>gi|26553473|ref|NP_757407.1| triose phosphate isomerase [Mycoplasma penetrans HF-2] >gi|26453479|dbj|BAC43811.1| triose phosphate isomerase [Mycoplasma penetrans HF-2] (305 aa)
Score = 1480, Expect = 2.4e-162, Identities = 305/305 (100%), Positives = 305/305 (100%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHLFNGSTYAYKQHYDHKVALDIPTEEERIKNATQVSDFDMYDITSETYFDDIKINEENM 305
           MREKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHLFNGSTYAYKQHYDHKVALDIPTEEERIKNATQVSDFDMYDITSETYFDDIKINEENM
  S:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHLFNGSTYAYKQHYDHKVALDIPTEEERIKNATQVSDFDMYDITSETYFDDIKINEENM 305
>gi|184154891|ref|YP_001843231.1| triosephosphate isomerase [Lactobacillus fermentum IFO 3956] >gi|183226235|dbj|BAG26751.1| triosephosphate isomerase [Lactobacillus fermentum IFO 3956] (258 aa)
Score = 260, Expect = 6.8e-21, Identities = 67/244 (27%), Positives = 125/244 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  ++ NWKM+        F +++    P+ + V+  VA ++L + P L   K   +E+++QN      G +TG VS   L D GI  A LGH + +  F E +  VN K+   L+ GM  ++  +ET +      +   +  Q+  +  G+ + D V  + I Y+P++   +    +        R+IR+ +   + Y VA+ + ILYGG +  ++I++I    D+DG+LI      ++ ++S++
  S:     1 MRKPFVVANWKMHKSVDEALDFIRSLQGRLPDADLVECGVAANFLALYPMLQEVKGQPLEIISQNAYAEYEGAYTGEVSPKALADAGINYALLGHIERRKLFNETDDLVNRKVIATLQAGMTPIICTDETMIQKEFSGSVHYVFEQLINVLRGV-SFDQVKNIIISYEPSWAVGVGQHANPNLAEEGCRLIRQTIADSYSYEVADKIRILYGGSVNPENIKQIMNKPDIDGVLIGRASLDTDNFLSMI 247
>gi|163787694|ref|ZP_02182141.1| triosephosphate isomerase [Flavobacteriales bacterium ALC-1] >gi|159877582|gb|EDP71639.1| triosephosphate isomerase [Flavobacteriales bacterium ALC-1] (252 aa)
Score = 260, Expect = 7.9e-21, Identities = 72/230 (31%), Positives = 115/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI------PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN D  +  K  K I       + +N +V+VAP+++ +V ++  +K +K+EV AQN+   + G  TG +S   LK  G+KT  LGH + +  F E +  +  K+   L N +  +    E   D    + +  +  QI      ++A D    + + Y+P +          E        IRE L  K+G  VA+++ ILYGG +   + +EI    DVDG LI
  S:     1 MRKNIVAGNWKMNNDLKATRKLVKQIRKSIKDSDLKNTRVIVAPTFVNLVTAVKRAKKSKIEVAAQNMHQATSGAFTGEISADMLKSVGVKTVILGHSERRAYFGETDALLAEKVNTALANNLEVIFCFGEELADRKAGNEEAVVGGQIKNALFHLEA-DAFKNIVLAYEPVWAIGTGETASPEQAQDMHAFIRETLADKYGKDVADSVSILYGGSVKPANAKEIFGKPDVDGGLI 235
>gi|118586333|ref|ZP_01543785.1| triosephosphate isomerase [Oenococcus oeni ATCC BAA-1163] >gi|118433224|gb|EAV39938.1| triosephosphate isomerase [Oenococcus oeni ATCC BAA-1163] (271 aa)
Score = 252, Expect = 6.5e-20, Identities = 66/230 (28%), Positives = 117/230 (50%)
  Q:     1 MREKILITNWKMN----ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+I NWKMN       + + K  K + N EN++V +A   L +   + +++N  + +VAQN  + + G  TG  S   L + G+    LGH + +  F E N  VN K++  L NGM+ ++ +EE +              Q+  +  G+   + + ++ I ++PTF          +        IR+ +R  +G  VA++  ILYGG +  D+++ + K  D+DG+L+
  S:    32 MRKPIIIANWKMNFLRDQANLYVKKLIKKLGNKENIEVGIASQDLFLTDLIKLTENTPISIVAQNAHWENFGPFTGETSPKALANVGVDYVMLGHFERRELFNETNSTVNLKVRTALNNGMDVIVDVEELE--------------QVAPVLEGVSE-EQMQQIIIGFEPTFAIGTGMSASTKGAEDVAEQIRKTVRKLYGSDVADSTRILYGGSVNRDNLKSLIKQKDIDGVLV 250
>gi|13508368|ref|NP_110318.1| triosephosphate isomerase [Mycoplasma pneumoniae M129] >gi|2501319|sp|P78010|TPIS_MYCPN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|1673878|gb|AAB95861.1| triosephosphate isomerase [Mycoplasma pneumoniae M129] (244 aa)
Score = 251, Expect = 8.4e-20, Identities = 70/230 (30%), Positives = 115/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKF---FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K LI NWK N D      F   FK  P      + +AP ++ +     +  N  + ++AQ+ +F + G++TG+VS+ +L+D  + +  +GH + +  F E    +N KL+  L+ GM  VL I ET     E      L+  + Q+  GID L ++ ++ I Y+P +          E    TI  IR +L   +   +A    ILYGG +  D+I+E+ +   +DG L+
  S:     1 MRTKYLIGNWKTNKDLHQALAFVEQFKQHPAKTKAVLGIAPVHVHLTEVNKVLPN-NLLLLAQDANFIASGSYTGTVSYTQLQDIKVNSVIIGHSERRKYFNETAQVINQKLKACLQAGMLVVLCIGET-----EGQPISFLKEDLTQVLQGID-LSLLKQLVIAYEPIWAIGTGKTATPEIANNTIAQIRVYLSELYNKEIAQQTSILYGGSVAKDNIKELAQTEQIDGFLV 226
>gi|116491623|ref|YP_811167.1| triosephosphate isomerase [Oenococcus oeni PSU-1] >gi|116092348|gb|ABJ57502.1| triosephosphate isomerase [Oenococcus oeni PSU-1] (257 aa)
Score = 249, Expect = 1.5e-19, Identities = 66/230 (28%), Positives = 117/230 (50%)
  Q:     1 MREKILITNWKMN----ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+I NWKMN       + + K  K + N EN++V +A   L +   + +++N  + +VAQN  + + G  TG  S   L + G+    LGH + +  F E N  VN K++  L NGM+ ++ +EE +              Q+  +  G+   + + ++ I ++PTF          +        IR+ +R  +G  VA++  ILYGG +  D+++ + K  D+DG+L+
  S:    18 MRKPIIIANWKMNFLRDQANLYVKKLIKKLGNKENIEVGIASQDLFLTDLIKLTENTPISIVAQNAYWENFGPFTGETSPKALANVGVDYVMLGHFERRELFNETNSTVNLKVRTALNNGMDVIVDVEELE--------------QVAPVLEGVSE-EQMQQIIIGFEPTFAIGTGMSASTKGAEDVAEQIRKTVRKLYGSDVADSTRILYGGSVNRDNLKSLIKQKDIDGVLV 236
>gi|171853886|emb|CAM11848.1| Triosephosphate isomerase [Candidatus Phytoplasma australiense] (268 aa)
Score = 248, Expect = 2.0e-19, Identities = 82/262 (31%), Positives = 132/262 (50%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMV-APSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHLFNGSTYAYK------QHYDHK 263
           R K++  NWKM  D     +F +    +IPN + V+ ++ A S L  +  L  ++   +++ AQN    S G  TG +S L L   G+K   LGH + +V F E +  VN KL K L+N ++ VL + ET        TKE L  Q+ Q    +   D+ +++ I Y+P +          +    TI+ IRE +   +   V  +L ILYGG + ++++E I + N++DG+L+           S+  K   N +  A K      QH+D K
  S:     6 RIKVIAGNWKMYKDKNEALEFIQKVNFSIPNSKEVETIIFAQSTL--LDVLVQNQGPNLKIGAQNAFHESEGAFTGEISPLNLVSLGVKYVLLGHSERRVLFGETDQLVNLKLLKALQNNLSPVLCLGETLETKENNKTKEFLEKQLTQALKDVPQEDL-EKILIAYEPVWAIGTGKTASPQEANQTIKQIREKVTNLYSAQVVQSLKILYGGSVSSNNVEAILEQNEIDGVLVGKA--------SLETKDFLNFTQAAVKLSSNCCQHFDKK 267
>gi|163756855|ref|ZP_02163964.1| triosephosphate isomerase [Kordia algicida OT-1] >gi|161323244|gb|EDP94584.1| triosephosphate isomerase [Kordia algicida OT-1] (249 aa)
Score = 246, Expect = 3.2e-19, Identities = 75/244 (30%), Positives = 120/244 (49%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIV--DRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR KI+  NWKMN D       ++   + +PN  +  VMVAP+++ +  +  + K   VEV+AQN+   + G +TG VS   LK  GIKT  LGH + +  F E +  +  K+   L N +  +    E   +L +     +  +  NQ+ N +  LD      + + Y+P +    GE  S    + +      IR+ +  KFG    N + ILYGG +   +  EI    DVDG LI      +  +++I+
  S:     1 MRRKIVAGNWKMNNDLSETEALLNDLIEQVPN-TDASVMVAPAFVNLFQAFNVLKTFNVEVIAQNMHQEAKGAYTGEVSARMLKSVGIKTVILGHSERRAYFGETDELLAKKVDAALANELEIIFCFGE---ELEDRKAGNHFNIVENQLKNALFHLDTAAWKNIVLAYEPVWAIGTGETASPEQAQEMHA---FIRKTVSEKFGDETGNGVSILYGGSVKPANAAEIFAKEDVDGGLIGGASLKAADFVAII 246
>gi|133930409|gb|ABO43776.1| triosephosphate isomerase [Lactobacillus reuteri] (249 aa)
Score = 245, Expect = 3.9e-19, Identities = 62/230 (26%), Positives = 115/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+ D      F + I    P  + ++  +A   L +VP +  +K + ++++A+N  + + G +TG  S   L   GI    LGH + +  F E +  +N K++  L NG+  ++  ++T   +      + +   +++I   +  L  D +  V + Y+P++        D E       +IR+ +   +G  VANN+ ILYGG +   +I  +   ND+DG+L+
  S:     1 MRVPIIAGNWKMHKDVQEAVSFIEKIKNQLPPADQLETAIAAPTLCLVPMVKAAKESPLKIMAENCYYKNEGAYTGETSPYALYQAGIHHVILGHSERRTYFNETDELINKKVKAALVNGLCPIVCCDDT---MRRRVAGKKVHWVVSRILADLHGLTNDEICHVTVAYEPSWAIGTGESADPEQAAEGCYLIRQTISDMYGDEVANNVRILYGGSVTTSNINALMAKNDIDGVLV 233
>gi|150025488|ref|YP_001296314.1| Triose-phosphate isomerase [Flavobacterium psychrophilum JIP02/86] >gi|160187444|sp|A6GZI2|TPIS_FLAPJ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|71913236|gb|AAZ53358.1| triosephosphate isomerase [Flavobacterium psychrophilum] >gi|149772029|emb|CAL43505.1| Triose-phosphate isomerase [Flavobacterium psychrophilum JIP02/86] (250 aa)
Score = 244, Expect = 5.1e-19, Identities = 67/244 (27%), Positives = 122/244 (50%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALD--IVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR KI+  NWKMN +       I++    +P   N K+++AP+++ +  ++  ++   + V AQN+     G +TG +S   LK  G+ T  LGH + +  F E +  ++ K+   L++ M  +    E   +L +   K++  +  NQ+ +G+  +D      + + Y+P +          E        IRE +R  FG  +A ++ ILYGG +  D+ +EI    DVDG LI      ++ ++ I+
  S:     1 MRAKIVAGNWKMNKNSEETEDLINELIDKLPTNSNAKIIIAPTFINLASAVDHTEFTNIRVAAQNMHQAENGAYTGEISADMLKSIGVNTVILGHSERRAIFHETDAIISFKVDTALRHEMTVIFCFGE---ELKDRQNKQHFNIVENQLRDGLFHIDKSAWANIILAYEPVWAIGTGETASPEQAQEMHEFIRETVRKVFGSDIAEDVSILYGGSVKPDNAKEIFSKPDVDGGLIGGAALKADDFVVIV 247
>gi|163764587|ref|ZP_02171643.1| 5'-nucleotidase [Bacillus selenitireducens MLS10] >gi|160354965|gb|EDP81622.1| 5'-nucleotidase [Bacillus selenitireducens MLS10] (252 aa)
Score = 242, Expect = 8.8e-19, Identities = 66/244 (27%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN       +F + I    P+ + V  +V   +L +   +  +    V++ AQN+ F   G  TG  S + L D G+    LGH + +  F E +  VN K      +G+  ++ + ET  +     T + + LQ+ +   G+ A D V    + Y+P +         +E    T  VIR+ +  +FG  VA+ + I YGG +   +I+E+ + +D+DG L+      +  Y+ ++
  S:     1 MRKPIIAGNWKMNKTKSEAVEFLQAIKTAVPSADKVDSVVCSPHLYLDALVQEAAGTDVKIGAQNMYFEESGAFTGETSPMALNDLGVTYVVLGHSERRELFGETDESVNKKTHAAFSHGLTPIVCVGETLEEREANKTSDVVTLQVKEGLKGLTA-DQVKETVVAYEPIWAIGTGKTATSEDANETCGVIRKVIAGEFGQDVADAVRIQYGGSVKPANIKELLEQSDIDGALVGGASLEAESYLQLV 247
>gi|89890368|ref|ZP_01201878.1| triose-phosphate isomerase [Flavobacteria bacterium BBFL7] >gi|89517283|gb|EAS19940.1| triose-phosphate isomerase [Flavobacteria bacterium BBFL7] (250 aa)
Score = 242, Expect = 8.8e-19, Identities = 72/243 (29%), Positives = 120/243 (49%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDI--VDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+ I+  NWKMN D       I    K +    N ++M+APS+  + P+   + +  +EVVAQNV     G +TG VS   L+  G+KT  +GH + +  + E +  + AK    ++NGM  +    E    L +     ++     QI  G+  L+   ++++ I Y+P +    GE  S    + +      IR F++ K+G   A +  ILYGG +   +  EI    DVDG L+      +  +++I
  S:     1 MRKNIVAGNWKMNCDLSLTQNLIGDLKKGLKADYNCELMIAPSFPCLYPAFNSTLDTPIEVVAQNVCEQDKGAYTGEVSIDMLQSVGVKTVIIGHSERRDIYSETDELLAAKTIAAVENGMRVIFCCGE---HLEQRKAGNHVSTVTAQIEKGLFQLNASQMEQIVIAYEPVWAIGTGETASPEQAQDMHAD---IRSFIQAKYGDMTARHTSILYGGSVKPSNAAEIFAKPDVDGGLVGGASLDAKSFLAI 246
>gi|71028912|ref|XP_764099.1| triosephosphate isomerase [Theileria parva strain Muguga] >gi|68351053|gb|EAN31816.1| triosephosphate isomerase, putative [Theileria parva] (250 aa)
Score = 242, Expect = 9.9e-19, Identities = 72/243 (29%), Positives = 119/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R K L  NWK N    SIS    +  N +    N+ V++ P  L +  +  + K    E+  QNVS    G  TG +S     D+G+K + +GH + +  F E N+ V AK++ L  NG+NAV+   ET  +  +  T   L+ Q+N     +      D+V + Y+P +          E +    + +RE +R   G  VA+ + ++YGG +   +  E+ K NDVDG L+    +L  +++ +L
  S:     4 RRKWLGGNWKCNGSKQSISDLLAHFNNLKSKHNNLDVVLFPPSLYVEHTRNVLKTGVFELGVQNVSQSKSGAFTGELSLPMFSDFGLKWSLVGHSERRQLFNEDNFDVRAKVKMLQDNGVNAVVCFGETLSEREQGQTVNVLKRQLNAFVKDVKDW---DKVVLAYEPVWAIGTGKVATVEQVNQAHKFVREHVRGLAG-AVADKVRVVYGGSVNEKNCHELAKCNDVDGFLVGGT-SLKKEFLDVL 245
>gi|86141237|ref|ZP_01059783.1| triosephosphate isomerase [Flavobacterium sp. MED217] >gi|85831796|gb|EAQ50251.1| triosephosphate isomerase [Leeuwenhoekiella blandensis MED217] (249 aa)
Score = 241, Expect = 1.0e-18, Identities = 74/244 (30%), Positives = 119/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKF---FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN D     +     K I    + +V++AP +  +  +    K++ +EV AQN+   S G  TG +S   LK  GIKT  LGH + +  F EK   +  K+   L+N M  +    E   D +     E +  QI+Q    +DA D    + + Y+P +    GE  S    + +      IR+ +  ++   VA+N+ ILYGG +   + +EI    DVDG LI      +  +++I+
  S:     1 MRKNIVAGNWKMNTDLADTQELIGGLKKIAKTSDAEVIIAPPFTNLYTAFETLKDSDIEVAAQNMHQSSSGAFTGEISASMLKGVGIKTVILGHSERRAYFGEKEDLLAEKVNAALENEMKVIYCFGEELKDRNFGEHFEVVNKQISQALFHLDA-DAWKHIVLAYEPVWAIGTGETASPEQAQEMHA---FIRKTIADEYSQEVADNVTILYGGSVKPANAKEIFSKADVDGGLIGGASLKAEDFMAIV 246
>gi|149370138|ref|ZP_01889989.1| triosephosphate isomerase [unidentified eubacterium SCB49] >gi|149356629|gb|EDM45185.1| triosephosphate isomerase [unidentified eubacterium SCB49] (249 aa)
Score = 240, Expect = 1.5e-18, Identities = 74/240 (30%), Positives = 115/240 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI-------EDERALSNKY 240
           MR+ I+  NWKMN D          +      ENV VMVAP++  +  +    +   +EV+AQN+     G  TG VS   LK  G+ T  +GH + +  F E N  +  K+   ++N M  +    E   D  +    E ++ Q+ Q    ID  +    + + Y+P +    GE  S    + I      +R+ + T +   V+ N+ ILYGG +   + +EI  N DVDG LI       ED  A+ N +
  S:     1 MRKNIVAGNWKMNNDLAQTEALLLGLKKHAIPENVSVMVAPAFTNLYQAFETVRETPIEVIAQNMHQAKNGAFTGEVSAPMLKSVGVNTVIIGHSERRAYFHETNALLAEKVTAAIENDMQVIFCFGEELSDRKQGEHFEVVKAQLQQGLFHIDE-NQFKNIVLAYEPVWAIGTGETASPEQAQEIHN---YVRKLVATTYSDAVSENVSILYGGSVKPANAKEIFANADVDGGLIGGAALKAEDFMAIVNAF 249
>gi|184153038|ref|YP_001841379.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|183224382|dbj|BAG24899.1| triosephosphate isomerase [Lactobacillus reuteri F275] (249 aa)
Score = 239, Expect = 1.8e-18, Identities = 63/230 (27%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNADY---VSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+ D    VS  +  KN +P  + ++  +A   L +VP +  ++ + ++++A+N  + + G +TG  S   L   GI    LGH + +  F E +  +N K++  L NG+  ++  ++T   +      + +   +++I   +  L  D +  V + Y+P++        D E       +IR+ +   +G  VANN+ ILYGG +   +I  +   ND+DG+L+
  S:     1 MRVPIIAGNWKMHKDVQEAVSFIEKVKNQLPPADQLETAIAAPTLCLVPMVKAAEESPLKIMAENCYYKNEGAYTGETSPYALYQAGIHHVILGHSERRTYFNETDELINKKVKAALVNGLCPIVCCDDT---MRRRVAGKKVHWVVSRILADLHGLTNDEICHVTVAYEPSWAIGTGESADPEQAAEGCYLIRQTISDMYGDEVANNVRILYGGSVTTSNINALMAKNDIDGVLV 233
>gi|187250571|ref|YP_001875053.1| Triose-phosphate isomerase [Elusimicrobium minutum Pei191] >gi|186970731|gb|ACC97716.1| Triose-phosphate isomerase [Elusimicrobium minutum Pei191] (252 aa)
Score = 239, Expect = 2.2e-18, Identities = 65/236 (27%), Positives = 115/236 (48%)
  Q:     9 NWKMNADYVSISKFFKNIP----NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKM+          K I     N  N  +M+APSY  +       K +KV V AQ+V F   G  T +V+  ++KD G     +GH + +  F + +  +N K+   LK+G+  V  + ET   L+E    + L +  +Q+ NG+     + +  + + Y+P +          E         R++L +K+G   A+ + I+YGG +  D+++ I    DVDG L+  +  ++ ++I I+
  S:    11 NWKMHNTIAESKALAKAIADCKENKNNADIMIAPSYTSLAAVAEAVKGSKVAVAAQDVHFEEKGAFTSAVAPSQIKDAGASHVIIGHSERRSLFGDTDAILNKKVAAALKHGLTVVFCVGET---LAEREADKTLGVIESQLENGLKGFTAEQLSSMVVAYEPVWAIGTGKTATPEQAQEVHASTRKYLSSKYGEDFASKVRIVYGGSVKTDNVDAIMAQPDVDGALVGGQSLVAEQFIRII 249
>gi|146301246|ref|YP_001195837.1| Triose-phosphate isomerase [Flavobacterium johnsoniae UW101] >gi|189036009|sp|A5FE44|TPIS_FLAJO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|146155664|gb|ABQ06518.1| Triose-phosphate isomerase [Flavobacterium johnsoniae UW101] (250 aa)
Score = 238, Expect = 2.7e-18, Identities = 67/244 (27%), Positives = 119/244 (48%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI--DALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+ +       +++    IP   N +V+VAP+++ +  +    KN  + V AQNV     G  TG +S   L   G+ T  LGH + +  F E +  +  K+   LK+ M  +    E   +L +  +  +  +  NQ+ +G+   A +   ++ + Y+P +          E        IRE +R  FG  +A+ + ILYGG +  ++ +EI    DVDG LI      ++ +++I+
  S:     1 MRKSIVAGNWKMHKNAAQTEELLNELIAKIPAKTNAQVIVAPTFVNLQAAAAKLKNTTIGVSAQNVHQAEGGAFTGEISADMLTSIGVNTVILGHSERRAIFHETDALIANKVDTALKHDMTVIFCFGE---ELKDRQSGNHFNIVENQLRDGVFHIAKESWSKIVLAYEPVWAIGTGETASPEQAQEMHEFIRETIRKAFGAEIADEVSILYGGSVKPENAKEIFSKPDVDGGLIGGAALKADDFLAIV 247
>gi|167757648|ref|ZP_02429775.1| hypothetical protein CLORAM_03198 [Clostridium ramosum DSM 1402] >gi|167702645|gb|EDS17224.1| hypothetical protein CLORAM_03198 [Clostridium ramosum DSM 1402] (247 aa)
Score = 238, Expect = 3.0e-18, Identities = 66/244 (27%), Positives = 115/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSK----NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I++ NWKMN        F + +    + KV  +  +    P L +        K+ V A+N  F   G +TG VS   LK+ G++   LGH + +  F E +  VNAK+ ++LKN M  ++ + ET  +    +TK+ ++ Q    F  +       R  I Y+P +         NE        IR  +   +G  VA+ + I YGG +  + ++ + +  D+DG L+      ++ YI+++
  S:     1 MRKPIIVGNWKMNKTIAETKAFVEAV----DAKVSDSADWGIATPYLALQAAKEGTKKLLVAAENCHFKDSGAYTGEVSVEMLKEIGVEWVILGHSERRQYFGETDETVNAKMLQVLKNDMTPIVCVGETLEEYEAGTTKDVVKTQTVAAFKDV-CPKCAGRTVIAYEPVWAIGTGKTATNEIAQDVCGYIRSVVAELYGQEVADQVRIQYGGSVKPEGLKTLLEQPDIDGALVGGASLQADSYIAMI 243
>gi|164686788|ref|ZP_02210816.1| hypothetical protein CLOBAR_00383 [Clostridium bartlettii DSM 16795] >gi|164604178|gb|EDQ97643.1| hypothetical protein CLOBAR_00383 [Clostridium bartlettii DSM 16795] (248 aa)
Score = 236, Expect = 4.1e-18, Identities = 69/244 (28%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI---PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN +     +F K +    + ++V+ ++   +L +      +K  K++V AQN+ F + G  TG VS   L++ G+    +GH + +  F E +  VN K+ K L+ G+N +L   ET        TK++++ QI      +   D+V +V I Y+P +          E     I  IRE + + +G  +AN + I YGG +   ++ EI   +D+DG L+      ++ Y++++
  S:     1 MRKPIIAGNWKMNKNIKEALEFVKEVGARADRDDVEAVICAPFLQLKDLKEATKGTKIKVGAQNMHFETSGAFTGEVSAEMLQEIGMDYVIIGHSERREYFGETDETVNKKVLKALQIGINPILCCGETLEQREAGVTKDHVKTQILAGLKDVTNEDLV-KVVIAYEPIWAIGTGKTATAEQANDVISYIREVVASVYG-DLANEVRIQYGGSVKPANVAEIMGQSDIDGALVGGASLKADDYVALV 245
>gi|90020340|ref|YP_526167.1| triosephosphate isomerase [Saccharophagus degradans 2-40] >gi|89949940|gb|ABD79955.1| triosephosphate isomerase [Saccharophagus degradans 2-40] (257 aa)
Score = 236, Expect = 4.9e-18, Identities = 64/229 (27%), Positives = 116/229 (50%)
  Q:     2 REKILITNWKMNADY----VSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+I NWK+N        S++ F     +FE   + + P Y+ +   L   +++++ + +QNVS    G +TG  S   LK+ G K   +GH + +  FKE N     K+   L +G+  +L + E K +   + TK+ +  Q+ +   G++ LD   ++ I Y+P +     +    E        IR+ L   +G   AN++ +LYGG +  D+ +++    DVDG+L+
  S:     7 RKPIVIANWKLNGGLELICTSVASFIGK--HFE-ADIAICPPYIYMRDMLTFLQHSEISIGSQNVSKFKSGAYTGETSAQMLKEAGCKLCLIGHSERRSMFKENNLSCQIKIGNALNHGLMPILCVGENKEEHDAKITKDVIFRQVTECLEGVE-LD-GRKICIAYEPIWAIGTGASATPEIAQDVHSFIRQELIKLYGEETANSIRLLYGGSVTKDNAKDLLAKEDVDGLLV 234
>gi|194468182|ref|ZP_03074168.1| Triose-phosphate isomerase [Lactobacillus reuteri 100-23] >gi|194453035|gb|EDX41933.1| Triose-phosphate isomerase [Lactobacillus reuteri 100-23] (249 aa)
Score = 236, Expect = 5.1e-18, Identities = 62/230 (26%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNADY---VSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+ D    VS  +  KN +P  + ++  +A   L +VP +  ++ + ++++A+N  + + G +TG  S   L   GI    LGH + +  F E +  +N K++  L NG+  ++  ++T   +      + +   +++I   +  L  D +  V I Y+P++        D +       +IR+ +   +G  VANN+ ILYGG +   ++  +   ND+DG+L+
  S:     1 MRVPIIAGNWKMHKDVQEAVSFIEKVKNQLPPADQLETAIAAPTLCLVPMVKAAEESPLKIMAENCYYKNEGAYTGETSPYALYQAGIHHVILGHSERRTYFNETDELINKKVKAALVNGLCPIVCCDDT---MRRRVAGKKVHWVVSRILADLHGLTNDEICHVTIAYEPSWAIGTGESADPDQAAEGCYLIRQTISDMYGDEVANNVRILYGGSVTTSNVNALMAKNDIDGVLV 233
>gi|88803810|ref|ZP_01119333.1| triosephosphate isomerase [Polaribacter irgensii 23-P] >gi|88780338|gb|EAR11520.1| triosephosphate isomerase [Polaribacter irgensii 23-P] (252 aa)
Score = 235, Expect = 5.1e-18, Identities = 72/230 (31%), Positives = 117/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN------FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR KI+  NWK+N D        K +         ++ +V+VAP+++ +  S+  +K +K+EVVAQN+     G +TG VS   LK  G+ T  LGH + +  F E +  +  K+  +L+  M A+    E    L +  +  +  +  +Q+ N +  L+  D   + + Y+P +    GE  S    + +   IR I E    ++   VA  + ILYGG +   + EEI    DVDG LI
  S:     1 MRTKIVAGNWKLNKDKEGSKSLIKELKKAIQENPLQDTRVIVAPTFVNLSASVKAAKKSKIEVVAQNMHQAINGAYTGEVSADMLKAIGVATVILGHSERRTYFNETDAALAEKMNTVLEKEMEAIFCFGEV---LEDRKSGNHFAVVESQLKNALFHLEGKDWSSIILAYEPVWAIGTGETASADQAQEMHAFIRSIIE---KQYSTAVAEAVSILYGGSVKPSNAEEIFSKPDVDGGLI 235
>gi|83319507|ref|YP_424701.1| triosephosphate isomerase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535534|sp|Q2SRB2|TPIS_MYCCT Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|83283393|gb|ABC01325.1| triosephosphate isomerase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (248 aa)
Score = 234, Expect = 6.9e-18, Identities = 72/244 (29%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFEN---VKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+K++  NWKMN    S+  F   + N  N   +   +A  Y+ +   + ++KN  V++ AQNV F   G +TG +S   LK+ G++   +GH + +  F E +  +N K + LL+N M  ++   E+     +  T E +  QIN I+  I   D + +  I Y+P +    G+  +  D E +    + IRE L   +    A  + I YGG +   +I+E  K  ++DG L+     L+N Y+ ++
  S:     1 MRKKVIFGNWKMNGTNKSLEDFLYQVDNKVNNSKITAGLAVPYVMLQTGIKLAKN--VKIAAQNVHFELKGAYTGEISVSMLKEIGVEYVIIGHSERREMFFETDLDINKKAKILLENNMIPIICCGESLETKEQGKTIEFVNNQINLIYQNISKQDAI-KTIIAYEPIWAIGTGKTANSLDAEEV---CKKIRENLAKIYDNLTAEKITIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLANDYLGLV 244
>gi|192807558|ref|ZP_03036235.1| Triose-phosphate isomerase [Geobacillus sp. Y412MC10] >gi|192802978|gb|EDV79481.1| Triose-phosphate isomerase [Geobacillus sp. Y412MC10] (250 aa)
Score = 234, Expect = 7.1e-18, Identities = 63/244 (25%), Positives = 114/244 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI---PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  I+  NWKM       + F +++      E V+ ++   +  +   +  +K   +++ AQN+ F   G  TG +S L LKD G+    +GH + +  F E +  VN K+    ++G+  ++ + E   +     TK+  ++Q    F G+ A D    V I Y+P +          E     I  IRE ++  +G  VA+ + I YGG +  +++ E    +D+DG L+         YI+++
  S:     1 MRTPIIAGNWKMFKTVPEATSFIEDVKGKAEVEGVESVICAPFTNLPALVEAAKGTNIKIGAQNLHFEDNGAFTGEISGLMLKDLGVDYVIIGHSERRQYFAETDEIVNKKVHAAFRHGLLPIVCVGEKLEEREAGQTKDVCKVQTEAAFAGVPA-DQAVHVVIAYEPIWAIGTGKSSTAEDANEVIAYIRELVKGLYGETVADQVRIQYGGSVKPENVAEYMGQSDIDGALVGGASLQPASYIALV 246
>gi|78044231|ref|YP_359154.1| triosephosphate isomerase [Carboxydothermus hydrogenoformans Z-2901] >gi|123577043|sp|Q3AFD0|TPIS_CARHZ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|77996346|gb|ABB15245.1| triosephosphate isomerase [Carboxydothermus hydrogenoformans Z-2901] (251 aa)
Score = 233, Expect = 9.7e-18, Identities = 64/230 (27%), Positives = 115/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +  NWKM    V  + F +    ++ +   V V V P +  + P     + + + + AQN+ F   G  TG VS   L+D G+K   LGH + +  F E +  +N K++     G+N +  + ET  +     TK  + +Q+ +   G+ A +  + + I Y+P +    G+  +  D + +    + IRE L   FG  +A+ + I YGG +  ++I+E+    D+DG L+
  S:     1 MRKPFIAGNWKMYKTPVEAAGFVRELIDSLKDVSGVDVAVCPPFPALWPVKEALEGSNIALGAQNMHFEKEGAFTGEVSPAMLQDIGVKYVILGHSERRAYFGETDELINQKIKAAFTWGLNPIFCVGETLEERERGITKAVVEIQVLKGLAGVTA-EQAENLTIAYEPVWAIGTGKTATPDDAQEV---CQFIRELLVKLFGREIADKVRIQYGGSVKPENIKELIAKPDIDGALV 233
>gi|183221464|ref|YP_001839460.1| triosephosphate isomerase (TIM; Triose-phosphate isomerase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911551|ref|YP_001963106.1| Triosephosphate isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776227|gb|ABZ94528.1| Triosephosphate isomerase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779886|gb|ABZ98184.1| Triosephosphate isomerase (TIM; Triose-phosphate isomerase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (249 aa)
Score = 233, Expect = 1.1e-17, Identities = 70/230 (30%), Positives = 123/230 (53%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGY-YVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI+  NWKMN   A+   I+K   +  +  + ++MV PS L +     +++++++ V AQN     L   TG +S ++L + GI+T  +GH + +    E +   N K+   LK+G+  V  + ET  +  + +T   L  QI +   GI + D+   + I Y+P +    G++ +  + E     IR  +E  +   G   VA N+ ILYGG +  D+I+E+    ++DG L+
  S:     1 MRKKIIAGNWKMNLTLAEAKEITKGLLSACDSSSYEIMVFPSALHLESVASIARDSQLIVGAQNAYQSGLTAMTGEISPVQLAELGIQTVLVGHSERRQFLGETSEFDNTKISYFLKHGLRVVYCVGETWAEREKGNTFSVLEDQIGKGLKGITS-DLFKNLVIAYEPVWAIGTGKVATPVEAEEAHAFIR--KEIGKLFVGADLVAENIQILYGGSVKPDNIKELLAKPNIDGGLV 234
>gi|42561345|ref|NP_975796.1| triosephosphate isomerase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81829352|sp|Q6MSF2|TPIS_MYCMS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|42492843|emb|CAE77438.1| TRIOSEPHOSPHATE ISOMERASE [Mycoplasma mycoides subsp. mycoides SC str. PG1] (248 aa)
Score = 232, Expect = 1.3e-17, Identities = 71/244 (29%), Positives = 127/244 (52%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-FENVKVM--VAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M++K++  NWKMN    S++ F   + N  ++ K++  +A  Y+ +   L ++KN  V++ AQNV +   G +TG +S   LK+ G++   +GH + +  F E +  VN K + LL+N +  ++   ET        T E +  QIN +F GI   D + +  I Y+P +    G+  +  D E +    + IR  L   +    A  + I YGG +   +I+E  K  ++DG L+     L++ Y+ ++
  S:     1 MKKKVIFGNWKMNGTNESLTDFLNQVDNKIDSSKIIAGLAVPYVMLQTGLKLAKN--VKIAAQNVHYKDKGAYTGEISTTMLKEVGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITPIICCGETLQTKESGKTIEFVNNQINIMFEGIKKEDAI-KAIIAYEPIWAIGTGKTATSSDAEEV---CKQIRNNLSKIYDKNTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLASDYLGLV 244
>gi|71280883|ref|YP_270122.1| triosephosphate isomerase [Colwellia psychrerythraea 34H] >gi|71146623|gb|AAZ27096.1| triosephosphate isomerase [Colwellia psychrerythraea 34H] (256 aa)
Score = 232, Expect = 1.4e-17, Identities = 69/229 (30%), Positives = 113/229 (49%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSL--------GMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKMN D   +      + + E   +V V++ PS+    P L          + N  + V +QNVS    G +TG VS   L++  I    +GH + +  FKE + QV  K+   L  G+  +L I E++ + +   T+  L  QI  + + I  ++    V I Y+P +         +     T + IR+FL  +    VA+ +P+LYGG +   + EE+    D+DG LI
  S:     3 RQAIVAANWKMNGDSALVDTMVSGLADIELSSHVDVVICPSF----PYLSELNQKIKAANLNEAIHVGSQNVSEHESGAYTGEVSTAMLQNLAINYVIVGHSERRSIFKETSTQVAKKVHAALNAGLTPILCIGESEAERATGETETVLSAQIQPVIDEI-GIEKFKDVVIAYEPVWAIGTGKTASSAMAQETHQFIRKFLAQQ-NEQVADKVPLLYGGSVNAANCEELFAQTDIDGGLI 236
>gi|188159112|ref|ZP_02998536.1| TRIOSEPHOSPHATE ISOMERASE [Mycoplasma mycoides subsp. mycoides LC str. GM12] (248 aa)
Score = 231, Expect = 1.5e-17, Identities = 71/244 (29%), Positives = 127/244 (52%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-FENVKVM--VAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M++K++  NWKMN    S++ F   + N  ++ K++  +A  Y+ +   L ++KN  V++ AQNV +   G +TG +S   LK+ G++   +GH + +  F E +  VN K + LL+N +  ++   ET        T E +  QIN +F GI   D + +  I Y+P +    G+  +  D E +    + IR  L   +    A  + I YGG +   +I+E  K  ++DG L+     L++ Y+ ++
  S:     1 MKKKVIFGNWKMNGTNESLTDFLNQVDNKIDSSKIIAGLAVPYVMLQTGLKLAKN--VKIAAQNVHYKDKGAYTGEISTTMLKEIGVEYVIIGHSERREMFNETDLDVNKKAKVLLENNITPIICCGETLQTKESGKTIEFVNNQINIMFEGIKKEDAI-KAIIAYEPIWAIGTGKTATSSDAEEV---CKQIRNNLAKIYDKNTAEQIIIQYGGSVKPSNIQEYLKMPNIDGALVGGASLLASDYLGLV 244
>gi|110597702|ref|ZP_01385986.1| triosephosphate isomerase [Chlorobium ferrooxidans DSM 13031] >gi|110340609|gb|EAT59089.1| triosephosphate isomerase [Chlorobium ferrooxidans DSM 13031] (250 aa)
Score = 230, Expect = 2.0e-17, Identities = 65/230 (28%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI++ NWKMN      S     +       F   +V +AP+Y+ +  +  +   + V++VAQN  + + G  TG +S   LK  G     +GH + +  F E N  VN +++K L  G+  +L + ET   L+E  ++   ++  +Q+  G+  +  +  V I Y+P +    G+  S    E +     +IR  +   +G   A  L I YGG +   +  E+    ++DG LI
  S:     1 MRQKIVVGNWKMNNTIAESSALASELVAALGKGFSGCEVGIAPTYVALQEAGKIIAGSAVQLVAQNCHYENDGAFTGEISTGMLKAVGCSYVIIGHSERRQFFGETNATVNLRIKKALAEGLKVILCVGET---LAERESEVTSKVVTSQVTEGLAGISDISTVVIAYEPVWAIGTGKTASSAQAEEVH---LLIRNTITKLYGDAAAGKLRIQYGGSVKPSNAAELFAMPNIDGGLI 232
>gi|12045291|ref|NP_073102.1| triosephosphate isomerase [Mycoplasma genitalium G37] >gi|1351277|sp|P47670|TPIS_MYCGE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|3845024|gb|AAC72452.1| triosephosphate isomerase [Mycoplasma genitalium G37] >gi|166078890|gb|ABY79508.1| triosephosphate isomerase [synthetic Mycoplasma genitalium JCVI-1.0] (244 aa)
Score = 230, Expect = 2.4e-17, Identities = 68/230 (29%), Positives = 123/230 (53%)
  Q:     1 MREKILITNWKMNA---DYVS-ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALD--IVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR + LI NWK N    D VS + +F +N  N+ N K+ +AP Y+ +     +  ++ + + AQ+ +F   G++TG+VS+ +L+D G+  + +GH + +  + E +  +N KL   LK  M  VL I         E+  + +      + N +D +D  ++  + I Y+P +          E    TI+ IRE++   +   VANN+ ILYGG + +++I+++     +DG L+
  S:     1 MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNY-NAKIGIAPVYVHLTEIKKIISDSLL-LFAQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQVVLCI--------GEALGQEISFLKTDLTNCLDTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTIKTIREYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLV 226
>gi|169351737|ref|ZP_02868675.1| hypothetical protein CLOSPI_02518 [Clostridium spiroforme DSM 1552] >gi|169291959|gb|EDS74092.1| hypothetical protein CLOSPI_02518 [Clostridium spiroforme DSM 1552] (247 aa)
Score = 229, Expect = 2.8e-17, Identities = 65/244 (26%), Positives = 116/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I++ NWKMN        F + +     ++    +A  YL +  +   +KN  + V A+N  F   G +TG VS   LK+ G++   LGH + +  F E +  VNAK+ ++LKN M  ++ + ET  +    +TK+ ++ Q    F  +       R  I Y+P +         NE        IR  +   +   VA+++ I YGG +  + ++ + +  D+DG L+       + YI+++
  S:     1 MRKPIIVGNWKMNKTIADTKAFVEAVDGKVTDSADWGIATPYLALQTAKAEAKN--LLVAAENCHFKDSGAYTGEVSVEMLKEIGVEWVILGHSERRQYFGETDETVNAKMLQVLKNDMTPIVCVGETLEEYEAGTTKDVVKKQTVAAFKDV-CPKCAARSVIAYEPVWAIGTGKTATNEIAQDVCAYIRSVVADLYDQEVADSIRIQYGGSVKPEGLKTLLEQPDIDGALVGGASLQPDSYIAMI 243
>gi|31544785|ref|NP_853363.1| hypothetical protein MGA_0357 [Mycoplasma gallisepticum R] >gi|39932268|sp|Q7NAQ4|TPIS_MYCGA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|31541631|gb|AAP56931.1| TpiA [Mycoplasma gallisepticum R] (252 aa)
Score = 228, Expect = 3.7e-17, Identities = 68/242 (28%), Positives = 125/242 (51%)
  Q:     3 EKILITNWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ +  NWK       + +FF       +    +V   VAP ++ +  +  + +N +  V+AQ+ ++     +TG+VS+ +LKD G+    +GH + +  F E +  +N K++ LL+N M  +L I ET  +     TK  L+ Q+ +   GID+  + D + I Y+P +    G+  S    +     IR +   L +K    +AN LPILYGG +  D++ E+    D++G L+       +K+I ++
  S:     5 KRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLERN-ECLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLENKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLI-IAYEPVWAIGTGKTASSQTAQDAIAYIRTVLGLLSSK---TIANELPILYGGSVTPDNVSELLAQKDINGALVGGASLDPHKFIQLI 249
>gi|147669316|ref|YP_001214134.1| triosephosphate isomerase [Dehalococcoides sp. BAV1] >gi|189036006|sp|A5FRB6|TPIS_DEHSB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|146270264|gb|ABQ17256.1| triosephosphate isomerase [Dehalococcoides sp. BAV1] (253 aa)
Score = 228, Expect = 4.1e-17, Identities = 61/243 (25%), Positives = 113/243 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+ I+  NWKMN          ++    +   E ++ ++ P ++ + P   M +N+ +++ AQN+ +   G +TG +S L LK+   +   +GH + +  F E    VN K++  L+ G+  ++ + E   +     T++ L  Q+ +  +G++   I+    I Y+P +                I  IR  L    G   A   PILYGG +   +I EI    ++DG L+      +  ++SI
  S:     1 MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTMLENSSIKLGAQNLFYQEKGAYTGEISPLMLKEL-CQYVIIGHSERRAYFGETGQVVNQKIKAALQAGLLPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCII----IAYEPIWAIGTGKAATASEANSAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFVSI 242
>gi|187605456|ref|ZP_02991651.1| Triose-phosphate isomerase [Exiguobacterium sp. AT1b] >gi|187482466|gb|EDU20475.1| Triose-phosphate isomerase [Exiguobacterium sp. AT1b] (250 aa)
Score = 227, Expect = 5.5e-17, Identities = 59/230 (25%), Positives = 114/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +    NIP+ + V   +    L + P +  +K + +++ AQN+     G +TG +S   + D G+    LGH + +  F E +  +N+K +K  ++G+  ++ + ET  +   +  +E ++ Q+      + A D V ++ I Y+P +        D      + + +R+ ++  +G  VA  + I YGG +  ++I+E     D+DG L+
  S:     1 MRKPIIAGNWKMNKTLSEAVAFVEEVKNNIPSTDKVDAAIGAPALFLAPMVEAAKGSNLKLGAQNMYDKDSGAYTGEISPAMIADLGVTYVILGHSERREYFGESDAFINSKTKKAFEHGLTPIVCVGETLEEREGDKFEEVIKTQVEGGLADLSA-DQVKQLVIAYEPVWAIGTGKSADEADAQSSCKYVRDVVKGLYGEDVAAAVRIQYGGSVKPENIKEYMAQEDIDGALV 233
>gi|86135344|ref|ZP_01053925.1| triosephosphate isomerase [Tenacibaculum sp. MED152] >gi|85819517|gb|EAQ40674.1| triosephosphate isomerase [Polaribacter dokdonensis MED152] (252 aa)
Score = 226, Expect = 6.6e-17, Identities = 71/230 (30%), Positives = 116/230 (50%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI+  NWKMN D       I+     I N E  N +V+V+PSY+ +  +L ++ + K+EV +QN+     G  TG VS   LK  GIK+  +GH + +  F E +  +  K+  ++ N + A+    E   D   ++    +  Q+      + A D    + + Y+P +    GE  S    + +      IR+ +  K+   VA+++ ILYGG +   +  EI    DVDG LI
  S:     1 MRKKIVAGNWKMNNDLAETKSLINGIQSEIENLELNNTRVIVSPSYVNLSLALELTSSNKIEVASQNMHQAKSGAFTGEVSADMLKSLGIKSVIIGHSERRQYFNETDALLAEKMDAIIANNLEAIFCFGELLEDRKSDNHFNVVESQLKNALFHLKAEDF-SSIVLAYEPVWAIGTGETASPEQAQEMHA---FIRKTIAEKYNQEVADSISILYGGSVKPANAVEIFSKEDVDGGLI 235
>gi|83857819|ref|ZP_00951347.1| triosephosphate isomerase [Croceibacter atlanticus HTCC2559] >gi|83849186|gb|EAP87055.1| triosephosphate isomerase [Croceibacter atlanticus HTCC2559] (250 aa)
Score = 225, Expect = 7.7e-17, Identities = 62/230 (26%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN D       IS     +    +V++++AP +  + P+    +   +++ AQN+     G  TG +S   LK  G+KT  LGH + +  F E N  ++ K+   + N M ++    E   +L +  +  +  +   QI +G+  ++  D   + + Y+P +          E      + +R  +  ++   VA N+ ILYGG +  ++ +EI    DVDG LI
  S:     1 MRKHIVAGNWKMNMDLAQTQELISSLKLQLVKETDVEILIAPPFTNLYPAFEALRETPIKIAAQNMHQSDNGAFTGEISAKMLKSVGVKTVILGHSERRAMFHESNESLSEKVNTAIANEMTSIFCFGE---ELEDRKSDNHFNVVKKQIQDGLCHINEKDWSSIVLAYEPVWAIGTGETASPEQAQDMHKFVRNLIAEEYSDEVAQNVSILYGGSVKPNNAKEIFSQPDVDGGLI 233
>gi|152995054|ref|YP_001339889.1| Triose-phosphate isomerase [Marinomonas sp. MWYL1] >gi|150835978|gb|ABR69954.1| Triose-phosphate isomerase [Marinomonas sp. MWYL1] (249 aa)
Score = 225, Expect = 8.2e-17, Identities = 72/244 (29%), Positives = 120/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENV--KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIV--DRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           +R+KI+  NWKMN    SI      +   ++   +V+VAPS+  +    G+   + + + AQNVS    G  TG VS   L D+G+K   LGH + +  + E N  V +K++ +L +G+  +L I ET   L+E  + + L +   Q+   ID + I   +++ I Y+P +          E        IR FL  K    V+  + ILYGG +       + +  DVDG L+      + ++I+I+
  S:     2 IRQKIVAGNWKMNGSKESIVSLISGLLEMDSSSSEVVVAPSFPYLSQVDGLISASSIVLAAQNVSQEVKGAFTGEVSTSMLGDFGVKYVLLGHSERRSLYGETNELVASKVKTVLDSGLTPMLCIGET---LAERESGKTLEICEQQLQAVIDLVGIASFEQLVIAYEPVWAIGTGLSASAEQAQEVHESIRSFL-AKSSESVSQKVQILYGGSVKASTSSALFQMPDVDGALVGGASLDAKEFIAIV 245
>gi|167730592|emb|CAO81504.1| Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) [Candidatus Cloacamonas acidaminovorans] (262 aa)
Score = 225, Expect = 8.6e-17, Identities = 73/230 (31%), Positives = 120/230 (52%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IP-----NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRL-QINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +  NWKMN        F +  IP       ENV  ++AP+Y  +  +L  S  + ++V AQ+VS  S G +TG VS   L   G+K   +GH + +    E +  VNAK+ KL +N +  ++ I ET +   EE   EN+ L Q++     I  L   + + + Y+P +    G+  +    + +     +IR +L++ +   VA  L +LYGG I   +++E+    D+DG LI
  S:     3 MRKIYIAGNWKMNKGLQETKNFLETVIPELNKLKLENVIPLIAPAYPFLEEALKGSYGSCMQVSAQDVSVHSEGAYTGEVSAGMLASLGLKYCIVGHSERRQYHNETDATVNAKILKLFENHITPLVCIGET-LQQREEGKTENVILSQLSGCLKNIKLLS-GEEIILAYEPVWAIGTGKTATPSQAQEVH---NLIRNWLKSNYSDKVAEKLSLLYGGSIKPGNLQELLDCEDIDGGLI 237
>gi|50365321|ref|YP_053746.1| triosephosphate isomerase [Mesoplasma florum L1] >gi|50363877|gb|AAT75862.1| triosephosphate isomerase [Mesoplasma florum L1] (275 aa)
