identities = 76/274 (27%), Positives = 135/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +       R IT I SI   + +          +  ++I  I R+ KYL+F  +     ++HL M G L     +S+  + H    +++D+   +R+ D RRFG   ++ + +      ++KLG +PL ++FD ++L    +  N +IK  L++Q  V GIGNIYA+E LF + I P   A  L     +++ +  +  L +A++  G+++  +   +   G FQ+   V+ +    C  C   + K +   R T+ C +CQ
  S:     1 MPELPEVEITRRGIDTH-LAGRVITQI-SIRNPVLRWPISAGLIALLPGQRINAIARRAKYLLFACSRG-TLIMHLGMSGNLRV-LPESTPPQLHDHFDLQVDNGMMLRFRDPRRFGAI-LWWDGDIRQHPLLQKLGPEPLSDDFDGQFLYTKTRGRNASIKEVLMNQHIVVGIGNIYANEALFQAGISPLAAAGSLNTMQCERLVDAVKATLLRAIKAGGSSLRDFTDCEGSPGYFQQQYWVYGRAGQSCRQCGELVSKTRQGQRSTFFCARCQ 270
>gi|117928780|ref|YP_873331.1| formamidopyrimidine-DNA glycosylase [Acidothermus cellulolyticus 11B] >gi|166215603|sp|A0LV85|FPG_ACIC1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|117649243|gb|ABK53345.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Acidothermus cellulolyticus 11B] (284 aa)
Score = 282, Expect = 1.9e-23, Identities = 82/274 (29%), Positives = 128/274 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCS--YEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD--YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTI-ATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+++   L     + R I   E   P+  +  S    DFT  +I  +I+ + R+GKYL F L +D   + HL M G+ F     +S   KH+  +    D   E+R+ D R FG  T+      + +  I  +  D L+  FD         +    +K  LLDQ  +SG+GNIYADE L+ + +H  T    ++    +++    R +   A+   GT+  A Y     Q G F + L V+ +    C  C   IV+     R ++ C  CQ
  S:     1 MPELPEVETIRRGLARH-LVGRRIGYAEVFHPRAVRRHSGGAADFTGRLIGRRIQAVLRRGKYLWFALDSDLALLAHLGMSGQ-FLLADAASPSPKHLRARFAFTDGDPELRFVDQRTFGGLTLAPLIADVPA-SISHIAPDILDVAFDEAEFHRRFTQRRTGVKRALLDQTLISGVGNIYADEALWRARLHYATPTVDISAATCRRLLAALRAVFRAALRAGGTSFDALYVNVNGQSGFFDRSLAVYGRAGQPCRRCGTAIVREPFMNRSSFRCPACQ 276
>gi|118464268|ref|YP_882954.1| formamidopyrimidine-DNA glycosylase [Mycobacterium avium 104] >gi|166215633|sp|A0QJ66|FPG_MYCA1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|118165555|gb|ABK66452.1| formamidopyrimidine-DNA glycosylase [Mycobacterium avium 104] (283 aa)
Score = 281, Expect = 2.1e-23, Identities = 78/276 (28%), Positives = 134/276 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK--NCSYEDFTHYIINEQIKDITRKGKYLIFHLTN-DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+ V   L     + +TI  +    P+  +       D T  ++  +I    R+GKYL   L   D   VVHL M G++       +   +HV +   +DD  +  + D R FG + + +    +  +  + +  L  DPL+  FD   +   +++ +  IK  LLDQ+ VSGIGNIYADE L+ + +H   IA+ LT      + + +  ++  A+   GT+  + +     + G F + L  + ++   C  C   + + K   R ++ C KCQ +
  S:     1 MPELPEVEVVRRGLHSH-VVGKTIGAVRVHHPRAVRRHEAGPADLTARLLGARITGTDRRGKYLWLLLDGRDTALVVHLGMSGQMLLGAVPRA---EHVRISALLDDGTVLSFADQRTFGGWMLADLLEVDGSVVPEPVAHLARDPLDPRFDADAVVKVLRRKHSEIKRQLLDQQVVSGIGNIYADEALWRAKVHGARIADALTRKQLTAVLDAAADVMRDALAKGGTSFDSLYVNVNGESGYFDRSLDAYGREGESCRRCGAVMRREKFMNRSSFYCPKCQPR 280
>gi|163733258|ref|ZP_02140702.1| formamidopyrimidine-DNA glycosylase [Roseobacter litoralis Och 149] >gi|161393793|gb|EDQ18118.1| formamidopyrimidine-DNA glycosylase [Roseobacter litoralis Och 149] (283 aa)
Score = 281, Expect = 2.2e-23, Identities = 78/275 (28%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLK--------EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL---------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDC--VNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L         +Q  +NR   ++    P         D    +  ++++ + R+ KY++  L + +  +VHL M G++         F  +  +     HV+  +  ++  I ++D RRFG   +    +    K +  LG +PL  +F   +L    K  N  +K+ LLDQ  VSG+GNIY  E LF + IHP   A K++      +    R +LA+A+E  G+++  +     + G FQ     + ++   C    C  +I +I  +GR ++ C +CQ+
  S:     1 MPELPEVETVRRGLTPAMEGVVIKQADVNRP--DLRWPFPV--------DMAARLTGKRVERLRRRSKYILMDLDSGETLLVHLGMSGRMLVSGDPLGQFVHRHPAPEKHDHVVFHMA-NNARITFNDPRRFGAMDLMETASADAHKLLAVLGPEPLGNDFHESHLIAAFKNKNSPVKSVLLDQRIVSGLGNIYVCEALFRAKIHPTRKAGKISGARVAGLVPIVREVLAEAIEAGGSSLRDFRQADGELGYFQHSFDAYGREGDPCKRSGCTGQIRRIVQSGRSSFYCTQCQR 283
>gi|163797306|ref|ZP_02191259.1| formamidopyrimidine-DNA glycosylase [alpha proteobacterium BAL199] >gi|159177397|gb|EDP61953.1| formamidopyrimidine-DNA glycosylase [alpha proteobacterium BAL199] (276 aa)
Score = 281, Expect = 2.2e-23, Identities = 71/275 (25%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V+  L  +    R + ++E+  P + +    + F   ++  ++  + R+ KY++  L +   +++HL M G++          +KH  V +  D+ + +R++D RRFG   ++   +  + + +  +G +PL   F    L+  ++     IK  LLDQ  V+GIGNIYA E L  S I P+ +A  +     + +      +L  A+   G+++  +     + G FQ    V+ ++   C    C+  + +I   GR T+ C  CQ+
  S:     1 MPELPEVETVMRGLTPR-LEGRILAHVEARRPDL-RWPLPDGFAGRLMGRRVIGLRRRAKYILVDLDDGTCWMIHLGMSGRMLLSNDGDPAFQKHDHVVLRTDEGWWLRFNDARRFGMMDLWPTADVENHRLLSGIGPEPLGNAFSASALETALEGRQTTIKAALLDQRVVAGIGNIYACEALHRSGIAPKRLALNVRGARAEALVSAIGAVLTDAIAAGGSSLRDHRQTSGELGYFQHAFGVYDREGQSCPKEGCQGTVQRIVQTGRSTFYCPSCQR 276
>gi|108760481|ref|YP_634069.1| formamidopyrimidine-DNA glycosylase [Myxococcus xanthus DK 1622] >gi|108464361|gb|ABF89546.1| formamidopyrimidine-DNA glycosylase [Myxococcus xanthus DK 1622] (290 aa)
Score = 281, Expect = 2.3e-23, Identities = 74/274 (27%), Positives = 128/274 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+    +L      +R I   ES   +IF+    + F    +  +++ + R+GKYL+F     K  + HL M GK F  +T+      +   +  +DD + I + D R FG           +   ++ LG DPL +      L+  +  S + +K  L+DQE +SG+GNI+A E LF + +HP      LT +++K++ +  R  +   ++ +      Y  +   +  FQ    V+ +    C  C  ++      GR T+ C +CQ
  S:     1 MPELPEVEIARRNLVRWFS-DRRIVRAESENTRIFRGAERQQFD--ALTGRLESLVRRGKYLLFAFEGGKGLMGHLGMTGK-FVRRTEGQV-APYSRARFHLDDGHVIHFSDPRMFGRLEPAPAARLRELDAVRILGRDPLADGLTAGQLQQAVGSSRKELKVALMDQERISGLGNIHAAEALFRAGLHPSRQPGSLTPDEWKRLVQAIRATIDFGLKEQEGEEPVYLEEGRSENPFQ----VYGRAGSPCSQCGTRVESFTQGGRTTHFCPRCQ 266
>gi|123440466|ref|YP_001004460.1| formamidopyrimidine-DNA glycosylase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166198757|sp|A1JHR7|FPG_YERE8 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|122087427|emb|CAL10208.1| formamidopyrimidine-DNA glycosylase [Yersinia enterocolitica subsp. enterocolitica 8081] (269 aa)
Score = 281, Expect = 2.4e-23, Identities = 83/274 (30%), Positives = 133/274 (48%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF--EKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L  Q  L   + N     P         D    + ++ +  + R+ KYL+  L    + +VHL M G L    E+T++   +KH  V + + + +I RY D RRFG +      +   S  +  LG +PL +EF  +YL    +     +K  L+D + V G+GNIYA E LF + I PE  A  LT+ +  ++    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C N I   K   R T+ C  CQ
  S:     1 MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWP-------VSDEILALSDQPVLSVQRRAKYLLIELKTGWI-IVHLGMSGSLRILPEETEA---EKHDHVDLVISNGKILRYTDPRRFGAWLW--AKDLETSNVLAHLGPEPLSDEFTAEYLFEKSRNKRTVVKQWLMDNKVVVGVGNIYASESLFTAGILPERAAGSLTETEITQLVATIKAVLLHSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGELCRRCGNVIEIAKHGQRSTFFCRHCQ 268
>gi|148265694|ref|YP_001232400.1| formamidopyrimidine-DNA glycosylase [Geobacter uraniireducens Rf4] >gi|189044594|sp|A5G7Q9|FPG_GEOUR Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|146399194|gb|ABQ27827.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Geobacter uraniireducens Rf4] (271 aa)
Score = 281, Expect = 2.4e-23, Identities = 74/274 (27%), Positives = 127/274 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +     + + I  +     K+ +     D    +    I  + R+GKYL+   T     ++HL M G L   + D+   +   L  +      +R  D RRF T  ++  ++ L    + K G +PL  +F   YL    +     +K  ++D   ++G+GNIYA E LF + IHPET A  L+     ++A+  + +L  A+ + G+T+  +   + + G F     V+ + D  C  C   I + +  GR TY C +CQ
  S:     1 MPELPEVETTRRGIAPY-LVGKRICRVTVRTAKL-RLPLQPDLDSILSGRIISAVERRGKYLLVRFTAG-TLILHLGMTGNLRLVQADTPPGRHDHLDLVLNSGLCLRLTDPRRFSTI-VWTHDDPLRHTLLAKHGPEPLTGDFSGDYLYTKSRGRRITVKQFIMDSRVLAGVGNIYACEALFRAGIHPETPAGALSTTHCLRLADTIKEVLTDAIASGGSTLGDFLVSEGKPGYFPMSFSVYGRNDAPCPGCGAPIRRSRQGGRSTYFCDRCQ 270
>gi|71901945|ref|ZP_00683998.1| Formamidopyrimidine-DNA glycolase [Xylella fastidiosa Ann-1] >gi|71728286|gb|EAO30464.1| Formamidopyrimidine-DNA glycolase [Xylella fastidiosa Ann-1] (271 aa)
Score = 281, Expect = 2.6e-23, Identities = 79/274 (28%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSL----KEQGCLNRTI----------TNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ +  L      Q   + T+          ++IES +P                  +I  + R+ KYL+         ++HL M G L     ++   + H  V I +++  + R++D RRFG   ++ E+  +    +++LG +PL + F+  YL    +  N ++KT L+DQ  V G+GNIYA E LF + I P   A+K++   ++++AE  + IL  A+   GTT+  +     + G F++ L V+ ++   C  C + + +  +  R T  C  CQ
  S:     1 MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWNIPSHIESRLP----------------GHRITTVCRRAKYLLIDTNAGGSLIIHLGMSGTLRLLAPETPL-RPHDHVDIMLNNRRVLRFNDPRRFGCL-LWQEDGQIHPL-LQRLGCEPLSDSFNGDYLYQCSRARNVSVKTLLMDQRIVVGVGNIYAAESLFRAGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDFLSPDGRPGYFKQELFVYGRQQQPCKQCGSLLRQTTIRQRTTVWCGHCQ 270