Score = 224, Expect = 1.0e-16, Identities = 68/244 (27%), Positives = 113/244 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGI---VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+K++  NWKMN     +  F K +        +VA   LG+   + S G+ K   V+V AQNV F   G  TG VS   L++ G++   +GH + +  F E +  VN K   LL  G+  ++   ET      + T   +  QI + + GI A D + +  I Y+P +         +E        IR+ L   +    A  + I YGG +   +I E+    ++DG L+      ++ +I+++
  S:    28 MRQKVIFGNWKMNGTNAELVTFLKKVDKAAKKSDVVAG--LGLPFTLLSKGIEKAKNVKVAAQNVHFAEKGAFTGEVSISMLQEVGVQYVIIGHSERREMFAETDETVNKKATALLAAGITPIICCGETLETKEAKKTVTFVNAQIKKAYKGISAEDAL-KTIIAYEPIWAIGTGKTATSEDAEKVCEAIRKNLTKIYDEKTAQQITIQYGGSVNPSNIAELMSQPNIDGALVGGASLKADDFIALI 271
>gi|149183682|ref|ZP_01862095.1| triosephosphate isomerase [Bacillus sp. SG-1] >gi|148848609|gb|EDL62846.1| triosephosphate isomerase [Bacillus sp. SG-1] (253 aa)
Score = 223, Expect = 1.3e-16, Identities = 64/230 (27%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN       KF +++    P+ E V+ ++    L +   + ++K  +VE+ AQN+ F   G  TG +S   L+D G+K   LGH + +  F E +  VN K        +  ++ + ET      + TK+ +  Q+ +   G+   D V    I Y+P +         +E        IR+ +  +F    A  L I YGG +  ++I E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTMSEAKKFAEDVNGLVPSSEKVESVICAPALFLERLVDITKEYQVEIGAQNMHFEENGAFTGEISPAALQDLGVKYVILGHSERREMFNETDESVNKKTHAAFNYNLTPIVCVGETLEQREADQTKQIVGDQVKKALEGLTE-DQVKATVIAYEPIWAIGTGKSSTSEDANEVCSHIRQTVAEQFSQEAAEALRIQYGGSVKPNNIGEYMAQSDIDGALV 233
>gi|188039667|ref|ZP_02998365.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 8] >gi|188530841|ref|ZP_03005140.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568704|ref|ZP_03005465.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 2] >gi|188592514|ref|ZP_03005846.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 10] (238 aa)
Score = 223, Expect = 1.3e-16, Identities = 70/241 (29%), Positives = 127/241 (52%)
  Q:     4 KILITNWKMNADYVSISKFFKNIPNFENVKVMV--APSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           K +I N+KMNA    I+ F  N+ +F+  K+ +  AP  L +   + +S+  KV++ AQN S  S G +TG +S L+L D  IK   +GH ++++D  +    +  +  K+  + ++ V+      +D+ E+  K++L   ++Q+ N I+   +  ++ I Y+P +    N   D + I   I  I+ +L    G     N+PILYGG +  ++I+E+C    +DG LI +     N +  I+
  S:     2 KYIIANFKMNATEELINHFLNNLISFDEQKLTIGLAPGDLYLKTFVDLSQTKKVKLYAQNPSAYSKGPYTGQISCLQLLDSNIKNTLVGHSEIRIDCSQ---SIIDQKTKICMDLLDQVIICIGEPLDVYEQ--KKSLSFVLSQLANVINYKGL-KKIIIAYEPIWAIGTNLTLDLKHINHMIEGIKTYLYNCTGL----NIPILYGGSVNANNIKELCTQKLIDGFLIGNASLDVNNFNQII 234
>gi|171920622|ref|ZP_02931867.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178795|ref|ZP_02964590.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024279|ref|ZP_02996972.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|189009904|ref|ZP_03004001.2| triosephosphate isomerase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195867742|ref|ZP_03079743.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195869052|ref|ZP_03004170.2| triosephosphate isomerase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|171903340|gb|EDT49629.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209416|gb|EDU06459.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018948|gb|EDU56988.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997910|gb|EDU67007.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660133|gb|EDX53513.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660597|gb|EDX53853.1| triosephosphate isomerase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (241 aa)
Score = 223, Expect = 1.4e-16, Identities = 70/244 (28%), Positives = 129/244 (52%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKVMV--APSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ K +I N+KMNA    I+ F  N+ +F+  K+ +  AP  L +   + +S+  KV++ AQN S  S G +TG +S L+L D  IK   +GH ++++D  +    +  +  K+  + ++ V+      +D+ E+  K++L   ++Q+ N I+   +  ++ I Y+P +    N   D + I   I  I+ +L    G     N+PILYGG +  ++I+E+C    +DG LI +     N +  I+
  S:     2 VKMKYIIANFKMNATEELINHFLNNLISFDEQKLTIGLAPGDLYLKTFVDLSQTKKVKLYAQNPSAYSKGPYTGQISCLQLLDSNIKNTLVGHSEIRIDCSQ---SIIDQKTKICMDLLDQVIICIGEPLDVYEQ--KKSLSFVLSQLANVINYKGL-KKIIIAYEPIWAIGTNLTLDLKHINHMIEGIKTYLYNCTGL----NIPILYGGSVNANNIKELCTQKLIDGFLIGNASLDVNNFNQII 237
>gi|73748555|ref|YP_307794.1| triosephosphate isomerase [Dehalococcoides sp. CBDB1] >gi|123619629|sp|Q3ZXC5|TPIS_DEHSC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|73660271|emb|CAI82878.1| triosephosphate isomerase [Dehalococcoides sp. CBDB1] (253 aa)
Score = 223, Expect = 1.4e-16, Identities = 60/243 (24%), Positives = 113/243 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+ I+  NWKMN          ++    +   E ++ ++ P ++ + P   + +N+ +++ AQN+ +   G +TG +S L LK+   +   +GH + +  F E    VN K++  L+ G+  ++ + E   +     T++ L  Q+ +  +G++   I+    I Y+P +                I  IR  L    G   A   PILYGG +   +I EI    ++DG L+      +  ++SI
  S:     1 MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTILENSSIKLGAQNLFYQEKGAYTGEISPLMLKEL-CQYVIIGHSERRAYFGETGQVVNQKIKAALQAGLLPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCII----IAYEPIWAIGTGKAATASEANSAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFVSI 242
>gi|194336834|ref|YP_002018628.1| Triose-phosphate isomerase [Pelodictyon phaeoclathratiforme BU-1] >gi|194309311|gb|ACF44011.1| Triose-phosphate isomerase [Pelodictyon phaeoclathratiforme BU-1] (251 aa)
Score = 223, Expect = 1.5e-16, Identities = 64/230 (27%), Positives = 114/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR KI++ NWKMN       +   ++       F   +V +AP+YL +  +  +   ++V++VAQN  + + G  TG VS   +   G  +  +GH + +  F E N  VN +++K L  G+N +L + ET   L+E  +     +  +Q+  G+D +  +  + I Y+P +    G+  S    E +   IR +   L   +G   +  + I YGG +   +  E+    ++DG LI
  S:     1 MRRKIVVGNWKMNNSVAESVQLATDVLAALGEGFSGCEVGIAPTYLALDATEKVIAESEVQLVAQNCHYENDGAFTGEVSARMILAVGCSSVIIGHSERRQYFGETNATVNLRIKKALSEGLNVILCVGET---LAERESGVMETVISSQVREGLDGIIDISAIVIAYEPVWAIGTGKTASSAQAEEVHLFIRTLVTGL---YGQTASEKVRIQYGGSVKPSNAAELFAMPNIDGGLI 232
>gi|71018431|ref|XP_759446.1| hypothetical protein UM03299.1 [Ustilago maydis 521] >gi|46099053|gb|EAK84286.1| hypothetical protein UM03299.1 [Ustilago maydis 521] (248 aa)
Score = 223, Expect = 1.6e-16, Identities = 63/222 (28%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN    S  +  + +   +   NV+V+V+P  L ++      K +KV V AQN      G  TG VS   LKD GI    LGH + +  F E +  V  K    L   ++ +L I ET   L +    E + + + Q+    D +    ++ + Y+P +    G++ +    + +      IR++   K G   A+ L I+YGG +   + +E+ +  D+DG L+
  S:    10 NWKMNGSLESTKQLTQTLTQAKLDSNVEVVVSPPALHLLAVQEQLKGSKVAVAAQNAYHKPSGAFTGEVSVTMLKDAGIPWVILGHSERRTLFHESDANVAEKTAAALAENLSVILCIGET---LEQREANETVNVVVRQLDAVADHVKDWSKIVVAYEPVWAIGTGKVATSEQAQEVHAA---IRKWATEKLGKDTADQLRIIYGGSVAAKNCKELAQRPDIDGFLV 231
>gi|169334488|ref|ZP_02861681.1| hypothetical protein ANASTE_00891 [Anaerofustis stercorihominis DSM 17244] >gi|169259205|gb|EDS73171.1| hypothetical protein ANASTE_00891 [Anaerofustis stercorihominis DSM 17244] (251 aa)
Score = 222, Expect = 1.9e-16, Identities = 61/229 (26%), Positives = 111/229 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENV---KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R K++  NWKMN       +FF    +  NV   +V++ P+Y+ I  ++   K   V + AQN+ F   G +TG V+   + + G K   +GH + +  F E +  VN K +K L+ G+  +  + ET  +       + L+ Q  ++  GI   D   ++ + Y+P +         +E        IR+ ++   G  VA+ + ILYGG +   +++ +   +D+DG L+
  S:     3 RTKVIAGNWKMNKTAAEAKEFFNEFLDKINVADPEVVICPTYMTIPAAVEAVKGTNVGIGAQNMYFEESGAYTGEVTADMIIEAGCKYVIIGHSERRQYFNETDEGVNLKTKKALEKGLIPIPCVGETLEERESGKAFDVLKEQTTKMLEGISKED-AKKIILAYEPVWAIGTGKTATDEQANEACGYIRKLVKELLGEEVADAMRILYGGSVNAGNVKALMSMSDIDGALV 233
>gi|160916081|ref|ZP_02078288.1| hypothetical protein EUBDOL_02108 [Eubacterium dolichum DSM 3991] >gi|158431805|gb|EDP10094.1| hypothetical protein EUBDOL_02108 [Eubacterium dolichum DSM 3991] (247 aa)
Score = 222, Expect = 2.0e-16, Identities = 65/246 (26%), Positives = 117/246 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF--ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           MR+ I++ NWKMN       +F K +     +     V  S+L +  S+  +KN  + + A+N  F   G  TG VS   L++ G+K   +GH + +  F + +  VN K ++L+  G+  +L I ET+       T++ +R Q++     +     V  + + Y+P +          E       ++R+ +R  +G   A+N+ I YGG +  ++I E     D+DG LI      ++ +I I+ K
  S:     1 MRKPIIVGNWKMNKTIAEAVEFIKAVDPVCHDGATFGVGTSFLALNESIKNAKN--LIIAAENCHFKDSGAFTGEVSVPMLEEIGLKYCIIGHSERREMFGDTDETVNLKAKRLIDAGITPILCIGETEAQYDAGETEKVIREQLSGSLADL-CPKCVANMVVAYEPIWAIGTGKSATKEDAQKCCAIVRDQVRVMYGDEAADNVRIQYGGSVKPENIVEYMACPDIDGALIGGASLKADSFIDIINK 245
>gi|196190760|gb|EDX85724.1| triosephosphate isomerase [Synechococcus sp. PCC 7335] (243 aa)
Score = 221, Expect = 2.7e-16, Identities = 64/230 (27%), Positives = 123/230 (53%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-PNFENVK-----VMVAP-SYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+      S F + + P  E+V      V+ AP + LG++  +   ++++V+V AQNV +   G +TG VS + LK+ G++   +GH + +  F E +  VNA+L+    +G+  +L + ETK     + T+  +  QI +    I+  ++V    I Y+P +    G+  +  + + + G IR + +             + I YGG +  ++++EI   +++DG L+
  S:     1 MRKVVIAGNWKMHKTQADASAFVQQLMPQLESVPEEREIVLCAPFTTLGLL--VDKLQSSRVQVGAQNVHWEREGAYTGEVSGVMLKELGVRYVVVGHSERRQYFGETDETVNARLKAAQLHGLTPILCVGETKQQRDADQTESVITGQIKKALVDINQFNLV----IAYEPIWAIGTGDTCAADEADAVIGKIRALLD----------NKEVSIQYGGSVKPENVDEIMAQSEIDGALV 224
>gi|163815107|ref|ZP_02206488.1| hypothetical protein COPEUT_01263 [Coprococcus eutactus ATCC 27759] >gi|158449516|gb|EDP26511.1| hypothetical protein COPEUT_01263 [Coprococcus eutactus ATCC 27759] (250 aa)
Score = 220, Expect = 2.9e-16, Identities = 65/229 (28%), Positives = 111/229 (48%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN   ++ V +    K++   ++V V+     + IVP +  +K   V V A+N+ F   G +TG +S   L D G+K   +GH + +  FKE +  +N K++K  + G+  +L   E+        T + +RLQI     G+ A D V  + I Y+P +         ++      + IR+ +   +    A  + I YGG +   +  E+    D+DG LI
  S:     3 RKKIIAGNWKMNKTPSEAVELVNLLKDLVKNDDVDVVYCVPAIDIVPVVEATKGTNVAVGAENMYFEESGAYTGEISAAMLVDAGVKYVIIGHSERRDYFKEDDVLLNKKVKKAFEAGITPILCCGESLEQRELGVTMDWIRLQIKSDLAGVTA-DQVKSMVIAYEPIWAIGTGKTATSDQAQEVCKGIRDLIAEIYDTDTAEAVRIQYGGSMNAGNAAELLAKPDIDGGLI 233
>gi|170017898|ref|YP_001728817.1| triosephosphate isomerase [Leuconostoc citreum KM20] >gi|169804755|gb|ACA83373.1| Triosephosphate isomerase [Leuconostoc citreum KM20] (270 aa)
Score = 220, Expect = 3.4e-16, Identities = 65/243 (26%), Positives = 119/243 (48%)
  Q:     2 REKILITNWKMN---ADYVS-ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFM---GEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R   ++ NWK+N   AD +  +S+    +P+ + V+  +A   L +   +  +    + VVA+NV +   G +TG  S   LKD G     +GH + +  F E +  VN K+   L+NG+  ++ ++E     ++    E    Q+     G+ ++D +  V I Y+PT+    GE  S    +       +IR+ L   +   +A  + +LYGG +  D+  EI   ND+DG+L+        K++ ++
  S:     9 RVPFVVANWKINKLQADVMDFLSQVNDKVPDQKVVETGIAAQDLFLADMVRTTAGTPIHVVAENVHWEDGGAYTGETSPKALKDIGATYVLIGHFERRKFFNETDSTVNLKVTAALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGV-SVDQIRNVTIAYEPTWAIGSGEAASADQAQ---KAAHLIRQTLAKLYSPVIAEQVRVLYGGSVTPDNAREIMSQNDIDGVLVGTAALDPKKFLQLI 254
>gi|148543408|ref|YP_001270778.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|184152817|ref|YP_001841158.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|148530442|gb|ABQ82441.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|183224161|dbj|BAG24678.1| triosephosphate isomerase [Lactobacillus reuteri F275] (256 aa)
Score = 219, Expect = 3.9e-16, Identities = 62/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +  NWKM+ +     +F   I    P+ + V+V +A     +   +  + ++ ++++AQN +    G  TG +S   L D G+    LGH + +  F E N  VN K+   L+ G+  ++  +ET V          +  Q+  +  G+ +LD +  V + Y+P++        +        R IR  +   + Y +A+ + ILYGG +  D+I  I    DVDG+LI
  S:     1 MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVQAADDSGLKIIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMGVTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGV-SLDQIKNVVVSYEPSWAVGYGQHANPVLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLI 233
>gi|194467559|ref|ZP_03073546.1| Triose-phosphate isomerase [Lactobacillus reuteri 100-23] >gi|194454595|gb|EDX43492.1| Triose-phosphate isomerase [Lactobacillus reuteri 100-23] (256 aa)
Score = 219, Expect = 4.2e-16, Identities = 62/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +  NWKM+ +     +F   I    P+ + V+V +A     +   +  + ++ ++++AQN +    G  TG +S   L D G+    LGH + +  F E N  VN K+   L+ G+  ++  +ET V          +  Q+  +  G+ +LD +  V + Y+P++        +        R IR  +   + Y +A+ + ILYGG +  D+I  I    DVDG+LI
  S:     1 MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVQAADDSGLKIIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMGVTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGV-SLDQIKNVVVSYEPSWAVGYGQHANPVLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLI 233
>gi|133930513|gb|ABO43828.1| triosephosphate isomerase [Lactobacillus reuteri] (264 aa)
Score = 219, Expect = 4.2e-16, Identities = 62/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +  NWKM+ +     +F   I    P+ + V+V +A     +   +  + ++ ++++AQN +    G  TG +S   L D G+    LGH + +  F E N  VN K+   L+ G+  ++  +ET V          +  Q+  +  G+ +LD +  V + Y+P++        +        R IR  +   + Y +A+ + ILYGG +  D+I  I    DVDG+LI
  S:     1 MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVHAADDSGLKIIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMGVTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGV-SLDQIKNVVVSYEPSWAVGYGQHANPVLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLI 233
>gi|464910|sp|P35144|TPIS_BACME Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|143319|gb|AAA73204.1| triose phosphate isomerase >gi|143761|gb|AAA73207.1| triose phosphate isomerase (251 aa)
Score = 219, Expect = 4.5e-16, Identities = 64/244 (26%), Positives = 114/244 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN      + F + +    P+ E+V  +V    L +   +  +K   +++ AQN+ F   G  TG VS + L D G+    LGH + +  F E +  VN K     K+G+  ++   ET  +  ++ TK  +  Q+ +   G+   + V +  I Y+P +          E        IR  +  +F   VA+ + I YGG +   +I+E    +D+DG L+      ++ ++ +L
  S:     1 MRKPIIAGNWKMNKVLSEATSFVEEVKGAVPSPESVDSVVCAPALFLDRLVEATKGTDLKIGAQNMHFEENGAFTGEVSPVALADLGVNYVILGHSERREMFAETDETVNQKTIAAFKHGLTPIVCCGETNEEYEQDQTKTVVANQVQKALAGLTD-EQVKQTVIAYEPIWAIGTGKSSTAEGANEVCAYIRSVVAEQFSQDVADAVRIQYGGSVKPANIKEYMSQSDIDGALVGGASLEADSFLQLL 247
>gi|88713961|ref|ZP_01108041.1| triosephosphate isomerase [Flavobacteriales bacterium HTCC2170] >gi|88707794|gb|EAR00034.1| triosephosphate isomerase [Flavobacteriales bacterium HTCC2170] (249 aa)
Score = 218, Expect = 4.9e-16, Identities = 66/244 (27%), Positives = 126/244 (51%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALD--IVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR KI+  NWKMN +       + +    +PN  + +VMV+P+++ +  ++   + +K++V+AQN+     G +TG +S   L + GI T  LGH + +  F E +  +  K++  L   M  +    E   +L++  +  + ++  +Q+ N +  LD      + + Y+P +    GE  S    + +      IR+ +   F   +A N+ ILYGG +   + +EI    DVDG LI     +++ +++I+
  S:     1 MRSKIVAGNWKMNKNLAETEALVIELEAKLPN-TDAEVMVSPTFVNLASAVSKLQGSKIKVIAQNMHNAESGAYTGEISADMLLNIGIDTVILGHSERRAYFGETDEILATKVKAALAKNMQIMFCFGE---ELNDRKSDNHFKVVESQLRNALFDLDPSAWSSIILAYEPVWAIGTGETASPEQAQEMHA---FIRKTIANAFNNEIAENVSILYGGSVKPGNAKEIFSKPDVDGGLIGGAALVADDFVAII 246
>gi|167957594|ref|ZP_02544668.1| triosephosphate isomerase [candidate division TM7 single-cell isolate TM7c] (256 aa)
Score = 218, Expect = 5.1e-16, Identities = 66/229 (28%), Positives = 117/229 (51%)
  Q:     2 REKILITNWKMNADY----VSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNA-KVEVVAQNVSFPSLGNHTGSVSWLELK---DYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+K++I NWKMN +     + + +  + I    +V+V+VAP+ L  + SL +  N  KV++ AQN  +   G +TG  S  +L+   DYG+    +GH + +  F E+   +  K+Q  ++NG   +L + ET+ + + + T   L  Q+      I + D V  V I Y+P +            +     VIR  LR  +G  V+ ++ I+YGG + +    +      +DG+L+
  S:     4 RKKLIIGNWKMNFNTHDASIYLHRLQEAITERRDVQVIVAPTTL-TLQSLSLQVNRRKVKLAAQNFYWRDFGPYTGETSATQLRGIVDYGL----VGHSERRYLFHEQEKDIRYKVQAAVRNGFKPILCVGETRAERTNKETHAVLYDQLTASLANITS-DEVGNVIIAYEPVWAIGTGDNAKPSDVIKAGSVIRRTLRNLYGDKVSKDVQIVYGGSVTSSSATDYLSIPGIDGLLV 234
>gi|153168535|ref|ZP_01928378.1| triosephosphate isomerase [Listeria monocytogenes FSL N1-017] >gi|153204030|ref|ZP_01944896.1| triosephosphate isomerase [Listeria monocytogenes HPB2262] >gi|133726306|gb|EBA28004.1| triosephosphate isomerase [Listeria monocytogenes FSL N1-017] >gi|133734442|gb|EBA36140.1| triosephosphate isomerase [Listeria monocytogenes HPB2262] (255 aa)
Score = 218, Expect = 5.2e-16, Identities = 65/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN       +F +    N+P+ + V+ +VA   L +   + +++   + V AQN  F   G  TG +S   L D G+    +GH + +  F E +  +N K   + K+GM  ++   ET        T   +R QI     G+    ++  V I Y+P +    G+ ++  D NE    T  VIR  +        A+ + I YGG +  ++I +    +D+DG L+
  S:     5 MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLRVAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSV-IAYEPIWAIGTGKSSTSADANE----TCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALV 237
>gi|120434797|ref|YP_860483.1| triosephosphate isomerase [Gramella forsetii KT0803] >gi|117576947|emb|CAL65416.1| triosephosphate isomerase [Gramella forsetii KT0803] (259 aa)
Score = 218, Expect = 5.2e-16, Identities = 69/230 (30%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK-----VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN D     +    +   + VK     VMVAPS+  + P+    K+  V V AQN+     G  TG VS   LK  G+ T  +GH + +  F E N  +  K+Q  ++N M  +    E   +L +  ++++  L   Q+   +  L   +   + + Y+P +          E      + +RE L    G  VA    ILYGG +  ++ +EI    DVDG LI
  S:    10 MRDHIVAGNWKMNNDLAETQELLGKL-KLQMVKEPEATVMVAPSFTNLYPTFQSLKDTPVIVAAQNMHESEKGAFTGEVSASMLKSIGVTTVIIGHSERRALFNETNDILAKKVQAAIENDMTVIFCFGE---ELEDRKSEKHFNLVEKQLKESLFQLPQSVWKNIILAYEPVWAIGTGETASPEQAQEMHKHVRELLNKNVGKEVAEATSILYGGSVKPNNAKEIFAKEDVDGGLI 242
>gi|16801613|ref|NP_471881.1| hypothetical protein lin2551 [Listeria innocua Clip11262] >gi|46908630|ref|YP_015019.1| triosephosphate isomerase [Listeria monocytogenes str. 4b F2365] >gi|47094182|ref|ZP_00231899.1| triosephosphate isomerase [Listeria monocytogenes str. 4b H7858] >gi|167015558|ref|ZP_02278091.1| triosephosphate isomerase [Listeria monocytogenes FSL J1-194] >gi|167218262|ref|ZP_02287898.1| triosephosphate isomerase [Listeria monocytogenes FSL J1-175] >gi|167454932|ref|ZP_02321155.1| triosephosphate isomerase [Listeria monocytogenes FSL J2-064] >gi|168266702|ref|ZP_02688667.1| triosephosphate isomerase [Listeria monocytogenes FSL J2-071] >gi|20140654|sp|Q928I1|TPIS1_LISIN Triosephosphate isomerase 1 (TIM 1) (Triose-phosphate isomerase 1) >gi|67462052|sp|Q71WW9|TPIS1_LISMF Triosephosphate isomerase 1 (TIM 1) (Triose-phosphate isomerase 1) >gi|16415073|emb|CAC97778.1| tpi [Listeria innocua] >gi|46881902|gb|AAT05196.1| triosephosphate isomerase [Listeria monocytogenes str. 4b F2365] >gi|47017444|gb|EAL08260.1| triosephosphate isomerase [Listeria monocytogenes str. 4b H7858] (251 aa)
Score = 218, Expect = 5.2e-16, Identities = 65/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN       +F +    N+P+ + V+ +VA   L +   + +++   + V AQN  F   G  TG +S   L D G+    +GH + +  F E +  +N K   + K+GM  ++   ET        T   +R QI     G+    ++  V I Y+P +    G+ ++  D NE    T  VIR  +        A+ + I YGG +  ++I +    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLRVAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSV-IAYEPIWAIGTGKSSTSADANE----TCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALV 233
>gi|196162925|ref|ZP_03123456.1| triosephosphate isomerase [Clostridium difficile QCD-23m63] (247 aa)
Score = 218, Expect = 5.3e-16, Identities = 65/244 (26%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP---NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+       +F   +    N + V+ ++   +  +      +K   +++ AQN+ F   G  TG VS L LK+  +    +GH + +  F E +  VN K+ K L+ G++ +L + ET        TK+  R+Q+ +    +   D+  +V + Y+P +          E     I  IRE ++  +G  +AN + I YGG +   ++ EI   +D+DG L+      SN Y+ ++
  S:     1 MRKPIIAGNWKMHKTIKEALEFVNEVKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKIGAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGIDPILCVGETLEQREAGKTKDVCRVQVEKALENVLKDDLA-KVVVAYEPIWAIGTGKTATAEDANDVISYIREVIKGLYG-ELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASNDYLDLV 245
>gi|116617369|ref|YP_817740.1| triosephosphate isomerase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096216|gb|ABJ61367.1| triosephosphate isomerase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (269 aa)
Score = 218, Expect = 5.3e-16, Identities = 61/243 (25%), Positives = 117/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFM---GEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R   ++ NWK+N  +  +++F   +    P    V+  +A   L +   +  +  + + +VA+NV +   G +TG  S   LKD G K   +GH + +  F E +  VN K+   L+NG+  ++ ++E     ++    E    Q+     G+ ++D +  V + Y+PT+    GE  S    +       +IR+ L   +   +A  + +LYGG +  D+  EI    D+DG+L+        K++ ++
  S:     8 RIPFVVANWKINKLHADVAEFLDKVNGKVPAENVVETGIAAQDLFLSDMVRATAQSPIHIVAENVHWEDSGAYTGETSPKALKDIGAKYVLIGHFERRKFFNETDSTVNLKVTAALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGV-SVDQIRNVTLAYEPTWAIGSGEAASAVQAQ---KAAHLIRQTLAKLYSPVIAEQVRVLYGGSVTPDNAREIMLQKDIDGVLVGTSALDPEKFLQLV 253
>gi|163789790|ref|ZP_02184227.1| triosephosphate isomerase [Carnobacterium sp. AT7] >gi|159875012|gb|EDP69079.1| triosephosphate isomerase [Carnobacterium sp. AT7] (251 aa)
Score = 218, Expect = 5.5e-16, Identities = 64/244 (26%), Positives = 114/244 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN      + F +     IP+ E V  +V    L +   +  S+  ++++ AQN  F + G  TG +S + L D G+    +GH + +  F E N ++N K   + KNGM  ++   ET        T E +  Q+     G+    + + V I Y+P +         ++    T  VIR+ +  +     A+ + I YGG +  ++I E    +D+DG L+      +  ++++L
  S:     1 MRKPIIAGNWKMNKTAAEAAAFVEAVKTKIPSSEQVDSVVGAPALFLQSLVKASEGTELKIAAQNSHFEASGAFTGEISPVALGDLGVDYVIIGHSERREFFHETNEEINKKAHAIFKNGMVPIICCGETLEQREAGETNEWVSGQVKAAIAGLTDGQVAESV-IAYEPIWAIGTGKSSTSKDANDTCAVIRQTIAKEVSQDAADAVRIQYGGSVKPENIAEYMAESDIDGALVGGASLEAESFLALL 247
>gi|160872644|ref|ZP_02062776.1| triose-phosphate isomerase [Rickettsiella grylli] >gi|159121443|gb|EDP46781.1| triose-phosphate isomerase [Rickettsiella grylli] (257 aa)
Score = 218, Expect = 5.8e-16, Identities = 64/243 (26%), Positives = 120/243 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE-----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR + +I NWKMN    S++     + + E     NV ++V P Y+ +  +  M + + ++   QN++    G +TG +S L L ++G +   LGH + +  + E N Q+  K    + +G+  +L + ET  +     T+  L+ Q+ +I     A  ++ +  I Y+P +        + E      + I +FLR +       +A  LPILYGG +   +   + +  D+DG LI      +++++SI
  S:     1 MRGQYIIGNWKMNGCKTSVTSLLNALRDVEKKEQSNVTMVVCPPYIFLDKTQKMLEKSPLQWGGQNMAAEPEGPYTGEISGLMLYEFGCRYVLLGHSERRQHYAETNDQIAKKFNLAVNSGLTPILCVGETLAERQANQTQVVLQTQLEKII--AHASPLLPQAIIAYEPVWAIGTGVSAEPE----QAQEIHQFLRDQIRMVDSDLAQILPILYGGSVKISNANALFQMPDIDGGLIGGASLDASEFLSI 245
>gi|169190776|ref|ZP_02850684.1| Triose-phosphate isomerase [Paenibacillus sp. JDR-2] >gi|169002597|gb|EDS49479.1| Triose-phosphate isomerase [Paenibacillus sp. JDR-2] (251 aa)
Score = 217, Expect = 6.2e-16, Identities = 65/243 (26%), Positives = 112/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R  I+  NWKM         FF  +     V     V+ AP Y  +   +  +K   + + AQN+ F   G  TG +S + LKD G+K   +GH + +  F E +  VN K+    K+G+  ++ + E   +     TK+  ++Q    F G+ A    + V I Y+P +    G+ ++  D + + G IR +   L   +    A  + I YGG +  +++ E     D+DG L+         YI+++
  S:     3 RTPIIAGNWKMFKTVSEAVSFFSEVKGKAEVAGVESVICAP-YTTLPALVEAAKGTSIAIGAQNLHFEDNGAFTGEISGVMLKDLGVKYVIIGHSERRAYFAETDEIVNKKMHSAFKHGITPIVCVGEKLEEREANQTKDVCKVQTEAAFEGLSAAQAAE-VVIAYEPIWAIGTGKSSTSEDAQDVIGYIRSVVADL---YDAATAEAVRIQYGGSVKPNNVAEYMGQADIDGALVGGASLEPASYIALV 247
>gi|42526745|ref|NP_971843.1| triosephosphate isomerase [Treponema denticola ATCC 35405] >gi|81700190|sp|Q73NB9|TPIS_TREDE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|41817060|gb|AAS11754.1| triosephosphate isomerase [Treponema denticola ATCC 35405] (250 aa)
Score = 217, Expect = 7.0e-16, Identities = 66/230 (28%), Positives = 117/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M++  +  NWKMN +     +        + + +N K M+APS+  +     + K + + + AQN+     G HTG VS L+L D G++   LGH + +  +KE +  +N K++  LK+G+  +L + E   +      +     QI +    + A D+ D+V I Y+P +    G+  S  D + I  +   IR+ L   +G   A N+ I YGG +  ++   + K +++DG LI
  S:     1 MKKFYIAANWKMNMNRAEAKQLATEMKAGLKDGKN-KYMIAPSFTLLQDVASVLKGSNILLGAQNMGLEEKGAHTGEVSVLQLLDVGVQAVILGHSERRHIYKETDDLINKKVKLALKHGLEVILCVGELLEEREAGHAEAVCERQIKKGLAEVSAKDL-DKVTIAYEPVWAIGTGKNASPEDADAIHSS---IRKTLAALYGEKAAKNMIIQYGGSMKPENAAGLLKKHNIDGGLI 232
>gi|153175709|ref|ZP_01931013.1| triosephosphate isomerase [Listeria monocytogenes FSL N3-165] >gi|153180555|ref|ZP_01933598.1| triosephosphate isomerase [Listeria monocytogenes F6900] >gi|153184965|ref|ZP_01935613.1| triosephosphate isomerase [Listeria monocytogenes J0161] >gi|153192117|ref|ZP_01939162.1| triosephosphate isomerase [Listeria monocytogenes J2818] >gi|153197237|ref|ZP_01941507.1| triosephosphate isomerase [Listeria monocytogenes 10403S] >gi|126942477|gb|EBA20216.1| triosephosphate isomerase [Listeria monocytogenes J0161] >gi|127633288|gb|EBA22705.1| triosephosphate isomerase [Listeria monocytogenes 10403S] >gi|127764445|gb|EBA24977.1| triosephosphate isomerase [Listeria monocytogenes J2818] >gi|133729134|gb|EBA30832.1| triosephosphate isomerase [Listeria monocytogenes FSL N3-165] >gi|133731948|gb|EBA33646.1| triosephosphate isomerase [Listeria monocytogenes F6900] (255 aa)
Score = 217, Expect = 7.9e-16, Identities = 65/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN       +F +    N+P+ + V+ +VA   L +   + +++   + V AQN  F   G  TG +S   L D G+    +GH + +  F E +  +N K   + K+GM  ++   ET        T   +R QI     G+    ++  V I Y+P +    G+ ++  D NE    T  VIR  +        A+ + I YGG +  ++I +    +D+DG L+
  S:     5 MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSV-IAYEPIWAIGTGKSSTSADANE----TCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALV 237
>gi|47097454|ref|ZP_00234999.1| triosephosphate isomerase [Listeria monocytogenes str. 1/2a F6854] >gi|116873821|ref|YP_850602.1| triosephosphate isomerase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|167405287|ref|ZP_02310046.1| triosephosphate isomerase [Listeria monocytogenes FSL J2-003] >gi|47014168|gb|EAL05156.1| triosephosphate isomerase [Listeria monocytogenes str. 1/2a F6854] >gi|116742699|emb|CAK21823.1| tpi [Listeria welshimeri serovar 6b str. SLCC5334] (251 aa)
Score = 217, Expect = 7.9e-16, Identities = 65/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN       +F +    N+P+ + V+ +VA   L +   + +++   + V AQN  F   G  TG +S   L D G+    +GH + +  F E +  +N K   + K+GM  ++   ET        T   +R QI     G+    ++  V I Y+P +    G+ ++  D NE    T  VIR  +        A+ + I YGG +  ++I +    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSV-IAYEPIWAIGTGKSSTSADANE----TCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALV 233
>gi|118443388|ref|YP_877494.1| triosephosphate isomerase [Clostridium novyi NT] >gi|171460884|sp|A0PYP2|TPIS_CLONN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|118133844|gb|ABK60888.1| triosephosphate isomerase [Clostridium novyi NT] (250 aa)
Score = 216, Expect = 8.8e-16, Identities = 66/230 (28%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE------NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    +IS+  K +   +      N  V+V P  L +   +  ++   ++V AQN+ F   G  TG  +   L++ G+K   LGH + +  F E +  +N K++K  ++ +  +L I ET  +   + T+E L  QI     G+    I + V I Y+P +         ++    TI  +R+ +   FG   A  + I YGG +    I+E     ++DG LI
  S:     1 MRKAIIAGNWKMNN---TISQGLKLVEELKPLVADANCDVVVCPPTLALDAVVKATEGTNIKVGAQNMHFEESGAFTGETAPAMLEELGVKYVILGHSERRQYFGENDADLNKKMKKAFEHNLTPILCIGETLEEREADVTEEVLAKQIKLDLAGLTEAQIAETV-IAYEPIWAIGTGKTATSDQAEETIAFVRKTVAGMFGAEAAEKMRIQYGGSVKPATIKEQMAKPNIDGGLI 232
>gi|78187323|ref|YP_375366.1| triosephosphate isomerase [Pelodictyon luteolum DSM 273] >gi|123730029|sp|Q3B2V8|TPIS_PELLD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|78167225|gb|ABB24323.1| triosephosphate isomerase [Pelodictyon luteolum DSM 273] (250 aa)
Score = 216, Expect = 9.1e-16, Identities = 64/230 (27%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR KI++ NWKMN      +     +           +  +AP+Y  +       + + + +VAQN  +   G +TG VS   LK  G     +GH + +  F E +  VN +++K+L +GM  +L + ET  +  E  T   +  Q+ +   G+   DI D V I Y+P +         ++      R+IR+ ++  +G  V+  + I YGG +   + EE+    D+DG LI
  S:     1 MRRKIVVGNWKMNKTVAESTALATAVIAALGDGCSACEAGIAPTYPALDAVGRALEGSGIALVAQNCHYEDDGAYTGEVSTGMLKAVGCSYVIIGHSERRQYFGETDETVNLRIKKVLASGMKVILCVGETLAEREEGVTGTVVSRQVTEGLKGV--ADITDLV-IAYEPVWAIGTGKTASSDQAQEVHRLIRDTVKGMYGAEVSEAVRIQYGGSVKASNAEELFAMPDIDGGLI 232
>gi|16804495|ref|NP_465980.1| hypothetical protein lmo2457 [Listeria monocytogenes EGD-e] >gi|167213116|ref|ZP_02283423.1| hypothetical protein LmonL_22044 [Listeria monocytogenes LO28] >gi|20140603|sp|Q8Y4I3|TPIS1_LISMO Triosephosphate isomerase 1 (TIM 1) (Triose-phosphate isomerase 1) >gi|16411945|emb|CAD00535.1| tpi [Listeria monocytogenes] (251 aa)
Score = 216, Expect = 9.2e-16, Identities = 65/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN       +F +    N+P+ + V+ +VA   L +   + +++   + V AQN  F   G  TG +S   L D G+    +GH + +  F E +  +N K   + K+GM  ++   ET        T   +R QI     G+    ++  V I Y+P +    G+ ++  D NE    T  VIR  +        A+ + I YGG +  ++I +    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTDLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSV-IAYEPIWAIGTGKSSTSADANE----TCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALV 233
>gi|167461757|ref|ZP_02326846.1| triose-phosphate isomerase [Paenibacillus larvae subsp. larvae BRL-230010] (250 aa)
Score = 216, Expect = 9.6e-16, Identities = 62/244 (25%), Positives = 110/244 (45%)
  Q:     1 MREKILITNWKM---NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM    ++ V  +   K       V  +V   +  +   +   K   ++V AQN+ F   G +TG +S + LKD G++   +GH + +  F E +  VN K+    K+ +  ++ + E   +     TKE  ++Q    F G+ A +   +V I Y+P +          E     I  IR  + + +   VA+ + I YGG +   ++ E    +D+DG L+         YI ++
  S:     1 MRKPIIAGNWKMFKTVSEAVEFANAVKGKAEMNGVDSVVCAPFTNLPALVETFKGTSIKVGAQNMHFEDNGAYTGEISGIMLKDLGVEYVIIGHSERRAYFAETDETVNKKVHAAFKHRLTPIVCVGEKLEEREAGQTKEVCKVQTEAAFQGLSA-EQAKQVVIAYEPIWAIGTGKSSTAEDANEVISYIRGLVSSLYDKSVADEVRIQYGGSVKPGNVREYMGQSDIDGALVGGASLEPASYIQLV 246
>gi|194015648|ref|ZP_03054264.1| triose-phosphate isomerase [Bacillus pumilus ATCC 7061] >gi|194013052|gb|EDW22618.1| triose-phosphate isomerase [Bacillus pumilus ATCC 7061] (253 aa)
Score = 216, Expect = 9.9e-16, Identities = 67/244 (27%), Positives = 122/244 (50%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN    + VS  +  K+ IP+ + V+ +V    L +     +S    +++ AQN+ F   G  TG +S   LKD GI  + +GH + +  F E +  VN K     K+G+  ++ + ET  +     T E +  Q+ +   G+    + + V I Y+P +    G+ ++  D   +      IR+ + +++G   A++L I YGG +   +I+E    +D+DG L+         ++ +L
  S:     1 MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPSPDKVESIVCAPALFLEKLNSLSNGTDLKIGAQNMHFEENGAFTGEISPAALKDLGIGYSVIGHSERREFFAETDETVNKKAHAAFKHGIVPIICVGETLEEREAGKTNELVADQVKKALAGLTTQQVAESV-IAYEPIWAIGTGKSSTAKDANDVCAH---IRQTVASEYGQEAADSLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLL 247
>gi|126700792|ref|YP_001089689.1| triosephosphate isomerase [Clostridium difficile 630] >gi|115252229|emb|CAJ70069.1| triosephosphate isomerase [Clostridium difficile 630] (247 aa)
Score = 216, Expect = 1.0e-15, Identities = 65/244 (26%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP---NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+       +F   I    N + V+ ++   +  +      +K   +++ AQN+ F   G  TG VS L LK+  +    +GH + +  F E +  VN K+ K L+ G++ +L + ET        TK+  ++Q+ +    +   D+  +V + Y+P +          E     I  IRE ++  +G  +AN + I YGG +   ++ EI   +D+DG L+      SN Y+ ++
  S:     1 MRKPIIAGNWKMHKTIKEALEFVNEIKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKIGAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGIDPILCVGETLEQREAGKTKDVCKVQVEKALENVLKDDLA-KVVVAYEPIWAIGTGKTATAEDANDVISYIREVIKGLYG-ELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASNDYLDLV 245
>gi|168185507|ref|ZP_02620142.1| triose-phosphate isomerase [Clostridium botulinum C str. Eklund] >gi|169296386|gb|EDS78519.1| triose-phosphate isomerase [Clostridium botulinum C str. Eklund] (250 aa)
Score = 215, Expect = 1.1e-15, Identities = 66/230 (28%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE------NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    +IS+  K +   +      N  V+V P  L +   +  ++   ++V AQN+ F   G  TG ++   L++ G+K   LGH + +  F E +  +N K++K  ++ +  +L I ET  +   + T+E L  QI     G+    I + V I Y+P +         ++    TI  +R+ +   FG   A  + I YGG +    I+E     ++DG LI
  S:     1 MRKAIIAGNWKMNN---TISQGLKLVEELKPLVAGANSDVVVCPPTLALDAVVKATEGTNIKVGAQNMHFEESGAFTGEIAPAMLEELGVKYVILGHSERRQYFGENDADLNKKMKKAFEHNLTPILCIGETLEEREADVTEEVLAKQIKLDLAGLTKEQIAETV-IAYEPIWAIGTGKTATSDQAEETIAFVRKTVAGMFGAEAAEKMRIQYGGSVKPATIKEQMAKPNIDGGLI 232
>gi|167759059|ref|ZP_02431186.1| hypothetical protein CLOSCI_01406 [Clostridium scindens ATCC 35704] >gi|167663466|gb|EDS07596.1| hypothetical protein CLOSCI_01406 [Clostridium scindens ATCC 35704] (257 aa)
Score = 215, Expect = 1.2e-15, Identities = 65/229 (28%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R KI+  NWKMN   ++ V++ +  K +   E+V V+     + I+P +   K   ++V A+N+ F   G +TG +S   L D GIK   LGH + +  F E N  VN K+ K  ++G+  ++   ET     +  T + +R Q+   F G+ A D      I Y+P +          E        IR  +   +    A  + I YGG +   +  E+    D+DG L+
  S:    11 RRKIVAGNWKMNKTPSEAVALVEELKPLVASEDVDVVFCVPAIDIIPVVEACKGTNIQVGAENMYFEESGAYTGEISPAMLTDAGIKYVVLGHSERREYFAETNETVNKKMLKAFEHGITPIMCCGETLEQREQGVTMDFIRQQVKVGFMGVTA-DQAKASVIAYEPIWAIGTGKTATTEQAEEVCAGIRACIAEIYDEATAEAIRIQYGGSVNAGNAAELFAQADIDGGLV 241
>gi|125624235|ref|YP_001032718.1| triosephosphate isomerase [Lactococcus lactis subsp. cremoris MG1363] >gi|160187461|sp|A2RL40|TPIS_LACLM Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|537286|gb|AAC43268.1| triosephosphate isomerase [Lactococcus lactis subsp. lactis] >gi|124493043|emb|CAL98006.1| TpiA protein [Lactococcus lactis subsp. cremoris MG1363] (252 aa)
Score = 215, Expect = 1.2e-15, Identities = 61/243 (25%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN        F +    N+P+ +NV+ ++    L + P   + + +++++ A+N  F + G  TG  S   + D GI+   +GH + +  F E +  +N K + +   G   +L   ET        T E +  QI     G+ A + V  + I Y+P +         NE    T  V+R  +   +G  V+  + I YGG +  + IE +    ++DG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSELKLAAENSYFENAGAFTGENSPAAIVDLGIEYIIIGHSERREYFHETDEDINKKAKAIFAAGATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLTA-EQVSNLVIAYEPIWAIGTGKTATNEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLEADSFLALL 248
>gi|85712949|ref|ZP_01043989.1| Triosephosphate isomerase [Idiomarina baltica OS145] >gi|85693255|gb|EAQ31213.1| Triosephosphate isomerase [Idiomarina baltica OS145] (252 aa)
Score = 215, Expect = 1.2e-15, Identities = 66/226 (29%), Positives = 113/226 (50%)
  Q:     5 ILITNWKMNADYV---SISKFFK-NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVAN------NLPILYGGEIINDDIEEICKNNDVDGILI 230
           ++I NWKMN +     ++S+  + N  +F+ V V++ P Y  +    G      V + AQNVS    G HTG VS   L++ G++   LGH + + +  E +  V AK   + + G+ AV+ + E K     ++T   ++ Q+ +   G+ A  +  RV + Y+P +    GE  S    + +   IR          G+ V N        P+LYGG +  ++ E +    D++G LI
  S:     6 LVIANWKMNGNRALTRNMSEVLRDNQADFKGVNVVICPPYTLLSEMAGHIYYDDVALGAQNVSEYESGAHTGEVSVAMLQELGVEYVLLGHSERRAEQHESDQLVAAKAATVTQAGLTAVICVGEDKAQREADNTWSVIQAQLEKSLAGLSAKQMA-RVVVAYEPIWAIGTGETASPAQAQEVHAKIR----------GWLVENYQQVGAKTPLLYGGSVKANNAESLFSEADINGGLI 233
>gi|154495834|ref|ZP_02034530.1| hypothetical protein BACCAP_00114 [Bacteroides capillosus ATCC 29799] >gi|150275032|gb|EDN02080.1| hypothetical protein BACCAP_00114 [Bacteroides capillosus ATCC 29799] (257 aa)
Score = 215, Expect = 1.4e-15, Identities = 64/229 (27%), Positives = 109/229 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI------PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKMN        F ++I      P +  V V+  P Y+ I  ++ + K+ ++ + A+N  + S G +TG VS   LK+ G+K   +GH + +  + E ++ VN K+   L+ G+  ++ + E+        T E +  Q+     G+ A D +  V I Y+P +          E        IR  +R  +G  VA  + I YGG +   +  E+    D+DG LI
  S:     6 RKTIIAGNWKMNKTLTETKAFAEDIKTKLGKPKWCEV-VLCVP-YVNIPAAVRLFKDCRIAIGAENCHYESHGAYTGEVSAEMLKELGVKYVIIGHSERRQYYNETDFTVNKKVHAALEAGLYPIVCVGESLEQRELGVTMELIAYQVKAALAGVPA-DKMRHVVIAYEPIWAIGTGKTATAEQAAEVCESIRVVIRKLYGARVARAVTIQYGGSMNAKNAAELLAQPDIDGGLI 237
>gi|168714210|ref|ZP_02746487.1| triosephosphate isomerase [Clostridium difficile QCD-63q42] >gi|196127535|ref|ZP_03119284.1| triosephosphate isomerase [Clostridium difficile ATCC 43255] (247 aa)
Score = 215, Expect = 1.4e-15, Identities = 64/244 (26%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP---NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+       +F   +    N + V+ ++   +  +      +K   +++ AQN+ F   G  TG VS L LK+  +    +GH + +  F E +  VN K+ K L+ G++ +L + ET        TK+  ++Q+ +    +   D+  +V + Y+P +          E     I  IRE ++  +G  +AN + I YGG +   ++ EI   +D+DG L+      SN Y+ ++
  S:     1 MRKPIIAGNWKMHKTIKEALEFVNEVKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKIGAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGIDPILCVGETLEQREAGKTKDVCKVQVEKALENVLKDDLA-KVVVAYEPIWAIGTGKTATAEDANDVISYIREVIKGLYG-ELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASNDYLDLV 245
>gi|15673116|ref|NP_267290.1| triosephosphate isomerase [Lactococcus lactis subsp. lactis Il1403] >gi|13878937|sp|P50918|TPIS_LACLA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|12724096|gb|AAK05232.1|AE006346_1 triosephosphate isomerase (EC 5.3.1.1) [Lactococcus lactis subsp. lactis Il1403] (252 aa)
Score = 214, Expect = 1.4e-15, Identities = 60/243 (24%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN        F +    N+P+ +NV+ ++    L + P   + + +++++ A+N  F + G  TG  S   + D G++   +GH + +  F E +  +N K + +   G   +L   ET        T E +  QI     G+ A + V  + I Y+P +         NE    T  V+R  +   +G  V+  + I YGG +  + IE +    ++DG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSELKLAAENSYFENAGAFTGENSPAAIVDLGVEYIIIGHSERREYFHETDEDINKKAKAIFAAGATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLSA-EQVSNLVIAYEPIWAIGTGKTATNEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLEADSFLALL 248
>gi|145953669|ref|ZP_01802677.1| hypothetical protein CdifQ_04003673 [Clostridium difficile QCD-32g58] >gi|168697729|ref|ZP_02730006.1| triosephosphate isomerase [Clostridium difficile QCD-37x79] >gi|168725747|ref|ZP_02758024.1| triosephosphate isomerase [Clostridium difficile QCD-76w55] >gi|168731905|ref|ZP_02764182.1| triosephosphate isomerase [Clostridium difficile QCD-97b34] >gi|196161332|ref|ZP_03121893.1| triosephosphate isomerase [Clostridium difficile CIP 107932] (247 aa)
Score = 214, Expect = 1.6e-15, Identities = 64/244 (26%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP---NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+       +F   +    N + V+ ++   +  +      +K   +++ AQN+ F   G  TG VS L LK+  +    +GH + +  F E +  VN K+ K L+ G++ +L + ET        TK+  ++Q+ +    +   D + +V + Y+P +          E     I  IRE ++  +G  +AN + I YGG +   ++ EI   +D+DG L+      SN Y+ ++
  S:     1 MRKPIIAGNWKMHKTIKEALEFVNEVKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKIGAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGIDPILCVGETLEQREAGKTKDVCKVQVEKALENV-LKDDLSKVVVAYEPIWAIGTGKTATAEDANDVISYIREVIKGLYG-ELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASNDYLDLV 245
>gi|29841157|gb|AAP06170.1| similar to GenBank Accession Number L07286 triosephosphate isomerase [Schistosoma japonicum] (252 aa)
Score = 214, Expect = 1.7e-15, Identities = 64/222 (28%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN       K  K +      +N +V++AP  +  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRDDNDKLLKLLSEAHFDDNTEVLIAPPSV-FLHEIRKSLKKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAEGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|184154841|ref|YP_001843181.1| triosephosphate isomerase [Lactobacillus fermentum IFO 3956] >gi|183226185|dbj|BAG26701.1| triosephosphate isomerase [Lactobacillus fermentum IFO 3956] (255 aa)
Score = 214, Expect = 1.7e-15, Identities = 63/230 (27%), Positives = 121/230 (52%)
  Q:     1 MREKILITNWKM------NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ +++ NWKM        DYV   K    +P+ E  +V +A   L +   +  ++   +++VA+N  +   G  TG  S L L++ GIK   +GH + +  F E +  +N K+   L  G+  +L ++ET   +  +   + +   ++Q+ +G+  +    + RV I Y+P++ +G  N     +       +IR+ +   +   VAN + ILYGG +   +I+ + + +D+DG+LI
  S:     1 MRKPLIVGNWKMYKTITEAVDYVDQIK--DALPDPEQEEVELAVPTLFLESLVEHTRGTNLKIVAENCFYQDEGAFTGETSPLALRELGIKHVIIGHSERRRLFYEDDATINKKVHAALSAGICPILCVDET---MKRKQEHDRIVWVVSQVISGLQGVKESELSRVTIAYEPSWAIGSGNEAATPQEANEGCYLIRQTIAHLYNDEVANQVRILYGGSVNLSNIKTLMQKDDIDGVLI 234
>gi|116511980|ref|YP_809196.1| triosephosphate isomerase [Lactococcus lactis subsp. cremoris SK11] >gi|123125590|sp|Q02Z48|TPIS_LACLS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116107634|gb|ABJ72774.1| triosephosphate isomerase [Lactococcus lactis subsp. cremoris SK11] (252 aa)
Score = 214, Expect = 1.7e-15, Identities = 60/243 (24%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN        F +    N+P+ +NV+ ++    L + P   + + +++++ A+N  F + G  TG  S   + D G++   +GH + +  F E +  +N K + +   G   +L   ET        T E +  QI     G+ A + V  + I Y+P +         NE    T  V+R  +   +G  V+  + I YGG +  + IE +    ++DG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSELKLAAENSYFENAGAFTGENSPAAIVDLGVEYIIIGHSERREYFHETDEDINKKAKAIFAAGATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLTA-EQVSNLVIAYEPIWAIGTGKTATNEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLEADSFLALL 248
>gi|78188475|ref|YP_378813.1| triosephosphate isomerase [Chlorobium chlorochromatii CaD3] >gi|123580290|sp|Q3ATA5|TPIS_CHLCH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|78170674|gb|ABB27770.1| triosephosphate isomerase [Chlorobium chlorochromatii CaD3] (252 aa)
Score = 214, Expect = 1.8e-15, Identities = 64/244 (26%), Positives = 121/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+KI++ NWKMN    +  +   ++      +F    V +AP++L +  +  +   + +++VAQN  + + G +TG VS   LK  G  +  +GH + +  F E N  VN +++K L  G++ +L + ET   L+E  +     +   Q+  G+  +  +  V I Y+P +    G+  +    E +     +IR  +   +G   A  L I YGG +   +  E+    ++DG LI      +  +++I+
  S:     1 MRKKIVVGNWKMNNGVAASEQLAADLLAALGSSFTGCDVGIAPTFLSLTTAGKVIAGSTIQLVAQNCHYENDGAYTGEVSAAMLKGAGCSSVIIGHSERRQFFGETNATVNLRVKKALAEGLDVILCVGET---LAERESGVTGDIVSAQVREGLVGVSDISNVVIAYEPVWAIGTGKTATSAQAEEVH---LMIRTLVTELYGEPAAQALRIQYGGSVKPSNAVELFAMPNIDGGLIGGASLNAADFVAIV 246
>gi|13357739|ref|NP_078013.1| triosephosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761975|ref|YP_001752263.1| triosephosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920153|ref|ZP_02931553.1| triosephosphate isomerase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508723|ref|ZP_02958206.1| triosephosphate isomerase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701905|ref|ZP_02971557.1| triosephosphate isomerase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189036029|sp|B1AIG9|TPIS_UREP2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|39932453|sp|Q9PQW2|TPIS_UREPA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|11270436|pir||H82924 triosephosphate isomerase UU181 [imported] - Ureaplasma urealyticum >gi|6899144|gb|AAF30588.1|AE002117_12 triosephosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827552|gb|ACA32814.1| triosephosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902523|gb|EDT48812.1| triosephosphate isomerase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675649|gb|EDT87554.1| triosephosphate isomerase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700640|gb|EDU18922.1| triosephosphate isomerase [Ureaplasma parvum serovar 6 str. ATCC 27818] (238 aa)
Score = 213, Expect = 2.0e-15, Identities = 69/243 (28%), Positives = 126/243 (51%)
  Q:     4 KILITNWKMNADYVSISKFFKNIPNFENVKVMV--APSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           K +I N+KMNA    I+ F  N+  F+  K+++  AP  L +   + +++  KV + AQN S  + G +TG +S L+L D  IK A +GH ++++DF +    ++ K++  +      ++ + ET          ++L   +NQ+ N I+   +  ++ I Y+P +    + + D + I   I  I+ +L    G     N+PILYGG + +++I E+C    +DG LI +     N +  I+ K
  S:     2 KYIIANFKMNATQELINHFLNNLTLFDEQKIIIGLAPGDLYLKTFVNLAEIKKVNLYAQNPSLHNKGPYTGQISCLQLLDINIKNALVGHSEIRIDFSQS--IIDQKIKISMDLLEQVIICVGET---FDAYKQNKSLNFVLNQLANIINYKGL-KKIIIAYEPIWAIGTDLELDFKHINYMIEGIKTYLYNCTGI----NIPILYGGSVNDNNINELCNQKLIDGFLIGNASLDVNVFNKIIDK 236
>gi|118725215|ref|ZP_01573858.1| Phosphoglycerate kinase., Triose-phosphate isomerase [Clostridium cellulolyticum H10] >gi|118665447|gb|EAV72066.1| Phosphoglycerate kinase., Triose-phosphate isomerase [Clostridium cellulolyticum H10] (646 aa)
Score = 213, Expect = 2.2e-15, Identities = 63/229 (27%), Positives = 107/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI-PNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I   NWKMN       +F   + P   + K  V+V   ++ +   +  +K + ++V AQN+ +   G  TG VS   L D G+    +GH + +  F E N  +N K   + K GM  ++   ET     +  T +++R QI      + A + V ++ I Y+P +         NE       +IRE +   +G  VA ++ I YGG +   +  E+   +D+DG L+
  S:   400 RKVIAAGNWKMNKTASEAVEFVNALKPAVADAKNEVVVGVPFVCLPGVVAAAKGSNIKVAAQNMHWEEKGAFTGEVSGPMLADLGVDYVIIGHSERREYFGETNEMINKKAHAIFKYGMTPIICCGETLTQREQGVTADHIRYQIKVALLDLTA-EQVSKLVIAYEPIWAIGTGKTATNEQANEVCTIIRELVAELYGSEVAEHVRIQYGGSVNAKNATELFAMSDIDGGLV 630
>gi|116333310|ref|YP_794837.1| triosephosphate isomerase [Lactobacillus brevis ATCC 367] >gi|122270002|sp|Q03SL6|TPIS_LACBA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116098657|gb|ABJ63806.1| triosephosphate isomerase [Lactobacillus brevis ATCC 367] (252 aa)
Score = 213, Expect = 2.2e-15, Identities = 61/229 (26%), Positives = 112/229 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQI---FNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGIL 229
           MR  ++  NWKMN       +F       +P  + ++  VA   L +   L  +    + V A+   +   G +TG  S   L + GI    +GH + +  F E +  +N K+Q + +NGM  +L  +ET   +   +  E +   +NQ+     G+ A D   ++ + Y+P++ +G   S   ++   G   +IR+ L   +   +AN + +LYGG +  D+I  +   ++VDG+L
  S:     1 MRIPLIAGNWKMNKSVTEARQFIDAVQGQLPQADVIETAVAAPALFLQTMLDANAEGTLRVAAETCYYEDEGAYTGETSPRALHEMGIPYTIVGHSERRRYFNETDDVINRKVQAVFRNGMTPILCCDET---MGRRTAGEKIHWVVNQVSAALKGVSAEDAA-KIVVAYEPSWAIGSGTSASSDQAEEGCY-LIRQTLADIYSDDLANGVRVLYGGSVKPDNIAGLMAKSNVDGVL 232
>gi|149178678|ref|ZP_01857262.1| triosephosphate isomerase [Planctomyces maris DSM 8797] >gi|148842453|gb|EDL56832.1| triosephosphate isomerase [Planctomyces maris DSM 8797] (257 aa)
Score = 212, Expect = 2.8e-15, Identities = 65/244 (26%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFEN--VKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  ++  NWKMN    S ++  +     +P+ EN  V+V+V P +  +     +   + V   AQN    + G  TG  S   L D G ++  LGH + +   KE +  +N K++K L+ G+  VL + E + +   + T+  L  Q+    +G+DA     ++ I Y+P +          E        +R +L+ ++   +A++  ILYGG +  D+ +E+    +VDG L+      +  +I I+
  S:     1 MRRFLVAGNWKMNTTKESGAQLAQALASEVPS-ENPAVEVLVCPPFPYLTTIGEIVSGSGVGFGAQNCYHEAPGAFTGETSTEMLTDVGCRSVILGHSERRHVLKETDTDINLKVKKALEAGLQVVLCVGELQSERESDQTETVLNTQMTGGLSGVDA-SAFGQIVIAYEPVWAIGTGLTASPEQAEAAHLYLRNWLKDQYSAEIADSTRILYGGSVKPDNAKELLSQENVDGALVGGASLKAELFIPII 248
>gi|148324527|gb|EDK89777.1| triose-phosphate isomerase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (251 aa)
Score = 212, Expect = 2.8e-15, Identities = 66/244 (27%), Positives = 123/244 (50%)
  Q:     1 MREKILITNWKM---NADYVSISKFFKNI-PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSL-GNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  ++  NWKM   N + V      K++  + +NV +++   +  +  ++   + + V++ A+NV +P + G +TG +S   LKD G+    LGH + +  FKE +  +N K++ +L+ GM  +L I E    L E    + L +   QI  G+  L  +  ++V I Y+P +          E    T + +R  L   FG  VA+ + I YGG +  ++ +++    D+DG L+      ++ +  I+
  S:     1 MRRLVIAGNWKMYKNNKEAVETLTQLKDLTKDIKNVDIVIGAPFTCLSDAVKAVEGSNVKIAAENV-YPKIEGAYTGEISPKMLKDIGVTYVILGHSERREYFKESDEFINQKVKAVLEIGMKPILCIGEK---LEEREGGKTLEVLTTQIKGGLAGLSKEEAEKVIIAYEPVWAIGTGKTATPEMAQETHKEVRNVLSEMFGKDVADKMIIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKADSFFEII 247
>gi|134298013|ref|YP_001111509.1| Triose-phosphate isomerase [Desulfotomaculum reducens MI-1] >gi|134050713|gb|ABO48684.1| triosephosphate isomerase [Desulfotomaculum reducens MI-1] (250 aa)
Score = 212, Expect = 2.8e-15, Identities = 62/244 (25%), Positives = 119/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFF---KNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I++ NWKM+       +F    K   +   V+V+V+P +  +  +  + K + + + AQN+ +   G  TG +S   LK+ G K   LGH + +  F E +  VN K++  L++ +  ++ + E+       +T+  +  QIN    G+   +    + I Y+P +    G+  S  D + + G    IR+ +  +FG  VA  + I YGG +   + + +    D+DG L+       + ++ I+
  S:     1 MRQLIIVGNWKMHKTVTETLEFLVELKEKLSNTAVEVVVSPPFTALAAAAEVLKGSPIALAAQNMHWKKQGAFTGEISSAMLKELGCKYVILGHSERRQYFSETDDHVNKKVKSALESELIPIVCVGESLEQRETGATEATVEKQINGALAGLSP-EQAAGIVIAYEPVWAIGTGKTASDEDAQQVNG---YIRKVIACRFGNTVAEAVRIQYGGSVKPANAQGLMAQPDIDGALVGGASLKMHDFVGII 246
>gi|89095218|ref|ZP_01168141.1| triosephosphate isomerase [Oceanospirillum sp. MED92] >gi|89080515|gb|EAR59764.1| triosephosphate isomerase [Oceanospirillum sp. MED92] (250 aa)
Score = 212, Expect = 3.0e-15, Identities = 75/243 (30%), Positives = 119/243 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFEN---VKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDI---VDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR   +  NWKMN +  SI++    + N  N   V+V+V P  + I     +++++K+ V AQNVS  + G  TG VS   L D G +   LGH + +  + E +  V AK    +++G+  +L + ET   L E    E L++   Q+   IDA  I    D V + Y+P +    G+  +    + +   IR   E  ++      A    ILYGG +   +  E+  N DVDG L+       N +I+I
  S:     1 MRTAFVAGNWKMNGNTDSINELMDGLVNSINSSSVEVLVCPPSVYISQVKSLTESSKISVGAQNVSENANGAFTGEVSLSMLNDLGCEYVILGHSERRSLYAETDQLVAAKFIAAVESGVKPILCVGET---LDERENGETLKVVSRQLNAVIDAAGIEKFADAV-VAYEPVWAIGTGKTATPEQAQEVHAAIRA--EIAKSDAA--TAEKTRILYGGSVNAANAAELFANADVDGGLVGGASLKVNDFIAI 244
>gi|157693807|ref|YP_001488269.1| triosephosphate isomerase [Bacillus pumilus SAFR-032] >gi|166988097|sp|A8FHJ2|TPIS_BACP2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|157682565|gb|ABV63709.1| triose-phosphate isomerase [Bacillus pumilus SAFR-032] (253 aa)
Score = 211, Expect = 3.2e-15, Identities = 65/244 (26%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN        F +    +IP  + V+ +V    L +     +S    +++ AQN+ F   G  TG +S   LKD GI  + +GH + +  F E +  VN K     K+G+  ++ + ET  +     T E +  Q+ +   G     + + V I Y+P +    G+ ++  D   +      IR+ + +++G   A++L I YGG +   +I+E    +D+DG L+         ++ +L
  S:     1 MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPYPDKVEAIVCAPALFLEKLNSLSNGTDLKIGAQNMHFEENGAFTGEISPAALKDLGIGYSVIGHSERREFFAETDETVNKKAHAAFKHGIVPIICVGETLEEREAGKTNELVADQVKKALAGFTTQQVAESV-IAYEPIWAIGTGKSSTAKDANDVCAH---IRQTVASEYGQEAADSLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLL 247
>gi|15893999|ref|NP_347348.1| triosephosphate isomerase [Clostridium acetobutylicum ATCC 824] >gi|8134739|sp|O52633|TPIS_CLOAB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|15023591|gb|AAK78688.1|AE007586_5 Triosephosphate isomerase [Clostridium acetobutylicum ATCC 824] >gi|2829140|gb|AAC13162.1| triosephosphate isomerase [Clostridium acetobutylicum] (248 aa)
Score = 211, Expect = 3.4e-15, Identities = 62/230 (26%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN   ++ + + +  K +      +V+VAP+ + +   +  +K + ++V AQN  F   G  TG +S   L++ G+    LGH + +  F E +  +N K++    + +  +L   ET  +     T E    QI     G+ A +   +V I Y+P +         +E    TI  IR+ +   FG  VA  + I YGG +  + I+      ++DG L+
  S:     1 MRTPIIAGNWKMNNTISESLKLIEELKPLVKDAKAEVVVAPTAVSLETVVNATKGSNIKVAAQNAHFEESGAFTGEISLKALEELGVSYVILGHSERRQYFNETDCALNKKVKAAFAHNITPILCCGETLEEREANVTNEVTGKQIKLDLAGLSA-EQAAKVVIAYEPIWAIGTGKTATDEQANETIGAIRKTVEVMFGKEVAEKVRIQYGGSVKPNTIKAQMAKPEIDGALV 232
>gi|160947583|ref|ZP_02094750.1| hypothetical protein PEPMIC_01518 [Peptostreptococcus micros ATCC 33270] >gi|158446717|gb|EDP23712.1| hypothetical protein PEPMIC_01518 [Peptostreptococcus micros ATCC 33270] (248 aa)
Score = 211, Expect = 3.4e-15, Identities = 68/230 (29%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++I NWKMN D     K  K I + +    V+ +V   ++ +     + + + V +  QN+ F + G  TG +S + LK  G+    LGH + +  F E +  +N K++  L+N +  +L   ET  + +    KE +  QI    + I   DI ++V I Y+P +    G   S  D E     I+ IRE L   +G  ++ N+ I YGG +  ++I+++ +  +VDG L+
  S:     1 MRKPVIIGNWKMNKDLDEAKKLVKEIVSEKLDNTVEKVVCVPFVYVTEVTKLLEGSDVGLGVQNMYFENKGAFTGEISPIMLKSCGVSYVILGHSERRTIFNETDEMINKKVKSALQNNLIPILCCGETLEERNLGIEKEVVEKQIRNTLDDISVNDI-EKVIIAYEPIWAIGTGLTASSDDAE---NMIKFIREILYDIYG-NLSENIRIQYGGSVKPNNIKDLMQKENVDGALV 231
>gi|154503932|ref|ZP_02040992.1| hypothetical protein RUMGNA_01758 [Ruminococcus gnavus ATCC 29149] >gi|153795531|gb|EDN77951.1| hypothetical protein RUMGNA_01758 [Ruminococcus gnavus ATCC 29149] (249 aa)
Score = 211, Expect = 3.5e-15, Identities = 65/229 (28%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN   ++ V++ +  K +   E V V+     + IVP +   K   ++V A+N+ F   G +TG +S   L D G+K   LGH + +  F E N  VN K+ K  ++G+  ++   ET     +  T + +R Q+   F  + A D      I Y+P +          E      + IRE +   +    A  + I YGG +      E+    D+DG L+
  S:     3 RKKIIAGNWKMNKTPSEAVALVEELKPLVANEEVDVVFCVPAIDIVPVVEAVKGTNIQVGAENMYFEESGAYTGEISPAMLVDAGVKYVVLGHSERRDYFGETNEDVNKKVLKAFEHGITPIMCCGETLEQREQGVTMDFIRQQVKVGFQNVTA-DQAKTAVIAYEPIWAIGTGKTATTEQAQEVCKGIRECIAEVYDEATAEAIRIQYGGSVNAATAPELFAQPDIDGGLV 233
>gi|150021144|ref|YP_001306498.1| Triose-phosphate isomerase [Thermosipho melanesiensis BI429] >gi|149793665|gb|ABR31113.1| Triose-phosphate isomerase [Thermosipho melanesiensis BI429] (240 aa)
Score = 211, Expect = 3.6e-15, Identities = 55/201 (27%), Positives = 105/201 (52%)
  Q:    30 ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           ++ +++VAP ++ I     + K++K++V AQN+ F   G  TG +SW  LKD G++   +GH + +  F E +  +N K+ K L+ G+  +  I E    L E  +     +   QI  G+  +  +++V I Y+P +    G++ +    + +    + IR+ +   +    A N+ ILYGG I  +++  +    D+DG L+
  S:    23 KDFEIIVAPPFISIPSVYEILKDSKIKVAAQNMYFEDEGAFTGEISWKMLKDVGVEYVIIGHSERRNIFNESDEMINKKVLKALEVGLKPIFCIGEK---LEERESSLTFAVIETQIRKGLKDVKDIEKVIIAYEPVWAIGTGKVATSHQAQEVH---KFIRKLISEMYSPEAAENIRILYGGSIKPNNLFNLIIQPDIDGGLV 220
>gi|126646360|ref|ZP_01718877.1| triosephosphate isomerase [Algoriphagus sp. PR1] >gi|126577992|gb|EAZ82212.1| triosephosphate isomerase [Algoriphagus sp. PR1] (253 aa)
Score = 211, Expect = 3.7e-15, Identities = 71/244 (29%), Positives = 116/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF---ENVKVMVA---PSYLGIVPSLGMSKNAK-VEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKE-NLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+KI+  NWKMN  +    K    I N    ENVK +VA   P +  I P   +    + + + AQN S    G  TG VS   +  +G++   LGH + +  F+E N  +  K+++ L NG+  +    E+ +D+    T E N++ Q+ Q    +   D   ++ I Y+P +          +        +R  + + +G  +A+N  ILYGG     + +EI    DVDG LI      S  ++ I+
  S:     1 MRKKIVAGNWKMNMTFDEGQKLTSEIVNMYKDENVKDVVAILNPPFPHIFPVKKLIGGVEGISLGAQNCSDKEAGAFTGEVSAKIIASFGVEYVILGHSERREYFQEDNEILATKVKEALANGLKPIFCCGES-LDIRTAGTHEPNVKFQLTQSLFDLSPEDF-SKITIAYEPIWAIGTGKTATADQAQEMHAALRRHIASHYGKEIADNTSILYGGSCNPKNAQEIFSKPDVDGGLIGGASLKSRDFVDII 250
>gi|119945859|ref|YP_943539.1| Triose-phosphate isomerase [Psychromonas ingrahamii 37] >gi|160196616|sp|A1SWS5|TPIS_PSYIN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|119864463|gb|ABM03940.1| triosephosphate isomerase [Psychromonas ingrahamii 37] (250 aa)
Score = 211, Expect = 3.9e-15, Identities = 70/244 (28%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  +++ NWK+N    S+S   K I       +NV+V V P  + I     +  N  +E+ AQ+VS    G  TG  S + +K++G K + +GH + +    E +  V AK   +  NG+  VL I ET  +   + T   +  Q+  + +  GIDAL   +   I Y+P +    G++ S    + +   IR        +    VA  + ILYGG +     +E+    D+DG L+     L  +++ I+
  S:     1 MRTPLVMGNWKLNGTKESVSALIKGIEAAADAAKNVEVAVCPPTIFIEQVANLVANNSIELGAQDVSTNISGAFTGETSPVMVKEFGAKYSLVGHSERRQYHNETDAVVAAKFVAIQANGLVPVLCIGETLEERETDKTFNVVETQLKAVIDVSGIDAL---ENAVIAYEPVWAIGTGKVASSEQAQDVHAHIRT----WLAEQSKVVAAKVQILYGGSVKASSAKELFAQPDIDGGLVGGAALLVEEFVGII 246
>gi|117925182|ref|YP_865799.1| triosephosphate isomerase [Magnetococcus sp. MC-1] >gi|160187511|sp|A0L8V0|TPIS_MAGSM Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|117608938|gb|ABK44393.1| triosephosphate isomerase [Magnetococcus sp. MC-1] (255 aa)
Score = 210, Expect = 4.2e-15, Identities = 68/244 (27%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIV--DRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  ++  NWK+N    + +     +      N  +  V+V P++  +    G+   + V++ AQN++  S G  TG +S   LKD G     LGH + +  F E N QV  K+    ++G+  +L + ET      E T + L  Q+      + A D     ++ + Y+P +    G++ S    +        IR  L  + G  VA+ + ILYGG +  D+ +E+    DVDG LI      +N +++I+
  S:     1 MRRALIAGNWKLNGTTQAATALATAVRDGVAANKPDCDVLVCPTFTVLSAVQGVVAGSGVDLGAQNMAVASSGAFTGEISGEMLKDVGCSYVILGHSERRTLFGETNEQVAQKVASAYRDGLTPILCVGETLEQREAEQTMQVLEQQLLACLPVLPA-DAAKQQQLVVAYEPVWAIGTGKVASTAQAQEAHA---FIRGLLAKELGANVADAVRILYGGSMKPDNAKELLGQADVDGGLIGGAALKANDFLAIM 250
>gi|52081960|ref|YP_080751.1| triosephosphate isomerase [Bacillus licheniformis ATCC 14580] >gi|52787348|ref|YP_093177.1| triosephosphate isomerase [Bacillus licheniformis ATCC 14580] >gi|81825182|sp|Q65EN0|TPIS_BACLD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|52005171|gb|AAU25113.1| triose phosphate isomerase [Bacillus licheniformis ATCC 14580] >gi|52349850|gb|AAU42484.1| TpiA [Bacillus licheniformis DSM 13] (253 aa)
Score = 210, Expect = 4.2e-15, Identities = 66/244 (27%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN   ++ VS  +  K+ IP  +  + +V    L +       K   ++V AQN+ F   G  TG +S   LKD G++   +GH + +  F E +  VN K     K G+  ++ + ET  +     T E +  Q+ +   G+    +   V I Y+P +    G+ ++  D   +      IR+ + ++FG   A+++ I YGG +   +I+E    +D+DG L+         ++ +L
  S:     1 MRKPIIAGNWKMNKVLSEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLKVGAQNMHFEESGAFTGEISPAALKDLGVEYCVIGHSERREMFAETDETVNKKAHAAFKYGIVPIICVGETLEEREANKTNELVADQVKKALAGLTTEQVAASV-IAYEPIWAIGTGKSSTAQDANEVCAH---IRKTVASEFGQTAADSVRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLL 247
>gi|169830515|ref|YP_001716497.1| Triose-phosphate isomerase [Candidatus Desulforudis audaxviator MP104C] >gi|169637359|gb|ACA58865.1| Triose-phosphate isomerase [Candidatus Desulforudis audaxviator MP104C] (257 aa)
Score = 210, Expect = 4.4e-15, Identities = 63/230 (27%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +R+ I+  NWKM        +F + +       +NV+++VAP +  +VP  G+   + + + AQN+ + + G  TG VS + L + G +   LGH + +  F E +  VN K    L  G+  ++ + E+  +     T++ +  QI     G+ A D V  + I Y+P +    G   S  D + +   IR +   L   FG   A+ + I YGG +  ++   +    D+DG L+
  S:     2 VRQPIIAGNWKMYKTPSEAVEFVRRLQEASAGVDNVEIVVAPPFPALVPVAGVLAGSFIGLAAQNMFWEAEGAFTGEVSPVMLAEIGCRYVILGHSERRQYFGETDANVNRKAWAALDRGLVPIVCVGESLDEREAGRTEKVVTAQIQGCLAGLPA-DAVAGLVIAYEPVWAIGTGRTASPADAQEVSARIRALVAEL---FGREAADRVRIQYGGSVKPENTRALISQPDIDGALV 234
>gi|86157957|ref|YP_464742.1| triosephosphate isomerase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85774468|gb|ABC81305.1| triosephosphate isomerase [Anaeromyxobacter dehalogenans 2CP-C] (253 aa)
Score = 210, Expect = 4.4e-15, Identities = 67/243 (27%), Positives = 117/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R K +  NWKM+      ++  K +          V+V VAP +  I  +   +  + +EV  Q+V + + G  TG VS   L + G +   +GH + +  F E +  V  K+  LL  G+  ++ + ET  +     T E +  Q+ Q   G+DA   + RV I Y+P +    G+  +    + +   IR ++RE      G  VA+ + I YGG +  ++  E+    DVDG L+      +N +++I+
  S:     3 RTKFVCGNWKMHKTVAEAAQLVKELAAGLGEAAGKVQVAVAPPFTAIHAAAQAAAGSAIEVAGQDVHWEAQGAFTGEVSAAMLAEAGCRHGIVGHSERRQLFGETDEAVRKKVGALLGAGLAPIVCVGETLAEREAGRTLEVVDRQVRQGLAGLDA-GALGRVTIAYEPVWAIGTGKTATSAQAQEVHAAIRKILRE-----MGGSVADAIRIQYGGSVKPENARELMSQPDVDGALVGGASLKANDFVAIV 248
>gi|182419740|ref|ZP_02950980.1| triose-phosphate isomerase [Clostridium butyricum 5521] >gi|182376288|gb|EDT73870.1| triose-phosphate isomerase [Clostridium butyricum 5521] (248 aa)
Score = 210, Expect = 5.2e-15, Identities = 63/230 (27%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + V + +  K +       V+V P+++ +         + ++V AQN+ F   G  TG V+   L+  GI    LGH + +  F E +  +N K++    + M  +L   ET       +T   +  QI     G+   D+ ++V I Y+P +         +E    TI+ IR  +   FG  VA+ + I YGG +    I+   + +D+DG L+
  S:     1 MRKAIIAGNWKMNKTVDEAVKMIEELKPLVKDATCDVVVCPTFVCLDAVKKAVAGSNIKVAAQNMHFEENGAFTGEVAPGMLEAMGIDYVVLGHSERREYFNETDEALNKKVKAAFAHNMTPILCCGETLEQRENGTTNAVVGAQIKADLEGLSK-DLAEKVVIAYEPIWAIGTGKTATDEQANETIKAIRGIVAEMFGSEVADKVRIQYGGSVKPGTIKAQMEQSDIDGALV 232
>gi|34763378|ref|ZP_00144330.1| Triosephosphate isomerase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886951|gb|EAA24071.1| Triosephosphate isomerase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (251 aa)
Score = 209, Expect = 6.0e-15, Identities = 65/244 (26%), Positives = 122/244 (50%)
  Q:     1 MREKILITNWKM---NADYVSISKFFKNI-PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSL-GNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  ++  NWKM   N + V      KN+  + +NV +++   +  +  ++   + + V++ A+NV +P + G +TG +S   LKD G+    LGH + +  FKE +  +N K++ +L+ GM  +L I E    L E  + +   +   QI  G+  L  +   +V I Y+P +          E    T + +R  L   FG  +A+ + I YGG +  ++ +++    D+DG L+      ++ +  I+
  S:     1 MRRLVIAGNWKMYKNNKEAVETLTQLKNLTKDIKNVDIVIGAPFTCLSDAVKTVEGSNVKIAAENV-YPKIEGAYTGEISPKMLKDIGVTYVILGHSERREYFKESDEFINQKVKAVLEIGMKPILCIGEK---LEERESGKTFEVLSKQIKGGLADLSKEEAGKVIIAYEPVWAIGTGKTATPEMAQETHKAVRNVLAEMFGKDIADKMIIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKADSFFEII 247
>gi|167039951|ref|YP_001662936.1| triosephosphate isomerase [Thermoanaerobacter sp. X514] >gi|166854191|gb|ABY92600.1| Triose-phosphate isomerase [Thermoanaerobacter sp. X514] (248 aa)
Score = 209, Expect = 6.1e-15, Identities = 67/244 (27%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  I+  NWKM+       K     IP  ++ K  V+V P ++ +     + +   + + AQ++ +   G +TG +S L LK+ G+K   +GH + +  F E +  VN K+   L +G++ ++ + E+     E  T E +  Q  +   G+   DIV+ V I Y+P +    G+  +  D NE     I+ IR  + + +G   A+ + I YGG +  ++I E+   +D+DG L+     +++ +  I+
  S:     1 MRRPIIAGNWKMHMTPSEAVKLVDELIPQVKDAKAEVVVIPPFVDLTEVNKVIQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKVLSALSHGLSPIVCVGESFSQREEGKTFEVVLSQTKEALKGVTHDDIVN-VVIAYEPIWAIGTGKTATAKDANE----VIKAIRNTIASLYGKEKADLVRIQYGGSVKPENISELMAESDIDGALVGGASLVASDFAKIV 246
>gi|154484684|ref|ZP_02027132.1| hypothetical protein EUBVEN_02401 [Eubacterium ventriosum ATCC 27560] >gi|149734532|gb|EDM50449.1| hypothetical protein EUBVEN_02401 [Eubacterium ventriosum ATCC 27560] (249 aa)
Score = 209, Expect = 6.7e-15, Identities = 61/230 (26%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI+  NWKMN   ++ V++    K +   E+V V+     + IVP++  +K   + + A+N+ F   G +TG ++   L D G+K   +GH + +  F E +  VN K+ K  ++G+  ++   ET     +    + +R QI   F  + A D      I Y+P +         ++        IRE ++  +    A  + I YGG +   +  E+    D+DG L+
  S:     1 MRKKIIAGNWKMNKTPSEAVALINELKPLVQNEDVDVVFCVPAISIVPAMEAAKGTNINIGAENMYFEESGAYTGEIAPNMLTDVGVKYVIIGHSERREYFAETDATVNKKVLKAFEHGITPIICCGETLEQREQGIAVDFIRQQIKIAFLNVTA-DQAKEAVIAYEPIWAIGTGKTATSDQAEEICAAIRECIKEVYDEATAEAIRIQYGGSMNAGNAAELLAKPDIDGGLV 232
>gi|169824488|ref|YP_001692099.1| triosephosphate isomerase [Finegoldia magna ATCC 29328] >gi|167831293|dbj|BAG08209.1| triosephosphate isomerase [Finegoldia magna ATCC 29328] (251 aa)
Score = 208, Expect = 7.1e-15, Identities = 60/230 (26%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLF----IEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKMN       +F  ++   +   NV+  +   +  +       +N+ +   AQN+ +   G  TG VS   LKD GI    +GH + +  FKE +  +N K+   LK+ +  +L     +E+ + +  EE  +  +RL +     GI+  DI+ ++ I Y+P +         ++      + IR  L   +   +A+++ I YGG +  ++I +I    D+DG L+
  S:     1 MRKPLIAGNWKMNKTDGETKQFINDLKCLDISDNVEACIISPFTSLKTLTEDLRNSNISTGAQNMYYEECGAFTGEVSPNMLKDLGIDYVIIGHSERRTIFKEDDELLNKKIASALKHDIKPILCCGENLEQRESNRHEEVVESQIRLDL----KGINEKDIMSKLVIAYEPIWAIGTGKTASSDDAQSMCKFIRNLLSKMYSKDLADSVRIQYGGSVKPENILDIMSKEDIDGALV 233
>gi|23099891|ref|NP_693357.1| triosephosphate isomerase [Oceanobacillus iheyensis HTE831] >gi|39932408|sp|Q8ENP4|TPIS_OCEIH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|22778122|dbj|BAC14392.1| triosephosphate isomerase [Oceanobacillus iheyensis HTE831] (252 aa)
Score = 208, Expect = 7.3e-15, Identities = 61/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRL---QINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+K++  NWKMN       +F  ++    P   +V+ +V   +  +   +  +K ++V+V AQN+ F   G  TG VS + LKD G+    LGH + +  F E N  VN K +    + +  ++ + ET   L +    E + +   Q+ Q   G+    + + + I Y+P +         +E        IR+ +       VA  + I YGG +   +++E+   +D+DG L+
  S:     1 MRKKVIAGNWKMNKVLSEAGEFMNSVVPKAPKGNDVEAIVCAPFPFLSKLVEQAKGSEVKVAAQNMHFEDSGAFTGEVSPVMLKDLGVTHVVLGHSERRELFAETNELVNKKTKAAFAHDLTPIVCVGET---LDQREANETMNIVGEQVKQAVAGLTNEQVAETI-IAYEPVWAIGTGKTATSEQANEVCTEIRKVVAEVTSADVAEKVIIQYGGSVKPANVDELLAQSDIDGALV 233
>gi|116070937|ref|ZP_01468206.1| triosephosphate isomerase [Synechococcus sp. BL107] >gi|116066342|gb|EAU72099.1| triosephosphate isomerase [Synechococcus sp. BL107] (243 aa)
Score = 207, Expect = 9.0e-15, Identities = 59/230 (25%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFK-------NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++  NWKM+       +F         ++PN  +  +++AP +  +     + KN+ V + +QNV +   G  TG +S   LK++G+    +GH + +  F E + Q+N + +    NG+  ++ + E+         +  +R QI Q   G+DA    D + + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRRPVIAGNWKMHMTCAQAREFMAAFLPLVADMPN--DRDLVLAPPFTALSTMAELCKNSPVALSSQNVHWEGSGAFTGEISPSMLKEHGVTYTIVGHSEPRKYFSESDEQINHRARSSQANGLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDA----DLLVVAYEPIWAIGTGKTCEAAEANRICGLIR----------SWVGSPDLVIQYGGSVKGGNIDELMGMSDIDGVLV 224
>gi|91214805|ref|ZP_01251778.1| triosephosphate isomerase [Psychroflexus torquis ATCC 700755] >gi|91187232|gb|EAS73602.1| triosephosphate isomerase [Psychroflexus torquis ATCC 700755] (250 aa)
Score = 207, Expect = 9.1e-15, Identities = 68/230 (29%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNG---IDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR +I+  NWKMN D          +   +    N +V+VAP +  +  +    +N+ +++ +QN++    G +TG +S   LK  G++ A +GH + +  ++E +  +  K+   LK+ +  +  I E   DL +    ++  +   Q+ NG   IDA ++ D V I Y+P +    GE  S    + I   IR I   L  ++   +A+   ILYGG +  ++ +EI    DVDG LI
  S:     1 MRTQIVAGNWKMNCDLDESQHLLNALKQKDFSKSNAEVIVAPPFTNLYAAHKTLENSSIKISSQNINENDKGAYTGEISPSMLKSVGVEYAIIGHSERRAIYEESDDLLAKKVTAALKHDLKVMFCIGE---DLEKRKADKHFEVVEEQLKNGLFHIDASEMKD-VVIAYEPVWAIGTGETASPEQAQEIHEHIRKI---LAKQYSQEIADQTSILYGGSVKPNNAKEIFAKKDVDGGLI 233
>gi|167037151|ref|YP_001664729.1| triosephosphate isomerase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855985|gb|ABY94393.1| Triose-phosphate isomerase [Thermoanaerobacter pseudethanolicus ATCC 33223] (248 aa)
Score = 207, Expect = 9.1e-15, Identities = 66/244 (27%), Positives = 125/244 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFD-NEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  I+  NWKM+       K  +  IP  ++ K  V+V P ++ +     + +   + + AQ++ +   G +TG +S L LK+ G+K   +GH + +  F E +  VN K+   L +G++ ++ + E+     E  T E +  Q  +   G+   DIV+ V I Y+P +    G+  +  D NE     I+ +R  + + +G   A+ + I YGG +  ++I E+   +D+DG L+     +++ +  I+
  S:     1 MRRPIIAGNWKMHMTPSEAVKLVEELIPQVKDAKAEVVVIPPFVDLTEVNKVIQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKVLSALSHGLSPIVCVGESLSQREEGKTFEVVLNQTKEALKGVSHDDIVN-VVIAYEPIWAIGTGKTATAKDANE----VIKALRNTIASLYGKEKASLVRIQYGGSVKPENISELMAESDIDGALVGGASLVASDFAKIV 246
>gi|81428221|ref|YP_395221.1| triosephosphate isomerase [Lactobacillus sakei subsp. sakei 23K] >gi|123564507|sp|Q38Y19|TPIS_LACSS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56711109|emb|CAD98928.1| triosephosphate isomerase [Lactobacillus sakei] >gi|78609863|emb|CAI54910.1| Triosephosphate isomerase [Lactobacillus sakei subsp. sakei 23K] (251 aa)
Score = 207, Expect = 9.5e-15, Identities = 57/230 (24%), Positives = 104/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN +    ++F      N+P F+  + ++    + +   L  +K   ++V A+N  F   G  TG  S   L + G+    +GH + +  F E +  +N K   + KN M  +    E+         +E +  Q+ +   G+ A D V  + I Y+P +          +       V+R+ +   +   VA+ + I YGG +   +++EI    D+DG L+
  S:     1 MRKPIIAGNWKMNMNPTQTTEFVNAIKANLPKFDQTESVIGAPAVDLPALLEAAKGTDLKVAAENCYFEEAGAFTGETSPKTLNEMGVDYVIIGHSERRDYFHETDEDINKKAHAIFKNNMTPIFCCGESLETREAGKAEEWVSNQVTEGLKGLSA-DQVSSMVIAYEPIWAIGTGKTASADQAQEICAVVRQTVAKLYDQTVADKVRIQYGGSVKPANVKEIMGKEDIDGGLV 233
>gi|153855255|ref|ZP_01996421.1| hypothetical protein DORLON_02435 [Dorea longicatena DSM 13814] >gi|149752254|gb|EDM62185.1| hypothetical protein DORLON_02435 [Dorea longicatena DSM 13814] (249 aa)
Score = 207, Expect = 9.5e-15, Identities = 63/229 (27%), Positives = 105/229 (45%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN   ++ V++ +  K +   E+V V+     + I+P     K   ++V A+N+ F   G +TG +S   L D G+K   LGH + +  F E N  VN K+ K  ++G+  ++   ET     +  T + +R Q+   F  + A D      I Y+P +          E        IR  +   +    A  + I YGG +   +  E+    D+DG L+
  S:     3 RKKIVAGNWKMNKTPSEAVALVEELKPLVANEDVDVVFCVPAIDIIPVAEAVKGTNIQVGAENMYFEESGAYTGEISPAMLTDAGVKYVVLGHSERREYFAETNETVNKKMLKAFEHGITPIMCCGETLEQREQGVTMDFIRQQVKVGFQNVTA-DQAKTAVIAYEPIWAIGTGKTATTEQAEEVCAGIRACIAEVYDEATAEAIRIQYGGSVNAGNAAELFAQADIDGGLV 233
>gi|126663841|ref|ZP_01734836.1| triosephosphate isomerase [Flavobacteria bacterium BAL38] >gi|126624105|gb|EAZ94798.1| triosephosphate isomerase [Flavobacteria bacterium BAL38] (249 aa)
Score = 207, Expect = 9.5e-15, Identities = 63/244 (25%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIV--YKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+ +       + +   N P     +++VAP+++ +  ++  +K   + V AQN+     G +TG ++   L D G+ T  LGH + +  F E +  + +K+    K+ M  +    E   +L +     +  +   Q+ + +  L+  D   IV  Y+P +          E      + IR  +   +G+ +A+NL ILYGG +  D+ +EI    DVDG LI      +  +++I+
  S:     1 MRKNIVAGNWKMHKNQQETIALLEEIIANHPK-TATEIVVAPTFVNLAKAVETTKEHNITVAAQNMHQAEGGAYTGEIAAGMLTDIGVNTVILGHSERRAYFHESDALLASKVDTAFKHEMRVIFCFGE---ELKDRQINNHFNVVEYQLRDALFHLEKKDWASIVLAYEPVWAIGTGETASPEQAQEMHKFIRSLVEKVYGFDIADNLTILYGGSVKPDNAKEIFSKPDVDGGLIGGAALKAEDFLAIV 246
>gi|168486839|ref|ZP_02711347.1| triose-phosphate isomerase [Streptococcus pneumoniae CDC1087-00] >gi|183570228|gb|EDT90756.1| triose-phosphate isomerase [Streptococcus pneumoniae CDC1087-00] (252 aa)
Score = 207, Expect = 9.7e-15, Identities = 61/243 (25%), Positives = 116/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L ++K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDFVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 248