>gi|109896382|ref|YP_659637.1| formamidopyrimidine-DNA glycosylase [Pseudoalteromonas atlantica T6c] >gi|123361457|sp|Q15ZV5|FPG_PSEA6 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|109698663|gb|ABG38583.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Pseudoalteromonas atlantica T6c] (270 aa)
Score = 280, Expect = 2.8e-23, Identities = 81/275 (29%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTI-TNIESIMPKIFKNCSY--EDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +   G     I  +IE I+ +  K   +   D  H     ++ D+ R+ KYL F  T+    ++HL M GKL    +++   K   +  +  +   +R++D RRFG   ++      +   I  LG +PL  +FD + L +  +  N  +K  ++D + V G+GNIYA+E LF + I P   A K++   +  + +  + +LAKA+E  GTT+  +       G F + L+V+ +K   C  C+++I  + +  R T+ C +CQK
  S:     1 MPELPEVE-----VSRLGISPHLIGQHIEQIIVR-HKQLRWWVPDDVHLAEGHKVNDVRRRAKYL-FIDTDAGSIILHLGMSGKLRIVNSETPVIKHDHIDIVLTNGVCLRFNDARRFGA-CLWQRVGDPEIGMIAALGPEPLTSDFDGQRLYDLSRTKNVPVKNFIMDNKVVVGVGNIYANESLFIAGIDPRKAAKKVSKKSYLALGDIIKQVLAKAIEQGGTTLKDFTQADGNPGYFAQHLRVYGRKGQACEVCESEIQSVTLGQRNTFFCEQCQK 270
>gi|118602365|ref|YP_903580.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166198745|sp|A1AW02|FPG_RUTMC Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|118567304|gb|ABL02109.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (269 aa)
Score = 280, Expect = 3.3e-23, Identities = 84/274 (30%), Positives = 144/274 (52%)
  Q:     1 VPELPEVQ----SVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     ++  +  Q  ++R I + E++   I KN         + N++IK I R+ KYL+         ++HL M G +      +    KH   +++ ++   +R +D RRFG      + ++   K +  LG++PLE  F+  YL    +   + IK  ++D + V G+GNIYA E LF +SI+P+  A  ++   +K + +  + IL +A++  GTT+  +       G F + L V+  ++  C  CK+KI+KI  N R T+ C KCQ
  S:     1 MPELPEVEITKRGLVPLIINQE-VSRVILHRENLRWAIPKN-----LITILANQKIKTIKRRAKYLLIKF-EAGTLIIHLGMSGSIKVVDIKTPL-LKHEHFELQFNNGTSMRLNDPRRFGAVLFSKDGSH---KLLDSLGVEPLEAVFNNGYLYQKSRNKRKNIKDFIMDSKIVVGVGNIYACESLFMASINPQRKAGNVSKTRYKILTQCIKDILTQAIKAGGTTLQDFSQVDGNPGYFTQTLSVYGCENKTCHFCKSKIIKIVQNQRSTFYCRKCQ 268
>gi|15836676|ref|NP_297364.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa 9a5c] >gi|15836775|ref|NP_297463.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa 9a5c] >gi|28197991|ref|NP_778305.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa Temecula1] >gi|28198069|ref|NP_778383.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa Temecula1] >gi|71275496|ref|ZP_00651782.1| Formamidopyrimidine-DNA glycolase [Xylella fastidiosa Dixon] >gi|71898603|ref|ZP_00680773.1| Formamidopyrimidine-DNA glycolase [Xylella fastidiosa Ann-1] >gi|170729297|ref|YP_001774730.1| DNA-formamidopyrimidine glycosylase [Xylella fastidiosa M12] >gi|170729377|ref|YP_001774810.1| DNA-formamidopyrimidine glycosylase [Xylella fastidiosa M12] >gi|182680617|ref|YP_001828777.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa M23] >gi|182680697|ref|YP_001828857.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa M23] >gi|54037120|sp|P64155|FPG_XYLFT Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|54040774|sp|P64154|FPG_XYLFA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|9104844|gb|AAF82884.1|AE003861_1 formamidopyrimidine DNA glycosylase [Xylella fastidiosa 9a5c] >gi|9104967|gb|AAF82983.1|AE003871_1 formamidopyrimidine DNA glycosylase [Xylella fastidiosa 9a5c] >gi|28056051|gb|AAO27954.1| formamidopyrimidine DNA glycosylase [Xylella fastidiosa Temecula1] >gi|28056129|gb|AAO28032.1| formamidopyrimidine DNA glycosylase [Xylella fastidiosa Temecula1] >gi|71163796|gb|EAO13512.1| Formamidopyrimidine-DNA glycolase [Xylella fastidiosa Dixon] >gi|71731550|gb|EAO33611.1| Formamidopyrimidine-DNA glycolase [Xylella fastidiosa Ann-1] >gi|167964090|gb|ACA11100.1| DNA-formamidopyrimidine glycosylase [Xylella fastidiosa M12] >gi|167964170|gb|ACA11180.1| DNA-formamidopyrimidine glycosylase [Xylella fastidiosa M12] >gi|182630727|gb|ACB91503.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa M23] >gi|182630807|gb|ACB91583.1| formamidopyrimidine-DNA glycosylase [Xylella fastidiosa M23] (271 aa)
Score = 280, Expect = 3.4e-23, Identities = 79/274 (28%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSVIDSL----KEQGCLNRTI----------TNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++ +  L      Q   + T+          ++IES +P                  +I  + R+ KYL+         ++HL M G L     ++   + H  V I +++  + R++D RRFG   ++ E+  +    +++LG +PL + F+  YL    +  N ++KT L+DQ  V G+GNIYA E LF + I P   A+K++   ++++AE  + IL  A+   GTT+  +     + G F++ L V+ ++   C  C + + +  +  R T  C  CQ
  S:     1 MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWDIPSHIESRLP----------------GHRITTVCRRAKYLLIDTNAGGSLIIHLGMSGTLRLLAPETPL-RPHDHVDIMLNNRRVLRFNDPRRFGCL-LWQEDGQIHPL-LQRLGCEPLSDSFNGDYLYQCSRARNVSVKTFLMDQRIVVGVGNIYAAESLFRAGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDFLSPDGRPGYFKQELFVYGRQQQPCKQCGSLLRQTTIRQRTTVWCGHCQ 270
>gi|182435700|ref|YP_001823419.1| putative formamidopyrimidine-DNA glycosylase [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464216|dbj|BAG18736.1| putative formamidopyrimidine-DNA glycosylase [Streptomyces griseus subsp. griseus NBRC 13350] (286 aa)
Score = 279, Expect = 3.6e-23, Identities = 75/275 (27%), Positives = 134/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKN--CSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVV-HLRMEGKLFFEKTDSSYDKKHVLVKIEMDD---YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+ V   L E+    RT++ +E + P+  +       DF   +   +     R+GKYL   +      ++ HL M G+L     D+  D+KH+ +++  DD    E+R+ D R FG  +++        + I  +  DPL+  FD       ++     +K  LLDQ  +SG+GNIYADE L+ + +H +     LT     ++  ++R ++  A+   GT+  + +     + G F + L  + ++   C  C   + +     R +Y C +CQ+
  S:     1 MPELPEVEVVRRGL-ERWVSGRTVSEVEVLHPRAVRRHLAGGVDFAARLAGARFGAAMRRGKYLWVPIDEASASLLGHLGMSGQLLVRPADAP-DEKHLRIRMRFDDALGTELRFVDQRTFGGLSLHANTPDGLPETIAHIARDPLDPLFDDAAFHTALRLRRTTVKRALLDQSLISGVGNIYADEALWRARLHYDRPTATLTRPRSAELLGHARDVMNAALAQGGTSFDSLYVNVNGESGYFDRSLDAYGREGEPCHRCGTPMRRRAWMNRSSYYCPRCQR 280
>gi|93117323|gb|ABE99579.1| fpg [Neisseria meningitidis] (258 aa)
Score = 279, Expect = 3.8e-23, Identities = 74/226 (32%), Positives = 113/226 (50%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGT 267
           D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    +  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK  +  RGT
  S:    31 DLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGRSDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEAFCTDYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGT 258
>gi|15640251|ref|NP_229878.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586313|ref|ZP_01676102.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae 2740-80] >gi|121729455|ref|ZP_01682084.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae V52] >gi|147674090|ref|YP_001218481.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae O395] >gi|153221468|ref|ZP_01952426.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MAK 757] >gi|153820030|ref|ZP_01972697.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae NCTC 8457] >gi|153821781|ref|ZP_01974448.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae B33] >gi|194532923|ref|YP_002068344.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MO10] >gi|172047483|sp|A5F407|FPG_VIBC3 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|21362548|sp|Q9KVC5|FPG_VIBCH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|9654629|gb|AAF93397.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121549433|gb|EAX59461.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae 2740-80] >gi|121628630|gb|EAX61105.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae V52] >gi|124119652|gb|EAY38395.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MAK 757] >gi|125618975|gb|EAZ47507.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae MO10] >gi|126509434|gb|EAZ72028.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae NCTC 8457] >gi|126520677|gb|EAZ77900.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae B33] >gi|146315973|gb|ABQ20512.1| formamidopyrimidine-DNA glycosylase [Vibrio cholerae O395] (269 aa)
Score = 279, Expect = 3.9e-23, Identities = 80/274 (29%), Positives = 134/274 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEI-KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     +  TI ++    PK+      E     +  + I  I R+ KYLI   T     +VHL M G L     D    K   +  +      +RY+D RRFG +     +   +S E+  +LG +PL E F+ +Y+ +  +    A+K  ++D   V G+GNIYA+E LF S +HP   A+ L+  +++ +  N + +L  A++  GTT+  +     + G F + L+V+ K    C +C   + + K+  R T+ C +CQ
  S:     1 MPELPEVEVSRLGISPH-LVGGTIQSLVLRTPKLRWPIPQE--LKQLEGQTILAIHRRAKYLIIE-TAVGSAIVHLGMSGSLRILDGDFPAAKHDHVDLVMTSGKRLRYNDPRRFGAWLWCAPD---ESHEVLGRLGPEPLTEAFNAEYMMDKARNKRIAVKAFIMDNAAVVGVGNIYANESLFTSRLHPLRPAHSLSLEEWQTLVANIKQVLQVAIKQGGTTLKDFTQSDGKPGYFAQELQVYGKAKQPCPHCGEPLCEQKIAQRNTFFCPQCQ 268
>gi|148244469|ref|YP_001219163.1| formamidopyrimidine-DNA glycosylase [Candidatus Vesicomyosocius okutanii HA] >gi|166198755|sp|A5CX90|FPG_VESOH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|146326296|dbj|BAF61439.1| formamidopyrimidine-DNA glycosylase [Candidatus Vesicomyosocius okutanii HA] (269 aa)
Score = 279, Expect = 4.4e-23, Identities = 82/274 (29%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPE++++   + SL     +N+ I + E++   I K+ S       + N+ I  I R+GKYL+         ++HL M G +    T++    KH   ++++ +   +R  D RRFG      + ++   K +  LG++PL+  F   YL    +   + IK  ++D + V G+GNIYA E LF + I+P+  A  ++   +  + +  + IL +A+E  GTT+  +       G F + L V+  K+  C  CK  I+K   N R T+ C KCQ
  S:     1 MPELPEIETIKRGLTSLIINQKVNKAILHRENLRWVIPKHLSTT-----LTNQLISTIDRRGKYLLIKFKVG-TLIIHLGMSGSIKVVNTNTPL-LKHEHFELQLKNGTSMRLKDPRRFGAVLFSKDGSH---KLLDSLGVEPLKTSFYDGYLYQKSRNKQQNIKAFIMDNKIVVGVGNIYACESLFMAGINPKLKAGSISKTRYNVLTQCIKNILTQAIEAGGTTLQDFVQVNGNPGYFTQNLSVYGCKNKKCYRCKGIIIKFVQNQRSTFYCKKCQ 268
>gi|167561491|ref|ZP_02354407.1| formamidopyrimidine-DNA glycosylase [Burkholderia oklahomensis EO147] >gi|167568721|ref|ZP_02361595.1| formamidopyrimidine-DNA glycosylase [Burkholderia oklahomensis C6786] (276 aa)
Score = 278, Expect = 4.5e-23, Identities = 79/275 (28%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK--KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKE---IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  ++ +   + +      F   +   ++ ++ R+GKYL+F + +   F+VHL M G L     D+      KH  V    D++ +R+ D RRFG   +++  +  D +    +  LG++P    F    L    +    ++K  LL  + V G+GNIYA E LF + I P T A +++    +++AE  R  LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPFVAGRRVKRVD-VRTAMLRWPVPAGFAELLRAREVLNVERRGKYLLFEV-DAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWIFDEFVLRFRDPRRFGA-VLWHPRDAGDVQAHPLLASLGVEPFSPAFTGALLFKRTRGRTVSVKQALLSGDIVVGVGNIYASESLFRAGIRPTTAAGRVSLPRCERLAEAVRATLADAIERGGSTLRDFVGSNGESGYFQLDCSVYDRAGEPCRVCGTPIRQIVQGQRSTYFCPNCQR 276
>gi|168705276|ref|ZP_02737553.1| formamidopyrimidine-DNA glycosylase [Gemmata obscuriglobus UQM 2246] (214 aa)
Score = 278, Expect = 5.3e-23, Identities = 57/183 (31%), Positives = 96/183 (52%)
  Q:    92 DKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           D  H +  ++ + +E+R+ D RRFG+   + +   ++S+   +LG +P     D  Y +  +  + R +K  LLDQ  V+G+GNIYADE  F + +HP    NKLT  +   + E    +L +A+E++G+TI  Y      +G FQ    V+ +    C  C   +V  +  GR ++ C +CQ
  S:    16 DHLHAVFALD-NGHELRFRDQRRFGSAEFFADRAAVESEMNAELGPEPFN--IDADYFRAAVSGTGRNLKAVLLDQTVVAGVGNIYADEACFRAKLHPGRPGNKLTAGECDALREAVEAVLTRAIESRGSTIRDYVGGSGLRGGFQNEFAVYGRTGEPCPTCAAAVVCARYAGRASHFCPRCQ 195
>gi|41409092|ref|NP_961928.1| formamidopyrimidine-DNA glycosylase [Mycobacterium avium subsp. paratuberculosis K-10] >gi|81700438|sp|Q73VL9|FPG_MYCPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|41397451|gb|AAS05311.1| Fpg [Mycobacterium avium subsp. paratuberculosis K-10] (283 aa)
Score = 277, Expect = 6.0e-23, Identities = 77/276 (27%), Positives = 133/276 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK--NCSYEDFTHYIINEQIKDITRKGKYLIFHLTN-DKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+ V   L     + +TI  +    P+  +       D T  ++  +I    R+GKYL   L   D   VVHL M G++       +   +HV +   +DD  +  + D R FG + + +    +  +  + +  L  DPL+  FD   +   +++ +  IK  LLDQ+ VSGIGNIYADE L+ + +H   IA  +T      + + +  ++  A+   GT+  + +     + G F + L  + ++   C  C   + + K   R ++ C KCQ +
  S:     1 MPELPEVEVVRRGLHAH-VVGKTIGAVRVHHPRAVRRHEAGPADLTARLLGARITGTDRRGKYLWLLLDGCDTALVVHLGMSGQMLLGAVPRA---EHVRISALLDDGTVLSFADQRTFGGWMLADLLEVDGSILPRPVAHLARDPLDPRFDAAAVVKVLRRKHSEIKRQLLDQQVVSGIGNIYADEALWRAKVHGARIAATMTGRQLTAVLDAAAEVMRDALAQGGTSFDSLYVNVNGESGYFDRSLDAYGREGESCRRCGAVMRREKFMNRSSFYCPKCQPR 280
>gi|83944872|ref|ZP_00957238.1| formamidopyrimidine-DNA glycosylase [Oceanicaulis alexandrii HTCC2633] >gi|83851654|gb|EAP89509.1| formamidopyrimidine-DNA glycosylase [Oceanicaulis alexandrii HTCC2633] (286 aa)
Score = 277, Expect = 6.2e-23, Identities = 78/275 (28%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYED-FTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYD-------------KKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKN-KIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L       R I   E+  P +     + D F   +    ++ + R+ KYL+  L + +  ++HL M G+      D S                 HV+ ++E     + Y+D RRFG  T++  +       ++ LG +PL   F    L    K     IK  LLDQ  V+G+GNIY  E L+ + I P  +   +      ++A   R ++++A+E  G+T+  Y       G FQ    V+ ++   C  C++ ++ +I  +GR T+ C  CQ+
  S:     1 MPELPEVETVRRGLIP-AMEGRRILRAEARRPDL--RFPFPDRFAERLTGTVVERLDRRSKYLLARLGSGETLLMHLGMSGRFSVTAEDISRQPGDFVYAAPANPAHDHVVFQME-GGVTVTYNDPRRFGFMTLFETDAEAAQPYLRDLGPEPLSNGFSEDLLNTAFKGRRSPIKAGLLDQHVVAGLGNIYVCEALWRAQISPRRLCQSIPGARAARLAPAVRSVISEAIEAGGSTLRDYAGADGAMGYFQHRFDVYGREGEPCHRCEDSRVERIVQSGRSTFFCPSCQR 286
>gi|88813702|ref|ZP_01128929.1| formamidopyrimidine DNA glycosylase [Nitrococcus mobilis Nb-231] >gi|88789056|gb|EAR20196.1| formamidopyrimidine DNA glycosylase [Nitrococcus mobilis Nb-231] (272 aa)
Score = 277, Expect = 6.4e-23, Identities = 81/274 (29%), Positives = 124/274 (45%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    + E     R I  I  I     +    E+      + +I  I R+ KYL+F L  D   ++HL M G L      D      H+ + I      +RY D RRFG+   +   +      +  LG +PL   F   YL    +      K  L+D   V GIGNIYA+E L+ ++I P   A  +  N + ++ +  + +LA+A+E  GTT+  +     Q G F + L+V+ +    C  C   I   ++  R TY C  CQ
  S:     1 MPELPEVETTRRGI-EPHVRGRRIAKI-IIRDARLRWPIAENLPRQAEDRRIIGIQRRAKYLLFRLEADATLILHLGMSGSLRLVAAQDPPLAHAHLDI-ILASGQALRYTDPRRFGSLH-WCTGDPAQHHLLASLGPEPLSSAFHADYLYGLSRGRRICAKALLMDSRAVVGIGNIYANEALYRAAIRPMRSAGCIGRNRYARLVQAVKSVLAEAIEAGGTTLRDFTDSTGQPGYFHRRLEVYGRGGAACQRCAGIIRMERLGQRATYYCPGCQ 271
>gi|88859719|ref|ZP_01134359.1| formamidopyrimidine DNA glycosylase [Pseudoalteromonas tunicata D2] >gi|88818736|gb|EAR28551.1| formamidopyrimidine DNA glycosylase [Pseudoalteromonas tunicata D2] (271 aa)
Score = 277, Expect = 6.5e-23, Identities = 74/225 (32%), Positives = 116/225 (51%)
  Q:    50 EQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           + I  I R+ KYL   +T     ++HL M G L       +  KKH  ++IE++    +R +D RRFG   ++       S    KLG +PL + F+ + L    K    AIK  ++D + V G+GNIYA+E LF + IHP+T A +L   DF  +    +  LA+A+   GTT+  +     + G F + L+V+ +K   CV C   +++I++  R T  C  CQ
  S:    47 QTITAIERRAKYLQL-VTPIGTVILHLGMSGNLRIVDKAVAL-KKHDHIEIELESGLVLRLNDPRRFGA-CLWQAPGETHSV-FAKLGPEPLTDAFNPEQLFEQAKNKKTAIKQFIMDNKFVVGVGNIYANEALFKAKIHPQTPAGQLQLADFVALVPIIKQTLAQAITQGGTTLKDFAQTDGKPGYFAQELQVYGRKGKPCVQCDTVLLEIRLGQRSTVFCPSCQ 268
>gi|124023869|ref|YP_001018176.1| formamidopyrimidine-DNA glycolase (Fapy-DNA glycolase) [Prochlorococcus marinus str. MIT 9303] >gi|123964155|gb|ABM78911.1| Formamidopyrimidine-DNA glycolase (FAPY-DNA glycolase) [Prochlorococcus marinus str. MIT 9303] (291 aa)
Score = 277, Expect = 6.7e-23, Identities = 86/275 (31%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPK-IFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV--------------FVVHLRMEGKLFFEKTDSSYDKKHVLVKI-EMDDYEIRYHDTRRFGTFTIYNENNYLDS--KEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L ++  ++  I  +E    + I        F   +    +    R+GKYL+  L +D                + VHLRM G+  + +  SS    H  V+I    D E+R+ DTR FG        N  ++    ++KLG +P    F+  YL   +K S R IK+ LLDQ  V+G GNIY DE LFA+ I P T + +L   + +++ +    +L  ++   GTT + +   +   G +     V+ +    C  C   I +  + GRGT+ C  CQ+
  S:     1 MPELPEVETVRRGLADR-LIDFQIDQVEVCRERAIASPGGSALFIKMLCGMHVGSWLRRGKYLMASLHHDFAQPSADSEPDPDGGWWGVHLRMTGQFQWHEAISS-PCPHTRVRIWNKKDEELRFVDTRSFGQMWWVPPGNAPETIITGLQKLGPEPFSSAFNSSYLSKRLKGSKRPIKSALLDQSIVAGAGNIYTDESLFAARILPHTPSGQLKKVELERLCDCLTEVLRVSIGAGGTTFSDFRDLEGMNGNYGGQAWVYRRGGQACRICSTPIRRESLCGRGTHWCPNCQR 291
>gi|34499517|ref|NP_903732.1| DNA-formamidopyrimidine glycosylase [Chromobacterium violaceum ATCC 12472] >gi|39931210|sp|Q7NQS5|FPG_CHRVO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|34105367|gb|AAQ61722.1| DNA-formamidopyrimidine glycosylase [Chromobacterium violaceum ATCC 12472] (270 aa)
Score = 277, Expect = 7.2e-23, Identities = 75/274 (27%), Positives = 135/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYE-----DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    + E     RT+      +  + +N S       D +  +  E++  + R+ KYL+    +    ++HL M G L      +   +KH  + + + +  +R+ D RRFG   +++         ++ LG +PL + FD   L   I++    IK  ++D   V G+GNIYA+E LF + I P   A  L+  D  ++A   + +L +A++  G+T+  +   + + G FQ+   V+ +++  C  C   I +I+   R TY C  CQ
  S:     1 MPELPEVETTRRGV-EPHLEGRTL------LGAVVRNPSLRWPVPPDLSERVAGEKVLAVRRRAKYLLLECESG-TLLIHLGMSGSLRVMPAGAP-PQKHDHLDLLLGEQVLRFRDPRRFGA-VLWHLGPVEMHPLLQALGPEPLSDAFDGAALHQAIRRRGSPIKLAIMDNHVVVGVGNIYANESLFHAGISPARAACDLSRADCDRLAAEIKAVLRRAIDAGGSTLRDFVDSEGKPGYFQQTYMVYNRQEEPCRLCGTPIRQIRQGQRSTYYCPLCQ 269
>gi|48474241|sp|Q9X981|FPG_SERMA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|16445331|gb|AAD28805.2| Fpg [Serratia marcescens] (271 aa)
Score = 277, Expect = 7.3e-23, Identities = 84/275 (30%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDIT--------RKGKYLIFHLTNDKVFVVHLRMEGKLFF---EKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++       +G     + +  SI   + +N        + ++EQI  ++        R+ KYL+  L    + +VHL M G L     E  D +    HV + I  +   +RY D RRFG + ++ E+    S  +  LG +PL E F+  YL    +     IK  L+D + V G+GNIYA E LF++ I P+  A  LT  +   +A+  + +L +++E  GTT+  +     + G F + L+V+ +    C  C   I   K   R T+ C +CQ+