>gi|182684530|ref|YP_001836277.1| triosephosphate isomerase [Streptococcus pneumoniae CGSP14] >gi|182629864|gb|ACB90812.1| triosephosphate isomerase [Streptococcus pneumoniae CGSP14] (259 aa)
Score = 207, Expect = 1.0e-14, Identities = 61/243 (25%), Positives = 116/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L ++K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:    10 RKPFIAGNWKMNKNPQEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 255
>gi|86132932|ref|ZP_01051523.1| putative triosephosphate isomerase [Cellulophaga sp. MED134] >gi|85816638|gb|EAQ37825.1| putative triosephosphate isomerase [Dokdonia donghaensis MED134] (250 aa)
Score = 207, Expect = 1.0e-14, Identities = 62/244 (25%), Positives = 111/244 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP---NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN D  + +    ++    N  + +V++AP+Y+ +  +     ++ + V AQN+     G +TG +S   LK  G+ T  LGH + +  F E +  +  K+   L+N M  +    E   D    + ++ +  Q+      +DA      + + Y+P +          E        IR+ +   +   VA N+ ILYGG +   + +EI    DVDG LI      ++ +  I+
  S:     1 MRKHIVAGNWKMNNDLAATAGLITDLKRKVNNGDAEVIIAPTYINLHSAFESLSDSNITVAAQNMHQAKSGAYTGEISAAMLKSVGVNTVILGHSERRAYFNEGDELLTEKVNAALENEMRVIFCFGEELEDRKAGNQEKVVESQLKNALFHLDA-SAWSSIVLAYEPVWAIGTGETASPEQAQDMHAFIRKTVAETYNEEVAENVTILYGGSVKPGNAKEIFGKPDVDGGLIGGASLKADDFFEIV 246
>gi|19704701|ref|NP_604263.1| triosephosphate isomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22096217|sp|Q8RDX7|TPIS_FUSNN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|19715015|gb|AAL95562.1| Triosephosphate isomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (251 aa)
Score = 207, Expect = 1.1e-14, Identities = 65/244 (26%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKM---NADYVSISKFFKNIP-NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  ++  NWKM   N + V      K++  + +NV +++   +  +  ++ + + + V++ A+NV     G +TG VS   LKD G+    LGH + +  FKE +  +N K++ +L+ GM  +L I E   D     T E L  QI +    +   D  ++  + Y+P +          E    T + IR  L   FG  VA+ + I YGG +  ++ +++    D+DG L+      ++ +  I+
  S:     1 MRRLVIAGNWKMYKNNKEAVETLTQLKDLTRDVKNVDIVIGAPFTCLSDAVKIVEGSNVKIAAENVYPKIEGAYTGEVSPKMLKDIGVTYVILGHSERREYFKESDEFINQKVKAVLEIGMKPILCIGEKLEDREGGKTLEVLAKQIKEGLVDLSKED-AEKTIVAYEPVWAIGTGKTATPEMAQETHKEIRNVLAEMFGKDVADKMIIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKADSFFEII 247
>gi|148997358|ref|ZP_01824963.1| triosephosphate isomerase [Streptococcus pneumoniae SP11-BS70] >gi|168575228|ref|ZP_02721191.1| triose-phosphate isomerase [Streptococcus pneumoniae MLV-016] >gi|147756413|gb|EDK63454.1| triosephosphate isomerase [Streptococcus pneumoniae SP11-BS70] >gi|183578986|gb|EDT99514.1| triose-phosphate isomerase [Streptococcus pneumoniae MLV-016] (252 aa)
Score = 207, Expect = 1.1e-14, Identities = 61/243 (25%), Positives = 116/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L ++K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVVSKLPSSDLVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 248
>gi|157753072|ref|XP_001680248.1| Hypothetical protein CBG21017 [Caenorhabditis briggsae AF16] >gi|187023251|emb|CAP37931.1| C. briggsae CBR-TPI-1 protein [Caenorhabditis briggsae] (247 aa)
Score = 207, Expect = 1.1e-14, Identities = 72/222 (32%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVS---ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSK---NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKE-NLRLQINQIFN-GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN D+ S   I  F     +  NV V+VAP      P L  +K    A V V AQN    + G  TG +S   +KD G++   LGH + +  F E +  +  K    L++G+  +  I E   +     TK+ N R Q+  I + G+   +IV    I Y+P +          E        IR FL+ K    VA+   I+YGG +  D+  E+ K  D+DG L+
  S:    10 NWKMNGDFASVDGIVAFLNQSADNSNVDVVVAPP----APYLAYAKANLKAGVLVAAQNCYKTAKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALESGIKVIFCIGEKLEEREAGHTKDVNFR-QLQAIVDKGVSWENIV----IAYEPVWAIGTGKTASPEQAQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLV 230
>gi|1730002|sp|P50919|TPIS_MYCHR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|602607|gb|AAA83218.1| triosephosphate isomerase (243 aa)
Score = 207, Expect = 1.1e-14, Identities = 70/244 (28%), Positives = 120/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFF----------KNIPNFENVKVMVAPSYLGIVPSLGMSKNA-KVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M + I+I NWKMN  +    +FF          KN  N +N+   VA   + +      SKN  K+E+  QN+S    G +TG +S   L D  +K A +GH + +  FKE +  VNAK Q+ +KN +  V+ + ET  +   + T + +  Q+      +D    + +V + Y+P +          E      + + +F+R +       NL ILYGG +  ++IE++    D++G L+       + +I +L
  S:     1 MSKTIIIGNWKMNKTFTQTKEFFSAFNQLYIENKNKIN-QNLDFAVALPAINVA---AFSKNTTKLELAVQNMSQFEKGAYTGEISAQMLLDLNVKYAIIGHSERRQYFKETDLDVNAKTQQAIKNNIIPVVCVGETLEEYEAQKTSQVIEYQLKNSLKDVD----LSKVIVAYEPIWAIGTGKTATPE----QAQQVCKFIRKQ----TNKNLTILYGGSVSQENIEQLLNQADINGALVGGASLKVDSFIKLL 239
>gi|15901416|ref|NP_346020.1| triosephosphate isomerase [Streptococcus pneumoniae TIGR4] >gi|111658480|ref|ZP_01409153.1| hypothetical protein SpneT_02000380 [Streptococcus pneumoniae TIGR4] >gi|116516798|ref|YP_816864.1| triosephosphate isomerase [Streptococcus pneumoniae D39] >gi|148988628|ref|ZP_01820061.1| triosephosphate isomerase [Streptococcus pneumoniae SP6-BS73] >gi|148993400|ref|ZP_01822917.1| triosephosphate isomerase [Streptococcus pneumoniae SP9-BS68] >gi|149003190|ref|ZP_01828086.1| triosephosphate isomerase [Streptococcus pneumoniae SP14-BS69] >gi|149007510|ref|ZP_01831145.1| triosephosphate isomerase [Streptococcus pneumoniae SP18-BS74] >gi|149007873|ref|ZP_01831460.1| triosephosphate isomerase [Streptococcus pneumoniae SP18-BS74] >gi|149012692|ref|ZP_01833668.1| triosephosphate isomerase [Streptococcus pneumoniae SP19-BS75] >gi|149022044|ref|ZP_01836006.1| triosephosphate isomerase [Streptococcus pneumoniae SP23-BS72] >gi|168488703|ref|ZP_02712902.1| triose-phosphate isomerase [Streptococcus pneumoniae SP195] >gi|168491532|ref|ZP_02715675.1| triose-phosphate isomerase [Streptococcus pneumoniae CDC0288-04] >gi|168493479|ref|ZP_02717622.1| triose-phosphate isomerase [Streptococcus pneumoniae CDC3059-06] >gi|169833751|ref|YP_001694979.1| triose-phosphate isomerase [Streptococcus pneumoniae Hungary19A-6] >gi|194398071|ref|YP_002038206.1| triosephosphate isomerase [Streptococcus pneumoniae G54] >gi|122278290|sp|Q04JH4|TPIS_STRP2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|54039750|sp|P66943|TPIS_STRR6 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|54042253|sp|P66942|TPIS_STRPN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|14973065|gb|AAK75660.1| triosephosphate isomerase [Streptococcus pneumoniae TIGR4] >gi|116077374|gb|ABJ55094.1| triosephosphate isomerase [Streptococcus pneumoniae D39] >gi|147758650|gb|EDK65647.1| triosephosphate isomerase [Streptococcus pneumoniae SP14-BS69] >gi|147760600|gb|EDK67574.1| triosephosphate isomerase [Streptococcus pneumoniae SP18-BS74] >gi|147760869|gb|EDK67839.1| triosephosphate isomerase [Streptococcus pneumoniae SP18-BS74] >gi|147763292|gb|EDK70230.1| triosephosphate isomerase [Streptococcus pneumoniae SP19-BS75] >gi|147925829|gb|EDK76904.1| triosephosphate isomerase [Streptococcus pneumoniae SP6-BS73] >gi|147927955|gb|EDK78975.1| triosephosphate isomerase [Streptococcus pneumoniae SP9-BS68] >gi|147929888|gb|EDK80877.1| triosephosphate isomerase [Streptococcus pneumoniae SP23-BS72] >gi|168996253|gb|ACA36865.1| triose-phosphate isomerase [Streptococcus pneumoniae Hungary19A-6] >gi|183572813|gb|EDT93341.1| triose-phosphate isomerase [Streptococcus pneumoniae SP195] >gi|183574227|gb|EDT94755.1| triose-phosphate isomerase [Streptococcus pneumoniae CDC0288-04] >gi|183576372|gb|EDT96900.1| triose-phosphate isomerase [Streptococcus pneumoniae CDC3059-06] >gi|194357738|gb|ACF56186.1| triosephosphate isomerase [Streptococcus pneumoniae G54] (252 aa)
Score = 207, Expect = 1.1e-14, Identities = 61/243 (25%), Positives = 116/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L ++K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 248
>gi|15903475|ref|NP_359025.1| triosephosphate isomerase [Streptococcus pneumoniae R6] >gi|15459087|gb|AAL00236.1| Triose phosphate isomerase [Streptococcus pneumoniae R6] (259 aa)
Score = 207, Expect = 1.1e-14, Identities = 61/243 (25%), Positives = 116/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L ++K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:    10 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNLKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 255
>gi|110004156|emb|CAK98494.1| triosephosphate isomerase protein [Spiroplasma citri] (245 aa)
Score = 207, Expect = 1.1e-14, Identities = 60/230 (26%), Positives = 104/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF-ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+I NWKM+        F K + +   ++K+    +   +  ++       + + AQN  +   G  TG +S   L++  I    +GH + +  F E N  VN K +K+L  GM  ++   ET        T++ +  QI +   GID  D    + I Y+P +          E       +IR  + + +   VAN + I YGG +  ++I+E+    D+DG L+
  S:     1 MRKPIIIGNWKMHKTINETIDFLKQVDHVCHDLKLDAGIAIPFVNLAVAKQHAHNLIIAAQNCHYEDFGAFTGEISVEMLENLKITHVIIGHSERREMFNETNETVNLKAKKILATGMVPIICCGETLQQYENNETQQIVETQIEKALQGIDFED-AKTIVIAYEPIWAIGTGKTATAEIAQNVCAIIRTKIASLYDEVVANVIRIQYGGSVKPENIQELLAQPDIDGALV 230
>gi|78184405|ref|YP_376840.1| triosephosphate isomerase [Synechococcus sp. CC9902] >gi|123581747|sp|Q3AYN1|TPIS_SYNS9 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|78168699|gb|ABB25796.1| triosephosphate isomerase [Synechococcus sp. CC9902] (243 aa)
Score = 206, Expect = 1.3e-14, Identities = 58/230 (25%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFK-------NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++  NWKM+       +F         ++PN  +  +++AP +  +     + K++ + + +QNV +   G  TG +S   LK++G+    +GH + +  F E + Q+N + +    NG+  ++ + ET         +  +R QI Q   G+DA    D + + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRRPVIAGNWKMHMTCAQAREFMAAFLPLVADMPN--DRDLVLAPPFTALSSMADLCKDSPIALSSQNVHWEGSGAFTGEISPSMLKEHGVTYTIVGHSEPRKYFSESDEQINHRARSSQANGLIPIVCVGETDEQRERGEAERVIRRQIEQGLEGLDA----DLLVVAYEPIWAIGTGKTCEAAEANRICGLIR----------SWVGSPDLVIQYGGSVKGGNIDELMGMSDIDGVLV 224
>gi|116625555|ref|YP_827711.1| triosephosphate isomerase [Solibacter usitatus Ellin6076] >gi|122252203|sp|Q01SE4|TPIS_SOLUE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116228717|gb|ABJ87426.1| triosephosphate isomerase [Solibacter usitatus Ellin6076] (249 aa)
Score = 206, Expect = 1.4e-14, Identities = 57/230 (24%), Positives = 103/230 (44%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM         FF+     +    + ++++ P +  +  ++   +   + V AQNV +   G  TG VS   L   G+    +GH + +  F E +  V  + Q  L+ G+  ++ + E   D     T+  L  Q  +   G+       ++ I Y+P +          E    T R IR  +R KFG   A+ + ILYGG +  D+ + +    ++DG+L+
  S:     1 MRKPVMAGNWKMYKTPAETIAFFEKFRPLVEKSSHCEIVICPPFTNLAAAVDAVRGTSIRVGAQNVGWAKEGAFTGEVSGPMLNAMGVSHVIIGHSERRQYFNETDETVLKRTQAALEFGLTPIVCVGELLADREGGRTEAVLAGQFQKGIAGLTEQQFA-KIVIAYEPVWAIGTGKTATPEIAADTHRAIRGQVREKFGKEAADAVRILYGGSVKPDNAKVLMGQPEIDGVLV 233
>gi|77918937|ref|YP_356752.1| triosephosphate isomerase [Pelobacter carbinolicus DSM 2380] >gi|123574344|sp|Q3A4X5|TPIS_PELCD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|77545020|gb|ABA88582.1| triosephosphate isomerase [Pelobacter carbinolicus DSM 2380] (252 aa)
Score = 205, Expect = 1.5e-14, Identities = 61/244 (25%), Positives = 122/244 (50%)
  Q:     1 MREKILITNWKM---NADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR   +  NWK+   +A+  ++    K  + +  +  ++VAP +  +   +   + + + V AQN    + G  TG VS   LKD G +   +GH + +  F E +  +N K++ ++  G++A+L I ET  +   + T + L  Q+     G+DA   ++++ + Y+P + +G   +  D++        IR  +   FG  VA  + I+YGG +   +++ + +  D+DG L+      +  +I I+
  S:     1 MRRPFIAGNWKLHKTSAEAAALVGELKGALSDVVDRDIVVAPVFTSLAAVIATLEKSDISVAAQNCYPENQGAFTGEVSPALLKDAGCRYVIVGHSERRQLFAESDAFINRKVKAVIDAGLSAILCIGETLEEREADKTFDVLERQVRCGLEGLDAA-AMEQIVVAYEPVWAIGTGKTATDSQ-AQQAHSFIRSLVNDIFGSKVAQQVRIVYGGSVKPGNVDGLLQQPDIDGALVGGASLNAEDFIRIV 247
>gi|115378717|ref|ZP_01465864.1| triosephosphate isomerase [Stigmatella aurantiaca DW4/3-1] >gi|115364267|gb|EAU63355.1| triosephosphate isomerase [Stigmatella aurantiaca DW4/3-1] (256 aa)
Score = 205, Expect = 1.6e-14, Identities = 61/229 (26%), Positives = 107/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R KI+  NWKMN          + +        + V++++AP ++ + P     +++ +++ AQN  + + G  TG V+   LK+ G     +GH + +  F E +  VN + Q +LK GM  ++ + ET  +     T E +  Q+     G  A D+  R  + Y+P +    G   +    + +   IR   +  R   G   A  + I YGG +  D+  E+    DVDG L+
  S:     6 RRKIVAGNWKMNKTVPEALALVRELRGLVSALGDKVELVIAPPFVALHPVAKAIEDSNLKLAAQNCHWEASGAFTGEVAAPMLKEVGCAYVIVGHSERRQFFGETDETVNKRSQAVLKAGMVPIICVGETLAEREANRTLEVVERQVKGALAGFSAADVA-RFVLAYEPVWAIGTGRTATSAQAQEVHAAIR--SQLARLYDG-AAAGQVRIQYGGSVKPDNAAELLGQPDVDGALV 238
>gi|158320007|ref|YP_001512514.1| Triose-phosphate isomerase [Alkaliphilus oremlandii OhILAs] >gi|166988096|sp|A8MFY0|TPIS_ALKOO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|158140206|gb|ABW18518.1| Triose-phosphate isomerase [Alkaliphilus oremlandii OhILAs] (248 aa)
Score = 205, Expect = 1.7e-14, Identities = 61/244 (25%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN    + + +    K+  +   V+V+V   +  +           +++ AQN+ +   G +TG +S   LKD G++   LGH + +  F E +  VN K++K +K  +  ++ I E+  +     T + ++ Q+   F G+ A + +D V + Y+P +         +E     I  IR  +  K+G  ++  + I YGG +   +  EI    D+DG L+      + +++ I+
  S:     1 MRKPIIAGNWKMNKVSKEALDLVNQIKDEVHKTEVEVVVCCPFTVLSQVQKALVGTNLKLGAQNMHWEEDGAYTGEISANMLKDIGVEYVILGHSERRQYFNETDETVNKKVKKAIKENLKPIVCIGESLEEREANQTFDVIKKQLLGAFEGVPA-EAMDNVVLAYEPIWAIGTGKTASSEEAQTVIAYIRSLIEEKYGVDISEEVRIQYGGSVKASNATEIMNETDIDGALVGGASLKAEEFLGII 246
>gi|27467477|ref|NP_764114.1| triosephosphate isomerase [Staphylococcus epidermidis ATCC 12228] >gi|57866429|ref|YP_188037.1| triosephosphate isomerase [Staphylococcus epidermidis RP62A] >gi|32130219|sp|Q8CTD5|TPIS_STAES Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|71153347|sp|Q5HQV2|TPIS_STAEQ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|27315020|gb|AAO04156.1|AE016745_255 triosephosphate isomerase [Staphylococcus epidermidis ATCC 12228] >gi|57637087|gb|AAW53875.1| triosephosphate isomerase [Staphylococcus epidermidis RP62A] (253 aa)
Score = 205, Expect = 1.7e-14, Identities = 64/230 (27%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK----VMVAPSYL--GIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN        F   +P   + K    V+ AP+     +V ++   K   +++ AQN  F   G +TG  S + L + G+K   +GH + +  F E + +VN K   +  +GM  ++ + E+  D   E+ K N ++  NQ+   ++ L  D +  V I Y+P +         +E        +R+ L       VA+   I YGG +  ++I+E    +D+DG L+
  S:     1 MRTPIIAGNWKMNKTVQEAKDFVNELPTLPDPKEVESVICAPTIQLDALVTAVKDGKAKGLKIGAQNAYFEESGAYTGETSPVALSELGVKYVVIGHSERRDYFHETDEEVNKKAHAIFNHGMTPIICVGES--DEEREAGKAN-KIVGNQVKKAVEGLSDDQLKEVVIAYEPIWAIGTGKSSTSEDANEMCAHVRQTLADLSSQEVADATRIQYGGSVKPNNIKEYMAQSDIDGALV 235
>gi|148984928|ref|ZP_01818181.1| triosephosphate isomerase [Streptococcus pneumoniae SP3-BS71] >gi|147922950|gb|EDK74066.1| triosephosphate isomerase [Streptococcus pneumoniae SP3-BS71] (252 aa)
Score = 205, Expect = 1.8e-14, Identities = 61/243 (25%), Positives = 115/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L ++K +  +V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNFKVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 248
>gi|134098715|ref|YP_001104376.1| triosephosphate isomerase [Saccharopolyspora erythraea NRRL 2338] >gi|160196644|sp|A4FBM6|TPIS_SACEN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|133911338|emb|CAM01451.1| triosephosphate isomerase [Saccharopolyspora erythraea NRRL 2338] (261 aa)
Score = 205, Expect = 1.8e-14, Identities = 65/229 (28%), Positives = 118/229 (51%)
  Q:     2 REKILITNWKMNADYVS----ISKFFKNIPN--FENVKVMVAPSYLGI--VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN +++     + K   ++P   F  V+V V P +  I  V +L       ++  AQ+VS    G +TG VS   L   G     +GH + +    E +  VN K++ +LK+GM+ +L + E    L       ++     Q+ N +  L  + + +V + Y+P +    G++ +  D + +   +R     L  K+G  +A+ + +LYGG + + +I E+   NDVDG L+
  S:     3 RQPLIAGNWKMNLNHLEAIALVQKIAFSLPEKYFAKVEVAVIPPFTDIRSVQTLIDGDKLLLKHGAQDVSEHESGAYTGEVSGPMLAKLGCSYVVVGHSERREHHAETDEVVNRKVRAVLKHGMSPILCVGEP---LEVREAGGHVEHSTTQLINALKGLKTEQIRQVVVAYEPVWAIGTGKVATAADAQEVCAALRTA---LADKYGKEIADEVRVLYGGSVKSSNIGELIGQNDVDGALV 238
>gi|119174825|ref|XP_001239740.1| hypothetical protein CIMG_09361 [Coccidioides immitis RS] >gi|90298526|gb|EAS28157.1| hypothetical protein CIMG_09361 [Coccidioides immitis RS] (249 aa)
Score = 205, Expect = 1.8e-14, Identities = 59/222 (26%), Positives = 112/222 (50%)
  Q:     9 NWKMNADYVSISKFFKNI--PNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI+    N+   N + N +V+++P  L ++ S  ++ + K+ V +QNV    +G +TG +S  +L+D GI    +GH + +V  KE +     K +  +  G++ +L + ET  +   + T + +  Q+  + + + A D   ++ + Y+P +          E        +R+++       VA NL I+YGG +   + +E+ K  DVDG L+
  S:    10 NFKMNGTQKSITDIITNLNSANLDPNTEVVISPPSLYLILSRSLA-DPKIGVASQNVFDKPMGAYTGELSVEQLQDCGISWTLVGHSERRVILKEDDDFAARKTKSAIDGGLSVILCVGETLEEREADKTVDVVTRQLGAVASRLSAQDW-SKLVVAYEPVWAIGTGKVATTEQAQEVHAAVRKYIAESVSPSVAENLRIIYGGSVNEKNCKELAKQADVDGFLV 232
>gi|69249236|ref|ZP_00604913.1| Triosephosphate isomerase [Enterococcus faecium DO] >gi|68194238|gb|EAN08761.1| Triosephosphate isomerase [Enterococcus faecium DO] (251 aa)
Score = 205, Expect = 1.8e-14, Identities = 62/244 (25%), Positives = 112/244 (45%)
  Q:     1 MREKILITNWKMNADYVSISKF---FKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN       +F    KN IP+ + V  ++    L +   +  ++  ++++ AQN  + + G  TG  S   L D G+    +GH + +  F E +  +N K + +  NGM  +L   E+        T E +  QI      + A  + + V I Y+P +        D +       V+R+ +   +G  V+  + I YGG +  ++I E     +VDG L+      ++ ++S+L
  S:     1 MRKPIIAGNWKMNKTASEAKEFAEAVKNKIPSNDKVDSVIGSPALFLQELMTSAEGTELKISAQNCYWENSGAFTGETSPAALADLGVHYVIIGHSERREYFHETDEDINKKAKAIFANGMTPILCCGESLETYEAGKTAEWIEGQITAGLADLSAEQVSNMV-IAYEPIWAIGTGKSADAQIADEICGVVRQTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQADSFLSLL 247
>gi|164661864|ref|XP_001732054.1| hypothetical protein MGL_0647 [Malassezia globosa CBS 7966] >gi|159105956|gb|EDP44840.1| hypothetical protein MGL_0647 [Malassezia globosa CBS 7966] (248 aa)
Score = 205, Expect = 1.9e-14, Identities = 58/222 (26%), Positives = 108/222 (48%)
  Q:     9 NWKMNAD---YVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN     Y S+ K   +       +V++AP  L ++PS  + +  ++ + AQN      G  TG +S  +LKD  I    LGH + +  F E +  V  K    L+ G++ +L + E+   L +    E++ + + Q+      +    ++ I Y+P +    G++ +    + +      IR++L  K    V++ L I+YGG +   + +E+    D+DG L+
  S:    10 NWKMNGSIEQYQSLIKHLLDSSLDSKAEVVIAPPSLYLLPSQKLLEGKQIALGAQNAYNKPSGAFTGEISVAQLKDASIPWVILGHSERRSIFGETDDMVAQKTSAALETGLSVILCVGES---LEQREKNESINVVLGQLETATKDVKDWSKIVIAYEPVWAIGTGKVATAEQAQEVHAA---IRQWLVKKADQQVSDTLRIIYGGSVAAKNCKELASQPDIDGFLV 231
>gi|29376484|ref|NP_815638.1| triosephosphate isomerase [Enterococcus faecalis V583] >gi|39932362|sp|Q833J0|TPIS_ENTFA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|29343948|gb|AAO81708.1| triosephosphate isomerase [Enterococcus faecalis V583] (251 aa)
Score = 205, Expect = 2.0e-14, Identities = 62/244 (25%), Positives = 113/244 (46%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN   ++  S ++  KN +P+ + V  ++    L + P     K+++V++ AQN  + + G  TG  S   + D G+    +GH + +  F E +  +N K + +  NGM  +    ET        T E +  QI +   G+    +   V I Y+P +        D         V+R  +   +G  V+  + I YGG +  ++I E     +VDG L+      ++ ++++L
  S:     1 MRKPIIAGNWKMNKTLSEAQSFAEAVKNAVPSNDVVDAVIGSPALFLAPLAWNLKDSEVKLAAQNCYWENAGAFTGENSPAAIADLGVDYVIIGHSERREYFHETDEDINKKAKAIFANGMTPIFCCGETLETYEAGKTAEWIEGQITKGLVGLSNEQVASMV-IAYEPIWAIGTGKSADANIADEICGVVRSTVEKLYGKEVSEAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLEADSFLALL 247
>gi|87125684|ref|ZP_01081528.1| triosephosphate isomerase [Synechococcus sp. RS9917] >gi|86166660|gb|EAQ67923.1| triosephosphate isomerase [Synechococcus sp. RS9917] (243 aa)
Score = 204, Expect = 2.1e-14, Identities = 59/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA------DYVSISKFFKNIPNF-ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+       D++++  F   I N  E+  ++VAP +  I     M + +++E+ +QNV +   G  TG +S   L ++G++ A +GH + +  F E + Q+N + +    +G+  ++ + E+    S    +  +R Q+ Q   G+D   +V    + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+++   +D+DG+L+
  S:     1 MRKPVIAGNWKMHMTCAQARDWMTV--FLPLIANTPEDRHLVVAPPFTAISTLAAMGQGSRLELSSQNVHWEGEGAFTGEISPTMLLEHGVRYAIVGHSEPRKYFSESDEQINHRGRSAQSHGLIPIVCVGESDEQRSRGEAERVIRRQVEQGLEGLDPAKLV----VAYEPIWAIGTGKTCEASEANRICGLIR----------SWVGSPDLIIQYGGSVKPGNIDQLMAMSDIDGVLV 224
>gi|187917934|ref|YP_001883497.1| triosephosphate isomerase [Borrelia hermsii DAH] >gi|119860782|gb|AAX16577.1| triosephosphate isomerase [Borrelia hermsii DAH] (254 aa)
Score = 204, Expect = 2.2e-14, Identities = 65/246 (26%), Positives = 122/246 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           MR+  L  NWKM+   V  +   K I +      ++V +M+ P++  +     ++K + V + AQN+S+ + G  T  +S   L ++G+    LGH + +    + +  +N K+   LK+     +L I ET   LSE    + L + +NQI  G+ ++   D  R+ + Y+P +          E      R IR  + + +    A+++ I YGG +  D++  +   ND+DG LI      ++ +++I+ K
  S:     1 MRKMFLAGNWKMHYTSVEAAGVAKQIVDGVQNINDDVVIMITPAFTSLCKVCEVTKGSNVLLGAQNMSYENSGARTSEISPSMLLEFGVDYVILGHSECRTYLGDTDEVINKKILAGLKHPFKYLILCIGET---LSERENNKTLDVVLNQIRRGLMSVSESDLKRIILAYEPVWAIGTGKTATKEEAQEVHRAIRLEIESLYSTSAADDIIIQYGGSVNVDNVGGLMGENDIDGALIGGASLKADSFLNIVNK 251
>gi|24159115|pdb|1MO0|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase >gi|24159116|pdb|1MO0|B Chain B, Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase (275 aa)
Score = 204, Expect = 2.4e-14, Identities = 73/222 (32%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVS---ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKE-NLRLQINQIFN-GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN DY S   I  F     +  +V V+VAP      P L  +K+   A V V AQN      G  TG +S   +KD G++   LGH + +  F E +  +  K    L+ G+  V  I E   +     TK+ N R Q+  I + G+   +IV    I Y+P +          E        IR FL+ K    VA+   I+YGG +  D+  E+ K  D+DG L+
  S:    30 NWKMNGDYASVDGIVTFLNASADNSSVDVVVAPP----APYLAYAKSKLKAGVLVAAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGIKVVFCIGEKLEEREAGHTKDVNFR-QLQAIVDKGVSWENIV----IAYEPVWAIGTGKTASGEQAQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLV 250
>gi|134300821|ref|YP_001114317.1| Triose-phosphate isomerase [Desulfotomaculum reducens MI-1] >gi|134053521|gb|ABO51492.1| triosephosphate isomerase [Desulfotomaculum reducens MI-1] (250 aa)
Score = 204, Expect = 2.4e-14, Identities = 60/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM+   A+ VS  +  K       V+V+V P++  + P     K + + + AQN+ + + G  TG ++   L++ G+K   LGH + +  F E +  VN K++  L+ G+  ++ + ET       ST++ +  Q      G+    +   V I Y+P +         +E      ++IR+ +  +FG   A  + I YGG +   +   +    D+DG L+
  S:     1 MRKLIIAGNWKMHKTVAEAVSFVQELKQKDLGNGVEVVVCPTFTALAPVAEALKGSNIALGAQNMHWEAQGAFTGEIAPAMLQELGVKYVILGHSERRQYFGETDQNVNQKVKAALEVGLVPIVCVGETLEQREAGSTEQIVTQQTTGALAGLRPEQVAGLV-IAYEPIWAIGTGQTASDEDAQQVNQIIRQVIDGQFGGAAAEAVRIQYGGSVKPGNARGLMAQPDIDGGLV 232
>gi|194334367|ref|YP_002016227.1| Triose-phosphate isomerase [Prosthecochloris aestuarii DSM 271] >gi|194312185|gb|ACF46580.1| Triose-phosphate isomerase [Prosthecochloris aestuarii DSM 271] (252 aa)
Score = 204, Expect = 2.6e-14, Identities = 73/244 (29%), Positives = 119/244 (48%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI-DALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+KI++ NWKMN   A+ V +S     I     V    +V +AP++  +    G+     + + AQN  +   G  TG VS   L + G     +GH + +  F + N  VN K++K L  G+N +L + ET  +  +  T E +  Q+ +   G+ D  DIV    I Y+P +    G+  S    + +  +IR       T  G Y    A  + I YGG +   + EE+    D+DG LI      +  +++I+
  S:     1 MRKKIVVGNWKMNKTIAEAVELSSAI--IDQLGEVSASCEVGIAPAFPALSGVHGVISGTGIHLAAQNCHYEDDGAFTGEVSVRMLDEAGCSYVIVGHSERRQYFGDTNPVVNLKVKKALSAGLNVILCVGETLDEREKGITTEVVTCQVKEGLEGVADIGDIV----IAYEPVWAIGTGKTASSLQAQEVHASIRA------TVAGLYSEPAAAGVRIQYGGSVKPSNAEELFAMPDIDGGLIGGASLNAEDFVAIV 246
>gi|55820571|ref|YP_139013.1| triosephosphate isomerase [Streptococcus thermophilus LMG 18311] >gi|55822461|ref|YP_140902.1| triosephosphate isomerase [Streptococcus thermophilus CNRZ1066] >gi|116627380|ref|YP_819999.1| triosephosphate isomerase [Streptococcus thermophilus LMD-9] >gi|81676595|sp|Q5M100|TPIS_STRT1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|122268019|sp|Q03LW9|TPIS_STRTD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|60416424|sp|Q8VVC1|TPIS_STRT2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|55736556|gb|AAV60198.1| triosephosphate isomerase [Streptococcus thermophilus LMG 18311] >gi|55738446|gb|AAV62087.1| triosephosphate isomerase [Streptococcus thermophilus CNRZ1066] >gi|116100657|gb|ABJ65803.1| triosephosphate isomerase [Streptococcus thermophilus LMD-9] (252 aa)
Score = 203, Expect = 2.6e-14, Identities = 60/243 (24%), Positives = 115/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   + +   +  +K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+    +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + +LYGG +  +++ E     DVDG L+         ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNLKVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMIPIICCGESLETYEAGKAAEFVGAQVSAALAGLTPEQVASSV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLEPESFLALL 248
>gi|121535412|ref|ZP_01667223.1| Triose-phosphate isomerase [Thermosinus carboxydivorans Nor1] >gi|121306011|gb|EAX46942.1| Triose-phosphate isomerase [Thermosinus carboxydivorans Nor1] (250 aa)
Score = 203, Expect = 2.7e-14, Identities = 64/230 (27%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM+          ++I         V+V+V P +  +     +     V + AQNV +   G  TG +S   L+D G     +GH + +  F E N  VN K++  L + +  ++ + ET  +    +T   +  Q+     G+ A D V  + I Y+P +    G   S  D   +   IR I   +R  FG   A+ + I YGG +  ++I E+   +D+DG L+
  S:     1 MRKPIIAGNWKMHKTVAEAQALVQDIVRLTADAGEVEVVVCPPFTALYSVRTVVGGTHVRLAAQNVHWEQQGAFTGEISPAMLRDVGCDYCIIGHSERRQYFAETNETVNKKVKAALAHDLIPIMCVGETLAEREAGATAAVVGEQVRGGLAGLTA-DQVAAMVIAYEPVWAIGTGRTASPRDANAVCAFIRAI---VREMFG-DAADRVRIQYGGSVKPENIAELMAQSDIDGALV 232
>gi|139439808|ref|ZP_01773185.1| Hypothetical protein COLAER_02216 [Collinsella aerofaciens ATCC 25986] >gi|133774823|gb|EBA38643.1| Hypothetical protein COLAER_02216 [Collinsella aerofaciens ATCC 25986] (255 aa)
Score = 203, Expect = 2.8e-14, Identities = 69/245 (28%), Positives = 117/245 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIV--DRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           R  ++  NWKMN D    +K    +          V+V+V P  + I       + A + + AQNV + + G  TG  S   LK  G     +GH + +  F E +   N K + L+  G+  V    E+ +++ E  T   +   +NQ+  G++ L+I    +V + Y+P +    G+  +  D + + G IR   E L+  FG  +AN + +LYGG     +I E+    DVDG L+      +  + S++ K
  S:     4 RTLLIAGNWKMNNDVAEAAKLADELAQALPEVPAGVEVLVCPPTIDITTVHDRIQAAPIALGAQNVYWEAKGAFTGESSCDMLKSAGCTYCIIGHSERRDYFHETDEDQNKKAKALVAAGLVPVFCCGES-LEVREAGTY--VEHVVNQVKAGLEGLEITCPKQVVVAYEPIWAIGTGKTATAEDAQEVCGAIR---ETLKEMFGEELANGIRVLYGGSAKPGNIAELVAKPDVDGALVGGASLKAADFASMVVK 252
>gi|168182162|ref|ZP_02616826.1| triosephosphate isomerase [Clostridium botulinum Bf] >gi|182674504|gb|EDT86465.1| triosephosphate isomerase [Clostridium botulinum Bf] (248 aa)
Score = 203, Expect = 2.8e-14, Identities = 59/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG +S   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +EE + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEIKGSNIKVGAQNMHFEESGAYTGEISPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEEREGNITEKVLERQIKVGLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKAMYGEDVASKVRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|17536593|ref|NP_496563.1| Triose Phosphate Isomerase family member (tpi-1) [Caenorhabditis elegans] >gi|21542472|sp|Q10657|TPIS_CAEEL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|3947595|emb|CAA19447.1| C. elegans protein Y17G7B.7, confirmed by transcript evidence [Caenorhabditis elegans] (247 aa)
Score = 203, Expect = 2.9e-14, Identities = 73/222 (32%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVS---ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKE-NLRLQINQIFN-GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN DY S   I  F     +  +V V+VAP      P L  +K+   A V V AQN      G  TG +S   +KD G++   LGH + +  F E +  +  K    L+ G+  V  I E   +     TK+ N R Q+  I + G+   +IV    I Y+P +          E        IR FL+ K    VA+   I+YGG +  D+  E+ K  D+DG L+
  S:    10 NWKMNGDYASVDGIVTFLNASADNSSVDVVVAPP----APYLAYAKSKLKAGVLVAAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGIKVVFCIGEKLEEREAGHTKDVNFR-QLQAIVDKGVSWENIV----IAYEPVWAIGTGKTASGEQAQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLV 230
>gi|146741274|dbj|BAF62292.1| triose phosphate isomerase [Schistosoma haematobium] (253 aa)
Score = 203, Expect = 3.0e-14, Identities = 61/222 (27%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN       K  K +      +N +V++AP  + +     + K  ++ V AQN    S G  TG +S   +KD G +   LGH + +  F E +  +  K+Q  L  G++ +  I ET  +     T+E    Q+  I N I + D   RV + Y+P +    G++ +    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSREDNEKLLKLLSEAHFGDNTEVLIAPPSVFLHDVRKILKK-EIHVAAQNCYKVSKGAFTGEISPAMIKDIGCEWVILGHSERRSIFGESDELIAEKVQHALAEGLSVIACIGETLSERESNKTEEVCVRQLKAIANKIKSADEWKRVVVAYEPVWAIGTGKVATPQQAQEVH---NFLRKWFKTNAPSGVDEKIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|167752416|ref|ZP_02424543.1| hypothetical protein ALIPUT_00660 [Alistipes putredinis DSM 17216] >gi|167660657|gb|EDS04787.1| hypothetical protein ALIPUT_00660 [Alistipes putredinis DSM 17216] (370 aa)
Score = 203, Expect = 3.0e-14, Identities = 68/230 (29%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFEN-----VKVMVAPSYL---GIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI+  NWKMN       +  +NI    N     V  +V P +    G++ +L   + + +EV AQN +    G +TG VS   L   G +   LGH + +  + E +  +N K+ +   NG+  +  + E   +   +   + ++ QI ++   +       R  I Y+P +    G+  +    + I   IR I   LR KFG   A+  PILYGG     +  E+    DVDG LI
  S:   118 MRKKIVAGNWKMNTLPAEGVELAENIRADRNQVCSCVNFIVCPPFTHLGGVIEAL---RGSDIEVGAQNCAAEDKGAYTGEVSAAMLAALGCRYVILGHSERRQYYGETSATLNKKMAQAFANGLQPIYCVGENLEEREADRHFDVVKTQIEEVIYNLTPAQFA-RTVIAYEPVWAIGTGKTATAEQAQEIHAYIRTI---LREKFG-AAADETPILYGGSCKPSNAPELFAKEDVDGGLI 350
>gi|57234490|ref|YP_181477.1| triosephosphate isomerase [Dehalococcoides ethenogenes 195] >gi|123618758|sp|Q3Z8H2|TPIS_DEHE1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|57224938|gb|AAW39995.1| triosephosphate isomerase [Dehalococcoides ethenogenes 195] (251 aa)
Score = 203, Expect = 3.0e-14, Identities = 59/243 (24%), Positives = 109/243 (44%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+ I+  NWKMN          +     +     ++ +V P ++ + P   +   + + + AQN+ +   G +TG +S L L+D       +GH + +  F E    VN K++  L+ G+  ++ + E   +     T++ L  Q+ +   GI+   I+    I Y+P +               TI  IR+ L   +G   +   PILYGG +   +  E+   +D+DG L+      +  ++SI
  S:     1 MRQIIIAGNWKMNTTLSEACTLVQGMKYELDQISGIQKIVCPPFISLAPVKTILDGSSIHLGAQNLFYEEKGAYTGEISPLMLQDI-CPYVIIGHSERRAYFGETGQVVNRKIKAALQAGIMPIVCVGEKLEENENGQTRQILETQMKEALAGINPSSII----IAYEPIWAIGTGKAATAAEANNTISYIRKVLGDIWGNTASRITPILYGGSVNEKNTAELLCQSDIDGALVGGASLKAESFVSI 242
>gi|153891599|ref|ZP_02012599.1| Triose-phosphate isomerase [Opitutaceae bacterium TAV2] >gi|151582328|gb|EDN45881.1| Triose-phosphate isomerase [Opitutaceae bacterium TAV2] (256 aa)
Score = 203, Expect = 3.0e-14, Identities = 66/230 (28%), Positives = 114/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGID------ALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +R+K++  NWKMN      +   + I        +V V+V P Y  +  +    + + V++ AQN+     G +TG +S   L++  +    LGH + +  F E +  +N K+   LKN +  +L + ET   L+E    + L++   QI  G++      AL+IV    I Y+P +    G++ +    + +      IR  L   FG  +A  + ILYGG +   +  E+    D+DG LI
  S:     3 LRKKLIAGNWKMNKTSAEATPLVQEIVAAVGKQTDVDVVVGPPYTALESAGKALEGSVVKLSAQNMHPEKSGAYTGEISAEMLRNLYVTHVILGHSERRTYFAETDAFINKKVLAALKNELKPILCVGET---LAEREGNQTLKVVQTQIEAGLEGVTKEQALNIV----IAYEPVWAIGTGKVATTEQAQEVHA---FIRSLLVKLFGDAIAQKVRILYGGSMKPSNAPELLAQKDIDGGLI 235
>gi|153005141|ref|YP_001379466.1| Triose-phosphate isomerase [Anaeromyxobacter sp. Fw109-5] >gi|152028714|gb|ABS26482.1| Triose-phosphate isomerase [Anaeromyxobacter sp. Fw109-5] (253 aa)
Score = 203, Expect = 3.1e-14, Identities = 64/243 (26%), Positives = 119/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+K +  NWKM+      +   + + +        V+V VAP +  +  ++  ++ + +E+ AQ+V +   G  TG VS   L D G +   +GH + +  F E +  V  K+  LL  G+  ++ + ET  +     T E +  Q+ Q   G+ ++D + R+ I Y+P +    G+  +    + +   IR I   LR   G  VA+ + + YGG +  ++  E+    DVDG L+      +  +I+I+
  S:     3 RQKFVCGNWKMHKTVAETAALVRELRSALGDAAGEVQVAVAPPFTALAAAVEAARGSAIEIAAQDVHWEKQGAFTGEVSAPMLADVGCRHGIVGHSERRQLFGETDEAVRKKVGALLAAGVRPIVCVGETLAEREAGRTLEVVDRQVRQGLAGL-SVDELGRLTIAYEPVWAIGTGKTATSAQAQEVHAAIRRI---LR-DVGAPVADQIRVQYGGSVKPENAAELMAQPDVDGALVGGASLKAADFIAIV 248
>gi|17066728|gb|AAL35375.1|AF442549_1 triosephosphate isomerase [Streptococcus thermophilus] (252 aa)
Score = 203, Expect = 3.1e-14, Identities = 60/243 (24%), Positives = 115/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   + +   +  +K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+    +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + +LYGG +  +++ E     DVDG L+         ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNLKVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMIPIICCGESLETYEAGKAPEFVGAQVSAALAGLTLKQVASSV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLEPESFLALL 248
>gi|26553824|ref|NP_757758.1| triose phosphate isomerase [Mycoplasma penetrans HF-2] >gi|38258588|sp|Q8EW34|TPIS_MYCPE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|26453831|dbj|BAC44162.1| triose phosphate isomerase [Mycoplasma penetrans HF-2] (250 aa)
Score = 203, Expect = 3.1e-14, Identities = 66/228 (28%), Positives = 117/228 (51%)
  Q:     3 EKILITNWKMNADYVSISKFFKNI-PNFENVKVMVAPSYLGIVPSLGMSKNAKV----EVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALD--IVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K++I NWKM      I  F +    N +NVKV     Y   VPS+ +++  ++    +V+AQ+  F + G +TG++SW +LKD GI  + +GH + +  F E +  VN K   L++N M AV+ + ET   L E    ++  +  NQ    +  +    +  V I Y+P +          + +   I+ +R+ L   +      +L +LYGG + + + EE  K  +++G L+
  S:     2 KKLIIANWKMFKTLNDIKTFKEEFDKNIKNVKVNA--DYSVGVPSIYLNQAKEILKGIKVIAQDAHFKNEGAYTGNISWSQLKDCGIDGSIIGHSERRQMFNETDETVNLKTISLVENNMQAVVCVGET---LEEYEANKSFDVVWNQTKKALANVSEAQLKNVVIAYEPVWAIGTGKVPTGKEVDDLIQKVRDELSKLYSKQAVESLVVLYGGSVNDKNAEEFFKQKNINGALV 231
>gi|187235580|gb|ACD02003.1| putative triosephosphate isomerase [Clostridium septicum] (234 aa)
Score = 203, Expect = 3.2e-14, Identities = 58/229 (25%), Positives = 109/229 (47%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKM+    + V +    K +    N  V++ P+++ +  +L  +  + +++ AQN+ F   G  TG V+   L+  G+    LGH + +  F E +  +N K++    + +  +L   ET       +T   +  QI     G+   ++ ++V + Y+P +         NE    TI  IR  L   FG  VA+ + I YGG +  + I++    +++DG L+
  S:     1 RKPIIAGNWKMHYTPEEAVKVITELKPLVKDANCDVVICPTFVCLDAALKAAAGSNIKIGAQNMHFEEKGAFTGEVAPGMLEAMGVDYVVLGHSERREYFNETDEALNKKVKVAFAHNLTPILCCGETLEQRENGTTNAVVGAQIKADLEGLSK-ELAEKVVVAYEPIWAIGTGKTATNEQANETIAAIRGILAEMFGKEVADKIRIQYGGSVKPNTIKDQMAMSEIDGALV 231