  S:     1 MPELPEVET-----SRRGIEPYLVGH--SIQYAVVRNARLR----WPVSEQILTLSDQPVLSVQRRAKYLLIELERGWI-IVHLGMSGSLRMLREENEDEAGKHDHVDLVIN-NGMILRYTDPRRFGAW-LWCED-LATSSVLAHLGPEPLSEAFNGDYLYEKSRNKRTLIKPWLMDNKLVVGVGNIYASESLFSAGILPDRPAGSLTKAEAALLAKTIKAVLQRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGEPCRTCGTPIESAKHGQRSTFFCRRCQR 271
>gi|190572171|ref|YP_001970016.1| putative formamidopyrimidine-dna glycosylase (fapy-dna glycosylase) (dna-(apurinic or apyrimidinic site) lyase mutm) [Stenotrophomonas maltophilia K279a] >gi|190010093|emb|CAQ43701.1| putative formamidopyrimidine-dna glycosylase (fapy-dna glycosylase) (dna-(apurinic or apyrimidinic site) lyase mutm) [Stenotrophomonas maltophilia K279a] (270 aa)
Score = 276, Expect = 8.1e-23, Identities = 82/275 (29%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSL-------KEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEI----KKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    L       +  G + R       I P++            +  ++I+DI R+ KYL+   T     V+HL M G L     D+   + H  V I +D+  + R++D RRFG+        +  + E+    + LG +PL++ FD  YL    +  +  +KT L+DQ  V G+GNIYA E LF + I P   A K++   ++++A+  + IL  A+   GTT+  +       G F++ L V+ +    C NC   +    +  R +  C  CQ+
  S:     1 MPELPEVETTRRGLAPHLQGRRVHGVILRRADLRWPIPPEV---------AELLPGQRIEDIRRRAKYLLLD-TAIGSAVLHLGMSGSLRVLPGDTPL-RAHDHVDISLDNGRLLRFNDPRRFGSLL------WQPAGEVHPLLQGLGPEPLDDAFDGDYLFARSRGRSAPVKTFLMDQAVVVGVGNIYAAESLFKAGISPLREAGKISRERYQRLADAVKEILGYAITRGGTTLRDFISPDGAPGYFEQELLVYGRDGLPCPNCGRALKHATIGQRASVWCSHCQR 270
>gi|77961974|ref|ZP_00825801.1| COG0266: Formamidopyrimidine-DNA glycosylase [Yersinia mollaretii ATCC 43969] (269 aa)
Score = 276, Expect = 8.3e-23, Identities = 82/274 (29%), Positives = 131/274 (47%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L  Q  L   + N     P         D    + ++ +  + R+ KYL+  L    + +VHL M G L     +++ +K H  V + + + +I RY D RRFG +      +   S  +  LG +PL +EF  +YL +  +     IK  L+D + V G+GNIYA E LFA+ I PE  A  LT  +   +    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C  +I   K   R T+ C  CQ
  S:     1 MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWP-------VSDEILALSDQPVLSVQRRAKYLLLELPTGWI-IVHLGMSGSLRVLPEETAAEK-HDHVDLVISNGKILRYTDPRRFGAWLW--AKDLETSSVLAHLGPEPLSDEFSPQYLFDKSRHKRTLIKPWLMDNKVVVGVGNIYASESLFAAGILPERAAGSLTQAEISLLVTTIKAVLLHSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGELCRRCGQRIEIAKHGQRSTFFCRHCQ 268
>gi|159045909|ref|YP_001534703.1| formamidopyrimidine-DNA glycosylase [Dinoroseobacter shibae DFL 12] >gi|189044587|sp|A8LNK8|FPG_DINSH Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|157913669|gb|ABV95102.1| formamidopyrimidine-DNA glycosylase [Dinoroseobacter shibae DFL 12] (284 aa)
Score = 276, Expect = 8.7e-23, Identities = 73/275 (26%), Positives = 130/275 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDY---------EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+      R I     I     +     +    +  ++I  + R+ KY++  L + +  ++HL M G++      +     H L  +E  D+          + ++D RRFG   +           +  LG +PL   F   YL   +K     IK+ LLDQ+ V+G+GNIY  E LF + I P   A ++++     +    R +L  A+E  G+++  Y       G FQ   +V+ +++  CV   C + + ++  +GR ++ C  CQ+
  S:     1 MPELPEVETVRRGLEPVMTGQRIIE--ADIRRPDLRWPLPANMQTRLEGKRILRLARRSKYILAELDSGETLIIHLGMSGRILIHGGQAPGAFHHALPSLEKHDHVVLDFDTGARVVFNDARRFGAMDLCETTEIDQHPMLATLGPEPLGNAFHEAYLTTRLKGRMTPIKSALLDQKVVAGLGNIYVCEALFQAGISPLRKAGRVSETRIASLVPIIRTVLGDAIEAGGSSLRDYRQTDGDLGYFQHRFRVYDRENAPCVTAGCPDVVRRVVQSGRSSFYCPSCQR 284
>gi|89069834|ref|ZP_01157169.1| formamidopyrimidine-DNA glycosylase [Oceanicola granulosus HTCC2516] >gi|89044635|gb|EAR50751.1| formamidopyrimidine-DNA glycosylase [Oceanicola granulosus HTCC2516] (283 aa)
Score = 276, Expect = 9.0e-23, Identities = 80/275 (29%), Positives = 138/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL---------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYN----ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L        TI   E   P + +    E     +   ++  + R+ KYL+  L  D+  +VHL M G++         F ++  ++    HV++ +      + ++D RRFG   ++     EN++L    + +LG +PL   FD  YL   ++     IK+ LLDQ  V+G+GNIY  E L  + IHP   A ++       +    R +LA+A+E  G+++  Y     + G FQ   +V+ ++   C    C   + +I  +GR ++ C  CQ+
  S:     1 MPELPEVETVRRGLAP-AMEGATIARAEVNRPDL-RWPFPERLAERLTGRRVLRLGRRSKYLLVELEGDETLIVHLGMSGRMVVSGDPLGQFHQEHAAAEKHDHVVLHMA-SGARVTFNDPRRFGAMDLWPTETLENHWL----LAELGPEPLGNSFDETYLVARLRGRATPIKSALLDQRIVAGLGNIYVCEALHRAGIHPRRKAGRIAPARLAGLVPVVRAVLAEAIEAGGSSLRDYRQADGELGYFQHTFEVYDREGHPCAKPGCAGTVARIVQSGRSSFYCPVCQR 283
>gi|145601093|ref|YP_001165169.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis Pestoides F] >gi|166198758|sp|A4TSD4|FPG_YERPP Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|145212789|gb|ABP42196.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Yersinia pestis Pestoides F] (278 aa)
Score = 275, Expect = 1.0e-22, Identities = 80/274 (29%), Positives = 131/274 (47%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L  Q  L   + N     P      S E  T  + ++ +  + R+ KYL+  L    + ++HL M G L     +++ +K   +  +  +   +RY D RRFG +      +   S  +  LG +PL +EF  +YL +  +     IK  L+D + V G+GNIYA E LFA+ I P+  A  LTD +   +    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C + I   K   R T+ C  CQ
  S:     1 MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWP-----VSDEILT--LSDQPVLSVQRRAKYLLLELPKGWI-IIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILRYTDPRRFGAWLW--AKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKVVVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQ 268
>gi|16120405|ref|NP_403718.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis CO92] >gi|22124009|ref|NP_667432.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis KIM] >gi|45439918|ref|NP_991457.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Microtus str. 91001] >gi|51594407|ref|YP_068598.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis IP 32953] >gi|108809481|ref|YP_653397.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis Antiqua] >gi|108813958|ref|YP_649725.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis Nepal516] >gi|150260884|ref|ZP_01917612.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis CA88-4125] >gi|153948540|ref|YP_001399065.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis IP 31758] >gi|162418456|ref|YP_001604698.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis Angola] >gi|165926106|ref|ZP_02221938.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936106|ref|ZP_02224675.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Orientalis str. IP275] >gi|166011428|ref|ZP_02232326.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213712|ref|ZP_02239747.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402103|ref|ZP_02307580.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419226|ref|ZP_02310979.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426672|ref|ZP_02318425.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469342|ref|ZP_02334046.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis FV-1] >gi|170026359|ref|YP_001722864.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis YPIII] >gi|186893395|ref|YP_001870507.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis PB1/+] >gi|122979351|sp|Q1C270|FPG_YERPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|123372834|sp|Q1CD05|FPG_YERPN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166988465|sp|A7FCT7|FPG_YERP3 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|21362543|sp|Q8ZJP0|FPG_YERPE Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81691945|sp|Q66GD3|FPG_YERPS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|21956751|gb|AAM83683.1|AE013609_8 formamidopyrimidine DNA glycosylase [Yersinia pestis KIM] >gi|45434773|gb|AAS60334.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Microtus str. 91001] >gi|51587689|emb|CAH19289.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis IP 32953] >gi|108777606|gb|ABG20125.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Yersinia pestis Nepal516] >gi|108781394|gb|ABG15452.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Yersinia pestis Antiqua] >gi|115345884|emb|CAL18742.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis CO92] >gi|149290292|gb|EDM40369.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis CA88-4125] >gi|152960035|gb|ABS47496.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis IP 31758] >gi|162351271|gb|ABX85219.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis Angola] >gi|165915720|gb|EDR34328.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Orientalis str. IP275] >gi|165921966|gb|EDR39143.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989574|gb|EDR41875.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205114|gb|EDR49594.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963220|gb|EDR59241.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048478|gb|EDR59886.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054361|gb|EDR64178.1| formamidopyrimidine-DNA glycosylase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752893|gb|ACA70411.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis YPIII] >gi|186696421|gb|ACC87050.1| formamidopyrimidine-DNA glycosylase [Yersinia pseudotuberculosis PB1/+] (269 aa)
Score = 275, Expect = 1.0e-22, Identities = 80/274 (29%), Positives = 131/274 (47%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L  Q  L   + N     P      S E  T  + ++ +  + R+ KYL+  L    + ++HL M G L     +++ +K   +  +  +   +RY D RRFG +      +   S  +  LG +PL +EF  +YL +  +     IK  L+D + V G+GNIYA E LFA+ I P+  A  LTD +   +    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C + I   K   R T+ C  CQ
  S:     1 MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWP-----VSDEILT--LSDQPVLSVQRRAKYLLLELPKGWI-IIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILRYTDPRRFGAWLW--AKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKVVVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQ 268
>gi|94970892|ref|YP_592940.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Acidobacteria bacterium Ellin345] >gi|94552942|gb|ABF42866.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Acidobacteria bacterium Ellin345] (272 aa)
Score = 275, Expect = 1.0e-22, Identities = 81/275 (29%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIM---PKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK-----VFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEF-DWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V + L ++       T IES+     K     S       +   +I  + R GK+++  L          +++HL M G       D+   K   L+       E+R+ D R FG   +  +++   +      GL+PL     D++ L    +  N  IK+ LL+Q  +SG+GNIYADE LF + I P   A  L+  D  ++ E    +L +AVE  G+++  Y   +  +G FQ    V+ +    C  CK  I ++ + GR ++ C  CQK
  S:     1 MPELPEVETVANGLNKRA----AGTTIESVWIGEKKQPLKSSARAIAKMLEGAKITLVRRVGKHIVADLAEPDGEPRGQWIIHLGMTGSTLVVDPDTPLPKHTHLIAKLSSGKELRFVDPRMFGKLAVRAKSDVFAAP-----GLEPLTVSLEDFQKL---FRGRNTPIKSALLNQALLSGVGNIYADEALFRAGIRPRRRAKSLSRADLTRLHEKVGEVLREAVELGGSSVNDYVDAEGNEGFFQLRHNVYQRTGEPCFTCKKPIKRVVIAGRSSHYCQNCQK 272
>gi|27364270|ref|NP_759798.1| formamidopyrimidine-DNA glycosylase [Vibrio vulnificus CMCP6] >gi|29611711|sp|Q8DDY4|FPG_VIBVU Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|27360388|gb|AAO09325.1|AE016799_223 Formamidopyrimidine-DNA glycosylase [Vibrio vulnificus CMCP6] (269 aa)
Score = 275, Expect = 1.1e-22, Identities = 83/274 (30%), Positives = 131/274 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKK-HVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+     +     LN+TI ++    PK+      E     +  + I+ I R+ KYLI   T+    +VHL M G L     D    K  HV +K+  +   +RY+D RRFG +         D   +  +G +PL   FD +Y+    +    A+K  ++D + V G+GNIYA E LF S I P      L+  +++++  + +  L  A+E  GTT+  +     + G F + L+V+ K    C  C   I + K+  R T+ C  CQ
  S:     1 MPELPEVEVSRMGITPH-LLNQTIQSLIFRTPKLRWVIPSE--LKKLQGQVIRHIGRRAKYLIIE-TDVGSAIVHLGMSGSLRVLDADFPAGKHDHVDLKLS-NGKVLRYNDPRRFGAWLYAAPGE--DHDVLGNIGPEPLTNAFDGQYMFEKAQGKRVAVKQFIMDNKIVVGVGNIYASESLFRSRILPTRATMSLSAEEWQRLVSHIKQTLQTAIEQGGTTLKDFSQADGKPGYFAQELQVYGKAGEPCPECGEAIQEQKIGQRNTFYCSYCQ 268
>gi|170691500|ref|ZP_02882665.1| formamidopyrimidine-DNA glycosylase [Burkholderia graminis C4D1M] >gi|170143705|gb|EDT11868.1| formamidopyrimidine-DNA glycosylase [Burkholderia graminis C4D1M] (276 aa)
Score = 275, Expect = 1.1e-22, Identities = 79/275 (28%), Positives = 128/275 (46%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEK--TDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIY--NENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  ++   P + +     D    +    ++++ R+GKYL+F  T+   F+VHL M G L   +         KH  V    D++ +R+ D RRFG    +     + L    +  LG++P    F    +    +    ++K  LL  E V G+GNIYA E LF + I P T A +++   +  +A+  R+ LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPYVSGRKVERVDVRTPAL-RWPIPADLAKTLRGHVVRNVERRGKYLLFE-TDAGWFIVHLGMTGTLRVLRHVPHPPAAAKHDHVDWIFDEFILRFRDPRRFGAVLWHPREAGDVLGHPLLASLGVEPFSPAFSGALMHRLTRGRKVSVKQALLAGEIVVGVGNIYASESLFRAGIRPTTAAGRVSLVRYGLLADAVRVTLAAAIEKGGSTLRDFVGSNGESGYFQLDYFVYDRAGQPCRVCGTPIRQIVQGQRSTYFCPTCQR 276
>gi|83941662|ref|ZP_00954124.1| formamidopyrimidine-DNA glycosylase [Sulfitobacter sp. EE-36] >gi|83847482|gb|EAP85357.1| formamidopyrimidine-DNA glycosylase [Sulfitobacter sp. EE-36] (283 aa)
Score = 275, Expect = 1.1e-22, Identities = 76/275 (27%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITNIESI---MPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKT-------DSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   +  + E   + R   N   +    P         D    +  +++  + R+ KY++  L++ +  +VHL M G++            D    +KH  V   M +   + ++D RRFG   + +  +    K +  +G +PL  +F   +L   +K  N  IKT LLDQ  V+G+GNIY  E L+ + IHP   A ++       +    R +L +A+   G+T+  +     + G FQ    V+ +    C +  C ++I +I  +GR ++ C +CQ+
  S:     1 MPELPEVETVRRGLSPVMEGEVIARAEVNRPDLRWPFPP--------DMAARLTGQRVTQLRRRSKYILADLSSGESLLVHLGMSGRMLISGDPLGQFVHDHPAPEKHDHVVFHMGNGARVTFNDPRRFGAMDLLDTASADSHKLLSSIGPEPLGNDFHEDHLIAALKGKNTPIKTALLDQRIVAGLGNIYVCETLYRAGIHPARKAGRIAAKRVGSLVPIIRDVLNEAITAGGSTLRDFKRADGELGYFQHSFDVYGRAAEPCRSEGCTHQIARIVQSGRSSFYCPQCQR 283
>gi|117924919|ref|YP_865536.1| DNA-(apurinic or apyrimidinic site) lyase / formamidopyrimidine-DNA glycosylase [Magnetococcus sp. MC-1] >gi|166215631|sp|A0L837|FPG_MAGSM Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|117608675|gb|ABK44130.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Magnetococcus sp. MC-1] (275 aa)
Score = 275, Expect = 1.3e-22, Identities = 77/275 (28%), Positives = 131/275 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF--EKTDSSYDKKHVLVKIEMDDYE-IRYHDTRRFGTFT-IYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++    + E   + + +  +    P++      +     ++ + I+ + R+ KYL++        +VHL M G L    E T  +   KH  V   M+  + +R HD RRFG    I   +   +   + KLG +PL    + +YL    +    A+K  ++DQ  V G+GNIYA E LF + I P   A K+    ++ +A   + +L  ++E  GTT+  +     + G F + L V+ +    C  C   I K  +  R +Y C +CQ+
  S:     1 MPELPEVETTRRGI-EPALVGKRLCGVVVRQPQLRWPIPVKTLEKELVGQVIQQVARRAKYLLWRCPQG-TLLVHLGMSGSLRIVPEHTPPA---KHDHVDWVMEGGQMVRLHDPRRFGAVVWIPVTSPEEEHPLLAKLGPEPLHRSLNGRYLHQGSRGRQLAVKNYIMDQSVVVGVGNIYASEALFRAGIAPAQAAGKVGLGRYRALACAIKAVLGDSIEQGGTTLRDFIGSDGKPGYFVQSLNVYGRAGKACPKCGTTIEKQVLGQRSSYYCPQCQR 274
>gi|75674239|ref|YP_316660.1| formamidopyrimidine-DNA glycolase [Nitrobacter winogradskyi Nb-255] >gi|90101307|sp|Q3SWN3|FPG_NITWN Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|74419109|gb|ABA03308.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Nitrobacter winogradskyi Nb-255] (293 aa)
Score = 274, Expect = 1.3e-22, Identities = 84/274 (30%), Positives = 135/274 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSS-------------YDKKHVLVKIEMDDY-EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLT------DNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++V   L +      TI   E+   K  +     DF   +  + +  + R+ KYL+  L +  V ++HL M G   F   D++              D+ H  V+  M    EI ++D RRFG   I   +   D   +K LG +PL  EFD   L +  +    ++K  LLDQ  V+G+GNIY  E LF + + P  +A  L           +++    R +L +A+E  G+++  +     + G FQ   +V+ ++   C    CK  + +   NGR T+ C  CQ
  S:     1 MPELPEVETVRRGL-QPAMEGATIVRAET-RRKDLRFPFQTDFVARLEGQAVTGLGRRAKYLLADLASGDVLLMHLGMSGS--FRVIDAAGVTVPGDFHRPRGEDRVHDHVRFTMSSRAEIVFNDPRRFGYMKIVARSALGDEPLLKGLGPEPLGNEFDAAVLAHGCRNRKTSLKAALLDQRVVAGLGNIYVCEALFRARLSPRRLAATLAMKTGAPSERAERLVGAIRDVLNQAIEAGGSSLRDHRQTTGELGYFQHSFQVYDREGDKCRTPACKGAVKRFTQNGRSTFWCPVCQ 292
>gi|163730085|ref|ZP_02137561.1| formamidopyrimidine-DNA glycosylase [Vibrio fischeri MJ11] >gi|161396539|gb|EDQ20832.1| formamidopyrimidine-DNA glycosylase [Vibrio fischeri MJ11] (273 aa)
Score = 274, Expect = 1.4e-22, Identities = 81/274 (29%), Positives = 140/274 (51%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L+ Q     TI  I     K+      E     ++ ++++ I R+ KYL+   T +   ++HL M G L   ++   S    HV + +E +   +RY+D R+FG + +Y+E   +  + + KLG +PL  EF+ +Y     K     +K  +++   V G+GNIYA E LF + IHP+T    L  +    +    + +L  A++  GTT+  +     + G F + LKV+ +   +C  C +KI + K+  R ++ C KCQ
  S:     1 MPELPEVETSRLGITPHLQGQ-----TIKAIVVRTDKLRWPIPQE--LQKLVGQRVQSIRRRAKYLMID-TPEGSAIIHLGMSGSLRVLDEEVPSAKHDHVDLVLE-NGKVLRYNDPRKFGAW-LYSEVG-VAHQVLSKLGPEPLTNEFNSEYFAEKAKNKKTVVKQFIMNNAVVVGVGNIYASESLFMAQIHPKTPVGSLKASQITVLVAEIKKVLETAIKQGGTTLKDFNQVDGKPGYFAQELKVYGRAGKECPVCSSKIEEEKIGQRNSFWCGKCQ 268
>gi|77976335|ref|ZP_00831832.1| COG0266: Formamidopyrimidine-DNA glycosylase [Yersinia intermedia ATCC 29909] (269 aa)
Score = 274, Expect = 1.5e-22, Identities = 81/274 (29%), Positives = 132/274 (48%)
  Q:     1 VPELPEVQS----VIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    +   L  Q  L   + N     P         D    + ++ +  + R+ KYL+  L    + +VHL M G L    +D +  +KH  V + + + +I RY D RRFG +      +   S  +  LG +PL +EF  +YL +  +     IK  L+D + V G+GNIYA E LFA+ + P+  A  LT+ +   +    + +L  ++E  GTT+  +     + G F + L+V+ +    C  C + I   K   R T+ C  CQ