>gi|160902889|ref|YP_001568470.1| phosphoglycerate kinase., Triose-phosphate isomerase [Petrotoga mobilis SJ95] >gi|160360533|gb|ABX32147.1| Phosphoglycerate kinase., Triose-phosphate isomerase [Petrotoga mobilis SJ95] (655 aa)
Score = 203, Expect = 3.3e-14, Identities = 62/226 (27%), Positives = 112/226 (49%)
  Q:     5 ILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           IL  NWKMN         +SK    I   +  +V+V P +  +     ++  + ++V AQNV +   G +TG +S   LKD G++   LGH + +  F+E +  +N KL+K+L +G+  +L + E   +  +  T   +  QI +   G+   +   ++ I Y+P +    G++ +    + +    + IR+ L+  F    A    ILYGG I  ++   +    D+DG L+
  S:   406 ILAGNWKMNKTNAEAAEFVSKLIGQIKTQDKFEVIVCPPFTALEKVRDITSTSSIKVGAQNVYYEDKGAYTGEISVNMLKDIGVEYVILGHSERRHIFQESDELINKKLKKVLASGLKPILCVGEQLEEREKGLTFNVVERQIKEALYGLTEEE-SKKIIIAYEPVWAIGTGKVATPNQAQEVH---KFIRDLLKDIFNEEFAKKTTILYGGSIKPNNYLGLFGKPDIDGGLV 634
>gi|27262472|gb|AAN87517.1| Triosephosphate isomerase [Heliobacillus mobilis] (251 aa)
Score = 203, Expect = 3.3e-14, Identities = 62/230 (26%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM+   A+ V++++  K+      V++++ P +  +       + + V V AQN+ +   G  TG VS   +KD G K   LGH + +  F E +  VN K++  + + +  ++ + ET        T++ +  Q      G+ A ++ D V I Y+P +    G   S  D + +   IR +   +   FG   A  + I YGG +   + E +    D+DG L+
  S:     1 MRKTIIAGNWKMHKTIAEAVTLAEAIKSQNPNPTVEIVICPPFTALAEVAKAVQGSPVAVAAQNMHWEVQGAFTGEVSPAMVKDAGCKYVVLGHSERRQYFGETDETVNKKVKAAIAHELIPIVCVGETLEQREAGQTEDVVATQTKGGLAGLSAQEVADLV-IAYEPVWAIGTGRTASDDDAQQVNAYIRSV---VAEVFGKEAAEAVRIQYGGSVKPSNAENLLAKGDIDGALV 232
>gi|163812798|ref|ZP_02204458.1| Triose-phosphate isomerase [Dehalococcoides sp. VS] >gi|157403570|gb|EDO69630.1| Triose-phosphate isomerase [Dehalococcoides sp. VS] (251 aa)
Score = 202, Expect = 3.5e-14, Identities = 58/243 (23%), Positives = 113/243 (46%)
  Q:     1 MREKILITNWKMNADY----VSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+ I+  NWKMN       + +      +   + ++ +V P ++ +     + +N+ +++ AQN+ +   G +TG +S L LK+   +   +GH + +  F E    VN K++  ++ G+  ++ + E   +  +  T++ L  Q+ +  NG+    I+    I Y+P +                I  IR+ L    G   A    ILYGG +   +  E+   +D+DG L+      ++ +ISI
  S:     1 MRQIIIAGNWKMNTTLSEACILVQSMKGELETIDGIEKIVCPPFISLSHIKTILENSSIKLGAQNLFYEEKGAYTGEISPLMLKEL-CQYVIIGHSERREYFGETGQVVNQKIKAAIQAGILPIVCVGEKLEENEKGQTRQVLETQLKEALNGLSLSSII----IAYEPIWAIGTGKAATASAANAAICYIRKVLSEILGNTAARKSSILYGGSVNEKNTAELLSQSDIDGALVGGASLKADSFISI 242
>gi|124521746|ref|ZP_01696598.1| triosephosphate isomerase [Bacillus coagulans 36D1] >gi|124496562|gb|EAY44152.1| triosephosphate isomerase [Bacillus coagulans 36D1] (253 aa)
Score = 202, Expect = 3.6e-14, Identities = 60/244 (24%), Positives = 110/244 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN        F +    ++P    V  ++    L +   +  +K  +V++ AQN+ +   G  TG +S + L D  ++   LGH + +  F E +  VN K++    + +  ++ + ET        TK+ +  Q+   F G+   D   +V + Y+P +          E        IR  +  +F   VA+++ I YGG +   +I+E  +  D+DG L+         Y+ +L
  S:     1 MRKPIIAGNWKMNKTLPEALAFTEEVKHSVPGESVVDSVICAPALFLERLVEATKGTRVKIGAQNMHYEESGAFTGEISPVALADLHVEYVILGHSERREMFNETDEAVNKKVKAAFAHHLTPIVCVGETLAQRENNETKQIVGSQVKAAFAGLSD-DEAKQVVVAYEPIWAIGTGKSSTAEDANEVCAYIRSVIADQFSRNVADSVRIQYGGSVKPGNIKEFMEQPDIDGALVGGASLDPQSYLQLL 247
>gi|157151151|ref|YP_001450061.1| triosephosphate isomerase [Streptococcus gordonii str. Challis substr. CH1] >gi|189036028|sp|A8AWA1|TPIS_STRGC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|157075945|gb|ABV10628.1| triosephosphate isomerase [Streptococcus gordonii str. Challis substr. CH1] (252 aa)
Score = 202, Expect = 3.7e-14, Identities = 60/243 (24%), Positives = 115/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   + +   L  +K + ++V AQN  F + G  TG  S   LK+ G     +GH + +  F E +  +N K + +  NGM  ++   E+          E +  Q++    G+ A  +   V I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPAVDLTAVLAAAKGSNLKVAAQNCYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFANGMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVASTV-IAYEPIWAIGTGKSASQDDAQKM---CKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 248
>gi|167747912|ref|ZP_02420039.1| hypothetical protein ANACAC_02642 [Anaerostipes caccae DSM 14662] >gi|167652643|gb|EDR96772.1| hypothetical protein ANACAC_02642 [Anaerostipes caccae DSM 14662] (248 aa)
Score = 202, Expect = 3.9e-14, Identities = 59/230 (25%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN   ++ V++    K +   E   V+     + I  ++  +K + + + A+N+ +   G +TG ++   L D G+K   +GH + +  F E +  VN K+ K  ++G+  ++   ET     +  T + +R QI   F G+ A D      I Y+P +          E      + IRE +   +    A+ + I YGG +      E+   +D+DG L+
  S:     1 MRKTIVAGNWKMNKTPSETVALVNELKPLVASETSDVVFCVPAICIPAAIEAAKGSNINIGAENMYYEESGAYTGEIAPNMLTDLGVKYVIIGHSERREYFAETDETVNKKVLKAFEHGITPIVCCGETLAQREQGVTIDFVRQQIKIAFQGVTA-DQAKTAVIAYEPIWAIGTGKVATTEQAQEVCKAIRECIAEVYDQATADAIRIQYGGSVSAASAPELFAQDDIDGGLV 232
>gi|146318185|ref|YP_001197897.1| triosephosphate isomerase [Streptococcus suis 05ZYH33] >gi|146320372|ref|YP_001200083.1| triosephosphate isomerase [Streptococcus suis 98HAH33] >gi|160196654|sp|A4VZZ4|TPIS_STRS2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|160196655|sp|A4VTQ8|TPIS_STRSY Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|145688991|gb|ABP89497.1| putative triosephosphate isomerase [Streptococcus suis 05ZYH33] >gi|145691178|gb|ABP91683.1| putative triosephosphate isomerase [Streptococcus suis 98HAH33] (250 aa)
Score = 202, Expect = 4.0e-14, Identities = 59/243 (24%), Positives = 114/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F + I    P  + ++  +A   + +   L  +K+++++V AQN  F   G  TG  S   L + G+    +GH + +  F E +  +N K   + +NG+  ++   E+          E +  Q++     + A D V  + I Y+P +    G+  +K D +      + +R+ +   FG  VA+ + + YGG +   ++ E     DVDG L+      +  ++++L
  S:     3 RKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSELKVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRNGLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTA-DQVASLVIAYEPIWAIGTGKSATKDDAQ---NMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLEAESFLALL 248
>gi|15643452|ref|NP_228498.1| phosphoglycerate kinase/triose-phosphate isomerase [Thermotoga maritima MSB8] >gi|6226667|sp|P36204|PGKT_THEMA Bifunctional PGK/TIM [Includes: Phosphoglycerate kinase ; Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)] >gi|4981212|gb|AAD35771.1|AE001741_4 phosphoglycerate kinase/triose-phosphate isomerase [Thermotoga maritima MSB8] (654 aa)
Score = 202, Expect = 4.0e-14, Identities = 62/229 (27%), Positives = 113/229 (49%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPN----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ IL  NWKM+       KF   + N     +  +++V P +  +     +     +++ AQNV +   G  TG +S L L++ G++   +GH + +  FKE +  +N K++ +L+ GM  +L + ET  +  +  T   +  Q+ + F G+D  +   RV I Y+P +    G + +    + +      IR+ L   +    A ++ ILYGG I  D+   +    D+DG L+
  S:   402 RKLILAGNWKMHKTISEAKKFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTFCVVEKQVREGFYGLDKEE-AKRVVIAYEPVWAIGTGRVATPQQAQEVHA---FIRKLLSEMYDEETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLV 633
>gi|153932906|ref|YP_001382632.1| triosephosphate isomerase [Clostridium botulinum A str. ATCC 19397] >gi|153935201|ref|YP_001386184.1| triosephosphate isomerase [Clostridium botulinum A str. Hall] >gi|171769223|sp|A7FQN8|TPIS_CLOB1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|152928950|gb|ABS34450.1| triosephosphate isomerase [Clostridium botulinum A str. ATCC 19397] >gi|152931115|gb|ABS36614.1| triosephosphate isomerase [Clostridium botulinum A str. Hall] (248 aa)
Score = 202, Expect = 4.0e-14, Identities = 58/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG ++   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +EE + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEEREGNITEKVLEGQIKVGLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKAMYGESVADKIRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|6730109|pdb|1B9B|A Chain A, Triosephosphate Isomerase Of Thermotoga Maritima >gi|6730110|pdb|1B9B|B Chain B, Triosephosphate Isomerase Of Thermotoga Maritima >gi|441103|gb|AAA67520.1| triosephosphate isomerase (255 aa)
Score = 202, Expect = 4.1e-14, Identities = 62/229 (27%), Positives = 113/229 (49%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPN----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ IL  NWKM+       KF   + N     +  +++V P +  +     +     +++ AQNV +   G  TG +S L L++ G++   +GH + +  FKE +  +N K++ +L+ GM  +L + ET  +  +  T   +  Q+ + F G+D  +   RV I Y+P +    G + +    + +      IR+ L   +    A ++ ILYGG I  D+   +    D+DG L+
  S:     3 RKLILAGNWKMHKTISEAKKFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQGAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTFCVVEKQVREGFYGLDKEE-AKRVVIAYEPVWAIGTGRVATPQQAQEVHA---FIRKLLSEMYDEETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLV 234
>gi|147679056|ref|YP_001213271.1| triosephosphate isomerase [Pelotomaculum thermopropionicum SI] >gi|146275153|dbj|BAF60902.1| triosephosphate isomerase [Pelotomaculum thermopropionicum SI] (255 aa)
Score = 202, Expect = 4.2e-14, Identities = 62/229 (27%), Positives = 112/229 (48%)
  Q:     2 REKILITNWKM---NADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKM     + V+ ++  K  +   + V++ V P +  +VP     +   + V AQ+V +   G  TG VS L LKD G     +GH + +  F E + +VN K++  L +G+  ++ + ET  +     T+E +R Q      G+   +    + I Y+P +    G+  S+ D + + G    IR  +R  +G   A  + I YGG +  ++   +    D+DG L+
  S:     4 RKPLIAGNWKMFKTVPEAVAFAQELKTAVAGVDGVEIAVCPPFTALVPVAEALRGTGIAVGAQDVHWEESGAFTGEVSPLMLKDAGCSYVIIGHSERRQLFGETDEKVNRKVRAALAHGLTPIMCVGETLEEREAGVTEEVVRRQAESGLAGLTP-EQAGGLVIAYEPVWAIGTGKTASEQDAQQMIG---FIRGLVRDLYGAGAAGAMRIQYGGSVKPENAAGLMAQPDIDGALV 235
>gi|110639649|ref|YP_679859.1| triosephosphate isomerase [Cytophaga hutchinsonii ATCC 33406] >gi|123058521|sp|Q11PZ7|TPIS_CYTH3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|110282330|gb|ABG60516.1| triosephosphate isomerase [Cytophaga hutchinsonii ATCC 33406] (251 aa)
Score = 202, Expect = 4.3e-14, Identities = 69/243 (28%), Positives = 110/243 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSK-----NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+K++  NWKMN            + N    +V    + +  +P + ++      N KV + AQNV     G  TG +S   LK  G+K   +GH + +  F E N Q+  K+   L NG+  +    ET   L++     ++     Q+   +  L   D  +V I Y+P +         +E        IRE L +K+G  VA+ + ILYGG +  D+ + +    D+DG LI      S  +I I
  S:     1 MRKKVIAGNWKMNKTLEEGLSLASEVANMAKDEVPADVNLVMCIPYISLAAVSKVINDKVAIGAQNVYQKESGAFTGEISAPMLKSVGVKYVIIGHSERREYFGETNQQLADKVTISLANGLTPLFCCGET---LAQREAGIHINFVNAQLTESLFHLSPEDFKKVVIAYEPIWAIGTGVTASDEQAQEMHAKIREHLASKYGAAVADEISILYGGSMKPDNAKGLLACKDIDGGLIGGASLKSRDFIDI 247
>gi|89210713|ref|ZP_01189099.1| Triosephosphate isomerase [Halothermothrix orenii H 168] >gi|89159683|gb|EAR79345.1| Triosephosphate isomerase [Halothermothrix orenii H 168] (250 aa)
Score = 202, Expect = 4.3e-14, Identities = 61/246 (24%), Positives = 116/246 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           MR   +  NWKMN    + V++ +  K+ +     V++ V P  + +     + K+  ++V AQN+ +   G  TG +S + L+D  +    +GH + +  F E +  VN K+Q    +G+  ++ + E+  +  E  T++ ++ Q+     G+    + D V I Y+P +          E     I+ IRE +   F     + + I YGG +   +IE+  K +D+DG L+      +  +  I+ K
  S:     1 MRTPFIAGNWKMNLTLKESVALVEELKDLVSGVTGVEIAVCPPAVNLTRVQEVLKDTSIKVGAQNMHWEDSGAFTGELSPVMLRDIDVDYIIIGHSERRQYFNETDQIVNRKVQAAHTHGLKPIICVGESLDEREEGKTRQVVKAQVKSALAGLTKDQVADSV-IAYEPIWAIGTGKSATAEEANDVIKFIRETVNQDFD-GAGDAMRIQYGGSVKPHNIEDFIKQSDIDGALVGGASLKAESFAEIVKK 248
>gi|88194557|ref|YP_499353.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|122539967|sp|Q2G030|TPIS_STAA8 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|87202115|gb|ABD29925.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus NCTC 8325] (253 aa)
Score = 202, Expect = 4.4e-14, Identities = 67/230 (29%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK----VMVAPSYL--GIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKEN--LRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN        F   +P   + K    V+ AP+     +  ++   K   +E+ AQN  F   G  TG  S + L D G+K   +GH + +  F E + ++N K   + K+GM  ++ + ET  D   ES K N  +  Q+ +   G+   D +  V I Y+P +    G+ ++  D   +   +R     L +K    V+    I YGG +  ++I+E     D+DG L+
  S:     1 MRTPIIAGNWKMNKTVQEAKDFVNTLPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGET--DEERESGKANDVVGEQVKKAVAGLSE-DQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSK---EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALV 235
>gi|193214256|ref|YP_001995455.1| Triose-phosphate isomerase [Chloroherpeton thalassium ATCC 35110] >gi|193087733|gb|ACF13008.1| Triose-phosphate isomerase [Chloroherpeton thalassium ATCC 35110] (252 aa)
Score = 201, Expect = 4.5e-14, Identities = 63/244 (25%), Positives = 108/244 (44%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+K +  NWKMN D +        I           +V +AP++L       +   + +++ AQN  +   G +TG +S   L++ G +   LGH + +  F E +  VN K++  L   ++ ++ + ET        TK  +  Q+      + A D+   V I Y+P +          E        IR  ++  FG  VAN L I YGG +   + +E+    D+DG LI      +  ++ I+
  S:     1 MRKKFVAGNWKMNKDLLGAVSLATEILQLLGDEAPTCEVAIAPTFLCQQAVFQVIDESAIKLAAQNCFYEDQGAYTGEISAAMLRNSGCEYVILGHSERRQYFNETDEIVNKKVKNALSVELDVIMCVGETLEQRESGVTKSVVETQVRGGLKDLTAEDM-KSVVIAYEPVWAIGTGKTATPEQAQEVHAFIRGIVKDMFGEEVANELRIQYGGSVKTSNAKELFGMPDIDGGLIGGASLNAEDFVEII 248
>gi|160943254|ref|ZP_02090490.1| hypothetical protein FAEPRAM212_00740 [Faecalibacterium prausnitzii M21/2] >gi|158445493|gb|EDP22496.1| hypothetical protein FAEPRAM212_00740 [Faecalibacterium prausnitzii M21/2] (285 aa)
Score = 201, Expect = 4.9e-14, Identities = 64/229 (27%), Positives = 109/229 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKN-IPNFENV--KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKMN      +      IP  ++   +V++   +  +V ++  +K   + V A+NV F   G  TG +S   L D G++   +GH + +  F E +  VN +    L  G+  +L + E+     E  T+E +R+Q       + A + ++ V I Y+P +    G+  +    E +   IR V+ E     +G  VA    + YGG +   + EE+    DVDG LI
  S:    35 RKAIIAGNWKMNKTASEAAVLVDELIPAVKDATCEVVICTPFTDLVTAVAKTKGTNIHVGAENVHFEKSGAFTGEISADMLVDLGVEYVIVGHSERRQYFAETDQTVNKRTLAALNAGLKVILCVGESLQQREEGVTEELVRMQTKIALRDVTA-EQMENVVIAYEPVWAIGTGKTATSDQAEEVCAQIRKVVGEL----YGEAVAEATTVQYGGSMNAKNCEELLSKKDVDGGLI 265
>gi|78213346|ref|YP_382125.1| triosephosphate isomerase [Synechococcus sp. CC9605] >gi|78197805|gb|ABB35570.1| triosephosphate isomerase [Synechococcus sp. CC9605] (248 aa)
Score = 201, Expect = 5.0e-14, Identities = 56/230 (24%), Positives = 116/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFK-------NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +R  ++  NWKM+       +F +       + P  ++  +++AP +  +     +S+N++V + +QNV +   G  TG +S   LK++G+    +GH + +  F E + Q+N + +    NG+  ++ + E+         +  +R QI Q   G+DA    +++ + Y+P +    G+  +  +   I G IR           +  + +L I YGG +   +I+E+   +D+DG+L+
  S:     6 VRRPVIAGNWKMHMTCAQSREFMEAFLPLIADTP--DDRDLVLAPPFTALSTMAELSRNSRVCLSSQNVHWEGQGAFTGEISPAMLKEHGVTHTIVGHSEPRKYFSESDEQINHRARSSQSNGLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDA----EKLVVAYEPIWAIGTGKTCAAEEANRICGLIR----------SWVGSPDLVIQYGGSVKPSNIDELMGMSDIDGVLV 229
>gi|148378231|ref|YP_001252772.1| triosephosphate isomerase [Clostridium botulinum A str. ATCC 3502] >gi|148287715|emb|CAL81780.1| triosephosphate isomerase [Clostridium botulinum A str. ATCC 3502] (248 aa)
Score = 201, Expect = 5.1e-14, Identities = 58/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG ++   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +EE + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEEREGNITEKVLEGQIKVGLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKAMYGESVADKVRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|194246567|ref|YP_002004206.1| Triosephosphate isomerase [Candidatus Phytoplasma mali] >gi|193806924|emb|CAP18353.1| Triosephosphate isomerase [Candidatus Phytoplasma mali] (258 aa)
Score = 201, Expect = 5.2e-14, Identities = 71/230 (30%), Positives = 118/230 (51%)
  Q:     1 MREKILIT-NWKMNADYVSISKFF----KNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M+ KIL+  NWKM        +F       IP+FE ++ ++ P +  ++ SL   + +K+++ AQN    + G  TG +S   LK  GIK   LGH +    F E    +N K+   LK  +  +L I E       +  K  L  ++ ++FNG+  LD V  + I Y+P++    GEI+  FD   I   IR         F   +A+ + I+YGG +   +I++I +  ++DG+L+
  S:     1 MKRKILVAGNWKMYKSKDEALEFIYQINTKIPSFEQIETIIFPQFT-LLDSLIQREGSKLQIGAQNTFHKTEGPFTGEISPKNLKQLGIKYVLLGHSERINLFHETYELINLKVLASLKEKIKIILCIGENIKINEIQKKKLFLAEKLKKLFNGVSLLD-VKNIVIAYEPSWSIGTGEISDLFDINKIIKFIRKKISQF---FSLEIADEIRIIYGGSVNVSNIQDILEQKEIDGVLV 233
>gi|194467651|ref|ZP_03073638.1| Triose-phosphate isomerase [Lactobacillus reuteri 100-23] >gi|194454687|gb|EDX43584.1| Triose-phosphate isomerase [Lactobacillus reuteri 100-23] (259 aa)
Score = 201, Expect = 5.3e-14, Identities = 58/230 (25%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF--ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +I NWKMN +      F K I      N ++ +A   + +     ++ ++ ++++AQN S    G +TG +S   L D G+    LGH + +  F E N  +N K+   L  G+  ++  +E  V          +  Q+  +  G+ A + + ++ I Y+P++      + + +      + IR+ L   +G  +   + ILYGG +  ++I +I    +VDG LI
  S:     1 MRKPFIIANWKMNKNVHESVAFVKAIKGKLPANKEIGIAAQAVSLYNMKKVAGSSNLQIIAQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNESNDSINQKVLAALNAGIIPIICTDEEMVQTEVNGKIHYVFRQLKSVLKGVPA-NKLSQIVISYEPSWAVGSTHQANPDIAEEGCQAIRQSLVEMYGNGIGEQVRILYGGSVNPENIGQIMSKPNVDGALI 231
>gi|160892539|ref|ZP_02073329.1| hypothetical protein CLOL250_00068 [Clostridium sp. L2-50] >gi|156865580|gb|EDO59011.1| hypothetical protein CLOL250_00068 [Clostridium sp. L2-50] (275 aa)
Score = 201, Expect = 5.5e-14, Identities = 65/229 (28%), Positives = 109/229 (47%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN   +  V + +  K +   ++V V+     + IVP +   K   VEV A+N+ F   G +TG +S   L D G+K   +GH + +  FKE +  +N K++K  + G+  +L   E+        T + +RLQI      I A D V  + I Y+P +         ++      + IR+ +   +    A  + I YGG +   +  E+    D+DG L+
  S:    28 RKKIIAGNWKMNMTPSQAVKLCEELKPLVANDDVDVVYCVPAIDIVPVVEAVKGTNVEVGAENMYFEEKGAYTGEISAEMLVDAGVKYVIIGHSERRDYFKECDCLLNKKVKKAFEAGLTPILCCGESLEQREMGITLDFIRLQIKSDLKDITA-DQVKSMVIAYEPIWAIGTGKTATSDQAQEVCKAIRDCIAEVYDTDTAEAVRIQYGGSMNAGNAAELLAKPDIDGGLV 258
>gi|146162132|ref|XP_001008794.2| triosephosphate isomerase [Tetrahymena thermophila SB210] >gi|146146531|gb|EAR88549.2| triosephosphate isomerase [Tetrahymena thermophila SB210] (256 aa)
Score = 201, Expect = 5.5e-14, Identities = 61/222 (27%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPN---FE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N           N+ N   F+   V V+VAP +L  VP +       V+V  QN S    G +TG +S   +KD G+  A LGH + +  + E N  V  K++  ++NG++ +  + E   D     T + +  Q+  I   ++     +++ I Y+P +    G++ +    + +      IR +L  K    V+    ILYGG +   +  E+    D+DG L+
  S:    11 NWKCNNTLAQTKDLVNNVLNKLHFDPAKVDVVVAPVFLH-VPWVAEHIQKPVQVSVQNTSLTGTGAYTGEISVAHVKDLGLNWAILGHSERRQYYGETNEVVANKVKYAVENGLDVIACVGEHLADREANQTNQVVEGQLEAIRGKLNEAQW-EKIVIAYEPVWAIGTGKVATPAQAQEVH---EFIRSYLTQKVSQNVSQKTRILYGGSVTEKNAGELIHQKDIDGFLV 235
>gi|170761014|ref|YP_001785559.1| triosephosphate isomerase [Clostridium botulinum A3 str. Loch Maree] >gi|169408003|gb|ACA56414.1| triosephosphate isomerase [Clostridium botulinum A3 str. Loch Maree] (248 aa)
Score = 201, Expect = 5.7e-14, Identities = 58/230 (25%), Positives = 119/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG +S   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +E+ + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  +++ +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEESGAYTGEISPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEQREGNVTEKVLEGQIKVDLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKSMYGEDVASKVRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|163723433|ref|ZP_02130968.1| Triose-phosphate isomerase [Desulfatibacillum alkenivorans AK-01] >gi|161403373|gb|EDQ27606.1| Triose-phosphate isomerase [Desulfatibacillum alkenivorans AK-01] (253 aa)
Score = 200, Expect = 5.9e-14, Identities = 64/229 (27%), Positives = 109/229 (47%)
  Q:     2 REKILITNWKM----NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  ++  NWKM           +   + +   E V VM+AP++  +VP     + + V + AQN+ + + G +TG +S   LK  G     +GH + +  F E +  VN K++  L+ G+ AVL I ET+ +  +E T   L  Q+      I      D + + Y+P + +G   +  D++        IR+ L    G  +A +  ILYGG +   +I  +    D+DG L+
  S:     4 RTPLIAGNWKMFKTPQEAARDAAALAELVKGVEGVDVMIAPTFACLVPVAQALEGSAVALGAQNMHWETEGAYTGELSGPMLKAAGCSHVIIGHSERRQYFGETDETVNKKIKAALEAGLKAVLCIGETEEERDQEKTLNVLDKQLKDGLKDIFPGSGEDALVVAYEPVWAIGTGKTATDDQAQEAHA-FIRKVLAELLGKDLAKSTRILYGGSVKPANIAALMSKPDIDGGLV 236
>gi|113955302|ref|YP_730419.1| triosephosphate isomerase [Synechococcus sp. CC9311] >gi|122945702|sp|Q0IAV3|TPIS_SYNS3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|113882653|gb|ABI47611.1| triosephosphate isomerase [Synechococcus sp. CC9311] (243 aa)
Score = 200, Expect = 6.1e-14, Identities = 58/230 (25%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVK-VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+         I  F   I    N + ++VAP +  I     +S+  ++E+ +QNV +   G +T  +S   LK++ ++ A +GH + +  F E + Q+N + +    NG+  ++ + E+    S    +  +R Q+ Q   G+D   +V    + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+++   +D+DG+L+
  S:     1 MRKPVIAGNWKMHMTCAQARAWIGTFLPLIAELPNDRHLVVAPPFTAISTLAELSEGTRLELSSQNVHWEGEGAYTAEISPSMLKEHNVQYAIVGHSEPRKYFSESDEQINHRARSAQTNGLIPIVCVGESDEQRSRGEAERVIRRQVEQGLEGLDPSQLV----VAYEPIWAIGTGKTCEASEANRICGLIR----------SWVGSPDLIIQYGGSVKPGNIDQLMGMSDIDGVLV 224
>gi|58040644|ref|YP_192608.1| triosephosphate isomerase [Gluconobacter oxydans 621H] >gi|58003058|gb|AAW61952.1| Triosephosphate isomerase [Gluconobacter oxydans 621H] (275 aa)
Score = 200, Expect = 6.2e-14, Identities = 55/223 (24%), Positives = 112/223 (50%)
  Q:     8 TNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           T+WKMN   ++ ++ ++  ++    E ++  V PS+  +     + +++ + V AQN+ +   G  TG VS   + + G     +GH + +  F E ++ VN K+Q  L++G+  ++ I +T  +     ++E L  Q+    +G+   D+  +V + Y+P + +G      +  F+ G    +R  +R   G      +P+LYGG +   +I +     DVDG+ +
  S:    24 TSWKMNKGPSEAIAAARALESFQPPEGIRSFVIPSFTSLRDVCSVLEDSALLVGAQNMHWEDSGAWTGEVSAPMIAECGASIVEIGHSERRQHFGETDWTVNLKVQAALRHGLRPLICIGDTSDEFEFGVSQETLARQVKIALHGVSRKDL-GQVMVAYEPVWAIGSAGRPAEASFVSGIHTRLRAVVRELAG-DSGVRIPLLYGGSVSQANIRDYVALPDVDGVFV 248
>gi|15923764|ref|NP_371298.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926451|ref|NP_373984.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus N315] >gi|21282465|ref|NP_645553.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus MW2] >gi|49483032|ref|YP_040256.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485646|ref|YP_042867.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650116|ref|YP_185714.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus COL] >gi|87162272|ref|YP_493459.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus USA300] >gi|148267234|ref|YP_001246177.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus JH9] >gi|150393283|ref|YP_001315958.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus JH1] >gi|151220955|ref|YP_001331777.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979102|ref|YP_001441361.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus Mu3] >gi|161509045|ref|YP_001574704.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727035|ref|ZP_02759312.1| triose-phosphate isomerase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123486729|sp|Q2FIL9|TPIS_STAA3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|166230012|sp|A7WZS8|TPIS_STAA1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|172048799|sp|A6QF83|TPIS_STAAE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|189036025|sp|A6TZQ3|TPIS_STAA2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|189036026|sp|A5IQX8|TPIS_STAA9 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|189036027|sp|A8Z1A2|TPIS_STAAT Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56749721|sp|Q6GB56|TPIS_STAAS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56749750|sp|Q6GIL6|TPIS_STAAR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56755034|sp|P68822|TPIS_STAAM Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56755035|sp|P68823|TPIS_STAAU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56755036|sp|P68824|TPIS_STAAW Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56755043|sp|P99133|TPIS_STAAN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|71153346|sp|Q5HHP3|TPIS_STAAC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|4490615|emb|CAB38647.1| triosephosphate isomerase [Staphylococcus aureus] >gi|13700665|dbj|BAB41962.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus N315] >gi|14246543|dbj|BAB56936.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus Mu50] >gi|21203902|dbj|BAB94601.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus MW2] >gi|49241161|emb|CAG39839.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244089|emb|CAG42515.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284302|gb|AAW36396.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus COL] >gi|87128246|gb|ABD22760.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|147740303|gb|ABQ48601.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus JH9] >gi|149945735|gb|ABR51671.1| Triose-phosphate isomerase [Staphylococcus aureus subsp. aureus JH1] >gi|150373755|dbj|BAF67015.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721237|dbj|BAF77654.1| triosephosphate isomerase [Staphylococcus aureus subsp. aureus Mu3] >gi|160367854|gb|ABX28825.1| triose-phosphate isomerase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (253 aa)
Score = 200, Expect = 6.2e-14, Identities = 67/230 (29%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK----VMVAPSYL--GIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKEN--LRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN        F   +P   + K    V+ AP+     +  ++   K   +E+ AQN  F   G  TG  S + L D G+K   +GH + +  F E + ++N K   + K+GM  ++ + ET  D   ES K N  +  Q+ +   G+   D +  V I Y+P +    G+ ++  D   +   +R     L +K    V+    I YGG +  ++I+E     D+DG L+
  S:     1 MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGET--DEERESGKANDVVGEQVKKAVAGLSE-DQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSK---EVSEATRIQYGGSVKPNNIKEYMAQTDIDGALV 235
>gi|170755354|ref|YP_001779859.1| triosephosphate isomerase [Clostridium botulinum B1 str. Okra] >gi|169120566|gb|ACA44402.1| triosephosphate isomerase [Clostridium botulinum B1 str. Okra] (248 aa)
Score = 200, Expect = 6.4e-14, Identities = 58/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG ++   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +EE + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEEREGNITEKVLEGQIKVGLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKDMYGESVADKVRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|1036784|gb|AAA79846.1| triosephosphate isomerase (247 aa)
Score = 200, Expect = 6.7e-14, Identities = 72/222 (32%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVS---ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKE-NLRLQINQIFN-GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN DY S   I  F     +  +V V+VAP      P L  +K+   A V V AQN      G  TG +S   +KD G++   LGH + +  F E +  +  K    L+ G+  V  I E   +     TK+ N R Q+  I + G+   +IV    I Y+P +          E        IR FL+ K    VA+   I+YGG +  D+  ++ K  D+DG L+
  S:    10 NWKMNGDYASVDGIVTFLNASADNSSVDVVVAPP----APYLAYAKSKLKAGVLVAAQNCYKVPKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALEAGIKVVFCIGEKLEEREAGHTKDVNFR-QLQAIVDKGVSWENIV----IAYEPVWAIGTGKTASGEQAQEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAADVGKKPDIDGFLV 230
>gi|46446435|ref|YP_007800.1| triose-phosphate isomerase [Candidatus Protochlamydia amoebophila UWE25] >gi|81829024|sp|Q6MD24|TPIS_PARUW Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|46400076|emb|CAF23525.1| probable triose-phosphate isomerase [Candidatus Protochlamydia amoebophila UWE25] (264 aa)
Score = 200, Expect = 6.8e-14, Identities = 62/229 (27%), Positives = 110/229 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI-PNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  ++  NWKM         F K + P  E   ++V +A  +  I P     +N+++ + AQN++  S G  TG ++   +K+ G     LGH + +  +KE N  +N K++K L+ G+  VL + ET  +     T++ +R QI +   G+ A D+   + I Y+P +          E      +  R+ ++  F   +A  + I YGG +   +   + K  D+DG+LI
  S:     6 RPVVITGNWKMYKTVKEACTFAKALLPVVEVSPIQVWIAVPFTAIYPVKQEIRNSRLVIGAQNMNDASEGAFTGEIAGKMVKEAGASFVLLGHSERRHLYKEDNAFINRKVKKALEIGLTPVLCVGETFEERKSGETQQIIRTQIQECLAGLTAEDL-KTLIIAYEPVWAIGNGQNAKPEGAQEIHQFCRKIIKEIFSEELAEQIVIQYGGSVNPSNAISLLKQPDIDGLLI 236
>gi|168177561|ref|ZP_02612225.1| triosephosphate isomerase [Clostridium botulinum NCTC 2916] >gi|182670564|gb|EDT82538.1| triosephosphate isomerase [Clostridium botulinum NCTC 2916] (248 aa)
Score = 200, Expect = 7.1e-14, Identities = 58/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG ++   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +EE + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEEREGNITEKVLEGQIKVGLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKDMYGESVADKVRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|1351281|sp|P48501|TPIS_SCHMA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|161129|gb|AAA29941.1| triose phosphate isomerase >gi|552248|gb|AAA29919.1| triose phosphate isomerase (253 aa)
Score = 200, Expect = 7.1e-14, Identities = 60/222 (27%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN       K  K +      +N +V++AP  +  +  +  S   ++ V AQN    S G  TG +S   ++D G     LGH + +  F E +  +  K+Q  L  G++ +  I ET  +     T+E    Q+  I N I + D   RV + Y+P +    G++ +    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRDDNDKLLKLLSEAHFDDNTEVLIAPPSV-FLHEIRKSLKKEIHVAAQNCYKVSKGAFTGEISPAMIRDIGCDWVILGHSERRNIFGESDELIAEKVQHALAEGLSVIACIGETLSERESNKTEEVCVRQLKAIANKIKSADEWKRVVVAYEPVWAIGTGKVATPQQAQEVH---NFLRKWFKTNAPNGVDEKIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|94969571|ref|YP_591619.1| triosephosphate isomerase [Acidobacteria bacterium Ellin345] >gi|94551621|gb|ABF41545.1| triosephosphate isomerase [Acidobacteria bacterium Ellin345] (250 aa)
Score = 200, Expect = 7.6e-14, Identities = 60/229 (26%), Positives = 105/229 (45%)
  Q:     2 REKILITNWKMN----ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKM+         +  F   + +    ++++ P YL +   +  +K + V V AQN+ +   G  TG  S   L + G+    +GH + +  F E +  VN KL+  L++G+  ++ + E   +     T++ LR Q ++ F GI       ++ + Y+P +          E       VIR      FG   A+ L I YGG +  D+   +    D+DG L+
  S:     3 RKKIIAGNWKMHNTPQQSLAFVKAFLPLVADHTRDEIVLCPPYLSLATVVEATKGSNVMVGAQNMHWEVKGAFTGECSPEMLVESGVTHVIIGHSERRQYFNETDDTVNRKLEVALEHGLTPIVCVGEVLEEREAGLTEDVLRRQCSRAFRGISGKKAA-KLVMAYEPVWAIGTGKTATPEIAEDAHLVIRGEAAKAFGDDFAHALRIQYGGSVKADNARTLMSQPDIDGALV 234
>gi|119952858|ref|YP_945067.1| triosephosphate isomerase [Borrelia turicatae 91E135] >gi|119861629|gb|AAX17397.1| triosephosphate isomerase [Borrelia turicatae 91E135] (254 aa)
Score = 199, Expect = 8.1e-14, Identities = 66/246 (26%), Positives = 120/246 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-FENVK----VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           MR+  L  NWKM+   +  +   K I +  +N+K    VM+ P +  +     +++ + V + AQN+S+   G  T  +S   L ++G+    LGH + +    + +  VN K+   LK+     +L I ET   L E    + L + +NQI  G+ ++   D  R+ + Y+P +          E      R IR  +   +    ANN+ I YGG +  D+++ +   +D+DG LI      ++ +++I+ K
  S:     1 MRKIFLAGNWKMHYTSMEAAGVAKQIVDGVKNIKDDVVVMITPPFTSLCKVCEVTRGSNVLLGAQNMSYEDSGARTSEISPSMLLEFGVDYVILGHSECRTYLGDTDEVVNKKVLAGLKHPFKYLILCIGET---LEERENNKTLDVVLNQIRKGLISVSESDLKRIILAYEPVWAIGTGKTATKEEAQEVHRAIRHEVELLYSVSAANNIIIQYGGSVNIDNVKGLMGESDIDGALIGGASLKADSFLNIVNK 251
>gi|188586627|ref|YP_001918172.1| triosephosphate isomerase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351314|gb|ACB85584.1| triosephosphate isomerase [Natranaerobius thermophilus JW/NM-WN-LF] (256 aa)
Score = 199, Expect = 8.5e-14, Identities = 64/244 (26%), Positives = 120/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISKF-------FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFM---GEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M   I+  NWKMN       +F       ++  P  E V   + P ++ I   +  S    ++  AQNV F   G  TG VS   L + G++   +GH + +  F E + +VN K++  LK G+  ++ + E+    +E  T E +  Q+    + + + D +  V   Y+P +    G+  +  D E +   IR +   L +     VA+++P+LYGG +  +++EE    ++++G L+  +  ++  Y  +L
  S:     1 MARTIIAGNWKMNHGPRETREFVAGMKEKYQTPPAVETV---ICPPFVSISDLVNESPEW-LKTGAQNVYFEESGAFTGEVSPKMLAELGVEYVIIGHSERRNIFAESDEEVNKKVRIALKYGIKPIICVGESDAQRNEGKTLEVVENQVKSALSEVVS-DTLQNVVFAYEPVWAIGSGKAATGEDAEQVCKHIRSVISELNSS----VADDIPVLYGGSVKPENLEEFMDQDNINGALVGGKSLVAETYCQLL 245
>gi|146296957|ref|YP_001180728.1| phosphoglycerate kinase., Triose-phosphate isomerase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410533|gb|ABP67537.1| phosphoglycerate kinase / triosephosphate isomerase [Caldicellulosiruptor saccharolyticus DSM 8903] (650 aa)
Score = 199, Expect = 8.5e-14, Identities = 68/244 (27%), Positives = 119/244 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNF-ENVK---VMVAPSYLGIVPSLGMS-KNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILY 245
           R+KI+  NWKMN       +F + +  + ++V+   V+ APS L  VP +  + +   +++  QN+ +   G +TG +S   LK  G++   +GH + +  F E +  VN K+   LK G+  ++ + ET        T E +RLQ+    NG+   D V++V I Y+P +          E     I VIR  +   +    A  + I YGG + + +  EI    ++DG L+      + ++  IL+
  S:   404 RKKIIAANWKMNKTPAEAKEFVEELKKYIDDVQAEVVICAPSIL--VPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEISGPMLKAVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGITDELVRLQVKIALNGVSRED-VEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEMYDEDTAQKVRIQYGGSVNSTNSAEIFNMPEIDGGLVGGASLNAQEFAKILH 649
>gi|73663223|ref|YP_302004.1| triosephosphate isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123642019|sp|Q49W01|TPIS_STAS1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|72495738|dbj|BAE19059.1| triosephosphate isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (253 aa)
Score = 199, Expect = 8.7e-14, Identities = 66/244 (27%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK----VMVAPSYL--GIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALD--IVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN        F   +P   + K    V+ AP+     +V  +   K   +++ AQN  F   G  TG  S + L D G+K   +GH + +  F E + ++N K   +  +GM  ++ + ET  D   ES K N  +  NQ+   ++ L    + ++ I Y+P +    G+ ++  D   +   +R     L ++    VA+   I YGG +  ++I+E    +D+DG L+       + ++ +L
  S:     1 MRKPIIAGNWKMNKTVKEAKDFINELPTLPDTKEVESVICAPTIQLDALVTLVNDGKAKGLQIGAQNAYFEDNGAFTGETSPVALADLGVKYVVIGHSERREIFHETDEEINKKAHAIFNHGMTPIVCVGET--DEERESGKAN-EVVGNQVKKAVEGLSEAQLQQLVIAYEPIWAIGTGKSSTAKDANEMCAFVRQTVAELSSQ---TVADATRIQYGGSVKPNNIKEYMAESDIDGALVGGASLKVDDFVQLL 249
>gi|145220080|ref|YP_001130789.1| triosephosphate isomerase [Prosthecochloris vibrioformis DSM 265] >gi|189036017|sp|A4SFM8|TPIS_PROVI Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|145206244|gb|ABP37287.1| triosephosphate isomerase [Prosthecochloris vibrioformis DSM 265] (250 aa)
Score = 199, Expect = 9.2e-14, Identities = 63/230 (27%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMS-KNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR KI++ NWKMN      ++    +      +    +  +AP+Y  +  S+G + K ++V +VAQN  +   G  TG VS   L   G     +GH + +  F E +  VN +++K+L  GM A+L + ET   L E  +     +   Q+  G+  +  +  + I Y+P +         +E      ++IR  +   +G   A+ + I YGG +   +  E+    D+DG LI