  S:     1 MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWP-------VSDEILALSDQPVLSVQRRAKYLLIELPTGWI-IVHLGMSGSLRI-LSDETEAEKHDHVDLVISNGKILRYTDPRRFGAWLW--AKDLETSNVLAHLGPEPLSDEFSPQYLFDKSRNKRTVIKQWLMDNKVVVGVGNIYASESLFAAGLLPDRAAGSLTNAEIVLLVATIKAVLLHSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRAGEPCRRCGHLIEIAKHGQRSTFFCRHCQ 268
>gi|148241549|ref|YP_001226706.1| formamidopyrimidine-DNA glycosylase [Synechococcus sp. RCC307] >gi|147849859|emb|CAK27353.1| Formamidopyrimidine-DNA glycosylase [Synechococcus sp. RCC307] (282 aa)
Score = 274, Expect = 1.6e-22, Identities = 80/275 (29%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQG----------CLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV----FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGT--FTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+ Q           C +R +       PK       + FT  +   ++    R+GKYL+  L  D        VHLRM G+  + + +      H  V+   + +E+R+ D R FG   F             + +LG +P  + F+  YL+  +K S+R IK  LLDQ  V+G+GNIYADE LF + I P T +  ++    +K+      +L  ++   GTT + +       G +    +V+ +    C  C   + +  + GR ++ C  CQ+
  S:     1 MPELPEVETVRRGLELQVGRFPIGETIVCRSRAVA-----APK----GDPDGFTAALRGCELAGWRRRGKYLVAKLERDGAPAGELGVHLRMTGQFQWLQREERPPCPHTRVRFLSEKHELRFVDVRSFGELWFVPLGTPTEQVITGLTRLGPEPFSDAFNANYLRQRLKGSSRPIKNALLDQALVAGVGNIYADESLFMAGIRPHTPSGSVSAARLEKLRAALVKVLELSIGAGGTTFSDFRDLTGTNGNYGGQARVYRRGGEPCRQCGTILRRDTLGGRSSHWCPSCQR 282
>gi|88705463|ref|ZP_01103174.1| Formamidopyrimidine-DNA glycosylase [gamma proteobacterium KT 71] >gi|88700553|gb|EAQ97661.1| Formamidopyrimidine-DNA glycosylase [Congregibacter litoralis KT71] (270 aa)
Score = 274, Expect = 1.7e-22, Identities = 76/275 (27%), Positives = 140/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNI-----------ESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNG-RGTYLCLKCQK 275
           +PELPEV++    L+   C  R +T +             ++P+I               ++I  + R+ KYL+F +      +VHL M G L    K   +    H+ +++E     +RY+D RRFG+F  +      +   + +LG +PL + F  K L    +    A+K  ++D   V G+GNIYA E L+ + I P+  A +++   +++++E+ + +L  A++  GTT+  +     + G F + L V+ +    C  C  ++++ KV G R +  C+ CQ+
  S:     1 MPELPEVETTRRGLRAH-CEGRCVTAVVLRDTRLRWPVTPLLPEILNG------------QRILKLERRAKYLLFRMERG-TLLVHLGMSGSLRVLLKPQPAAKHDHIDIELESGAV-LRYNDPRRFGSFQWFVAGE--EFTPLSRLGPEPLSDAFGGKRLFELSRGRKVAVKPFIMDGATVVGVGNIYASEALYLAGIRPDRAAQRVSLARYQRLSEHIKQVLTNAIDQGGTTLRDFVGGDGKPGYFAQQLFVYGRSGEPCKGC-GRVLRDKVIGQRASVYCIACQR 270
>gi|189425027|ref|YP_001952204.1| formamidopyrimidine-DNA glycosylase [Geobacter lovleyi SZ] >gi|189421286|gb|ACD95684.1| formamidopyrimidine-DNA glycosylase [Geobacter lovleyi SZ] (271 aa)
Score = 273, Expect = 1.7e-22, Identities = 84/274 (30%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSVIDSLKEQ--GCLNRTITNIESIMPKIFKNCSYED----FTHYIINEQIKDITRKGKYLIF----HLTNDKVFV-VHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV+SV+  L       + R +  +     +I +N   +         +      D+ R GKYL F    H  + +V++ +HLRM G+LF    +    ++H    + +D    +R+ D R FG   + ++ + + SK    LG D L      K   + +  + R +K  LLDQ  V+G+GNIYADE LF + +HP  ++  LT ++ ++       +L +AV  KG  I   F    + G F   + V+ +    C+ C   IVK ++  RGT+ C  CQ
  S:     1 MPELPEVESVLQCLTTSNPSLIGRLVREV-----RILRNSVIDGEASAVVQTVTGSTCCDVYRHGKYLFFGFQGHSASKRVWLALHLRMTGRLFL-VPEQEIAERHTRFALLLDHGLALRFDDPRAFGRVWLVDDPSEVTSK----LGPDALL--IQQKTFLDRLHGARRQLKPLLLDQGFVAGVGNIYADETLFRAQLHPARLSADLTSSEAERFYHALHGVLVQAVAAKGANIDGVF----EAGSFP--VAVYGRGGRPCIVCGTLIVKERLGQRGTHFCPVCQ 268
>gi|126730152|ref|ZP_01745964.1| formamidopyrimidine-DNA glycosylase [Sagittula stellata E-37] >gi|126709532|gb|EBA08586.1| formamidopyrimidine-DNA glycosylase [Sagittula stellata E-37] (283 aa)
Score = 273, Expect = 1.9e-22, Identities = 76/275 (27%), Positives = 134/275 (48%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKT-------DSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCV--NCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L    +G   + I + +   P + +    E     +    +  + R+ KY++  L+ D+  ++HL M G++            D    +KH  V  +MD+   + ++D RRFG   + +         + ++G +PL   F   +L   +K  N  IK+ LLDQ+ V+G+GNIY  E LF S IHP     +++      +    R +L  A+   G+++  +     + G FQ    V+ ++   C    C   I +I  +GR ++ C KCQ+
  S:     1 MPELPEVETVRRGLAPVMEG---QVIAHAQVNRPDL-RWPFPERMAQRLTGAHVLQLRRRSKYILADLSTDETLLIHLGMSGRMLVSGDPLGQFVHDHPMPEKHDHVVFDMDNGARVTFNDPRRFGAMDLMSTRAVDAHPLLARIGPEPLGNAFTESHLVERLKGRNTPIKSALLDQKIVAGLGNIYVCEALFRSGIHPARRCVRISAARISTLVPIVRDVLEDAIAAGGSSLRDFRQADGELGYFQHSFDVYGREGAPCKAPGCTGTIHRIVQSGRSSFFCPKCQR 283
>gi|58040922|ref|YP_192886.1| formamidopyrimidine-DNA glycosylase [Gluconobacter oxydans 621H] >gi|81351172|sp|Q5FN17|FPG_GLUOX Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|58003336|gb|AAW62230.1| Formamidopyrimidine-DNA glycosylase [Gluconobacter oxydans 621H] (277 aa)
Score = 273, Expect = 2.1e-22, Identities = 78/275 (28%), Positives = 131/275 (47%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDS-SYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNC--KNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V+   ++    +R I+++    P + +     D    +    +    R+ KY++  L      ++HL M G+L   +  + +    H  + +E D        D RRFG   +   +     + +  LG++PL +      L    +     IK+ LLDQ+ ++G+GNIY  E LF   IHPE  A  LT  +   +AE    IL +A+ + G+++  Y      KG FQ    V+ ++   C NC  ++ I +I   GR T+ C  CQK
  S:     1 MPELPEVETVMRGFRDAFEGHR-ISHVTVNRPDL-RWPFPADLREKLEGHHVLSFRRRAKYILVRLEGGWSMLLHLGMSGRLTIGRAGTNATPPAHEHLVLETDSGARAGLVDPRRFGMVDLVRTSEEDSHRLLAHLGMEPLSDAMTGPALAELFRGRRSPIKSALLDQKLIAGLGNIYVCEALFRCGIHPERQACTLTGEETAALAEAIPQILEQAIASGGSSLRDYVQADGTKGAFQDLHLVYGREGVPCPNCGAEHPIQRITQAGRSTFFCPTCQK 277
>gi|28896963|ref|NP_796568.1| formamidopyrimidine-DNA glycosylase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839968|ref|ZP_01992635.1| formamidopyrimidine-DNA glycosylase [Vibrio parahaemolyticus AQ3810] >gi|31076660|sp|Q87T81|FPG_VIBPA Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|28805171|dbj|BAC58452.1| formamidopyrimidine-DNA glycosylase [Vibrio parahaemolyticus RIMD 2210633] >gi|149746507|gb|EDM57496.1| formamidopyrimidine-DNA glycosylase [Vibrio parahaemolyticus AQ3810] (269 aa)
Score = 273, Expect = 2.1e-22, Identities = 78/275 (28%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEI-RYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     +     + +TI       PK+  +   E     +  + I++I R+ KYL+   T+    +VHL M G L     D     KH  V +++ + ++ RY+D RRFG +             ++ +G +PL + F+ +Y+ +  +    A+K  ++D + V G+GNIYA+E LF S I P   A ++T  ++  + EN +  L  A+   GTT+  +     + G F + L V+ K    C  C   + ++K+  R T+ C +CQ+
  S:     1 MPELPEVEVSRMGISPH-MVGQTIKAFVFRTPKLRWDIPQE--LKLLEGQVIRNIRRRAKYLLID-TDQGTAIVHLGMSGSLRVLDADFP-AAKHDHVDLKLTNGKVLRYNDPRRFGAWLWCAPGE--SHAVLEHMGPEPLTDAFNSEYIADKAQGKRVAVKQFIMDNKVVVGVGNIYANESLFKSRILPTRQAGQVTPQEWVLLVENIKATLKIAINQGGTTLKDFAQADGKPGYFAQELLVYGKAGEPCPECGEPLQELKIGQRNTFFCNECQQ 269
>gi|56695071|ref|YP_165418.1| formamidopyrimidine-DNA glycosylase [Silicibacter pomeroyi DSS-3] >gi|81350839|sp|Q5LWT9|FPG_SILPO Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|56676808|gb|AAV93474.1| formamidopyrimidine-DNA glycosylase [Silicibacter pomeroyi DSS-3] (283 aa)
Score = 272, Expect = 2.3e-22, Identities = 78/275 (28%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKI---FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKT-------DSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDC--VNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L    +G +   I   E   P +   F +   E  T     ++++ + R+ KY++  L+  +  ++HL M G++            D    +KH  V   MD+   I ++D RRFG   +       + K +  LG +PL  +F   YL   +K  N  +K+ LLDQ  V+G+GNIY  E LF + + P   A ++       +    R +L++A+E  G+++  +     + G FQ    V+ ++   C    C   + +I  +GR ++ C +CQ+
  S:     1 MPELPEVETVRRGLAPAMEGAV---IARAEVNRPDLRWPFPDRMAERLT----GQRVERLRRRSKYILADLSGGETLLIHLGMSGRMTVSGDPLGQFVHDHPAAQKHDHVVFHMDNGARITFNDPRRFGAMDLMATATADEHKLLMVLGPEPLGNDFHEDYLVAALKGRNTPVKSALLDQGIVAGLGNIYVCEALFRAGVSPRRKAGQIAAARVSALVPIIRQVLSEAIEAGGSSLKDFRQADGELGYFQHSFDVYGREGEPCRRAGCDGTVQRITQSGRSSFYCAQCQR 283
>gi|163858324|ref|YP_001632622.1| formamidopyrimidine-DNA glycosylase [Bordetella petrii DSM 12804] >gi|163262052|emb|CAP44354.1| fpg [Bordetella petrii] (275 aa)
Score = 272, Expect = 2.5e-22, Identities = 82/276 (29%), Positives = 129/276 (46%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKE--IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGE-FQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV++    ID++     L R +   ES M          D    +    + +  R+GKYL+    +    +VHL M G L       +  +KH  V    D   +R HD RRFG    + +     +    + +LG++P +  FD  +L +  +    A+K  LL  + V G+GNIYA E LF + I P T A +++     ++A+  R  LA A+ + G+T+  Y     Q G  F+    V+ +    C  C   I ++    R TY C  CQK+
  S:     1 MPELPEVETTRRGIDAVITGKTLRRLLVR-ESRMRWPIP----ADLPGLLSGRAVLECARRGKYLLLRFEHGTQ-IVHLGMSGSLRSVPAGEA-PRKHDHVDWIFDHATLRLHDPRRFGAVLWHPDTAGPIAAHPLLARLGIEPFDPRFDGAWLHSQFRNRAIAVKQALLAGDAVVGVGNIYASESLFRAGIDPRTPARRISRARCARLADMVRATLADALASGGSTLRDYVGASGQPGSYFEIHAAVYERAGLPCRVCGTPIRRLVQGQRATYYCPSCQKR 275