  S:     1 MRRKIVVGNWKMNKTVAESTELASAVVAALGSDCSACEAGIAPTYPAL-DSVGRTIKGSEVLLVAQNCHYEDDGAFTGEVSTGMLNALGCSYVIIGHSERRQYFGETDATVNLRIKKVLAAGMKAILCVGET---LEERESGAFEAVVSTQVTGGLQGVVDISDIVIAYEPVWAIGTGRTASSEQAQEVHKIIRNKVAELYGAPAADAVRIQYGGSVKPSNAAELFAMPDIDGGLI 232
>gi|56421591|ref|YP_148909.1| triose-phosphate isomerase [Geobacillus kaustophilus HTA426] >gi|81675702|sp|Q5KVE5|TPIS_GEOKA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56381433|dbj|BAD77341.1| triose-phosphate isomerase [Geobacillus kaustophilus HTA426] (253 aa)
Score = 199, Expect = 9.6e-14, Identities = 60/230 (26%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR++I+  NWKM+       +F +N+    P  + V  +V   +L +   +  +    +++ AQ + F   G +TG VS + LKD G+    LGH + +  F E +  VN K+      G+  ++   E+  +     T   +  Q+ +   G+   + V +  I Y+P +    G+ ++  D   + G IR +   L   FG   A  + I YGG +  D+I +      +DG L+
  S:     1 MRKRIIAGNWKMHKTLAEAVQFVENVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTP-EQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL---FGPEAAEAIRIQYGGSVKPDNIRDFLAQEQIDGALV 233
>gi|157363859|ref|YP_001470626.1| Triose-phosphate isomerase [Thermotoga lettingae TMO] >gi|157314463|gb|ABV33562.1| Triose-phosphate isomerase [Thermotoga lettingae TMO] (241 aa)
Score = 199, Expect = 9.7e-14, Identities = 55/200 (27%), Positives = 101/200 (50%)
  Q:    31 NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N K+++ P ++ +     + K + + + AQN  + + G  TG +S + LK+  I+   +GH + +  F E +  +N K++ +L NGM  ++ I ETK +  +  T   +  Q+ Q   G++  D V ++ I Y+P +    G +      + +      IR+ L   +G   A  +PILYGG I  D+   +    D+DG L+
  S:    23 NFKIVLCPPFVCLSDITEILKGSNLHIGAQNCYYENFGAFTGEISPVMLKELNIEYVIIGHSERRHIFGETDEMINKKIKAVLSNGMKPIICIGETKEEREKGLTFCVIESQLRQALFGLNE-DDVRKIVIAYEPVWAIGTGIVAKPHQAQQVH---MFIRKLLEQLYGQEFAQQIPILYGGSIKPDNFLGLMIQPDIDGGLV 221
>gi|85057829|ref|YP_456745.1| triosephophate isomerase [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518098|sp|Q2NIS7|TPIS_AYWBP Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|84789934|gb|ABC65666.1| triosephophate isomerase [Aster yellows witches'-broom phytoplasma AYWB] (274 aa)
Score = 199, Expect = 9.7e-14, Identities = 62/228 (27%), Positives = 109/228 (47%)
  Q:     2 REKILITNWKM----NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGIL 229
           R K++  NWKM    +     I K    +P+   V+ ++ P  L ++  L   + A ++V AQN+ + + G  TG VS   L   G+K   LGH + +  F E +  VN KL   LK+ +   + + E+ +      T+  L  Q+  IF G+   + +  + I Y+P +        + +    TI  IRE +   + +  +  + I+YGG +   +I+ I +   +DGIL
  S:     6 RTKVIAGNWKMHKCKDEALEFIQKVSLQVPDQTQVQTLIFPQ-LTLLDPLVQLQGANLQVGAQNMFYETEGAFTGEVSPQNLLSLGVKHVLLGHSERRTLFGETDQTVNLKLLSALKHKLVPTVCVGESLLTKENNQTQMFLDQQLTNIFAGVPE-EALKNMIIAYEPVWAIGTGKSANPQDANKTIEQIREKVTALYSFQASCAIRIIYGGSLSVANIKSILEQPAIDGIL 235
>gi|153938617|ref|YP_001389591.1| triosephosphate isomerase [Clostridium botulinum F str. Langeland] >gi|171769214|sp|A7G9Y1|TPIS_CLOBL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|152934513|gb|ABS40011.1| triosephosphate isomerase [Clostridium botulinum F str. Langeland] (248 aa)
Score = 199, Expect = 9.8e-14, Identities = 58/230 (25%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG ++   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +EE + +++E+  +  +++ + ++     + + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLEEREGNITEKVLEGQIKVGLKEL-----SKEQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKDMYGENVADKVRIQYGGSVKPGTIKAQMAKEEIDGALV 232
>gi|153814501|ref|ZP_01967169.1| hypothetical protein RUMTOR_00715 [Ruminococcus torques ATCC 27756] >gi|145847995|gb|EDK24913.1| hypothetical protein RUMTOR_00715 [Ruminococcus torques ATCC 27756] (250 aa)
Score = 198, Expect = 9.9e-14, Identities = 61/229 (26%), Positives = 107/229 (46%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R KI+  NWKMN   ++ V++ +  K +   + V V+     + IVP +   K   ++V A+N+ F   G +TG +S   L D G+K   LGH + +  F E N  VN K+ K L++G+  ++   E+     +  T + +R Q+      + + +    + I Y+P +          E      + IRE +   +    A  + I YGG +   +  E+    D+DG L+
  S:     5 RRKIIAGNWKMNKTPSEAVALVEELKPLVANDAVDVVFCVPAIDIVPVVEAVKGTNIQVGAENMYFEESGAYTGEISPAMLVDAGVKYVVLGHSERRDYFGETNEDVNKKVLKALEHGITPIMCCGESLEQREQGVTMDFIRQQVKVGLQNVTS-EQAKTMVIAYEPIWAIGTGKTATTEQAEEVCKAIRECVAEVYDDATAEEIRIQYGGSVNAGNAAELFAQADIDGGLV 235
>gi|116327980|ref|YP_797700.1| triosephosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330860|ref|YP_800578.1| triosephosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122281386|sp|Q04TF0|TPIS_LEPBJ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|122284228|sp|Q052H8|TPIS_LEPBL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116120724|gb|ABJ78767.1| Triosephosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124549|gb|ABJ75820.1| Triosephosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (250 aa)
Score = 198, Expect = 1.0e-13, Identities = 67/230 (29%), Positives = 116/230 (50%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFK-NIPNFENVKV-MVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR--VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKMN    + +S++   K  IP     ++ M+ PS L +     + +  ++ V AQNV    L   TG  S  +LK+ G+K   +GH + +    E N   N K+  LLKN    +  + ET ++     T E +  QI +   GI +    + + + Y+P +    G++ +    + +   IR  +   FL  K    +A ++ ILYGG +  D+I+ + K  D+DG L+
  S:     1 MRKTVIAGNWKMNLSEKEALSLAHSIKEKIPAISKGRISMIFPSTLHLAGVAKILQGTEILVGAQNVYPSGLAAFTGETSPEQLKELGVKVVMIGHSERRQFLGETNSFCNEKIHFLLKNDFIVLYCVGETLMERESGKTFEVISSQIREGLKGIHSHSFSNLI-LAYEPVWAIGTGKVATPAQAQEVHFFIRKEIAGLFLGAK---EIAESISILYGGSVKPDNIQTLLKEKDLDGGLV 236
>gi|150391310|ref|YP_001321359.1| Triose-phosphate isomerase [Alkaliphilus metalliredigens QYMF] >gi|166988095|sp|A6TU32|TPIS_ALKMQ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|149951172|gb|ABR49700.1| Triose-phosphate isomerase [Alkaliphilus metalliredigens QYMF] (248 aa)
Score = 198, Expect = 1.0e-13, Identities = 62/244 (25%), Positives = 120/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN---FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN       +F   I +     +V+V++   +  +  +      +K+++ AQN+ +   G  TG +S   LK+ G+    +GH + +  F E +  VN K++K L+  +  +L + ET   L E    +   +  NQI   ++ +  D +  + I Y+P +    G+  S  D   +   I  IR+ ++ K+   ++  + I YGG +  ++  EI    D+DG L+      ++ ++ I+
  S:     1 MRKPIIAGNWKMNKTVAETLQFINEIRDQAETTDVEVVLCCPFTALSEAKKALGASKIKLGAQNMHWEDNGAFTGEISAEMLKELGVDYILIGHSERRQYFNETDETVNKKIKKALEQKLMPILCVGET---LQEREAAQTFDVIKNQITIDLEGILPDSMKDIVIAYEPIWAIGTGKTASSQDANHV---IAYIRQLIQEKYDDGISETVRIQYGGSVKPENATEIMNEEDIDGALVGGASLKADAFLGIV 246
>gi|160881003|ref|YP_001559971.1| Triose-phosphate isomerase [Clostridium phytofermentans ISDg] >gi|189036003|sp|A9KPF8|TPIS_CLOPH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|160429669|gb|ABX43232.1| Triose-phosphate isomerase [Clostridium phytofermentans ISDg] (248 aa)
Score = 198, Expect = 1.1e-13, Identities = 61/230 (26%), Positives = 114/230 (49%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRV-IREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR KI+  NWKMN   ++ V + +  K +   ++V V+     + +  ++  +K + + + A+N+ +   G +TG ++   L D G+K   +GH + +  F E +  VN K+ K L++G+  ++   E+     +  T + +R QI   F  + A      V I Y+P +    G++ +    + +   IRV I E     +G   A  + I YGG +      E+   +D+DG L+
  S:     1 MRRKIIAGNWKMNKTPSETVKLIEELKPLVKNDDVDVVFCVPAISLTTAIEAAKGSNISIGAENMFYEESGAYTGEIAPNMLTDIGVKYVIIGHSERREYFAESDITVNKKVLKALEHGITPIICCGESLTQREQGITIDWIRQQIKIAFLNVTAEQAATTV-IAYEPIWAIGTGKVATTEQAQEVCAAIRVCIGEL----YGETTAEAIRIQYGGSVTAASAPELFTQSDIDGGLV 232
>gi|110189791|gb|ABG56078.1| triose-phosphate isomerase [Monocercomonoides sp. PA203] (257 aa)
Score = 198, Expect = 1.1e-13, Identities = 65/222 (29%), Positives = 110/222 (49%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    S+    K     ++P  E + V+VAP +L +  ++   K+ +V V +Q+ +   +G +TGS+S   L D GIKT  +GH + +  F E + ++  K+ K L  GMN +  + E   +     T E L  Q+  I     + ++ D  +V I Y+P +          E      + +R +L  K    VA ++ I+YGG +   +  ++ K  DVDG L+
  S:    11 NWKCNGTKGSVDTLIKTLNEADLPPAEALDVVVAPPHLWLTHTIETIKD-RVTVSSQDCNQFGMGAYTGSLSPEMLLDAGIKTTIIGHSERRDIFHENDEEIGKKVAKALSCGMNVIACLGEHLEERKSGKTNEVLFRQLAAI-----SANVTDWSKVVIAYEPVWAIGTGVVATPEQAQEAHQALRGWLNEKVSAEVAASVRIVYGGSVSAVNSADLAKMPDVDGFLV 233
>gi|148543474|ref|YP_001270844.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|184152883|ref|YP_001841224.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|148530508|gb|ABQ82507.1| triosephosphate isomerase [Lactobacillus reuteri F275] >gi|183224227|dbj|BAG24744.1| triosephosphate isomerase [Lactobacillus reuteri F275] (259 aa)
Score = 198, Expect = 1.3e-13, Identities = 57/230 (24%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF--ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +I NWKMN +      F K I      + ++ +A   + +     ++ ++ ++++AQN S    G +TG +S   L D G+    LGH + +  F E N  +N K+   L  G+  ++  +E  V          +  Q+  +  G+ A + + ++ I Y+P++      + + +      + IR+ L   +G  +   + ILYGG +  ++I +I    +VDG LI
  S:     1 MRKPFIIANWKMNKNVHESVAFVKAIKEKLPADKEIGIAAQAVSLYNMKKVASSSNLQIIAQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNESNDSINQKVLAALNAGIIPIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPA-NKLSQIVISYEPSWAVGSTHQANPDIAEEGCQAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMSKPNVDGALI 231
>gi|460257|gb|AAA21679.1| triose phosphate isomerase (252 aa)
Score = 198, Expect = 1.3e-13, Identities = 69/244 (28%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN    + VS  +  K+ IP  +  + +V+P+ L +       K   ++V AQN+ F   G  TG +S + LKD G+    +GH + +  F E +  VN K     K+G+  ++ + ET   L E    +   L  +Q+  G+  L  + V    I Y+P +    G+ ++  D   +      IR+ +   F    A+ L I YGG +   +I+E    +D+DG L+         ++ +L
  S:     1 MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVSPA-LFLEKLASAVKGTDLKVGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHGIVPIICVGET---LEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTAKDANDVCAH---IRKTVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLL 246
>gi|124002632|ref|ZP_01687484.1| triosephosphate isomerase [Microscilla marina ATCC 23134] >gi|123991860|gb|EAY31247.1| triosephosphate isomerase [Microscilla marina ATCC 23134] (253 aa)
Score = 197, Expect = 1.3e-13, Identities = 65/243 (26%), Positives = 112/243 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF-------ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+ I+  NWKMN       K    + N         NV+V++   ++ +     ++   K+ + AQN    + G +TG +S   LK   ++   +GH + +  F E +  +  K   LL + +  +    E+ +D+ E+   E++    NQ+ + +  L   D  R+ I Y+P +         NE        IR F+  K+G  VA   PILYGG +  D+ + +    DVDG L+      S  ++ I
  S:     1 MRQNIVAGNWKMNNTLDEGLKLTSEVVNMVQDELTNNNVQVILGCPFVHLTSVQKLTNGTKLALSAQNCHEEAKGAYTGEISATMLKSVPVQYVIIGHSERRQYFGESHDTLTKKTDTLLAHNLTPIFCCGES-LDIREKG--EHVAYVCNQLKDSLFHLSAEDFARLVIAYEPIWAIGTGVTASNEQAQEMHLAIRSFIADKYGKEVAEGTPILYGGSVKPDNAKALFACPDVDGGLVGGASLKSRDFVDI 249
>gi|167761360|ref|ZP_02433487.1| hypothetical protein CLOSCI_03768 [Clostridium scindens ATCC 35704] >gi|167661026|gb|EDS05156.1| hypothetical protein CLOSCI_03768 [Clostridium scindens ATCC 35704] (259 aa)
Score = 197, Expect = 1.4e-13, Identities = 53/201 (26%), Positives = 102/201 (50%)
  Q:    30 ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEIN-SKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           + +++ + PSY  +  ++       V + AQN+ +   G  TG +S   +++ GI    +GH + +  F E + + N K++  LK+G   +L I ET  +     + E LR Q+   F G+DA D ++ +++ Y+P +   +N +    ++      VI+E LR  FG     ++P+LYGG +   +  ++     VDG+ +
  S:    36 DKIELFIIPSYTSLDAAVKCGDRNYVRIGAQNMCWEDEGQFTGEISPCMIEEMGINLVMIGHSERRHVFGETDVEENRKVRLALKHGFKTLLCIGETAEEKKYGISSEVLRTQLKIGFYGVDASDALN-IWVAYEPVWSIGVNGTPATAQYAEKMHEVIKETLREIFG-ETGESIPVLYGGSVNPQNANQLIIQPSVDGLFV 235
>gi|160940326|ref|ZP_02087671.1| hypothetical protein CLOBOL_05216 [Clostridium bolteae ATCC BAA-613] >gi|158436906|gb|EDP14673.1| hypothetical protein CLOBOL_05216 [Clostridium bolteae ATCC BAA-613] (250 aa)
Score = 197, Expect = 1.4e-13, Identities = 62/229 (27%), Positives = 112/229 (48%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN   ++ V++    K +   E+V V+     + I+P++  +K + + + A+N+ +   G +TG +S   L D G+K   +GH + +  F E +  VN K+ K  ++G+  ++   ET     +  T + +R QI   F  + A D      I Y+P +    G++ +    E +   IRV    +   +    A  + I YGG +      E+    D+DG L+
  S:     3 RKKIIAGNWKMNMTPSEAVALVNELKPLVANEDVDVVFCVPAIDIIPAMEAAKGSNICIGAENMYYEEKGAYTGEISPNMLVDAGVKYVIIGHSERREYFAETDETVNKKVLKAFEHGITPIVCCGETLTQREQGITIDWIRQQIKIAFLNVTA-DQAKTAVIAYEPIWAIGTGKVATTEQAEEVCAAIRVC---IGEIYDEATAEAIRIQYGGSVSASSAPELFAQPDMDGGLV 233
>gi|33520037|ref|NP_878869.1| triosephosphate isomerase [Candidatus Blochmannia floridanus] >gi|39932316|sp|Q7VRL0|TPIS_BLOFL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|33504383|emb|CAD83276.1| triosephosphate isomerase [Candidatus Blochmannia floridanus] (262 aa)
Score = 197, Expect = 1.4e-13, Identities = 68/230 (29%), Positives = 114/230 (49%)
  Q:     1 MREKILITNWKMNAD-------YVSISKFFKNIPNFENVKVMVAPS--YLGIVPSLGMSKNAK-VEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M+   +I NWK+N +        ++++    NIP +  +K+ +AP   Y+ +V +   S N K +E+ +QNV     G  TG +S   LKD  +K   +GH + ++  KE N  +  K   + +  +  +L I E K +    ST+     QI+ I    GI A    +   I Y+P +     S          ++ I +F+R     Y   +AN + I YGG I  D++ E     D+DG+L+
  S:     1 MKNLSIIANWKLNGNKNTITNSLINLTTQLTNIPQY--IKIAIAPPILYIDMVKNHLTSYNNKTIELCSQNVDIHLSGAFTGDISASMLKDLSVKYVLIGHSERRIYHKENNSLIAQKFSIIKQTELIPILCIGENKEERDSGSTQSICIQQIDSIIKLVGIKAF---ENTIIAYEPVWAIGSGSSASPR----NVQSIHQFIRNYIAQYDKTIANQISIQYGGSITTDNVLEFITQKDIDGVLV 236
>gi|123416314|ref|XP_001304868.1| triosephosphate isomerase, putative [Trichomonas vaginalis G3] >gi|121886349|gb|EAX91938.1| triosephosphate isomerase, putative [Trichomonas vaginalis G3] (252 aa)
Score = 197, Expect = 1.4e-13, Identities = 70/230 (30%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR   +  NWK N   V  ++    + N      NV+V+VA  ++  +P+L        +V A+NV     G  TG V+   +K +GI+   LGH + +   KE +  + AK +  L+NGM  +    E   +       E +  QI ++   I A    D V I Y+P +    G++ S  D + +    +VIR+ L  K G  +AN + ILYGG +  ++  E+    DVDG L+
  S:     1 MRTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFV-FLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPA-GKWDDVVIAYEPIWAIGTGKVASTQDAQEM---CKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLV 232
>gi|38258647|sp|Q9GTX8|TPIS_TAESO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|10644117|gb|AAG21132.1|AF244894_1 triose-phosphate isomerase TTPI [Taenia solium] (250 aa)
Score = 197, Expect = 1.5e-13, Identities = 65/244 (26%), Positives = 119/244 (48%)
  Q:     1 MREKILIT-NWKMNADYVSISKFFKNI------PNFENVKVMVAPSYLGIVPSLGMSKNAK-VEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M  K+ +  NWKMN  Y  I+ FF  +      PN  ++ + V   YL         K  K +++ A+N      G  TG +S   +KD G +   LGH + +  F E N  +  K++  L +G+N +  I E   +     T +    Q++ I   + + +  D+V I Y+P +    G+  +    + +    +V+R+++R      +A+ + ILYGG +   + +++    DVDG L+    +L   +I+I+
  S:     1 MTRKLFVGGNWKMNGSYSHINTFFDTLQKADTDPN-ADIVIGVPACYL----KYAQDKAPKGIKIAAENCYKVGSGAFTGEISTEMIKDCGCEWVILGHSERRHIFGESNELIGEKVKHALDSGLNVIPCIGELLSEREAGKTNDVCFAQMDAIAKNVPSKEAWDKVVIAYEPVWAIGTGKTATPAQAQEVH---KVVRDWIRKHVDAGIADKVRILYGGSVTASNAKDLGTQPDVDGFLVGGA-SLKPDFITII 246
>gi|166031733|ref|ZP_02234562.1| hypothetical protein DORFOR_01433 [Dorea formicigenerans ATCC 27755] >gi|166028186|gb|EDR46943.1| hypothetical protein DORFOR_01433 [Dorea formicigenerans ATCC 27755] (249 aa)
Score = 197, Expect = 1.5e-13, Identities = 62/229 (27%), Positives = 102/229 (44%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R KI+  NWKMN   ++ V++    K +   + V V+     + I+P     K   ++V A+N+ F   G +TG +S   L D G+K   LGH + +  F E N  VN K+ K  ++G+  ++   ET     +  T + +R Q+   F  + A D      I Y+P +          E        IR  +   +    A  + I YGG +   +  E+    D+DG L+
  S:     3 RRKIVAGNWKMNKTPSEAVALVNELKPLVANDEVDVVFCVPAIDIIPVAEAVKGTNIQVGAENMYFEESGAYTGEISPAMLVDAGVKYVVLGHSERREYFGETNADVNKKILKAFEHGITPIMCCGETLEQREQGVTMDFIRQQVKVGFQNVTA-DQAKTAVIAYEPIWAIGTGKTATTEQAEEVCAGIRACIAEIYDEATAEAIRIQYGGSVNAGNAAELFAQADIDGGLV 233
>gi|123474305|ref|XP_001320336.1| triosephosphate isomerase, putative [Trichomonas vaginalis G3] >gi|121903139|gb|EAY08113.1| triosephosphate isomerase, putative [Trichomonas vaginalis G3] (252 aa)
Score = 197, Expect = 1.5e-13, Identities = 70/230 (30%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR   +  NWK N   V  ++    + N      NV+V+VA  ++  +P+L        +V A+NV     G  TG V+   +K +GI+   LGH + +   KE +  + AK +  L+NGM  +    E   +       E +  QI ++   I A    D V I Y+P +    G++ S  D + +    +VIR+ L  K G  +AN + ILYGG +  ++  E+    DVDG L+
  S:     1 MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFI-FLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPA-GKWDDVVIAYEPIWAIGTGKVASTQDAQEM---CKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLV 232
>gi|159463610|ref|XP_001690035.1| triose phosphate isomerase [Chlamydomonas reinhardtii] >gi|55792815|gb|AAV65490.1| chloroplast triosephosphate isomerase [Chlamydomonas reinhardtii] >gi|158284023|gb|EDP09773.1| triose phosphate isomerase [Chlamydomonas reinhardtii] (282 aa)
Score = 197, Expect = 1.5e-13, Identities = 62/222 (27%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    +++K         IP    V V+VAP ++ I   +      K ++ AQN      G  TG VS  +L D+G+    LGH + +  F E N  V  K    L  G+  +  I ET    +  S  + L  Q++ +   +D +    +V + Y+P +    G + S    + +      +R++   K G  VA+ L I+YGG + + + +++ K  D+DG L+
  S:    38 NWKCNGSVANVAKLVDELNAGTIP--RGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDAL---VDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHA---YLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLV 259
>gi|112944089|gb|ABI26333.1| triosephosphate isomerase [Lactobacillus reuteri] (259 aa)
Score = 197, Expect = 1.5e-13, Identities = 58/230 (25%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF--ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+  +I NWKMN +      F K I      N ++ +A   + +     ++ ++ ++++AQN S    G +TG +S   L D G+    LGH + +  F E N  +N K+   L  G+  ++  +E  V          +  Q+  +  G+ A + + ++ I Y+P++      + + +        IR+ L   +G  +   + ILYGG +  ++I +I    +VDG LI
  S:     1 MRKPFIIANWKMNKNVHESVAFVKAIKEKLPANKEIGIAAQAVSLYNMKKVAGSSNLQIIAQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNENNDSINQKVLAALNAGIIPIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPA-NKLSQIVISYEPSWAVGSTHQANPDIAEEGCLAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMSKPNVDGALI 231
>gi|16080445|ref|NP_391272.1| triosephosphate isomerase [Bacillus subtilis subsp. subtilis str. 168] >gi|6175067|sp|P27876|TPIS_BACSU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|2635905|emb|CAB15397.1| triose phosphate isomerase [Bacillus subtilis subsp. subtilis str. 168] (253 aa)
Score = 197, Expect = 1.6e-13, Identities = 68/244 (27%), Positives = 115/244 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN    + VS  +  K+ IP  +  + +V    L +       K   ++V AQN+ F   G  TG +S + LKD G+    +GH + +  F E +  VN K     K+G+  ++ + ET   L E    +   L  +Q+  G+  L  + V    I Y+P +    G+ ++  D   +      IR+ +   F    A+ L I YGG +   +I+E    +D+DG L+         ++ +L
  S:     1 MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLASAVKGTDLKVGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHGIVPIICVGET---LEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTAKDANDVCAH---IRKTVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLL 247
>gi|149184600|ref|ZP_01862918.1| triosephosphate isomerase [Erythrobacter sp. SD-21] >gi|148831920|gb|EDL50353.1| triosephosphate isomerase [Erythrobacter sp. SD-21] (253 aa)
Score = 197, Expect = 1.6e-13, Identities = 66/239 (27%), Positives = 112/239 (46%)
  Q:     6 LITNWKMNADYVSISK---FFKNIPNFENVKVMVAPSYLGIVPSLGMSKNA-KVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ NWKMN     +S+     +    +   +V VAP Y  I     + + A ++ + AQ+      G HTG +S   + D G K   LGH + + D KE N Q+NAK++  L+ G+  +L   ET     +    E +  Q+      I+  D  +R+ + Y+P +    G+  +  D E +    R IR  L   +G   +  + ILYGG +  D+  EI    +V G L+      +  ++ I+
  S:     7 IVGNWKMNGTRAMLSEARAIDRAAQRYMKAEVAVAPPYTLI---HAVHREAEQIGIGAQDCHDGDDGAHTGDISAAMVADAGAKFVILGHSERRADHKETNTQINAKIEAALEAGLRIILCCGETLATREKGDAVEFVLKQLKASLPKIE--DAAERLTVAYEPVWAIGTGKTATPKDIEEMH---RAIRGLLDETYGAEQSAEVRILYGGSVKPDNAREILSVPEVGGALVGGASLSAESFLGIV 244
>gi|187777184|ref|ZP_02993657.1| hypothetical protein CLOSPO_00730 [Clostridium sporogenes ATCC 15579] >gi|187774112|gb|EDU37914.1| hypothetical protein CLOSPO_00730 [Clostridium sporogenes ATCC 15579] (248 aa)
Score = 197, Expect = 1.6e-13, Identities = 57/230 (24%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVL----FIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN    + V + K  K +       V+V P+Y+ +   L   K + ++V AQN+ F   G +TG ++   L++ G+    +GH + +  F E +  VN K++K  ++ +  ++     +++ + +++E+  +E +++ + ++       + V+++ I Y+P +         +E    TI  IR  ++  +G  VA+ + I YGG +    I+      ++DG L+
  S:     1 MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKVGAQNMHFEENGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNLIPIVCCGESLDQREGNITEKVLEEQIKVGLKELNK-----EQVEKLVIAYEPIWAIGTGKTATDEQANETIGYIRTVVKAMYGESVADKVRIQYGGSVKPGTIKAQMNKEEIDGALV 232
>gi|160877706|pdb|2OMA|A Chain A, Crystallographic Analysis Of A Chemically Modified Triosephosphate Isomerase From Trypanosoma Cruzi With Dithiobenzylamine (Dtba) >gi|160877707|pdb|2OMA|B Chain B, Crystallographic Analysis Of A Chemically Modified Triosephosphate Isomerase From Trypanosoma Cruzi With Dithiobenzylamine (Dtba) (250 aa)
Score = 197, Expect = 1.7e-13, Identities = 62/228 (27%), Positives = 110/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFK--NIPNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           + I   NWK N     +    +  N   F+ +V+ +VAP++L I  +     N K ++ AQN    S G  TG VS   LKDYGI    LGH + ++ + E N  V  K+ +    G + ++ + ET  +     T   +  Q+  +   +   +   RV I Y+P +    G++ +    + +     ++R ++R+K G  +A  L ILYGG +   +   + +  D++G L+
  S:     5 QPIAAANWKCNGSESLLVPLIETLNAATFDHDVQCVVAPTFLHIPMTKARLTNPKFQIAAQNAITRS-GAFTGEVSLQILKDYGISWVVLGHSERRLYYGETNEIVAEKVAQAXAAGFHVIVCVGETNEEREAGRTAAVVLTQLAAVAQKLSK-EAWSRVVIAYEPVWAIGTGKVATPQQAQEVH---ELLRRWVRSKLGTDIAAQLRILYGGSVTAKNARTLYQMRDINGFLV 233
>gi|73667018|ref|YP_303034.1| triosephosphate isomerase [Ehrlichia canis str. Jake] >gi|72394159|gb|AAZ68436.1| triosephosphate isomerase [Ehrlichia canis str. Jake] (255 aa)
Score = 196, Expect = 1.7e-13, Identities = 62/241 (25%), Positives = 118/241 (48%)
  Q:     5 ILITNWKMNADYVSISKFFKNIP-NFENVK----VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILY 245
           +++ NWKM  D+++ S F K +  N  NVK    V++ P ++ + P + +   + ++  AQN  + + G +TG VS   L D G     +GH + +  F E +Y V  K    +K+G+  ++ + ET +D      K++L   +NQ +N   +     +  I Y+P +    N+    + I   + VIR +  T           I+YGG +  D+I ++   N + G+L+       + + +I++
  S:    19 LIVANWKMYGDFITFSSFTKELSINLTNVKADLEVVLCPPFIAL-PKV-VDCISCIKFGAQNCFYETEGKYTGEVSAKMLYDCGCSYVIVGHSERRSIFHESDYHVQLKASAAIKSGLIPIVCVGETLLDRENGMLKDSL---LNQCYN---SFPKSGKFIIAYEPVWAIGSNTIPSIDMITEALEVIRSYDSTS---------DIIYGGAVNQDNIRDVIAINQLSGVLVGSASLKLDSFYNIIH 247
>gi|1730005|sp|P52270|TPIS_TRYCR Triosephosphate isomerase, glycosomal (TIM) (Triose-phosphate isomerase) >gi|6137635|pdb|1CI1|A Chain A, Crystal Structure Of Triosephosphate Isomerase From Trypanosoma Cruzi In Hexane >gi|6137636|pdb|1CI1|B Chain B, Crystal Structure Of Triosephosphate Isomerase From Trypanosoma Cruzi In Hexane >gi|52695579|pdb|1SUX|A Chain A, Crystallographic Analysis Of The Complex Between Triosephosphate Isomerase From Trypanosoma Cruzi And 3-(2- Benzothiazolylthio)-1-Propanesulfonic Acid >gi|52695580|pdb|1SUX|B Chain B, Crystallographic Analysis Of The Complex Between Triosephosphate Isomerase From Trypanosoma Cruzi And 3-(2- Benzothiazolylthio)-1-Propanesulfonic Acid >gi|1289358|gb|AAB58349.1| triosephosphate isomerase [Trypanosoma cruzi] (251 aa)
Score = 196, Expect = 1.7e-13, Identities = 62/228 (27%), Positives = 110/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFK--NIPNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           + I   NWK N     +    +  N   F+ +V+ +VAP++L I  +     N K ++ AQN    S G  TG VS   LKDYGI    LGH + ++ + E N  V  K+ +    G + ++ + ET  +     T   +  Q+  +   +   +   RV I Y+P +    G++ +    + +     ++R ++R+K G  +A  L ILYGG +   +   + +  D++G L+
  S:     6 QPIAAANWKCNGSESLLVPLIETLNAATFDHDVQCVVAPTFLHIPMTKARLTNPKFQIAAQNAITRS-GAFTGEVSLQILKDYGISWVVLGHSERRLYYGETNEIVAEKVAQACAAGFHVIVCVGETNEEREAGRTAAVVLTQLAAVAQKLSK-EAWSRVVIAYEPVWAIGTGKVATPQQAQEVH---ELLRRWVRSKLGTDIAAQLRILYGGSVTAKNARTLYQMRDINGFLV 234
>gi|4389144|pdb|1TCD|A Chain A, Trypanosoma Cruzi Triosephosphate Isomerase >gi|4389145|pdb|1TCD|B Chain B, Trypanosoma Cruzi Triosephosphate Isomerase (249 aa)
Score = 196, Expect = 1.7e-13, Identities = 62/228 (27%), Positives = 110/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFK--NIPNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           + I   NWK N     +    +  N   F+ +V+ +VAP++L I  +     N K ++ AQN    S G  TG VS   LKDYGI    LGH + ++ + E N  V  K+ +    G + ++ + ET  +     T   +  Q+  +   +   +   RV I Y+P +    G++ +    + +     ++R ++R+K G  +A  L ILYGG +   +   + +  D++G L+
  S:     4 QPIAAANWKCNGSESLLVPLIETLNAATFDHDVQCVVAPTFLHIPMTKARLTNPKFQIAAQNAITRS-GAFTGEVSLQILKDYGISWVVLGHSERRLYYGETNEIVAEKVAQACAAGFHVIVCVGETNEEREAGRTAAVVLTQLAAVAQKLSK-EAWSRVVIAYEPVWAIGTGKVATPQQAQEVH---ELLRRWVRSKLGTDIAAQLRILYGGSVTAKNARTLYQMRDINGFLV 232
>gi|154687529|ref|YP_001422690.1| triosephosphate isomerase [Bacillus amyloliquefaciens FZB42] >gi|166229997|sp|A7Z8Y3|TPIS_BACA2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|154353380|gb|ABS75459.1| TpiA [Bacillus amyloliquefaciens FZB42] (253 aa)
Score = 196, Expect = 1.8e-13, Identities = 68/244 (27%), Positives = 115/244 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKN-IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN    + VS  +  K+ IP  +  + +V    L +       K   ++V AQN+ F   G  TG +S + LKD G+    +GH + +  F E +  VN K     K+G+  ++ + ET   L E    +   L  +Q+  G+  L  + V    I Y+P +    G+ ++  D   +   IR +   +   F    A+ L I YGG +   +I+E    +D+DG L+         ++ +L
  S:     1 MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLKVGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHGIVPIICVGET---LEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTAKDANDVCAHIRKV---VAESFSQETADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEPQSFVQLL 247
>gi|172058402|ref|YP_001814862.1| Triose-phosphate isomerase [Exiguobacterium sibiricum 255-15] >gi|171990923|gb|ACB61845.1| Triose-phosphate isomerase [Exiguobacterium sibiricum 255-15] (250 aa)
Score = 196, Expect = 2.0e-13, Identities = 58/244 (23%), Positives = 113/244 (46%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFK-NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN    D V+ ++  K  +P    V   V    + +      +    +++ AQN+     G  TG +S + LK+ G+    LGH + +  F E +  +N+K +K  ++G+  ++ + ET  +      +  +R Q      G+  +D V  + + Y+P +          +    + + +R+ +  +FG   A  + I YGG +  D+I+E     D+DG L+      +  ++ +L
  S:     1 MRKPIIAGNWKMNLTLKDAVAFAEEVKGTVPASSKVDAAVCAPSVFLAHLTEATAGTDLKIGAQNMYDQESGAFTGEISPVMLKELGVTYVVLGHSERREYFGETDAFINSKTKKAFEHGLVPIVCVGETLEEREGGKFESVIREQTTNSLKGL-TVDQVKNLVVAYEPVWAIGTGKSATEQDAQDSCKFVRDVIAAEFGTEAAEAVRIQYGGSVKPDNIKEYMAQPDIDGALVGGASLETGSFLKLL 247
>gi|119478262|ref|XP_001259342.1| triosephosphate isomerase [Neosartorya fischeri NRRL 181] >gi|119407496|gb|EAW17445.1| triosephosphate isomerase [Neosartorya fischeri NRRL 181] (249 aa)
Score = 196, Expect = 2.2e-13, Identities = 62/222 (27%), Positives = 109/222 (49%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    +I+   KN+   +   +V+V+++PS L ++ +   + N+K+ V AQNV     G  TG +S  +LKD  I  A +GH + +V  KE +  +  K +  +  G++ +L I ET  +     T + +R Q+  +   +   +   +V I Y+P +          E        IR++L        + N+ I+YGG +   +  E+ K  DVDG L+
  S:    10 NFKMNGVTDTITSIIKNLNEAKLDPSVEVVISPSALYLLLAR-QTANSKIGVAAQNVFDKPNGAFTGEISVEQLKDAKIDWAIIGHSERRVILKETDEFIARKTKAAIDGGLSVILCIGETLEEREAGKTIDVVRRQLTAVAKELSK-EQWQKVVIAYEPVWAIGTGKVATTEQAQEVHAAIRKWLSDDVSAEASENVRIIYGGSVSEKNCRELAKQPDVDGFLV 232
>gi|56460080|ref|YP_155361.1| triosephosphate isomerase [Idiomarina loihiensis L2TR] >gi|81821776|sp|Q5R0R3|TPIS_IDILO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56179090|gb|AAV81812.1| Triosephosphate isomerase [Idiomarina loihiensis L2TR] (252 aa)
Score = 195, Expect = 2.2e-13, Identities = 60/239 (25%), Positives = 112/239 (46%)
  Q:     5 ILITNWKMNADY----VSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           ++I NWKMN +        +   + +   + VK+++ P +  I           + + AQNVS  + G  TG +S  +L+++G+    +GH + +  F E +  VN K    +  GM AV+ + E K    E +T E +  Q       +   +   ++ + Y+P +    GE  S    + +   +R +   L  +FG  +   +P+LYGG +  D+  E+    D+DG LI       + +++I
  S:     6 LVIANWKMNGNRELTKTMSAALREKLNQLQQVKLVICPPFTLIGELANQCYYDDIAIGAQNVSEHTGGAFTGEISTAQLQEFGVSYVLVGHSERRQLFAETDKMVNEKALATVNAGMTAVICVGENKAQRDEGNTWEVVAQQAQAALADLPK-EQAGKIVLAYEPVWAIGTGETASPEQAQDVHAKLRAL---LVEQFG-AIGEKMPLLYGGSVKADNAAELFAQKDIDGGLIGGASLKESDFVAI 246
>gi|20808179|ref|NP_623350.1| triosephosphate isomerase [Thermoanaerobacter tengcongensis MB4] >gi|22096216|sp|Q8R966|TPIS_THETN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|20516771|gb|AAM24954.1| Triosephosphate isomerase [Thermoanaerobacter tengcongensis MB4] (248 aa)
Score = 195, Expect = 2.3e-13, Identities = 61/244 (25%), Positives = 112/244 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  I+  NWKM+       K  +  IP  ++ K  V+V P ++ +     + K   + + AQN+ +   G +TG +S + LK+ G+    +GH + +  FKE +  VN K+   L + +  ++ + E+     E  T + +  Q  +   G+   DI  +V I Y+P +          +     I+ IR  +   +G   A  + I YGG +  D+I      +D+DG L+     ++  +  I+
  S:     1 MRRPIIAGNWKMHKTPSEAVKLVEELIPLVKDAKAEVVVIPPFVDLTEVARVIKGTNILLGAQNMFWEEKGAYTGEISPVMLKEIGVTYVVIGHSERRQYFKETDEMVNKKVLSALSHDLKPIVCVGESLSQREEGKTYDVVLTQTREALKGVSEEDIT-KVVIAYEPVWAIGTGKNATPQDANEVIKAIRNTIAELYGKDKAEMVRIQYGGSVKPDNISGFMAESDIDGALVGGASLVAEDFAKIV 246
>gi|145353513|ref|XP_001421055.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144581291|gb|ABO99348.1| predicted protein [Ostreococcus lucimarinus CCE9901] (245 aa)
Score = 195, Expect = 2.3e-13, Identities = 54/176 (30%), Positives = 84/176 (47%)
  Q:    55 VEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           V V AQN+ F + G  TG +S    K  G     +GH + +  F E +     K +K L  GM AVL I ETK +      K+    Q++   +G++A D + +V I Y+P +                   IR++ RT +G  VA  + I YGG +  + ++E+ +  DVDG L+
  S:    61 VAVGAQNIYFEASGAFTGEMSAEMAKSVGCTHVLIGHSERRELFGETDEMTRLKTRKTLDCGMTAVLCIGETKEEYERGEAKKVCNRQLSAALSGVEA-DEMSKVIIAYEPVWAIGTGLTATPAIAQSVHAGIRQWFRTNYGESVAAKIQIQYGGSVKPETVDELMQAPDVDGCLV 235
>gi|195958747|ref|ZP_03094956.1| triosephosphate isomerase [Borrelia sp. SV1] (253 aa)
Score = 195, Expect = 2.3e-13, Identities = 62/244 (25%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLF-IEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++V +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+    ++F + ET   L E  + + L + +NQ+  G++ +   D  R+ + Y+P +    G+  +K + E +    R IR  +   +    ++N+ I YGG + +++++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSAEASIVAKKIATEVKTLKDDVVIMITPPFTALSKVSECVKGSSILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILAGLKHPFKYLIFCVGET---LDERDSGKTLEVVLNQVKKGLNCVSESDIQRIILAYEPVWAIGTGKTATKEEAEEVH---RAIRLEIMKLYSKSASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|189499864|ref|YP_001959334.1| Triose-phosphate isomerase [Chlorobium phaeobacteroides BS1] >gi|189495305|gb|ACE03853.1| Triose-phosphate isomerase [Chlorobium phaeobacteroides BS1] (250 aa)
Score = 195, Expect = 2.3e-13, Identities = 66/244 (27%), Positives = 122/244 (50%)
  Q:     1 MREKILITNWKMN---ADYVSI-SKFFKNIPNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+KI++ NWKMN   A+ V++ S   +N+   +   +V +AP+Y  +     + + + + +VAQN  +   G +TG VS   L   G     +GH + +  F E N  VN +L+K L+ GM  +L I ET   L E        +   Q+  G+  ++ +  V + Y+P +    G+  +    + +  +IR     +   +G   A ++ I YGG +   +  E+    ++DG LI      ++ +++I+
  S:     1 MRKKIVVGNWKMNKNVAEGVALASSILENLDGGKMACEVGIAPAYPVLSEVGRVIEGSDICLVAQNCHYEDEGAYTGEVSVRMLDSLGCSYIIVGHSERRQYFGETNRTVNLRLKKALEGGMRVILCIGET---LEEREAGVTDAIVTAQVREGLADIEDLGNVVLAYEPVWAIGTGKTATPEQADAVHASIRAT---ISDMYGEADAEDIRIQYGGSVKPSNAVELFGMPNIDGGLIGGASLKADDFVAIV 246
>gi|95930090|ref|ZP_01312829.1| Triosephosphate isomerase [Desulfuromonas acetoxidans DSM 684] >gi|95133784|gb|EAT15444.1| Triosephosphate isomerase [Desulfuromonas acetoxidans DSM 684] (258 aa)
Score = 195, Expect = 2.5e-13, Identities = 59/230 (25%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWK++       +  + + N        ++++AP +  +     +   + V++ AQN      G +TG VS   L D G     +GH + +  F E ++ VN K + +LK+G+ A++ + ET   L +  + E   +   QI   ++ +  + + +V + Y+P +    G+  +  + E +      IR  L   FG  +A+   ILYGG +   +I E+    D+DG L+
  S:     1 MRKPLIAGNWKLHNTVEQSCQLAQALVNDLSDVTETEIVIAPVFTALSEVGKICTESPVQLAAQNCHCMDDGAYTGEVSVPLLADVGCSHIIVGHSERRQYFGETDHFVNVKARAILKHGLTAIICVGET---LEQRESGELFEVIAAQIRGALEEITAEQMAQVVLAYEPVWAIGTGKTATSEEAEEVHA---YIRGLLHGSFGTDIASQCRILYGGSVKPGNISELMAEEDIDGALV 233
>gi|2501312|sp|Q27775|TPIS_SCHJA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|1255223|gb|AAC47393.1| triosephosphate isomerase [Schistosoma japonicum] >gi|189503030|gb|ACE06896.1| unknown [Schistosoma japonicum] (252 aa)
Score = 195, Expect = 2.5e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAEGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|1351271|sp|P48496|TPIC_SPIOL Triosephosphate isomerase, chloroplast precursor (TIM) (Triose-phosphate isomerase) >gi|806312|gb|AAA66289.1| triosephosphate isomerase, chloroplast isozyme (322 aa)
Score = 195, Expect = 2.6e-13, Identities = 62/222 (27%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    SI+K   ++ +     +V V+VAP ++  +  +  S   +VE+ AQN      G  TG +S  +LKD G +   LGH + +    E+N  +  K    L  G+  +  I E    L E    +   +   Q+    DAL   D V + Y+P +    G++ S    + +      +R++L+      VA+   I+YGG +   +  E+ K  D+DG L+
  S:    78 NWKCNGTKESITKLVSDLNSATLEADVDVVVAPPFV-YIDQVKSSLTGRVEISAQNCWIGKGGAFTGEISVEQLKDLGCQWVILGHSERRHVIGEQNEFIGKKAAYALNQGVGVIACIGEL---LEEREAGKTFDVCYQQLKAFADALPSWDNVVVAYEPVWAIGTGKVASPDQAQEVH---VAVRDWLKKNVSEEVASKTRIIYGGSVNGGNCAELAKQEDIDGFLV 298
>gi|151967120|gb|ABS19440.1| multivalent antigen sjTPI-23 [synthetic construct] (485 aa)
Score = 195, Expect = 2.6e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|151967104|gb|ABS19432.1| multivalent antigen sj23-TPI [synthetic construct] (485 aa)
Score = 195, Expect = 2.6e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:   245 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 468
>gi|1174082|gb|AAC47855.1| triosephosphate isomerase [Schistosoma japonicum] (252 aa)
Score = 195, Expect = 2.6e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|94265673|ref|ZP_01289413.1| Triosephosphate isomerase [delta proteobacterium MLMS-1] >gi|93453800|gb|EAT04169.1| Triosephosphate isomerase [delta proteobacterium MLMS-1] (250 aa)
Score = 195, Expect = 2.7e-13, Identities = 67/230 (29%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-------PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  +L  NWKM+ D  + ++    +       P  E   VM+AP +  +  + G +   +V + AQNV + + G  TG ++   L++ G   A +GH + +  F E N  +N +L   L +G+  VL I ET  +   + T E L  Q+ +   GI +LD   R+ + Y+P +          E      R +R  L   +   +A+ + ILYGG +   +++ I    DVDG L+