>gi|53718165|ref|YP_107151.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei K96243] >gi|76810131|ref|YP_332171.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1710b] >gi|126441301|ref|YP_001057626.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 668] >gi|126453315|ref|YP_001064872.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1106a] >gi|134279564|ref|ZP_01766276.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 305] >gi|161360192|ref|ZP_02106057.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1106b] >gi|161369933|ref|ZP_02109501.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1710a] >gi|167718022|ref|ZP_02401258.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei DM98] >gi|167737037|ref|ZP_02409811.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 14] >gi|167814146|ref|ZP_02445826.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 91] >gi|167822670|ref|ZP_02454141.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 9] >gi|167844242|ref|ZP_02469750.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei B7210] >gi|167892753|ref|ZP_02480155.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 7894] >gi|167901249|ref|ZP_02488454.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei NCTC 13177] >gi|167909466|ref|ZP_02496557.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 112] >gi|167917495|ref|ZP_02504586.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei BCC215] >gi|194504563|ref|YP_002034135.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1655] >gi|194511190|ref|YP_002023719.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei Pasteur 52237] >gi|194516352|ref|YP_002051795.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei S13] >gi|166215617|sp|A3NRA1|FPG_BURP0 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|166215618|sp|A3N5K5|FPG_BURP6 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|81690471|sp|Q63XL4|FPG_BURPS Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|90101297|sp|Q3JW82|FPG_BURP1 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|52208579|emb|CAH34515.1| putative formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei K96243] >gi|76579584|gb|ABA49059.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1710b] >gi|126220794|gb|ABN84300.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 668] >gi|126226957|gb|ABN90497.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1106a] >gi|134248764|gb|EBA48846.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 305] >gi|157935475|gb|EDO91145.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei Pasteur 52237] >gi|169653585|gb|EDS86278.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei S13] >gi|184212400|gb|EDU09443.1| formamidopyrimidine-DNA glycosylase [Burkholderia pseudomallei 1655] (276 aa)
Score = 272, Expect = 2.6e-22, Identities = 78/275 (28%), Positives = 132/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDK--KHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKE---IKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+     + E     R +  ++ +   + +      F   + + ++  + R+GKYL+F + +   F+VHL M G L     D+      KH  V    D++ +R+ D RRFG   +++  +  D      +  LG++P    F    L    +    ++K  LL  + V G+GNIYA E LF + I P T A +++   ++++A+  R  LA A+E  G+T+  +     + G FQ    V+ +    C  C   I +I    R TY C  CQ+
  S:     1 MPELPEVEVTRRGI-EPFVAGRRVERVD-VRTAMLRWPVPAGFAEMLRSREVLRVERRGKYLLFEV-DAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWIFDEFVLRFRDPRRFGA-VLWHPRDAGDVHAHPLLASLGVEPFSAAFSGALLFGRTRGRTVSVKQALLAGDIVVGVGNIYASESLFRAGIRPTTAAGRVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNGESGYFQLDCFVYDRAGEPCRVCGAPIRQIVQGQRSTYFCPNCQR 276
>gi|84701588|ref|ZP_01016163.1| formamidopyrimidine-DNA glycosylase [Parvularcula bermudensis HTCC2503] >gi|84690834|gb|EAQ16674.1| formamidopyrimidine-DNA glycosylase [Parvularcula bermudensis HTCC2503] (286 aa)
Score = 271, Expect = 3.0e-22, Identities = 75/275 (27%), Positives = 124/275 (45%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKI---FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL----------FFEKTDSSYDKKHVLVKIEMDDY---EIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L         I  +E   P +   F N     F+  +   +I  + R+GKYL   L+  +  ++HL M G+           F+  +       HV   +++       + Y D RRFG   +         +   ++G +PL E F   +L    +     +K+ LLDQ  V+G+GNIY  E L+ + + P  +A  L      ++    +  L  A+E  G+T+  Y       G FQ    V+ ++   C  C   I +   +GR T+ C  CQ+
  S:     1 MPELPEVETVRRGLAPS-MAGAMIERVELRRPDLRFPFPN----GFSQRLEGNRILSVDRRGKYLTLPLSTGETLIMHLGMSGRFLVSGERAPGRFYHASAGDVAHTHVRFTLQIPAEGRGHVAYADPRRFGFMDLVASGELATCRHFAQMGPEPLSEAFTPDHLVAEARGRRTPLKSFLLDQSTVAGLGNIYVCEALWRARLSPRRLAASLGPKRATRLVAAIQDALEDAIEAGGSTLRDYHAADGAMGYFQHRFDVYDREGEPCRQCGRSISRFAQSGRSTFSCTTCQR 286
>gi|150384544|ref|ZP_01923232.1| formamidopyrimidine-DNA glycosylase [Victivallis vadensis ATCC BAA-548] >gi|150259048|gb|EDM96295.1| formamidopyrimidine-DNA glycosylase [Victivallis vadensis ATCC BAA-548] (274 aa)
Score = 271, Expect = 3.1e-22, Identities = 80/275 (29%), Positives = 139/275 (50%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLD-SKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPE +++  +LK +  + R I  +E   P + +  +    +  +   +I D+ R+ +Y++  L + +  ++H  M G +  E  +    +KH  V + +DD    R+  TRRF    +           E+  LG++PL + F+  YL    +     +K  +++ E V GIGNIYA E L+AS + P      +T  +  +IAE ++ ILA+A+E  GT+I+ +      +G+F   L V+ +K   C  C  +I   K+ GR +  C  CQK
  S:     1 MPELPEAENIGRALK-RALVERRIVKVEVFTPAMREPLT-PLLSAGLEGRRIIDVRRRARYVVVELDDGRGLLMHFGMSGVVRVESPEVP-RRKHEHVFLHLDDGRAFRFECTRRFSVLKVCELPRPGGWPSELDALGVEPLTDAFNGNYLYEKSRGRTGCVKNFIMNNEIVVGIGNIYATETLYASEVSPLRETGSVTREECSRIAECAKRILARAIELGGTSISDFLNVDGSEGKFALELAVYGRKGQACPKCGERIEMRKLGGRSSCFCPVCQK 274
>gi|77919460|ref|YP_357275.1| formamidopyrimidine-DNA glycosylase [Pelobacter carbinolicus DSM 2380] >gi|90101308|sp|Q3A3F2|FPG_PELCD Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|77545543|gb|ABA89105.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Pelobacter carbinolicus DSM 2380] (271 aa)
Score = 271, Expect = 3.1e-22, Identities = 76/275 (27%), Positives = 137/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDK-VFVVHLRMEGKLFFEKTDS---SYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+++   +     +++ +  +    P++ +     + +  ++      + R+ KYL+  L N     ++HL M G L    +D+   ++D  HV + +E     +R +D RRFG   ++ E    D   +  LG +P   EF    L    +    A+K  ++DQ  V G+GNIYA E L+ + IHP   A +++   +  +AE  R +L  A+E  GTT+  +  +  + G F + L V+ ++   CV+C   I    +  R +Y C +CQ+
  S:     1 MPELPEVETIRRGISPW-VIDQKVVAVVVRQPRL-RWPVPSNLSACLVGYAFSGVERRAKYLL--LPNPAGCLLIHLGMSGSLRIVPSDTPPAAHD--HVDIALE-SGRTLRLNDPRRFGA-VLWIEGRPEDHALLAHLGPEPFAVEFTGAMLYARSRGRKLAVKNFIMDQRIVVGVGNIYASEALYRAGIHPMRAAGRVSRRRYAALAEAVRQVLTAAIEAGGTTLRDFTDENGRPGYFSQRLLVYGREGQPCVHCGRPIRCETIGQRSSYFCTRCQR 271
>gi|90421901|ref|YP_530271.1| formamidopyrimidine-DNA glycosylase [Rhodopseudomonas palustris BisB18] >gi|122477567|sp|Q21CD4|FPG_RHOPB Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|90103915|gb|ABD85952.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Rhodopseudomonas palustris BisB18] (293 aa)
Score = 271, Expect = 3.2e-22, Identities = 81/275 (29%), Positives = 134/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSY-----------DKKHVLVKIEMDDYEIR-YHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDND------FKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E       I   E+    + +     D    +I + +K + R+ KYL+  L++  V ++HL M G     + ++S            D+ H  V   M +  +  ++D RRFG   I       D   +K LG +PL   FD   L +       ++K  LLDQ  V+G+GNIY  E LF + + P+ +A  L           +++ E  R +L  A++  G+++  +     + G FQ    V+ ++   C +  C   + +   NGR T+ C KCQK
  S:     1 MPELPEVETVRRGL-EPAMAGARIDGFEARRADL-RFALQPDLATRLIGQTVKGLGRRAKYLLAELSSGDVLLMHLGMSGSFRVLQGEASGAPGAFHHPRNDDRAHDHVVFRMSNGAVVVFNDPRRFGYMKILAPGEIADEPFLKGLGPEPLGNSFDAAMLASACAGRKTSLKAALLDQRVVAGLGNIYVCEALFGAHLSPKRLAATLATRTGAPTERAERLVEAIRAVLHAAIKAGGSSLRDHRQTSGELGYFQHSFAVYDREGEPCRSKGCDGVVKRFVQNGRSTFWCPKCQK 293
>gi|163745032|ref|ZP_02152392.1| formamidopyrimidine-DNA glycosylase [Oceanibulbus indolifex HEL-45] >gi|161381850|gb|EDQ06259.1| formamidopyrimidine-DNA glycosylase [Oceanibulbus indolifex HEL-45] (283 aa)
Score = 271, Expect = 3.3e-22, Identities = 79/275 (28%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKI---FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFE-------KTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDC--VNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L       + I   E   P +   F +   E  T     +++  + R+ KY++  L   +  +VHL M G++          + +    +KH  V + M +   I ++D RRFG   + N  +    K +  LG +PL  +F   +L   +K  N  IK+ LLDQ  V+G+GNIY  E L+ + IHP   A +++ +    +    R +LA A+   G+++  +     + G FQ    V+ ++   C   +C   I +I   GR ++ C +CQ+
  S:     1 MPELPEVETVRRGLAP-AMEGQVIARAEVNRPDLRWPFPDRMAERLT----GQRVSLLRRRSKYILADLEGGESLLVHLGMSGRMLVSGDPLGQFQHNHPAPEKHDHVVLHMGNGARITFNDPRRFGAMDLLNTADADAHKLLASLGPEPLGNDFHEAHLVAALKGRNMPIKSALLDQRIVAGLGNIYVCEALYRAGIHPARKAGRISASRIAGLVPIIRQVLADAITAGGSSLKDFRQADGELGYFQHSFDVYGREGKACRRPSCDGTIGRIVQGGRSSFYCPRCQR 283
>gi|118052189|ref|ZP_01520736.1| formamidopyrimidine-DNA glycosylase [Comamonas testosteroni KF-1] >gi|118000317|gb|EAV14474.1| formamidopyrimidine-DNA glycosylase [Comamonas testosteroni KF-1] (319 aa)
Score = 271, Expect = 3.4e-22, Identities = 88/275 (32%), Positives = 130/275 (47%)
  Q:     1 VPELPEVQ----SVIDSLK----EQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSS---YDKKHVLVKIEMDDYEIRYHDTRRFGTFT-IYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV+    S  D +     E   L + +     + P+             ++   +  + R+GKYL+  L+   + ++HL M G L F   D +       H    ++     +R HD RRFG    +  E++ L  K +  LG++PL E F    LK  +  S   IK  LL    V G+GNIYA E+LF S IHP T A  +       + E  R +LA AVE  GTT+  +      +G FQ   +V+ +    C +C   I  ++   R TY C  CQK
  S:    41 MPELPEVEVTRRSFADRIAGAQIEAATLGKPLRWPLGLQPQA------------LVGRVVLGVRRRGKYLLLDLSEGLL-LMHLGMSGSLRFAGRDEAPLGEGGPHDHFDLQTSRGLLRLHDPRRFGAVVYVPGESDALARKLLDHLGMEPLSEGFTLAALKAGLAASRSPIKQLLLSGSVVVGVGNIYASEVLFLSRIHPATPARDVGARKVTALYEAIRAVLAMAVEKGGTTLRDFSAANGMEGHFQLQAQVYGRDGLPCTHCGAAIRLMRQGQRSTYYCSSCQK 314
>gi|93117333|gb|ABE99584.1| fpg [Neisseria meningitidis] (249 aa)
Score = 271, Expect = 3.4e-22, Identities = 72/218 (33%), Positives = 109/218 (50%)
  Q:    42 DFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-FFEKTDSSYDK--KHVLVKIEMDDYEI-RYHDTRRFGTFTIYN---ENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVK 259
           D    +   Q+    R+ KYLI       + ++HL M G L  F  +D    K  +H  V I   D  + RY D R+FG    Y    E++ L    ++KLG +PL E F   YL   +K   RA+K  L+D   V G+GNIYA+E LF + I P   AN+L   +   + E  + +L +A+E  G+T+  +     + G FQ+   V+ + +  C  C   +VK
  S:    29 DLGEILSGRQVLSCGRRAKYLIVRFQTG-ILLIHLGMSGSLRIFTPSDGRIGKPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPL----LEKLGPEPLSEVFCADYLYARLKTQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLQRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVK 248
>gi|77464917|ref|YP_354421.1| formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Rhodobacter sphaeroides 2.4.1] >gi|90101315|sp|Q3IY64|FPG_RHOS4 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|77389335|gb|ABA80520.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Rhodobacter sphaeroides 2.4.1] (283 aa)
Score = 271, Expect = 3.5e-22, Identities = 78/275 (28%), Positives = 134/275 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKI---FKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL---------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L E     R I         +   F     E  T     +++  + R+ KY++  L+  +  ++HL M G++         FF    +     HV++++E     I ++D RRFG   +           +  LG +PL   FD  YL   ++     IK  LLDQ  V+G+GNIY  E+LF + + P  +A  L+  + + +    R +L +A+E  G+++  Y     + G FQ   +V+ ++   CV   C   + +I  +GR ++ C  CQ+
  S:     1 MPELPEVETVRRGL-EPAMAGRLIAEARVNRADLRWPFPPRMAERLT----GQRVLRLRRRSKYILADLSGGQSLLIHLGMSGRMLVSGAQLGEFFHDHPAPSRHDHVVLEME-GGARITFNDARRFGAMDLVATEAAEAHPLLAVLGPEPLGNAFDGAYLAARLEGRRTPIKAALLDQRIVAGLGNIYVCEVLFRAGLAPGRLAGSLSRAEAEGLVPLIREVLLEAIEAGGSSLRDYRQADGELGYFQHTFRVYGREGLPCVTPGCSGTVGRIVQSGRSSFHCPLCQR 283
>gi|118470267|ref|YP_886759.1| formamidopyrimidine-DNA glycosylase [Mycobacterium smegmatis str. MC2 155] >gi|166215635|sp|A0QV21|FPG_MYCS2 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|118171554|gb|ABK72450.1| formamidopyrimidine-DNA glycosylase [Mycobacterium smegmatis str. MC2 155] (285 aa)
Score = 271, Expect = 3.6e-22, Identities = 78/276 (28%), Positives = 134/276 (48%)
  Q:     1 VPELPEVQSVIDSLKEQGCLNRTITNIESIMPKIFK--NCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKK----LGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFK-KEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQKK 276
           +PELPEV+ V   L E     +TIT +    P+  +       D T  +++ +I    R+GKYL   L +    VVHL M G++         D +H+ +   +DD   + + D R FG + +  E   +D  ++ +    +  DPL+  FD   +   ++  +  IK  LLDQ  VSGIGNIYADE L+ + I+   IA  L      ++ + +  ++  A+   GT+  + +     + G F + L  + ++   C  C   + + K   R ++ C +CQ +
  S:     1 MPELPEVEVVRRGLAEH-VTGKTITGVRVHHPRAVRRHEAGPADLTARLLDVRITGTGRRGKYLWLTLDDSAALVVHLGMSGQMLLGPIR---DTRHLRIAAVLDDGTALSFVDQRTFGGWQL-TEMVTVDGTDVPEPVAHIARDPLDPLFDRDRVVTVLRGKHSEIKRQLLDQTVVSGIGNIYADEALWRTKINGARIAAALPRRRLAELLDAAAEVMTDALGQGGTSFDSLYVNVNGESGYFDRSLDAYGREGEPCRRCGAIMRREKFMNRSSFYCPRCQPR 279
>gi|70733155|ref|YP_262928.1| formamidopyrimidine-DNA glycosylase [Pseudomonas fluorescens Pf-5] >gi|90101311|sp|Q4K4A5|FPG_PSEF5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|68347454|gb|AAY95060.1| formamidopyrimidine-DNA glycosylase [Pseudomonas fluorescens Pf-5] (270 aa)
Score = 271, Expect = 3.6e-22, Identities = 87/274 (31%), Positives = 138/274 (50%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV--FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    I    E   ++R I     +   I      ED    +  ++I  + R+ KYL   L N +V   + HL M G L   +       KH  V IE++    +RY D RRFG   +   ++ L+ + + +LG +PL + FD + L    +  + A+K  ++D   V G+GNIYA E LFA+ I P   A  ++   + K+A   + ILA A+E  GTT+  +     Q G FQ+ L V+ +   +C  C   + +IK+  R +  C +CQ
  S:     1 MPELPEVETTRRGIAPHLEGQKVSRVIVRDRRLRWPI-----PEDLDVRLSGQRIVLVERRAKYL---LINAEVGTLISHLGMSGNLRLVEVGLP-AAKHEHVDIELESGLALRYTDPRRFGA--MLWSHDPLNHELLVRLGPEPLTDLFDGERLYQLSRGRSMAVKPFIMDNAVVVGVGNIYATEALFAAGIDPRREAKGISRARYLKLAIEIKRILAAAIERGGTTLRDFIGGDGQPGYFQQELFVYGRGGENCKVCGTGLREIKLGQRASVYCPRCQ 269
>gi|115522499|ref|YP_779410.1| formamidopyrimidine-DNA glycosylase [Rhodopseudomonas palustris BisA53] >gi|122297836|sp|Q07UF4|FPG_RHOP5 Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|115516446|gb|ABJ04430.1| DNA-(apurinic or apyrimidinic site) lyase / Formamidopyrimidine-DNA glycosylase [Rhodopseudomonas palustris BisA53] (293 aa)
Score = 271, Expect = 3.7e-22, Identities = 81/275 (29%), Positives = 136/275 (49%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKLFF-----EKTDSSY------DKKHVLVKIEMDDYE-IRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDN------DFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVN--CKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L+   +G    T+    + +   F+     DFT  +  + +  ++R+ KYL+  L++    ++HL M G         E T   +      D+ H  V   M   + + ++D RRFG   ++      D   +K LG +PL   FD   L         ++K  LLDQ  V+G+GNIY  E LF + + P+ +A  L           +K+ E  R +L +A++  G+++  +     + G FQ    V+ ++   C    C   + +   NGR T+ C KCQK
  S:     1 MPELPEVETVRLGLQPAMEGARFDTVALRRADLRFPFQ----PDFTDRLTGQTVTGLSRRAKYLLADLSSGDALLMHLGMSGSFRVIEPGGEATPGDFHHPRSEDRSHDHVVFSMSSGKTVVFNDPRRFGYMKLFRRAAIEDEPFLKGLGPEPLGNAFDASMLARACAGKKTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPKRLAATLATKAGGPTERAEKLVEAIRTVLHEAIQAGGSSLRDHRQTSGELGYFQHSFAVYDRESEPCRTKGCGGVVKRFVQNGRSTFCCPKCQK 293
>gi|77461572|ref|YP_351079.1| formamidopyrimidine-DNA glycosylase [Pseudomonas fluorescens PfO-1] >gi|90101312|sp|Q3K566|FPG_PSEPF Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) >gi|77385575|gb|ABA77088.1| Formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase [Pseudomonas fluorescens PfO-1] (270 aa)
Score = 270, Expect = 4.3e-22, Identities = 87/274 (31%), Positives = 137/274 (50%)
  Q:     1 VPELPEVQSV---IDSLKEQGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKV--FVVHLRMEGKLFFEKTDSSYDKKHVLVKIEMDD-YEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILAKAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDCVNCKNKIVKIKVNGRGTYLCLKCQ 274
           +PELPEV++    I    E   ++R I     +   I      ED    +  ++I  + R+ KYL   L N +V   + HL M G L   +       KH  V IE++    +RY D RRFG   +   N+ L+ + + +LG +PL + FD + L    +  + A+K  ++D   V G+GNIYA E LFA+ I P   A  ++   + K+A   + ILA A+E  GTT+  +     Q G FQ+ L V+ +    C  C   + ++K+  R +  C +CQ
  S:     1 MPELPEVETTRRGIAPHLEGQRVSRVIVRDRRLRWPI-----PEDLDVRLSGQRIVLVERRAKYL---LINAEVGTLISHLGMSGNLRLVEVGMP-AAKHEHVDIELESGLALRYTDPRRFGA--MLWSNDPLNHELLIRLGPEPLTDLFDGERLYQLSRGRSMAVKPFIMDNAVVVGVGNIYATEALFAAGIDPRREAKGISRARYLKLAIEIKRILAAAIERGGTTLRDFIGGDGQPGYFQQELFVYGRGGEHCKVCGTGLREMKLGQRASVWCPRCQ 269
>gi|154247235|ref|YP_001418193.1| formamidopyrimidine-DNA glycosylase [Xanthobacter autotrophicus Py2] >gi|154161320|gb|ABS68536.1| formamidopyrimidine-DNA glycosylase [Xanthobacter autotrophicus Py2] (293 aa)
Score = 270, Expect = 4.3e-22, Identities = 78/275 (28%), Positives = 143/275 (52%)
  Q:     1 VPELPEVQSVIDSLKE--QGCLNRTITNIESIMPKIFKNCSYEDFTHYIINEQIKDITRKGKYLIFHLTNDKVFVVHLRMEGKL-------------FFEKTDSSYDKKHVLVKIEMDDYEIRYHDTRRFGTFTIYNENNYLDSKEIKKLGLDPLEEEFDWKYLKNNIKKSNRAIKTTLLDQENVSGIGNIYADEILFASSIHPETIANKLTDNDFKKIAENSRIILA------KAVENKGTTIATYFFKKEQKGEFQKFLKVHTKKDFDC--VNCKNKIVKIKVNGRGTYLCLKCQK 275
           +PELPEV++V   L    QG +   I + E+  P + +    ++F   +   +++ I R+ KYL+  L   +V ++HL M G +             F     +     HV++ +      + ++D RRFG   I   +  +    +  LG +PL   F+ +YL     + + ++K  LLDQ+ V+G+GNIY  E LF + + P  +A+ +   +        R+++A      +A+   G+++  +     + G FQ   KV+ ++   C  ++CK+ I +I  NGR T+ C  CQ+
  S:     1 MPELPEVETVRRGLIPVLQGAV---IESAEARRPDL-RWPLPDNFAERLAGRRVEAIGRRAKYLLADLDGGEVMILHLGMSGSIRIEGGAVKGRPGRFHHPRGAGGPHDHVVLHLA-GGATVTFNDPRRFGAILIVPYDQIMSHPLLAGLGPEPLGNGFNAEYLARACARRHTSLKAALLDQKLVAGLGNIYVCEALFRAGLSPRRLAHTIATAEGAPTRRAERLVIAIRDVLREAIHAGGSSLRDHRQVNGELGYFQHTFKVYDREGQPCQTLHCKDTIRRIVQNGRSTFYCPTCQR 293