  S:     1 MRTPLLAGNWKMHLDQAAAAELAAAVANVAAACPERE---VMIAPPFTALA-AAGQAAGQQVILAAQNVCWEAQGAFTGEIAPPMLRELGCGMALVGHSERRQLFHEDNAMINRRLGGALAHGLVPVLCIGETLAEREADRTMEVLASQLREGLAGI-SLDDPRRLVVAYEPVWAIGTGKTAGPEQAQQVHRFVRGLLAELYQKNIADGVRILYGGSVNAANVDSIMAQPDVDGALV 232
>gi|51598316|ref|YP_072504.1| triosephosphate isomerase [Borrelia garinii PBi] >gi|81825666|sp|Q662V9|TPIS_BORGA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|51572887|gb|AAU06912.1| triosephosphate isomerase [Borrelia garinii PBi] (253 aa)
Score = 195, Expect = 2.7e-13, Identities = 64/244 (26%), Positives = 126/244 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++  +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L+E  +++ L + +NQ+  G+D +   D  R+ + Y+P +    G+  +K + E +   IR+  E ++  +   V++N+ I YGG + + +++E+    D+DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSTEASIVAKKIATEVKTLKDDFVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLGETDEIINKKILTGLKHPFKYLILCVGET---LNERDSEKTLDVVLNQVKKGLDGVSESDIKRIILAYEPIWAIGTGKTATKEEAEEVHKAIRL--EIMKL-YSKSVSDNVIIQYGGSVNSSNVKELMNEPDIDGALIGGASLKAESFLSII 249
>gi|149375759|ref|ZP_01893527.1| triosephosphate isomerase [Marinobacter algicola DG893] >gi|149359884|gb|EDM48340.1| triosephosphate isomerase [Marinobacter algicola DG893] (252 aa)
Score = 195, Expect = 2.7e-13, Identities = 68/243 (27%), Positives = 117/243 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFF----KNIPNFEN-VKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFI----EETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR KI+  NWKMN     +S         + +F+N V+ ++ P  L  V  +      K+ V  QNV+  S G +TG +S    KD G     +GH + +  F E + QV  K+++ L +G+ AV+ +    EE     +E+     +R  +  + NG     +  +V I Y+P +    G+  +  D + +   IR +   L        A+ + +LYGG +  D+   +    D+DG LI      ++ ++SI
  S:     1 MRRKIVAGNWKMNGSKGLVSNLVGQVRSELASFDNGVEAVIIPPAL-FVDDVVEQAGKKLAVGVQNVACWSSGAYTGEISAAMAKDCGCGFTLVGHSERRQLFGETDEQVATKVEQALASGLVAVICVGETLEERDAGKAEDVVSRQVRKAVADVGNG-----LWQQVVIAYEPVWAIGTGKTATADDAQAMHAAIRAVLMSLGAP-----ADEVSLLYGGSVKADNAAALFAQPDIDGGLIGGASLDASDFVSI 244
>gi|186684444|ref|YP_001867640.1| triosephosphate isomerase [Nostoc punctiforme PCC 73102] >gi|186466896|gb|ACC82697.1| triosephosphate isomerase [Nostoc punctiforme PCC 73102] (243 aa)
Score = 195, Expect = 2.8e-13, Identities = 62/248 (25%), Positives = 118/248 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVAN-NLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           MR+ ++  NWKM        +F +  +P+ E      +V++ P +  +         + +++ AQN+ +   G +TG +S   L + G++   +GH + +  F E +  VN +L+   + G+  +L + ETK       T+  + LQ+++    ID  ++V    I Y+P +    GE     +   I G IR             ++N N+ I YGG +  ++I+EI    ++DG+L+         +  I+  HL
  S:     1 MRKIVIAGNWKMFKTQAETQEFLQGFLPHLEETPQGREVILCPPFTDLSVLSKTLHGSLIQLGAQNIHWEEFGAYTGEISGPMLTESGVRFVIVGHSERRQYFGETDATVNLRLRTAQRFGLTPILCVGETKQQRDAGETESLIALQLDKGLVDIDQNNLV----IAYEPIWAIGTGETCEAVEANRIIGLIRS-----------QLSNPNVSIQYGGSVKPNNIDEIMAQPEIDGVLVGGASLEPESFARIVNFHL 242
>gi|28210136|ref|NP_781080.1| triosephosphate isomerase [Clostridium tetani E88] >gi|39932381|sp|Q898R2|TPIS_CLOTE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|28202572|gb|AAO35017.1| triosephosphate isomerase [Clostridium tetani E88] (255 aa)
Score = 195, Expect = 2.8e-13, Identities = 65/244 (26%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKM-NADYVSISKFFKNIPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEET----KVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           +R+ I+  NWKM N    S+    + IP  +  +  V+V P ++ +     +++   ++V AQN+ F   G  TG VS L L+   I    +GH + +  FKE +  VN KL+   ++ +  +L + ET    +  ++EE   + ++L + ++       + V+++ I Y+P +         +E     I +IR  +++ +G  VA +L I YGG +    I+E    +D+DG L+      +N + +I+
  S:     7 LRKAIIAGNWKMHNTIDESVKLVEELIPKVKEAECEVVVCPPFICLPKIREITEGTNIKVGAQNMYFEEKGAFTGEVSPLMLEKLNIDYVIIGHSERRQYFKETDQTVNKKLKAAFEHNLIPILCVGETLDEKENGVTEEVVSKQVKLGLFELKE-----EQVEKLVIAYEPIWAIGTGKTATSEEANEVIALIRSTVKSLYGDKVAESLRIQYGGSVKPSTIKEQMSMSDIDGALVGGASLKANDFSAIV 252
>gi|148657912|ref|YP_001278117.1| Triose-phosphate isomerase [Roseiflexus sp. RS-1] >gi|166230008|sp|A5UZW4|TPIS_ROSS1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|148570022|gb|ABQ92167.1| triosephosphate isomerase [Roseiflexus sp. RS-1] (254 aa)
Score = 195, Expect = 2.8e-13, Identities = 59/245 (24%), Positives = 115/245 (46%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILY 245
           MR  +L  NWKM          +      + +  + KV+V P +  +     + +   + + AQ+V     G  TG++S + L+D G     +GH + +  F E +  +  K++  L + +  +L + ETK        +  +  Q+     G+   D + R+ I Y+P +    G+  +  D + +  T   IR+ L    G  VA+ + ILYGG +  D+I+++    D+DG L+      ++ ++ I++
  S:     1 MRTPLLAGNWKMYKTTGEARELVEGLLHGLGDVSDRKVLVCPPFTALHTVRDLVQGTPIALGAQDVYIEPQGAFTGAISPVMLRDLGCTYVIVGHSERRAIFGEGDELIGKKVRAALAHDLTPILCVGETKPQRDAGEAETIVVAQVRAALAGMTP-DQIARIVIAYEPVWAIGTGDTATPADAQAMHVT---IRQTLGELAGSDVADAINILYGGSVKPDNIDDLMAQPDIDGALVGGASLKADSFLRIVH 248
>gi|24379183|ref|NP_721138.1| triosephosphate isomerase [Streptococcus mutans UA159] >gi|26007043|sp|P72484|TPIS_STRMU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|24377092|gb|AAN58444.1|AE014914_6 triosephosphate isomerase [Streptococcus mutans UA159] (252 aa)
Score = 194, Expect = 2.9e-13, Identities = 63/243 (25%), Positives = 106/243 (43%)
  Q:     2 REKILITNWKMNADYVSISKFF----KNIPNFENVKVMVAPSYLGIVPSLGMSKNAK---VEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN       +F      NIP+   V  ++    L +    GM K  K   ++V AQN  +   G  TG  S   L   G+    +GH + +  F E + ++N K   + K+ M  +L   E+        T E +  QI     G+ A + V  + I Y+P +        D         V+R  +   +G  VA  + I YGG +  +++ E     +VDG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKTAAEAREFIDAVKNNIPSNNLVDTVIGSPALFLE---GMKKGVKGTELQVAAQNCYWEDFGAFTGETSPAALAALGVDYVIIGHSERRDYFHETDQEINKKAHAIFKHKMTPILCCGESLETYEAGKTAEWIEGQITADLKGLSA-EQVSSMVIAYEPIWAIGTGKSADANIADDICGVVRATVEKLYGKEVAQAVRIQYGGSVKPENVAEYMAKENVDGALVGGASLQADSFLALL 248
>gi|72382222|ref|YP_291577.1| triosephosphate isomerase [Prochlorococcus marinus str. NATL2A] >gi|123621237|sp|Q46KV4|TPIS_PROMT Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|72002072|gb|AAZ57874.1| triosephosphate isomerase [Prochlorococcus marinus str. NATL2A] (246 aa)
Score = 194, Expect = 3.0e-13, Identities = 62/230 (26%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA------DYVSI-SKFFKNIPNFENVKVMVAPSYLGIVP--SLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKMN       +Y+ +     K+IP  ++ ++++AP +  + P       +N  + + +QNV +   G +T  VS L L +  +K A +GH + +  F E + Q+N + +    + +  ++ + ET         +  +R QI Q   GI+    V R+ + Y+P + +G   +   NE        I   +R   GY    ++ I YGG + +++I+EI   +D+DG+L+
  S:     1 MRKPVIAGNWKMNMTCTEAIEYMRVLIPLLKDIPK-KDREIVIAPPFTALYPLSEFIRDRNEYLSLSSQNVHWEDSGAYTAEVSPLMLNELSVKCAIVGHSEPRKYFSESDEQINKRAKSAQDHQLIPIVCVGETFQQREMGEAERVIRRQIEQGLEGIE----VKRLIVAYEPIWAIGTGKTCEANE-----ANRICGLIRKWIGY---EDVIIQYGGSVKSNNIDEIMSMSDIDGVLV 227
>gi|151967148|gb|ABS19454.1| multivalent antigen sj26-TPI [synthetic construct] (485 aa)
Score = 194, Expect = 3.0e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:   245 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 468
>gi|151967124|gb|ABS19442.1| multivalent antigen sjTPI-26 [synthetic construct] (485 aa)
Score = 194, Expect = 3.1e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|45657942|ref|YP_002028.1| triosephosphate isomerase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|59798775|sp|Q72QL9|TPIS_LEPIC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|45601183|gb|AAS70665.1| triosephosphate isomerase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (250 aa)
Score = 194, Expect = 3.2e-13, Identities = 72/230 (31%), Positives = 121/230 (52%)
  Q:     1 MREKILITNWKMN-----ADYVSISKFFKNIPNFENVKV-MVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIV--DRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKF-GYYVA-----NNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN     A +++ S   + IP+    KV MV PS L +     + + + V V AQN     L   TG  S  +LK+ G+K   +GH + +    E N+  N K++ LLKN    +  + ET   LSE  + + L +  +QI  G+  +D V    + + Y+P +    G++ +           + +  F+R +  G +V       ++ ILYGG +  D+I+++ K  D+DG L+
  S:     1 MRKTIIAGNWKMNLSLKEAVFLAHS-IREKIPSISKDKVSMVFPSTLHLENVSKILEGSSVIVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGET---LSERESGKTLEVLSSQIREGLKGIDSVFFSNLILAYEPVWAIGTGKVATP-------SQAQEVHSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLV 236
>gi|120556259|ref|YP_960610.1| Triose-phosphate isomerase [Marinobacter aquaeolei VT8] >gi|160187514|sp|A1U604|TPIS_MARAV Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|120326108|gb|ABM20423.1| triosephosphate isomerase [Marinobacter aquaeolei VT8] (252 aa)
Score = 194, Expect = 3.3e-13, Identities = 68/243 (27%), Positives = 119/243 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEET----KVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR +I+  NWKMN     + +    +        E+V+V++ P   YL  V   G     ++   AQNVS    G +TG +S    +D G     +GH + +  F E +    AK++++L +G+ AVL + ET    + D +E    E +R  ++ + +G        RV + Y+P +    G+  +  D + +   IR + + +        AN + +LYGG +  D+   +    D+DG LI      + ++ISI
  S:     1 MRRRIVAGNWKMNGSKDLVKQLVGAVREQSGSVGEDVEVVIIPPAIYLDQVAEQG---GGRITTGAQNVSQWQSGAYTGEISAEMARDMGCGYVLVGHSERRQLFGETDSVAAAKVEQVLLSGLVAVLCVGETLAEREADQAEAVVAEQVRSGLSVVADG-----QWSRVVVAYEPVWAIGTGKTATADDAQAMHSEIRKVLDGMNAP-----ANEISVLYGGSVKADNAAALFAEPDIDGGLIGGASLKAEEFISI 244
>gi|169856984|ref|XP_001835145.1| triosephosphate isomerase [Coprinopsis cinerea okayama7#130] >gi|189047103|sp|Q12574|TPIS_COPC7 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116503734|gb|EAU86629.1| triosephosphate isomerase [Coprinopsis cinerea okayama7#130] (251 aa)
Score = 194, Expect = 3.3e-13, Identities = 62/222 (27%), Positives = 109/222 (49%)
  Q:     9 NWKMNADYVSISKFFKNIPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK+N   +S +K      N  ++    +V+VAP  L ++P   ++  A V+V AQN  F   G  TG +S  ++ D GI    LGH + +  F E +  V  K +  L NG+  +L I ET  +  E  T      Q++ +   +   D  + + I Y+P +    G++ +    +    T   +R++L T     VA+   ++YGG +   + +++    D+DG L+
  S:    10 NWKLNPTSLSAAKALVEALNKADLDPSTEVVVAPPALYLLPIQEIAGKA-VKVAAQNAYFKESGAFTGEISPKQISDAGIPYVILGHSERRTLFHETSEVVALKTRAALDNGLKVILCIGETLKEREEGRTAAVCEEQLSAVVKQLKEEDWSN-IVIAYEPVWAIGTGKVATTSQAQ---ETHVDVRKYLATAVSPKVASETRVIYGGSVNAANSKDLASQQDIDGFLV 233
>gi|39938656|ref|NP_950422.1| triosephosphate isomerase [Onion yellows phytoplasma OY-M] >gi|81830059|sp|Q6YR48|TPIS_ONYPE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|39721765|dbj|BAD04255.1| triosephosphate isomerase [Onion yellows phytoplasma OY-M] (274 aa)
Score = 194, Expect = 3.3e-13, Identities = 61/228 (26%), Positives = 106/228 (46%)
  Q:     2 REKILITNWKM----NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGIL 229
           R K++  NWKM    +     I K    +P+   V+ ++ P  L ++ SL   +   ++V AQN+ + S G  TG VS   L   G+K   LGH + +  F E +  VN KL   LK+ +   + + E+ +      T+  L  Q+  IF G+   + +  + I Y+P +          +     I  IR+ +   +    +  + I+YGG +   +I+ I +   +DGIL
  S:     6 RTKVIAGNWKMYKCKDEALEFIQKVSLQVPDQTQVQTLIFPQ-LTLLDSLAQLQGTNLQVGAQNMFYESEGAFTGEVSPQNLLSLGVKHVLLGHSERRTFFGETDQTVNLKLLSALKHKLVPTVCVGESLLTKENNQTQVFLDQQLTNIFAGVPE-EALQNIIIAYEPVWAIGTGKSATPQDANKVIEQIRDKVTALYSSQASCAMRIIYGGSVSVANIKTILEQPAIDGIL 235
>gi|24214396|ref|NP_711877.1| triosephosphate isomerase [Leptospira interrogans serovar Lai str. 56601] >gi|39932414|sp|Q8F5I5|TPIS_LEPIN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|24195335|gb|AAN48895.1|AE011347_5 Triosephosphate isomerase [Leptospira interrogans serovar Lai str. 56601] (250 aa)
Score = 194, Expect = 3.4e-13, Identities = 72/230 (31%), Positives = 121/230 (52%)
  Q:     1 MREKILITNWKMN-----ADYVSISKFFKNIPNFENVKV-MVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIV--DRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKF-GYYVA-----NNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN     A +++ S   + IP+    KV MV PS L +     + + + V V AQN     L   TG  S  +LK+ G+K   +GH + +    E N+  N K++ LLKN    +  + ET   LSE  + + L +  +QI  G+  +D V    + + Y+P +    G++ +           + +  F+R +  G +V       ++ ILYGG +  D+I+++ K  D+DG L+
  S:     1 MRKTIIAGNWKMNLSLKEAVFLAHS-IREKIPSISKDKVSMVFPSTLHLENVSKILEGSSVIVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGET---LSERESGKTLEVLSSQIREGLKGIDSVFFSNLILAYEPVWAIGTGKVATP-------SQAQEVHSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLV 236
>gi|71983330|gb|AAZ57433.1| triose-phosphate isomerase [Orientobilharzia turkestanicum] (251 aa)
Score = 194, Expect = 3.4e-13, Identities = 57/222 (25%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN       K    + +    +N +V++AP ++  +  +  +   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  +  K++  +  G+N +  I ET  +     T+E    Q+  I N I + D   R+ I Y+P +    G++ +    + +      +R++ +T     V   + I+YGG +   + +E+    DVDG L+
  S:    12 NWKMNGSQEENKKLLHILSDAHFGDNTEVLIAPPFV-FLQEVRRTLKKEIHVAAQNCYKVPKGAFTGEISPAMIKDIGCDWVILGHSERRSIFGESDELIADKVEHAIDGGLNVIACIGETLSERESGKTEEVCVRQLKAIANKIKSADQWKRIVIAYEPVWAIGTGKVATPQQAQDVH---HFLRQWFKTNTPSGVDEKIRIIYGGSVTAANCKELAHQPDVDGFLV 235
>gi|84996815|ref|XP_953129.1| triosephosphate isomerase, putative [Theileria annulata] >gi|65304125|emb|CAI76504.1| triosephosphate isomerase, putative [Theileria annulata] (329 aa)
Score = 194, Expect = 3.4e-13, Identities = 66/244 (27%), Positives = 120/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISK----FFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ K L  NWK N    SIS     F ++     N+ V++ P  L +  +    K+   E+  QNVS    G  TG +S     D+G+K + +GH + +  F E +  V  K+  L +NG+NAV+   ET  +  +  T+  L+ Q++     +      D+V + Y+P +          + +    + +R+++R   G  VA+ + ++YGG +   +  E+ K +DVDG L+    +L  +++ IL
  S:    83 IKRKWLGGNWKCNGTKQSISDLLLHFNRHQTKNNNLDVVLFPPSLYVEHTRNELKSEVFELGVQNVSQSKSGAFTGELSLTMFTDFGLKWSLVGHSERRQLFNEDDSYVCEKVMMLQENGVNAVVCFGETLSEREQGQTENVLKRQLDAFVKHVKDW---DKVVLAYEPVWAIGTGKVATVDQVKEAHKFVRDYVRGLVG-DVADKVRLVYGGSVNEKNCLELSKCSDVDGFLVGGA-SLKKEFLDIL 325
>gi|171780074|ref|ZP_02920978.1| hypothetical protein STRINF_01862 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281422|gb|EDT46857.1| hypothetical protein STRINF_01862 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (252 aa)
Score = 194, Expect = 3.4e-13, Identities = 61/243 (25%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ E V+  +A   L +   L  +K + ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NGM  ++   ET          E +  Q++    G+   + V  + I Y+P +    G+  S+ D + +    +V+R+ +   FG  VA+ + + YGG +  +++       DVDG L+         ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNLKVAAQNCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFANGMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSE-EQVSSLVIAYEPIWAIGTGKSASQDDAQKM---CKVVRDTVAADFGQAVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQPESFLALL 248
>gi|153810445|ref|ZP_01963113.1| hypothetical protein RUMOBE_00826 [Ruminococcus obeum ATCC 29174] >gi|149833624|gb|EDM88705.1| hypothetical protein RUMOBE_00826 [Ruminococcus obeum ATCC 29174] (249 aa)
Score = 194, Expect = 3.5e-13, Identities = 60/229 (26%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN   ++ V + +  K +   + V V+     + IVP +   K   + V A+N+ F   G +TG ++   L D G+K   LGH + +  F E +  VN K+ K  ++G+  ++   E+     +  T + +R Q+      + A D    + I Y+P +         +E      + IRE +   +    A  + I YGG +   +  E+    D+DG L+
  S:     3 RKKIIAGNWKMNMTPSEAVKLVETLKPLVQNDEVDVVFGVPAIDIVPVVEACKGTNIAVAAENMYFEEKGAYTGEIAPAMLVDAGVKYVILGHSERRDYFGETSEDVNKKVLKAFEHGITPIMCCGESLEQREQGITMDWIRQQVKVGLQNVTA-DQAKTMVIAYEPIWAIGTGKTATSEQAQEICKGIRECVAEIYDTDTAEAIRIQYGGSVNAGNAAELFAMGDIDGGLV 233
>gi|71662494|ref|XP_818253.1| triosephosphate isomerase, putative [Trypanosoma cruzi strain CL Brener] >gi|70883493|gb|EAN96402.1| triosephosphate isomerase, putative [Trypanosoma cruzi] (251 aa)
Score = 193, Expect = 3.8e-13, Identities = 62/228 (27%), Positives = 110/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFK--NIPNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           + I   NWK N     +    +  N   F+ +V+ +VAP++L I  +     N K ++ AQN    S G  TG VS   LKDYGIK   LGH + ++ + E N  V  K+ +    G + ++ + ET  +     T   +  Q+  +   +   +    V I Y+P +    G++ +    + +     ++R ++R+K G  +A  L ILYGG +   +   + +  D++G L+
  S:     6 QPIAAANWKCNGSESLLVPLIETLNAATFDHDVQCVVAPTFLHIPMTKARLTNPKFQIAAQNAITRS-GAFTGEVSLQILKDYGIKWVVLGHSERRLYYGETNEIVAEKVAQACAAGFHVIVCVGETNEEREAGRTAAVVLTQLAAVAQKLSK-EAWAHVVIAYEPVWAIGTGKVATPQQAQEVH---ELLRRWVRSKLGADIAAQLRILYGGSVTAKNARTLYQMRDINGFLV 234
>gi|116072921|ref|ZP_01470183.1| triosephosphate isomerase [Synechococcus sp. RS9916] >gi|116068226|gb|EAU73978.1| triosephosphate isomerase [Synechococcus sp. RS9916] (243 aa)
Score = 193, Expect = 3.9e-13, Identities = 56/230 (24%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVK-VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+         ++ F   I    N + ++VAP +  I     ++K + VE+ +QNV +   G +T  ++   L ++G+  A +GH + +  F E + Q+N + +    NG+  ++ + E+    +    +  +R Q+ Q   G+D   ++    + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRKPVIAGNWKMHMTCAQAREWMAAFLPLISATPNDRHLVVAPPFTAISTMAELAKGSSVELSSQNVHWEGHGAYTAEIAPSMLLEHGVGYAIVGHSEPRKYFSESDEQINHRARSAQTNGLIPIVCVGESDEQRTRGEAERVIRRQVEQGLEGLDPAKLI----VAYEPIWAIGTGKTCESSEANRICGLIR----------SWVGSPDLIIQYGGSVKPGNIDELMSMSDIDGVLV 224
>gi|56707259|ref|YP_169155.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669729|ref|YP_666286.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis FSC198] >gi|81677136|sp|Q5NII7|TPIS_FRATT Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|123359644|sp|Q14JZ0|TPIS_FRAT1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|54113601|gb|AAV29434.1| NT02FT1788 [synthetic construct] >gi|56603751|emb|CAG44713.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320062|emb|CAL08096.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis FSC 198] >gi|151568188|gb|EDN33842.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis FSC033] >gi|151571262|gb|EDN36916.1| triosephosphate isomerase [Francisella tularensis subsp. novicida GA99-3549] >gi|151572719|gb|EDN38373.1| triose-phosphate isomerase [Francisella tularensis subsp. novicida GA99-3548] >gi|157122850|gb|EDO66967.1| hypothetical protein FTAG_01641 [Francisella tularensis subsp. holarctica FSC022] (253 aa)
Score = 193, Expect = 3.9e-13, Identities = 66/228 (28%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K+++ NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          E I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:     2 QKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLEQIQETHQFIRSLL-AKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLI 230
>gi|124025771|ref|YP_001014887.1| triosephosphate isomerase [Prochlorococcus marinus str. NATL1A] >gi|160196544|sp|A2C2B2|TPIS_PROM1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|123960839|gb|ABM75622.1| Triosephosphate isomerase [Prochlorococcus marinus str. NATL1A] (246 aa)
Score = 193, Expect = 4.1e-13, Identities = 63/230 (27%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNA------DYVSI-SKFFKNIPNFENVKVMVAPSYLGIVP--SLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKMN       +Y+ +     K+IP  ++ +V++AP +  + P       KN  + + +QNV +   G +T  VS L L +  +K A +GH + +  F E + Q+N + +    + +  ++ + ET         +  +R QI Q   GI+    V ++ + Y+P + +G   +   NE        I   +R   GY    ++ I YGG + +++I+EI   +D+DG+L+
  S:     1 MRKPVIAGNWKMNMTCTEAIEYMRVLIPLLKDIPK-KDREVVIAPPFTALYPLSEFIRDKNDCLSLSSQNVHWEDSGAYTAEVSPLMLNELSVKCAIVGHSEPRKYFSESDEQINKRAKSAQDHQLIPIVCVGETFQQREMGEAERVIRRQIEQGLEGIE----VKKLIVAYEPIWAIGTGKTCEANE-----ANRICGLIRKWIGY---EDVIIQYGGSVKSNNIDEIMSMSDIDGVLV 227
>gi|89257043|ref|YP_514405.1| triosephosphate isomerase [Francisella tularensis subsp. holarctica] >gi|115315398|ref|YP_764121.1| triose-phosphate isomerase [Francisella tularensis subsp. holarctica OSU18] >gi|167009429|ref|ZP_02274360.1| triose-phosphate isomerase [Francisella tularensis subsp. holarctica FSC200] >gi|169656755|ref|YP_001429317.2| triosephosphate isomerase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|122324615|sp|Q0BKA0|TPIS_FRATO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|189036102|sp|A7NEF8|TPIS_FRATF Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|108936016|sp|P96763|TPIS_FRATH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|89144874|emb|CAJ80219.1| triosephosphate isomerase [Francisella tularensis subsp. holarctica LVS] >gi|115130297|gb|ABI83484.1| triose-phosphate isomerase [Francisella tularensis subsp. holarctica OSU18] >gi|134254094|gb|EBA53188.1| triosephosphate isomerase [Francisella tularensis subsp. holarctica 257] >gi|164551823|gb|ABU62361.2| triosephosphate isomerase [Francisella tularensis subsp. holarctica FTNF002-00] (253 aa)
Score = 193, Expect = 4.1e-13, Identities = 66/228 (28%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K+++ NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          E I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:     2 QKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRKSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLEQIQETHQFIRSLL-AKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLI 230
>gi|160941594|ref|ZP_02088925.1| hypothetical protein CLOBOL_06494 [Clostridium bolteae ATCC BAA-613] >gi|158435488|gb|EDP13255.1| hypothetical protein CLOBOL_06494 [Clostridium bolteae ATCC BAA-613] (263 aa)
Score = 193, Expect = 4.4e-13, Identities = 57/225 (25%), Positives = 110/225 (48%)
  Q:     6 LITNWKMNADYVSISKFFKNIPNFEN------VKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEET----KVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINS-KFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           L TN KM       + F   +           + + V PS+  +  +  ++  + + + AQN+ +   G  TG +S + LK+ G+    +GH + +  F+E ++    K  K  ++G   +L I ET    +  LS E+    L++ ++ I       +  ++++I Y+P +   +N    D++++      IR  L  +FG    + +PILYGG +   + +E+    DVDG+ I
  S:     9 LGTNTKMYKTIAETTSFLTQLRRLTEDLADSPLTLFVIPSFTSLESANRITSGSHIRLGAQNMCWEDQGQFTGEISPVMLKEVGVSVVEIGHSERRHVFRENDFDQEKKTAKAAQSGFTPLLCIGETLTQREYGLSGETLSTQLKVGLHSI-----TTEQAEQLWIAYEPVWAIGVNGIPADSDYVAERHAGIRRILCARFGEEQGSRIPILYGGSVNPQNAQELIALPDVDGLFI 239
>gi|4389127|pdb|2BTM|A Chain A, Does The His12-Lys13 Pair Play A Role In The Adaptation Of Thermophilic Tims To High Temperatures? >gi|4389128|pdb|2BTM|B Chain B, Does The His12-Lys13 Pair Play A Role In The Adaptation Of Thermophilic Tims To High Temperatures? (252 aa)
Score = 193, Expect = 4.4e-13, Identities = 61/229 (26%), Positives = 108/229 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKMN       +F +++     P  E + V+ AP +L +   +  +    +++ AQ + F   G +TG VS + LKD G+    LGH + +  F E +  VN K+      G+  ++   E+  +     T   +  Q+ +   G+   + V +  I Y+P +    G+ ++  D   + G IR +   L   FG   A  + I YGG +  D+I +      +DG L+
  S:     1 RKPIIAGNWKMNGTLAEAVQFVEDVKGHVPPADEVISVVCAP-FLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTP-EQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL---FGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGALV 232
>gi|50424135|ref|XP_460653.1| hypothetical protein DEHA0F07436g [Debaryomyces hansenii CBS767] >gi|52783438|sp|Q6BMB8|TPIS_DEBHA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|49656322|emb|CAG88985.1| unnamed protein product [Debaryomyces hansenii CBS767] (248 aa)
Score = 193, Expect = 4.6e-13, Identities = 66/240 (27%), Positives = 107/240 (44%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           N+KMN    S+SK    +   E   NV+V++AP    I  ++  +K   +EV AQN    + G +TG +S  ++KD G      GH + +   KE +  + +K +  L  G++ +L I ET   L E      L +   Q+      +    ++ + Y+P +          E    T + IRE L    G   A    ILYGG +   +  E     DVDG L+    +L  +++ I+   L
  S:    10 NFKMNGTRESVSKIVDGLNKAELPSNVEVVIAPPAPYIALAVNENKQKTIEVSAQNCFDKASGAYTGEISPEQIKDLGATWTLTGHSERRTIIKESDDFIASKTKFALDQGLSVILCIGET---LEERKANVTLDVCARQLDAVARVVSDWSKIVVAYEPVWAIGTGLAATPEDAQETHKAIREHLSKSIGADAAEKTRILYGGSVNGKNAPEFKDKADVDGFLVGGA-SLKPEFVDIIKSRL 248
>gi|1314259|gb|AAB53932.1| triosephosphate isomerase (253 aa)
Score = 192, Expect = 5.1e-13, Identities = 64/244 (26%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++V +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L E  + + L + +NQ+  G++ +   D  R+ + Y+P +    G+  +K + E +   IR+    L TK     ++N+ I YGG + +++++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSAEASIVAKKIATEVKTLKDDVVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILAGLKHPFKYLILCVGET---LDERDSGKTLEVVLNQVKKGLNCVSESDIQRIILAYEPVWAIGTGKTATKEEAEEVHKAIRLEITKLYTK---SASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|148239771|ref|YP_001225158.1| triosephosphate isomerase [Synechococcus sp. WH 7803] >gi|160196656|sp|A5GLP6|TPIS_SYNPW Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|147848310|emb|CAK23861.1| Triosephosphate isomerase [Synechococcus sp. WH 7803] (243 aa)
Score = 192, Expect = 5.2e-13, Identities = 55/230 (23%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNF-ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+         +  F   I    ++  +++AP +  I     +   ++VE+ +QNV +   G +TG +S   L+++G++ A +GH + +  F E + Q+N + +    + +  ++ + E+    S    +  +R Q+ Q   G+D      R+ + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRKPVIAGNWKMHMTCAQTRDWMGTFLPLISETPDDRHLVIAPPFTAISTLADVGAGSRVEISSQNVHWEGHGAYTGEISPAMLQEHGVRYAIVGHSEPRKYFSESDEQINHRARSAQAHDLIPIVCVGESDEQRSRGEAERVIRRQVEQGLEGLDP----QRLVVAYEPIWAIGTGKTCESAEANRICGLIR----------SWVGSPDLIIQYGGSVKPANIDELMGMSDIDGVLV 224
>gi|196255227|ref|ZP_03153766.1| Triose-phosphate isomerase [Cyanothece sp. PCC 7822] >gi|196204424|gb|EDX99240.1| Triose-phosphate isomerase [Cyanothece sp. PCC 7822] (241 aa)
Score = 192, Expect = 5.2e-13, Identities = 68/230 (29%), Positives = 120/230 (52%)
  Q:     1 MREKILITNWKM---NADYVSISKFFKNIPNFENVK---VMVAP-SYLGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM    A+ +   + FK+  +  N     V+ AP + LG      MSKN   +++ + AQN+ +   G +TG ++   L + G+    +GH + +  F E +  VN +L    K+G+  +L + E+K   S+    E  ++ INQ+   +  +D  + + I Y+P +        ++      I +IRE L  K       N+PI YGG +  ++I+EI K +++DG L+
  S:     1 MRKIIIAGNWKMYKTQAEALEFVQTFKSKVDNTNESREIVLCAPFTTLG-----AMSKNLHGSRIRLGAQNIHWEDAGAYTGEIAGPMLTEIGVNYVIIGHSERRQYFGETDETVNLRLLAAQKHGLIPILCVGESK---SQRDAGETEKIIINQLKRDLVDVD-QNNLVIAYEPIWAIGTGDTCESTEANRVIGLIREQLTNK-------NVPIQYGGSVKPNNIDEIMKQSEIDGALV 224
>gi|90022362|ref|YP_528189.1| triosephosphate isomerase [Saccharophagus degradans 2-40] >gi|89951962|gb|ABD81977.1| triosephosphate isomerase [Saccharophagus degradans 2-40] (246 aa)
Score = 192, Expect = 5.4e-13, Identities = 60/243 (24%), Positives = 110/243 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR ++++ NWKM  D+ +  K  +++ +        +V V+P+Y  +  + GM +N  + + AQ+VS    G  TG VS   L D G +   +GH + +    E    +  K Q + +  M  +L + ET  D   + T + +  Q+ ++ N    L+ + +  + Y+P +          E        IRE L  +        + ILYGG +  D  E +    D+DG L+      +  +++I
  S:     1 MRRRLIVGNWKMCGDFRTNQKRLEDLSSLWFGVHQTEVSVSPAYPYLAQAAGMLENTNISLCAQDVSTRENGAFTGEVSAAMLADMGCRYVMVGHSERRHYHNEGYDLIAEKFQAVCEAKMIPILCLGETTADREADRTFDVIGRQLLKVVNAC-GLEGLAKGVVAYEPIWAIGTGRAATPEQAQDVHSYIREILGPE-----GEQIRILYGGSVKPDTAEGLFAKKDIDGALVGGASLDARDFVAI 241
>gi|83644097|ref|YP_432532.1| triosephosphate isomerase [Hahella chejuensis KCTC 2396] >gi|123534480|sp|Q2SML7|TPIS_HAHCH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|83632140|gb|ABC28107.1| triosephosphate isomerase [Hahella chejuensis KCTC 2396] (248 aa)
Score = 192, Expect = 5.5e-13, Identities = 60/244 (24%), Positives = 117/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+K++  NWK N          + I N +   +V V+V P +  +        ++ +E+ +QN S    G +TG VS     D       LGH + +  + E +  +  K+++ +++G+  +L + ET  D      +E    Q++ +F  +      D   + Y+P +    G+  S  D + +    + +R  +R  F   +A+ + ILYGG + + + +E+    DVDG L+     +S +++SI+
  S:     1 MRKKLIAGNWKSNGSLERNKALLEGIVNAKALGSVDVVVCPPFPYLQSVESAVSDSMIELGSQNCSATEDGAYTGEVSAKMCADMKCSWVILGHSERRALYAENDEVIACKVKRAVESGLAPILCVGETLADRESGRAEEVTLKQLDAVFMSVQP---DDSWVVAYEPVWAIGTGKTASPEDAQSMH---KALRNNIRKHFP-QIADKIRILYGGSVKSSNAKELFSMPDVDGALVGGASLVSEEFVSII 243
>gi|188589792|ref|YP_001922189.1| triose-phosphate isomerase [Clostridium botulinum E3 str. Alaska E43] >gi|188500073|gb|ACD53209.1| triose-phosphate isomerase [Clostridium botulinum E3 str. Alaska E43] (248 aa)
Score = 192, Expect = 5.5e-13, Identities = 61/230 (26%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + V + +  K +       V+V P+++ +      +  + ++V AQN+ F   G  TG VS   L+  GI+   LGH + +  F E +  +N K++    + +  ++   ET        T   +  QI     G+   +  ++V I Y+P +          E    TI  IR  +   +G  VA+ + I YGG +  + I E    +D+DG L+
  S:     1 MRKAIIAGNWKMNKTVDEAVKVVEELKPLVKDATCDVVVCPTFVCLDAVKKATAGSNIKVAAQNMHFEESGAFTGEVSPGMLEAMGIEYVVLGHSERREYFNETDEAINKKVKAAFAHNITPIVCCGETLEQRESGVTNNFIACQIKVDIAGLTK-EQAEKVVIAYEPIWAIGTGKTATKEQANETILAIRNVVVEMYGKEVADKVRIQYGGSVKPNTITEQMAMSDIDGALV 232
>gi|47206738|emb|CAF90849.1| unnamed protein product [Tetraodon nigroviridis] (247 aa)
Score = 192, Expect = 5.7e-13, Identities = 64/222 (28%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMV-APS-YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN D  S+ +  + + + +   NV+V+  +PS YL  V S     N K  V AQN    + G  TG +S   +KD G+    LGH + +  F E +  +  K    L+NG+  +  I E K+D  E    E +     ++    D +    +V + Y+P +          +        +R++L+T     VAN++ I+YGG +     +E+    DVDG L+
  S:    10 NWKMNGDKKSLGELIQTLNDAKVDSNVEVVCGSPSIYLDFVRS---KLNTKFGVAAQNCYKTAKGAFTGEISPAMIKDCGVNWVILGHSERRHVFGESDELIGQKTAHALENGLGVIACIGE-KLDEREGGITEKVVFAQTKVI--ADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHEKLRDWLKTNVSEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLV 230
>gi|151967122|gb|ABS19441.1| multivalent antigen sjTPI-FABP [synthetic construct] (389 aa)
Score = 192, Expect = 5.8e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|82750482|ref|YP_416223.1| triosephosphate isomerase [Staphylococcus aureus RF122] >gi|123547665|sp|Q2YSF0|TPIS_STAAB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|82656013|emb|CAI80418.1| triosephosphate isomerase [Staphylococcus aureus RF122] (253 aa)
Score = 192, Expect = 6.1e-13, Identities = 62/230 (26%), Positives = 104/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK----VMVAPSYL--GIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKEN--LRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN        F   +P   + K    V+  P+     +  ++   K   +E+ AQN  F   G  TG  S + L D G+K   +GH + +  F E + ++N K   + K+GM  ++ + ET  D   ES K N  +  Q+ +   G+   + +  V I Y+P +         +E        +R+ +       V+    I YGG +  ++I+E     D+DG L+
  S:     1 MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICGPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGET--DEERESGKANDVVGEQVKKAVAGLSE-EQLKSVVIAYEPIWAIGTGKSSTSEDANEMCTFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALV 235
>gi|151967118|gb|ABS19439.1| multivalent antigen sjGAPDH-TPI [synthetic construct] (605 aa)
Score = 192, Expect = 6.3e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:   365 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 588
>gi|151967126|gb|ABS19443.1| multivalent antigen sjTPI-GAPDH [synthetic construct] (605 aa)
Score = 192, Expect = 6.3e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|138896642|ref|YP_001127095.1| triosephosphate isomerase [Geobacillus thermodenitrificans NG80-2] >gi|196249343|ref|ZP_03148041.1| Triose-phosphate isomerase [Geobacillus sp. G11MC16] >gi|160187446|sp|A4ISP6|TPIS_GEOTN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|134268155|gb|ABO68350.1| Triosephosphate isomerase [Geobacillus thermodenitrificans NG80-2] >gi|196211100|gb|EDY05861.1| Triose-phosphate isomerase [Geobacillus sp. G11MC16] (253 aa)
Score = 191, Expect = 6.6e-13, Identities = 62/230 (26%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM+       +F + +     P  E   V+ AP +L +   +  +    +++ AQ + F   G +TG VS + LKD G+    LGH + +  F E +  VN K+      G+  ++   ET  +     T   +  Q+ +   G+   D V +  I Y+P +    G+ ++  D   + G IR +   L   FG   A  + I YGG +  ++I +      +DG L+
  S:     1 MRKPIIAGNWKMHKTLTEAVQFVEEVKGLVPPKAEVDSVICAP-FLFLDRLVQNTNGTDLQIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLVPIICCGETLEEREAGQTNAVVASQVEKALAGLTP-DQVKQAVIAYEPIWAIGTGKSSTAEDANNVCGHIRSVVARL---FGAEAAEAIRIQYGGSVKPENISDFLAQEHIDGALV 233
>gi|149196804|ref|ZP_01873857.1| triosephosphate isomerase [Lentisphaera araneosa HTCC2155] >gi|149139914|gb|EDM28314.1| triosephosphate isomerase [Lentisphaera araneosa HTCC2155] (256 aa)
Score = 191, Expect = 6.7e-13, Identities = 61/230 (26%), Positives = 108/230 (46%)
  Q:     1 MREKILIT-NWKMNADYV----SISKFFKNIPNFE-NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M+ ++ I  NWK+N        +++     + +F  ++ V + P +L I      +  + + + AQNV F   G +TG +S   LK+ GI+   +GH + +  F E N  VN + +  L  G+   + I ET  +    + +  L+ QI + F  I A  + + V + Y+P +          E    T   IR      +G  VA+ + I YGG +   ++ E+    D+DG L+
  S:     1 MKRRLFIAGNWKLNKTAAETTETVADLKAKLADFNGSLDVALFPPFLSIAAGQAAAAGSPIGIGAQNVHFAESGAYTGELSAAMLKEAGIELVIIGHSERRQYFGETNETVNLRTKAALAAGIKPFVCIGETLEEREGGNMESVLKAQIVEGFADITAEQMTNLV-VAYEPVWAIGTGVTASPEQAQDTHAYIRSEFAALYGQEVADKVIIQYGGSVKPANVAELMSCEDIDGALV 235
>gi|57339514|gb|AAW49744.1| hypothetical protein FTT0080 [synthetic construct] (288 aa)
Score = 191, Expect = 6.7e-13, Identities = 66/228 (28%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K+++ NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          E I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:    28 QKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLEQIQETHQFIRSLL-AKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLI 256
>gi|116492263|ref|YP_803998.1| triosephosphate isomerase [Pediococcus pentosaceus ATCC 25745] >gi|122266273|sp|Q03GW6|TPIS_PEDPA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116102413|gb|ABJ67556.1| triosephosphate isomerase [Pediococcus pentosaceus ATCC 25745] (251 aa)
Score = 191, Expect = 7.1e-13, Identities = 59/230 (25%), Positives = 101/230 (43%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN +     +F   I    P+   V+ ++A   + +   +  SK+ +++  A+N  F   G  TG  S   L + G+    +GH + +  F E +  +N K + +  N M  ++   ET        T E +  QI      + A  +   V I Y+P +         ++       VIRE +   +   VA+ + I YGG +   +I E+    D+DG L+
  S:     1 MRTPIIAGNWKMNKNPQETQEFLDAIKGKLPDASVVESVIAAPAIDLSTLVAFSKDEQLKTAAENSYFEDEGAFTGETSPKALNEMGVNYVVIGHSERRQYFGETDEDINKKAKAIFNNNMTPIICCGETLEQREAGETNEWVAGQITNALKDLTAEQVAASV-IAYEPIWAIGTGKTASSDQAQEVCHVIRETVAKLYDQTVADKVRIQYGGSVKPANIAELMGKEDIDGGLV 233
>gi|47459254|ref|YP_016116.1| triosephosphate isomerase [Mycoplasma mobile 163K] >gi|81828462|sp|Q6KHM5|TPIS_MYCMO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|47458583|gb|AAT27905.1| triosephosphate isomerase [Mycoplasma mobile 163K] (242 aa)
Score = 191, Expect = 7.2e-13, Identities = 69/230 (30%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKF---FKNIPNFENVKV---MVAPSYLGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI+I NWKMN        F   F  I +  N+K+   +VA   L    SLG+ K    A + + AQN    + G  TG +S   L D G+K   LGH + +  F E +  VN K+ + +KN +  ++ + ET++  +   +KE ++   NQI   +  L    ++ I Y+P +          E+     + IR     K          I YGG +  ++I+E+    D+DG L+
  S:     1 MRKKIIIGNWKMNKTKTEAENFVKEFNKITSELNLKLDKNLVAGLALPFT-SLGIKKEGNFANLVIAAQNFHQNNSGAFTGEISAEMLLDLGVKMVVLGHSERREFFHETDEIVNMKMHQAIKNNLVPIVCVGETELQYNSNKSKEVIK---NQIEKSLKNLSDFSKIIIAYEPIWAIGTGKTATVEYAQEMCKYIRSLTNEK--------TIIQYGGSVKPNNIKELLSQKDIDGALV 227
>gi|162448049|ref|YP_001621181.1| triosephosphate isomerase (TIM) [Acholeplasma laidlawii PG-8A] >gi|161986156|gb|ABX81805.1| triosephosphate isomerase (TIM) [Acholeplasma laidlawii PG-8A] (254 aa)
Score = 191, Expect = 7.2e-13, Identities = 61/229 (26%), Positives = 108/229 (47%)
  Q:     2 REKILITNWKMNADYVSISKFF----KNIPNFENVK-VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  ++  NWKM        +F       +P+ + V+ ++ AP+ L  +  L   +   + + AQN+ +   G  TG  S  ++K  G +   +GH + +  F E +  VN K+    K  +  +L I E         TKE L +Q+++ F G+     + +  + Y+P +          +    TI+ +R  L   +G  VA  + ILYGG +  D+IE + + +D+DG LI
  S:     4 RIPVIAANWKMFKTKDEALEFIFAVNAAVPSRDEVESIICAPAIL--LNLLVKREGEHIRIGAQNMHYADEGAFTGENSPAQVKTAGAEYILIGHSERRSLFNETDKDVNLKMHAAFKYDLAPILCIGEQLDTREANKTKEVLDVQLDKAFEGVSKEQAL-KTIVAYEPVWAIGTGKTATPQMANDTIKDVRAKLSDLYGAEVAAQVRILYGGSVKPDNIESLLQESDIDGALI 234
>gi|168334249|ref|ZP_02692450.1| Triose-phosphate isomerase [Epulopiscium sp. 'N.t. morphotype B'] (247 aa)
Score = 191, Expect = 7.4e-13, Identities = 58/230 (25%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+KI+  NWKMN    + V +    K+  N + V V+  P+++ +   L  +    + V AQN+ F   G +TG ++   L + G+K   +GH + +  F E +  VN K+   +K+ +  ++ + E+     +  T + +RLQ       + A +   +V I Y+P +         N       + IR+ +   +   VA+ + I YGG +   +  E+    ++DG L+
  S:     1 MRKKIIAGNWKMNKTPKEAVELVNLLKDKVNTDAVDVIFCPTFVCLDAVLKATAGTNIAVGAQNMYFEENGAYTGEIAPDMLVEMGVKYVIIGHSERRQYFAETDESVNKKVLAAIKHNLIPIICVGESLEQREQGITVDLVRLQTKIALKDVCA-EAAKKVIIAYEPIWAIGTGKTATNAEAEEVCKAIRDVVGEIYSDKVADEIRIQYGGSVNAGNANELFNMGNIDGGLV 232
>gi|15616120|ref|NP_244425.1| triosephosphate isomerase [Bacillus halodurans C-125] >gi|20140832|sp|Q9K715|TPIS_BACHD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|10176182|dbj|BAB07277.1| triosephosphate isomerase [Bacillus halodurans C-125] (251 aa)
Score = 191, Expect = 7.5e-13, Identities = 60/230 (26%), Positives = 102/230 (44%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP+ + V  +V    L +   +  ++  ++ + AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K      +G+  ++ + ET   L E    +   +   Q+  G++ L  + V    I Y+P +          E        IR+ +  KF    A+ + I YGG +   +I E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTVGEAKAFVEEVKGAIPSSDKVDSVVCSPALFLEGLVQKAEGTELRIGAQNMHFEESGAFTGEISPVALSDMKVDYVILGHSERRDMFAETDELVNKKTHAAFAHGLTPIVCVGET---LEEREANQTYDVVKTQVEKGLEGLTDEQVKVTVIAYEPVWAIGTGKSSSAEDANDVCSYIRKVVTEKFSQEAADAVRIQYGGSVKPANIAEYMAQSDIDGALV 233
>gi|136054|sp|P00943|TPIS_BACST Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|49093|emb|CAA46920.1| triosephosphate isomerase [Geobacillus stearothermophilus] (253 aa)
Score = 191, Expect = 7.9e-13, Identities = 61/230 (26%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM+       +F +++     P  E + V+ AP +L +   +  +    +++ AQ + F   G +TG VS + LKD G+    LGH + +  F E +  VN K+      G+  ++   E+  +     T   +  Q+ +   G+   + V +  I Y+P +    G+ ++  D   + G IR +   L   FG   A  + I YGG +  D+I +      +DG L+
  S:     1 MRKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAP-FLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTP-EQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL---FGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLV 233
>gi|189199502|ref|XP_001936088.1| triosephosphate isomerase [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187983187|gb|EDU48675.1| triosephosphate isomerase [Pyrenophora tritici-repentis Pt-1C-BFP] (248 aa)
Score = 191, Expect = 8.3e-13, Identities = 55/222 (24%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI+   +N+   +   N +V++AP  L ++P+    +  ++EV +QN+     G  TG +S  +LKD G+    +GH + +   +E +  V +K +  +  G+  +L   E+   L +    E + +   Q+    D +    ++ + Y+P +          E        +RE+L+ +     A    ILYGG +   + +E+ K  D+DG L+
  S:    10 NFKMNGTMKSITDIVENLNKAQLDPNTEVVIAPPSLYLLPTRQQLRK-EIEVASQNIFDKPNGAFTGEISVEQLKDSGVTWTLIGHSERRQILQETDDFVASKTKAAIDGGLGVILCCGES---LEQREAGETVNVVTKQLKAVADKVKDWSKIVVAYEPIWAIGTGKVATTEQAQEVHAALREWLKKEISAEAAEKTRILYGGSVSEKNCKELAKQADIDGFLV 230
>gi|121998546|ref|YP_001003333.1| Triose-phosphate isomerase [Halorhodospira halophila SL1] >gi|160187449|sp|A1WXW9|TPIS_HALHL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|121589951|gb|ABM62531.1| triosephosphate isomerase [Halorhodospira halophila SL1] (249 aa)
Score = 190, Expect = 8.7e-13, Identities = 64/243 (26%), Positives = 110/243 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE-NVKVMVAPSYLGIVPSLGMSKNA---KVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR KI+  NWKMN D   + +  +   +   + ++ V P Y    P L  + +     V + AQ+VS    G +TG VS   L + G +   +GH + +  + E N +V  K       G+  +L + ET  +   E T+  +  Q++ + + +        V I Y+P +          E        IR+ ++ +    +A+ LPILYGG +  D+  E+    D+DG LI       + ++SI
  S:     1 MRRKIIAGNWKMNGDQDLVRRVAERAADSAGDAELAVCPPY----PLLAAAASQLPFGVALGAQDVSEYDSGAYTGEVSASMLLEAGCRYVIVGHSERRTLYGEDNGRVAGKFVAARNAGLTPILCVGETLAERDAERTESVVGEQLDAVMDAVGGATFQGAV-IAYEPVWAIGTGRTATPEQAQAVHAFIRQRVQERDAGEIADQLPILYGGSMKADNAAELLAQPDIDGGLIGGASLDPDSFLSI 242
>gi|151967110|gb|ABS19435.1| multivalent antigen sjFABP-TPI [synthetic construct] (389 aa)
Score = 190, Expect = 8.8e-13, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:   149 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVH---NFLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 372
>gi|150015488|ref|YP_001307742.1| triosephosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|189036001|sp|A6LR06|TPIS_CLOB8 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|149901953|gb|ABR32786.1| Triose-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] (248 aa)
Score = 190, Expect = 8.8e-13, Identities = 59/230 (25%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + V + +  K +       V+V P+++ +         + ++V AQN+ F   G  TG V+   L+  GI    LGH + +  F E +  +N K++K  ++ +  +L   E+       +T + +  QI     G+   + V+++ I Y+P +         +E    TI+ IR  +   +G   A    I YGG +  + I+   + +D+DG L+
  S:     1 MRKAIIAGNWKMNKTIDEAVKMVEELKPLVKDATCDVVVCPTFVCLDAVKKAVAGSNIKVAAQNMHFEESGAFTGEVAPGMLEAMGIDYVVLGHSERREYFNETDEALNKKVKKAFEHNITPILCCGESLEQRENGTTNKVIEAQIKADIAGLTN-EQVEKLVIAYEPIWAIGTGKTATDEQANETIKAIRAMVAEMYGSESAEKTRIQYGGSVKPNTIKAQMEMSDIDGALV 232
>gi|15828929|ref|NP_326289.1| triosephosphate isomerase(TIM) [Mycoplasma pulmonis UAB CTIP] >gi|20140732|sp|Q98QA8|TPIS_MYCPU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|14089872|emb|CAC13631.1| TRIOSEPHOSPHATE ISOMERASE(TIM) [Mycoplasma pulmonis] (248 aa)
Score = 190, Expect = 9.0e-13, Identities = 63/230 (27%), Positives = 117/230 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF---------ENVKVMVAPSYLGI-VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M++ ++I NWKMN  Y     F     N          EN++  +APS+  + + +  + +   + +VAQN++    G  TG +S   LK    K   +GH + + +++E N  VN K +  ++NG+  ++ + E+  +     TK  ++ QI Q    ++ALD+  ++ + Y+P +    G++ +    + I   IR I            + +L I YGG +   +IE + K  D+DG L+
  S:     1 MKKLLIIGNWKMNKTYDEARDFINAFSNAYALNGAKISENIEYGIAPSFTNMSLFNKELLEKTNINLVAQNINENRSGAFTGEISAQMLKSINAKYVIVGHSERRQNYRETNKIVNQKAKAAIENGLIPIICVGESLEEYEAGKTKAVIKKQIKQ---SLEALDL-SKIVVAYEPIWAIGTGKVATAEVAQQICKFIRSI-----------TSKDLIIQYGGSVSPSNIENLMKQEDIDGALV 228
>gi|1036782|gb|AAA79845.1| triosephosphate isomerase (251 aa)
Score = 190, Expect = 9.2e-13, Identities = 62/222 (27%), Positives = 109/222 (49%)
  Q:     9 NWKMNADYVSISKFFKNIPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK+N   +S +K      N  ++    +V+VAP  L ++P   ++  A V+V AQN  F   G  TG +S  ++ D GI    LGH + +  F E +  V  K +  L NG+  +L I ET  +  E  T      Q++ +   +   D  + + I Y+P +    G++ +    +    T   +R++L T     VA+   ++YGG +   + +++    D+DG L+
  S:    10 NWKLNPTSLSAAKAPVEALNKADLDPSTEVVVAPPALYLLPIQEIAGKA-VKVAAQNAYFKESGAFTGEISPKQISDAGIPYVILGHSERRTLFHETSEVVALKTRAALDNGLKVILCIGETLKEREEGRTAAVCEEQLSAVVKQLKEEDWSN-IVIAYEPVWAIGTGKVATTSQAQ---ETHVDVRKYLATAVSPKVASETRVIYGGSVNAANSKDLASQQDIDGFLV 233
>gi|167931850|ref|ZP_02518937.1| triosephosphate isomerase [Borrelia burgdorferi 156a] (253 aa)
Score = 190, Expect = 9.2e-13, Identities = 60/244 (24%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++V +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L E  + + L + +NQ+  G++ +   D  R+ + Y+P +          E +    R IR  +   +    ++N+ I YGG + +++++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSAEASIVAKKIATEVKTLKDDVVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILTGLKHPFKYLILCVGET---LDERDSGKTLEVVLNQVKKGLNCVSESDIQRIILAYEPVWAIGTGKTATKEEVEEVHRAIRLEIAKLYSKSASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|70727112|ref|YP_254026.1| triosephosphate isomerase [Staphylococcus haemolyticus JCSC1435] >gi|123659642|sp|Q4L4K5|TPIS_STAHJ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|68447836|dbj|BAE05420.1| triosephosphate isomerase [Staphylococcus haemolyticus JCSC1435] (253 aa)
Score = 190, Expect = 9.2e-13, Identities = 62/230 (26%), Positives = 106/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK----VMVAPSY-LGIVPSLGMSKNAK-VEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F  N+P   + K    V+ AP+  L  + SL     AK +++ AQN  F   G  TG  S + L D G+K   +GH + +  F E +  VN K   +  +GM  ++ + ET  +       E +  Q+ +   G+   + +  V I Y+P +         ++        +R+ +       VA+   I YGG +  ++++E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTVKEAKDFVNNLPTLPDEKEVESVICAPTIQLDALISLVNDGKAKGLKIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEDVNKKAHAVFNHGMTPIICVGETDEERENGKANEIVSNQVEKALEGLSE-EQLKEVVIAYEPIWAIGTGKSATSDDANEMCAHVRKTVAKVASQDVADATRIQYGGSVKPNNVKEYMAQSDIDGALV 235
>gi|83589133|ref|YP_429142.1| triosephosphate isomerase [Moorella thermoacetica ATCC 39073] >gi|123525150|sp|Q2RLU0|TPIS_MOOTA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|83572047|gb|ABC18599.1| triosephosphate isomerase [Moorella thermoacetica ATCC 39073] (249 aa)
Score = 190, Expect = 9.3e-13, Identities = 59/230 (25%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+    +   +    + +      +V+V P +  I  ++  +  + + V AQ++ +   G +TG VS   L+D G +   +GH + +  F E +  VN KL    +N +  ++ + ET  +     T E +  Q+ +   G++     D V + Y+P +    G+  +  D + +   I  IR+ L   +G   A  + I YGG +  ++I E+    D+DG L+
  S:     1 MRRPIIAGNWKMHNTTEEARDLVTLLRPLVGTARAEVVVCPPFTAIAATVNAASGSNISVGAQDLFWEDKGAYTGEVSGPMLRDLGCRYVIIGHSERRQYFGETDATVNKKLLAAYRNELLPIVCVGETLAEREAGHTLEVVGRQVREGLKGLETGQARDLV-VAYEPVWAIGTGKTATAADAQEV---IAFIRKTLGEMYG-ETAAAIRIQYGGSVKPENIAELMAQPDIDGALV 231
>gi|168703841|ref|ZP_02736118.1| triosephosphate isomerase [Gemmata obscuriglobus UQM 2246] (252 aa)
Score = 190, Expect = 9.5e-13, Identities = 66/243 (27%), Positives = 111/243 (45%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+K +  NWKMN   A+  ++          + V V V P Y  +     + K + V + AQ+VS    G  TG VS   L + G K A +GH + +    E    +N K+   L+ G++ VL + ET   L+E       R+   Q++     L  +   R+ I Y+P +          E        +R  LR  +G  +A++ PI+YGG +  D+   +    DVDG L+      ++ +++I+
  S:     4 RKKFVAGNWKMNTTLAEAKALGAAVAKGVTDDRVTVAVFPPYPWLTAVGEVLKGSPVALGAQDVSSEKKGAFTGEVSPAMLLETGCKYALIGHSERRHIIGESETFINHKVHTALEEGLSVVLCMGET---LAERERGLQERVFQRQVYAACAGLTDEQFGRIVIAYEPVWAIGTGKVATPEQAQEAHAFVRSKLRLLYGDKIADSTPIVYGGSVTPDNTVGLMSQPDVDGALVGGASLKADSFLAIV 248
>gi|168013983|ref|XP_001759539.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162689078|gb|EDQ75451.1| predicted protein [Physcomitrella patens subsp. patens] (256 aa)
Score = 190, Expect = 9.5e-13, Identities = 66/235 (28%), Positives = 103/235 (43%)
  Q:     9 NWKMNADYVSISKFFK--NIPNFEN-VKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           NWK N    SI +     N  + EN V V+VAP +L I   +G S   ++EV AQN      G  TG +S  +L D G+K    GH + +    E N  +  K    L  G+  +  + E    L E        +   Q+    D +    +V I Y+P +    G++ +    + +   IR    +L  K    VA    I+YGG +   +  E+ K  D+DG L+        +++SI
  S:    12 NWKCNGSTASIKQLVNELNSASIENDVDVVVAPPFLYIGQVIG-SLTDRIEVSAQNCWVGKGGAFTGEISADQLVDVGVKWVIQGHSERRHVIGESNATIGKKSAYALSKGLGVIACVGEK---LEEREASRTTAVVFEQLQAYADEISDWSKVVIAYEPVWAIGTGKVATPEQAQEVHAAIR---SWLSEKISLEVALATRIIYGGSVNRSNCAELAKKEDIDGFLVGGASLKGPEFVSI 245
>gi|125972663|ref|YP_001036573.1| triosephosphate isomerase [Clostridium thermocellum ATCC 27405] >gi|196251422|ref|ZP_03150092.1| Triose-phosphate isomerase [Clostridium thermocellum DSM 4150] >gi|160185042|sp|A3DBQ1|TPIS_CLOTH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|125712888|gb|ABN51380.1| triosephosphate isomerase [Clostridium thermocellum ATCC 27405] >gi|196199385|gb|EDX94212.1| Triose-phosphate isomerase [Clostridium thermocellum DSM 4150] (251 aa)
Score = 190, Expect = 9.5e-13, Identities = 59/229 (25%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I   NWKMN    + V   +  K      + +V+V   ++ +   +  +K + ++V AQN+ +   G  TG VS   L + G+    +GH + +  F E +  VN K+    K G+  ++ + E+     +  T E +R Q+     G+ A  + + V I Y+P +         NE       +IRE ++  +G  VA  + I YGG +   +  E+    ++DG L+
  S:     3 RKVIAAGNWKMNKTPKEAVEFVQALKGRVADADTEVVVGVPFVCLPGVVEAAKGSNIKVAAQNMHWEEKGAFTGEVSGPMLAELGVDYVIIGHSERRQYFGETDETVNKKVHAAFKYGLKPIICVGESLTQREQGVTAELVRYQVKIALLGLSAEQVKEAV-IAYEPIWAIGTGKTATNEQAEEVCGIIRECIKELYGQDVAEAIRIQYGGSVNAANAAELFNMPNIDGGLV 233
>gi|167751307|ref|ZP_02423434.1| hypothetical protein EUBSIR_02293 [Eubacterium siraeum DSM 15702] >gi|167655814|gb|EDR99943.1| hypothetical protein EUBSIR_02293 [Eubacterium siraeum DSM 15702] (257 aa)
Score = 190, Expect = 1.0e-12, Identities = 59/230 (25%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +R+ ++  NWKMN          +     + + ++V+V+    +  +  +L ++    +++ A+N  F   G  TG +S   L + G++   LGH + +  F E +  VN + +  L+ G+  ++ + E   +     T+E +  QI   F GI A D+  +  I Y+P +    G+  +    E +   IR     L   +G  VA  + I YGG +   + EE+    +VDG LI
  S:     5 VRKAVIAGNWKMNKTRPEAKALLEELKPMVADVKDVEVVACVPFTNLETALAVTAGTNIKIGAENCHFEKSGAFTGEISADMLAEMGVEYVVLGHSERRQYFAETDETVNKRTKAALEAGLKPIVCVGELLWERECNITEEVIARQIKLDFFGISADDL-KKCIIAYEPVWAIGTGKTATADQAEEVCAFIRAT---LAKLYGADVAETITIQYGGSMNAKNAEELLSKTNVDGGLI 237
>gi|90962139|ref|YP_536055.1| triosephosphate isomerase [Lactobacillus salivarius UCC118] >gi|122448775|sp|Q1WSX9|TPIS_LACS1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|90821333|gb|ABD99972.1| Triosephosphate isomerase [Lactobacillus salivarius UCC118] (251 aa)
Score = 190, Expect = 1.0e-12, Identities = 60/247 (24%), Positives = 118/247 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL-YKH 247
           MR  I+  NWKMN +    ++F K    N+P    V+ ++A   + +   L  +K + ++V A+N  F   G  TG  S   LK+ G+    +GH + +  F E +  +N K   + +NG+  ++   E+         +E +  Q+      + A  +   V I Y+P +    G+  +    E I     V+R+ +   +   VA+ + + YGG +   +++E+    ++DG L+     + + Y+ ++ YK+
  S:     1 MRTPIIAGNWKMNMNPEQTAEFVKAVKDNLPAASEVEAVIAAPAVDLPALLENAKGSDLKVAAENCYFEDEGAFTGETSPKVLKEMGVDYVVIGHSERRDYFHETDEDINKKAHAIFRNGLTPIICCGESLETREAGKAEEWVANQVTAALKDLSAEQVASLV-IAYEPIWAIGTGKTATADQAEEICA---VVRKTVADLYDETVADKVRVQYGGSVKPANVKELMAKENIDGGLVGGASLVPDSYLQLVNYKN 251
>gi|88808811|ref|ZP_01124321.1| triosephosphate isomerase [Synechococcus sp. WH 7805] >gi|88787799|gb|EAR18956.1| triosephosphate isomerase [Synechococcus sp. WH 7805] (243 aa)
Score = 190, Expect = 1.1e-12, Identities = 56/230 (24%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNF-ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+         +  F   I    ++  ++VAP +  I     +   ++VE+ +QNV +   G +TG +S   L+++G+  A +GH + +  F E + Q+N + +    + +  ++ + E+    S    +  +R Q+ Q   G+D      R+ + Y+P +    G+     +   I G IR           +  + +L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRKPVIAGNWKMHMTCAQTRDWMGTFLPLIAETPDDRHLVVAPPFTAISTLATVGAGSRVEISSQNVHWEGHGAYTGEISPAMLQEHGVSYAIVGHSEPRKYFSESDEQINHRARSAQAHDLIPIVCVGESDEQRSRGEAERVIRRQVEQGLEGLDPA----RLVVAYEPIWAIGTGKTCESAEANRICGLIR----------SWVGSPDLIIQYGGSVKPANIDELMGMSDIDGVLV 224
>gi|167627201|ref|YP_001677701.1| Triose-phosphate isomerase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189036010|sp|B0TWU2|TPIS_FRAP2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|167597202|gb|ABZ87200.1| Triose-phosphate isomerase [Francisella philomiragia subsp. philomiragia ATCC 25017] (253 aa)
Score = 189, Expect = 1.1e-12, Identities = 68/228 (29%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIP----NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K+++ NWKMN    SI +  K I     N E V V V PS + +   L      ++ V  QN++F   G +TG +S   L D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      ++ L  Q++ I   + +++ + RV I Y+P +          E +  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:     2 QKLIMGNWKMNGSSASIKELCKGISEVNYNSEKVAVAVFPSSVYVKEVLAQLPK-EIGVGLQNITFYDNGAYTGELSAEMLHDVGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVVPVVCIGESLEDRQGGRLEKVLTTQLSLILENL-SIEQLARVIIAYEPVWAIGTGVVASLEQVQETHQFIRS-LVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLI 230
>gi|76789052|ref|YP_328138.1| triosephosphate isomerase [Chlamydia trachomatis A/HAR-13] >gi|123606966|sp|Q3KM32|TPIS_CHLTA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|76167582|gb|AAX50590.1| triosephosphate isomerase [Chlamydia trachomatis A/HAR-13] (274 aa)
Score = 189, Expect = 1.1e-12, Identities = 62/242 (25%), Positives = 108/242 (44%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYL-GIVPSLGM-------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ +  NWKMN        F K+   F +  ++  P  + GI+P   +         ++ + + AQ       G  TG +S   LKD G+    +GH + +  F E+N  +  K    + +GM  VL I ET   L E+ +     + +NQ+  G+  L       + Y+P +          + +  T    R+ + + F   +A   PILYGG +  DD   +    DV+G+L+      S  ++SI+
  S:    25 KQFVFGNWKMNKTLTEAQTFLKS---FISSDILSNPQIITGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSERRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGET---LEEQESGATQDILLNQLTIGLSKLPEQASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADDARSLSLCPDVNGLLVGGASLSSENFLSII 268
>gi|68536076|ref|YP_250781.1| triosephosphate isomerase [Corynebacterium jeikeium K411] >gi|68263675|emb|CAI37163.1| tpi [Corynebacterium jeikeium K411] (261 aa)
Score = 189, Expect = 1.1e-12, Identities = 69/229 (30%), Positives = 112/229 (48%)
  Q:     2 REKILITNWKMNADYVS----ISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEET--------KVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN +++     + KF   +P   +E+V V   P +  I     +    K+ +    Q+VS  + G +TG VS   L+  G   A +GH + +    E +  V AK +  L N +  ++ + E          VD  +E TK +L         G+ A D+   V I Y+P +    G++ S  D + +      IRE +    G  VA  + ILYGG +  D + E+    DVDG L+
  S:     4 RKPLIAGNWKMNLNHLEAMQVVQKFVFALPKEYYESVDVAFIPPFTDIRSVQTLVDGDKLAITYGGQDVSQHASGAYTGEVSGAMLQKLGCTWAIVGHSERRQYHGETDEVVAAKARAALDNELQPIVCVGEQLDVREKGEHVDFVKEQTKASLA--------GLSAEDLAKTV-IAYEPVWAIGTGKVASAEDAQEV---CHAIRELVAELAGEEVAGGIRILYGGSVKTDSVGELVSQPDVDGGLV 239
>gi|22536927|ref|NP_687778.1| triosephosphate isomerase [Streptococcus agalactiae 2603V/R] >gi|25010838|ref|NP_735233.1| triosephosphate isomerase [Streptococcus agalactiae NEM316] >gi|76788572|ref|YP_329510.1| triosephosphate isomerase [Streptococcus agalactiae A909] >gi|76798439|ref|ZP_00780678.1| triosephosphate isomerase [Streptococcus agalactiae 18RS21] >gi|77409081|ref|ZP_00785797.1| triosephosphate isomerase [Streptococcus agalactiae COH1] >gi|123602005|sp|Q3K1U3|TPIS_STRA1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|39932401|sp|Q8E0H0|TPIS_STRA5 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|39932403|sp|Q8E644|TPIS_STRA3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|22533779|gb|AAM99650.1|AE014226_10 triosephosphate isomerase [Streptococcus agalactiae 2603V/R] >gi|23095217|emb|CAD46427.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563629|gb|ABA46213.1| triosephosphate isomerase [Streptococcus agalactiae A909] >gi|76586201|gb|EAO62720.1| triosephosphate isomerase [Streptococcus agalactiae 18RS21] >gi|77172298|gb|EAO75451.1| triosephosphate isomerase [Streptococcus agalactiae COH1] (252 aa)
Score = 189, Expect = 1.2e-12, Identities = 55/243 (22%), Positives = 109/243 (44%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ E V+  +A   L +   L  +K +++++ AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+   + V  + I Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++ E     DVDG L+      +  ++++L
  S:     3 RKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSELKIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFANGLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSE-EQVSSLVIAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLEAESFLALL 248
>gi|89098797|ref|ZP_01171678.1| triosephosphate isomerase [Bacillus sp. NRRL B-14911] >gi|89086473|gb|EAR65593.1| triosephosphate isomerase [Bacillus sp. NRRL B-14911] (253 aa)
Score = 189, Expect = 1.2e-12, Identities = 62/244 (25%), Positives = 110/244 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM+        F + I    P+ E+V  +V    L +   +  ++   V + AQN+ F   G  TG +S   L+D G+    LGH + +  F E +  VN K        +  ++ + E+        T E +  Q+ +   G+   D V +  I Y+P +    G+ ++  D   +      IR+ +  +F    A  + I YGG +  ++I+E     D+DG L+       N ++ +L
  S:     1 MRKSIIAGNWKMHKTLPEAKSFLEEINGLVPSKEDVDTVVCAPALFLERLVESAEGHDVAIGAQNMHFEESGAFTGEISPKALQDIGVSYVVLGHSERREMFNETDEAVNKKTLAAFNYNLTPIVCVGESLEQRENGETTEIVGSQVKKALAGLTE-DQVKQTVIAYEPIWAIGTGKSSTSADANEVCAH---IRQVVGEEFSTAAAEAVRIQYGGSVKPENIKEYMAQPDIDGALVGGASLEPNSFLQLL 247
>gi|87119795|ref|ZP_01075692.1| triosephosphate isomerase [Marinomonas sp. MED121] >gi|86165271|gb|EAQ66539.1| triosephosphate isomerase [Marinomonas sp. MED121] (250 aa)
Score = 189, Expect = 1.2e-12, Identities = 70/243 (28%), Positives = 118/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKF-------FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRL-----QINQIFN--GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+KI+  NWKMN    SI +          N P    V+V+VAPS+  +     + + + +++ AQNVS    G  TG VS   L+D+ +    +GH + +  + E +  +  K + LL + +  VL I E     S E  ++N+ L     QI+ + N  G++A    ++V I Y+P +          E      + IRE +  K    V+  + I+YGG +      E+    D+DG L+        ++I I+
  S:     3 RQKIVAGNWKMNGSSESIDQLVVGLNAAIDNAP----VEVVVAPSFPYLAQVDNLLEKSPIKMAAQNVSEQGSGAFTGEVSISMLQDFAVDYVLVGHSERRSVYGETDQVIAEKTKALLASEITPVLCIGE-----SLEQREKNITLDVCFSQIDAVLNLVGVNAF---EQVVIAYEPVWAIGTGLSASAEQAQEVHKAIREHI-AKSDEVVSEKVRIIYGGSVKASSSSELFTMPDIDGALVGGASLKVEEFIGIV 246
>gi|187933535|ref|YP_001887250.1| triose-phosphate isomerase [Clostridium botulinum B str. Eklund 17B] >gi|187721688|gb|ACD22909.1| triose-phosphate isomerase [Clostridium botulinum B str. Eklund 17B] (248 aa)
Score = 189, Expect = 1.2e-12, Identities = 60/230 (26%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + V + +  K +       V+V P+++ +      +  + ++V AQN+ F   G  TG V+   L+  GI+   LGH + +  F E +  +N K++    + +  ++   ET        T   +  QI     G+   +  ++V I Y+P +          E    TI  IR  +   +G  VA+ + I YGG +  + I E    +D+DG L+
  S:     1 MRKAIIAGNWKMNKTVDEAVKVVEELKPLVKDATCDVVVCPTFVCLDAVKKATAGSNIKVAAQNMHFEESGAFTGEVAPGMLEAMGIEYVVLGHSERREYFNETDEAINKKVKAAFAHNITPIVCCGETLEQRESGVTNNFIACQIKVDIAGLTK-EQAEKVVIAYEPIWAIGTGKTATKEQANETILAIRNVVVEMYGKEVADKVRIQYGGSVKPNTITEQMAMSDIDGALV 232
>gi|145614206|ref|XP_364060.2| triosephosphate isomerase [Magnaporthe grisea 70-15] >gi|145021151|gb|EDK05280.1| triosephosphate isomerase [Magnaporthe grisea 70-15] (250 aa)
Score = 189, Expect = 1.2e-12, Identities = 59/222 (26%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI K  +N+ + +   N +V+++P ++ +  +  ++K  ++EV AQNV   + G +TG  S  +LKD GI    LGH + +    E +  V +K +  + NG+  +    E+  +   + T E +  Q+  +   +      + + I Y+P +          E        IR +L++K    VA    ILYGG +   +  E+ +  D+DG L+
  S:    10 NFKMNGTSESIKKIVENLNDAKLDANAEVVISPPHVYLSHTRSLAKK-EIEVAAQNVFDKADGAYTGETSVSQLKDLGINWVILGHSERRTILGESDEVVASKTKYAIDNGLKVIWCCGESLEERESDKTVEVVTRQLEALKAKVGTSGW-ENIVIAYEPIWAIGTGKVATPEQAQDAHAAIRGYLKSKVSDKVAEETRILYGGSVNEKNCGELSQKPDIDGFLV 232
>gi|169826063|ref|YP_001696221.1| triosephosphate isomerase [Lysinibacillus sphaericus C3-41] >gi|168990551|gb|ACA38091.1| Triosephosphate isomerase [Lysinibacillus sphaericus C3-41] (253 aa)
Score = 189, Expect = 1.2e-12, Identities = 58/244 (23%), Positives = 114/244 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM   +    +F       +P+ E V  ++    L +   + ++  +++ + AQ + + + G  TG +S  +L    +    LGH + +  + E +  +N K+   L + +  ++   ET  +    +T++ +  QI     G +A   V+ + I Y+P +    G+  +  D   + G IR + E L   F    AN + I YGG +  D++ E+     +DG L+         Y+++L
  S:     1 MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPALYLPTLVQVASESELAIGAQTMHYENEGAFTGEISPAQLASVDVDYVILGHSERREYYNETDEAINKKVAAALAHNIVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQ-VEHMVIAYEPIWAIGTGKTATADDANQVCGAIRSVVEEL---FDAATANAVRIQYGGSVKPDNVHELLSKEHIDGALVGGASLQPESYLTLL 247
>gi|15594401|ref|NP_212189.1| triosephosphate isomerase [Borrelia burgdorferi B31] >gi|167933650|ref|ZP_02520725.1| triosephosphate isomerase [Borrelia burgdorferi ZS7] >gi|167943833|ref|ZP_02530907.1| triosephosphate isomerase [Borrelia burgdorferi Bol26] >gi|168526221|ref|ZP_02719860.1| triosephosphate isomerase [Borrelia burgdorferi 118a] >gi|168579890|ref|ZP_02723878.1| triosephosphate isomerase [Borrelia burgdorferi 72a] >gi|168692528|ref|ZP_02725320.1| triosephosphate isomerase [Borrelia burgdorferi 94a] >gi|195949306|ref|ZP_03090406.1| triosephosphate isomerase [Borrelia burgdorferi WI91-23] >gi|195951389|ref|ZP_03092486.1| triosephosphate isomerase [Borrelia burgdorferi 29805] >gi|195955276|ref|ZP_03093969.1| triosephosphate isomerase [Borrelia burgdorferi CA-11.2a] >gi|195960631|ref|ZP_03096836.1| triosephosphate isomerase [Borrelia burgdorferi 64b] >gi|3915900|sp|Q59182|TPIS_BORBU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|2687945|gb|AAC66452.1| triosephosphate isomerase [Borrelia burgdorferi B31] (253 aa)
Score = 189, Expect = 1.3e-12, Identities = 63/244 (25%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++V +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L E  + + L + +NQ+  G++ +   D  R+ + Y+P +    G+  +K + E +   IR+    L +K     ++N+ I YGG + +++++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSAEASIVAKKIATEVKTLKDDVVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILAGLKHPFKYLILCVGET---LDERDSGKTLEVVLNQVKKGLNCVSESDIQRIILAYEPVWAIGTGKTATKEEAEEVHKAIRLEITKLYSK---SASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|195941794|ref|ZP_03087176.1| triosephosphate isomerase [Borrelia burgdorferi 80a] (253 aa)
Score = 189, Expect = 1.3e-12, Identities = 63/244 (25%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++V +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L E  + + L + +NQ+  G++ +   D  R+ + Y+P +    G+  +K + E +   IR+    L +K     ++N+ I YGG + +++++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSAEASIVAKKIATEVKTLKDDVVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILTGLKHPFKYLILCVGET---LDERDSGKTLEVVLNQVKKGLNCVSESDIQRIILAYEPVWAIGTGKTATKEEAEEVHKAIRLEITKLYSK---SASDNIIIQYGGSVNSNNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|187931036|ref|YP_001891020.1| triosephosphate isomerase [Francisella tularensis subsp. mediasiatica FSC147] >gi|187711945|gb|ACD30242.1| triosephosphate isomerase [Francisella tularensis subsp. mediasiatica FSC147] (253 aa)
Score = 189, Expect = 1.3e-12, Identities = 65/228 (28%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K+++ NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          E I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    +VDG LI
  S:     2 QKLIMANWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLEQIQETHQFIRSLL-AKVDEKLAKNIKIVYGGSLKAENAKDILSLPNVDGGLI 230
>gi|194477254|ref|YP_002049433.1| triosephosphate isomerase [Paulinella chromatophora] >gi|171192261|gb|ACB43223.1| triosephosphate isomerase [Paulinella chromatophora] (233 aa)
Score = 189, Expect = 1.3e-12, Identities = 47/202 (23%), Positives = 100/202 (49%)
  Q:    29 FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           + + +V++AP +  I           +++ +QN+ +   G +T  +S L L ++ +  A +GH + +  + E + Q+N + +    +G+  ++ + E+      E T+  +R Q+ Q   G+D      R+ + Y+P +    G+  +  +   I G IR           +  A+++ I YGG +  D+I+EI   +D+DG+L+
  S:    21 YSDREVVLAPPFTAIATMAEALDGTNIKLSSQNIHWEGTGAYTAEISPLMLLEHNVSYAIVGHSEPRKYYSESDEQINRRARAAQASGLIPIVCVGESNQQRESEETERVIRRQVEQGLEGLDPA----RLIVAYEPIWAIGTGKTCASAEANRICGLIR----------AWVGASDVTIQYGGSVKPDNIDEIMTQSDIDGVLV 211
>gi|28377644|ref|NP_784536.1| triosephosphate isomerase [Lactobacillus plantarum WCFS1] >gi|38258540|sp|Q88YH4|TPIS_LACPL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|28270477|emb|CAD63379.1| triosephosphate isomerase [Lactobacillus plantarum WCFS1] >gi|56711115|emb|CAD99190.1| triosephosphate isomerase [Lactobacillus plantarum] (252 aa)
Score = 189, Expect = 1.3e-12, Identities = 57/230 (24%), Positives = 101/230 (43%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKMN        F       +P+   V+ +VA   L +   +  +K + +++ A+N  F   G  TG  S   L D G+    +GH + +  F E +  +N K   + KNGM  ++   E+         +  +  QI      + A D V  + I Y+P +         ++       V+R+ +   +   VA+ + I YGG +   ++ E+   +D+DG L+
  S:     1 MRTPIIAGNWKMNKTASEALAFVNAVKDQLPDPSKVESVVAAPALFLQEMVEAAKGSDLKIAAENAYFEDAGAFTGETSPAALADLGVDYVVIGHSERRGYFHETDEDINKKAHAIFKNGMKPIICCGESLEQREAGEAESWVSGQIKAALKDLSA-DQVSSLVIAYEPIWAIGTGKTATSDQAEEICAVVRKTVADLYSQEVADKVRIQYGGSVKPANVNELMGKDDIDGGLV 233
>gi|148242073|ref|YP_001227230.1| triosephosphate isomerase [Synechococcus sp. RCC307] >gi|160196657|sp|A5GSL8|TPIS_SYNR3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|147850383|emb|CAK27877.1| Triosephosphate isomerase [Synechococcus sp. RCC307] (253 aa)
Score = 189, Expect = 1.3e-12, Identities = 57/229 (24%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKN-IPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  ++  NWKM+       ++    +P   N      +++AP +  I         + V++ +QNV +   G  TG +S   L + G+    +GH + +  F E + Q+N + +     G+  +L + E+    S   T+  +R Q+ Q   GID   +V    + Y+P +        ++E       +IR ++    GY    NL I YGG +   +I+E+   +D+DG+L+
  S:     6 RPVVIAGNWKMHMTCAQAKQYAAAFLPQVANAPKDRSIVLAPPFTAISTLQEALAGSDVQIASQNVHWKDSGAFTGEISAEMLLELGVGYTIVGHSEPRKYFSESDEQINQRARASQAAGLIPILCVGESDEQRSSNETERVIRRQVEQGLEGIDPSKLV----VAYEPIWAIGTGKTCESEEANRVCGLIRNWV----GY---PNLTIQYGGSVKPGNIDELMAKSDIDGVLV 228
>gi|77412463|ref|ZP_00788766.1| triosephosphate isomerase [Streptococcus agalactiae CJB111] >gi|77161481|gb|EAO72489.1| triosephosphate isomerase [Streptococcus agalactiae CJB111] (252 aa)
Score = 189, Expect = 1.4e-12, Identities = 55/243 (22%), Positives = 109/243 (44%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ E V+  +A   L +   L  +K +++++ AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+   + V  + I Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++ E     DVDG L+      +  ++++L
  S:     3 RKPFIPCNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSELKIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFANGLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSE-EQVSSLVIAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLEAESFLALL 248
>gi|126649361|ref|ZP_01721602.1| triose-phosphate isomerase [Bacillus sp. B14905] >gi|126593686|gb|EAZ87609.1| triose-phosphate isomerase [Bacillus sp. B14905] (253 aa)
Score = 189, Expect = 1.4e-12, Identities = 58/244 (23%), Positives = 115/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKM   +    +F       +P+ E V  ++    L +   + ++  +++ + AQ + + + G  TG +S  +L +  +    LGH + +  + E +  +N K+   L + +  ++   ET  +    +T++ +  QI     G +A   V+ + I Y+P +    G+  +  D   + G IR + E L   F    AN + I YGG +  D++ E+     +DG L+         Y+++L
  S:     1 MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPALYLPTLVQVASESELAIGAQTMHYENEGAFTGEISPAQLANVDVDYVILGHSERREYYNETDEAINKKVAAALAHNIVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQ-VEHMVIAYEPIWAIGTGKTATADDANQVCGAIRSVVEEL---FDAETANAVRIQYGGSVKPDNVHELLSKEHIDGALVGGASLQPESYLTLL 247
>gi|118498193|ref|YP_899243.1| triosephosphate isomerase [Francisella tularensis subsp. novicida U112] >gi|160187445|sp|A0Q8C4|TPIS_FRATN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|118424099|gb|ABK90489.1| triosephosphate isomerase [Francisella tularensis subsp. novicida U112] (253 aa)
Score = 189, Expect = 1.4e-12, Identities = 65/228 (28%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +K+++ NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          + I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:     2 QKLIMGNWKMNGNSTSIKELCSGISQAQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLDQIQETHQFIRSLL-AKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLI 230
>gi|91782610|ref|YP_557816.1| triosephosphate isomerase [Burkholderia xenovorans LB400] >gi|91686564|gb|ABE29764.1| triosephosphate isomerase [Burkholderia xenovorans LB400] (258 aa)
Score = 188, Expect = 1.5e-12, Identities = 59/229 (25%), Positives = 116/229 (50%)
  Q:     2 REKILITNWKMNADYV-------SISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKF---GYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R K+++ NWKM+           ++++    +P    V V V   YL    S  + + ++V    Q+VS  + G +TG V+     D+G   A +GH + +   +E    V  K Q++L+ G+  ++ + ET  +    ST++ + +Q++++   +   +   R+ + Y+P +         +E      + +  FLR +    G  VA ++P+LYGG +  ++ EE+ +  D+DG LI
  S:     5 RAKLVVGNWKMHGRLAENAVLLQAVAQGAGELPAQVRVGVCVPSPYLA--QSQSLLEGSRVAWGVQDVSAFTHGAYTGEVAAPMAVDFGATLAIVGHSERRAYHRESAELVAVKTQRVLEAGLTPIVCVGETLEEREAGSTEQVVGMQLDEVLAKLSEQEAA-RIVVAYEPVWAIGTGKSASSE----QAQAVHAFLRARLAAKGAAVA-DVPLLYGGSVKPENAEELFRQPDIDGGLI 235
>gi|193213186|ref|YP_001999139.1| Triose-phosphate isomerase [Chlorobaculum parvum NCIB 8327] >gi|193086663|gb|ACF11939.1| Triose-phosphate isomerase [Chlorobaculum parvum NCIB 8327] (250 aa)
Score = 188, Expect = 1.6e-12, Identities = 67/230 (29%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMN---ADYVSIS-----KFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I++ NWKMN   A+ + ++     K     P  E   V +AP++  +       + + V++ AQN  + + G  TG VS   L   G     LGH + +  F E N  VN K++K L  G+  +L + ET   L E       ++   Q+  G+  +  +  + I Y+P +    G+  +K   + +  +IR   E L   +G   A +L I YGG +   +  E+    D+DG LI
  S:     1 MRRTIVVGNWKMNNTIAESIELATAIAEKVGATKPECE---VGIAPTFPALHEVGKTIEWSGVQLAAQNCHYENDGAFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNEIVNRKVKKALAEGLRVILCVGET---LDEREAGVTDKIVTAQVVEGLADVSDISTLVIAYEPVWAIGTGKTATKEQAQDVHASIRSTIEKL---YGDSAARHLRIQYGGSVKPSNAAELFAMPDIDGGLI 232
>gi|156740989|ref|YP_001431118.1| Triose-phosphate isomerase [Roseiflexus castenholzii DSM 13941] >gi|189036019|sp|A7NI03|TPIS_ROSCS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|156232317|gb|ABU57100.1| Triose-phosphate isomerase [Roseiflexus castenholzii DSM 13941] (254 aa)
Score = 188, Expect = 1.6e-12, Identities = 58/245 (23%), Positives = 113/245 (46%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILY 245
           MR  +L  NWKM          +      + +  + KV+V P +  +     + +   + + AQ+V     G  TG++S + L+D G     +GH + +  F E +  +  K++  L + +  +L + ETK        +  +  Q+     G+   + + R+ I Y+P +    G+  +  D + +  TIR I   L    G   A  + ILYGG +  D+I+++    D+DG L+      ++ ++ I++
  S:     1 MRTPLLAGNWKMYKTTGEARELVEGLLHGLGDVGDRKVLVCPPFTALQTVHDLVQGTPIALGAQDVYIEPQGAFTGAISPVMLRDLGCAYVIVGHSERRAIFGEGDELIGKKVRAALAHDLTPILCVGETKPQRDAGHAETVVVAQVRAALTGMTP-EQIGRIVIAYEPVWAIGTGDTATPADAQAMHETIRRI---LGDMAGSDTAATINILYGGSVKPDNIDDLMAQPDIDGALVGGASLKADSFLRIVH 248
>gi|50312993|ref|XP_455924.1| unnamed protein product [Kluyveromyces lactis] >gi|49645060|emb|CAG98632.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (256 aa)
Score = 188, Expect = 1.7e-12, Identities = 67/222 (30%), Positives = 114/222 (51%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQI--NQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI +        +IP+  NV+V++AP  + +  ++ ++K  +V++ AQN    + G +TG  S  ++KD G +   LGH + +  F E +  V  K +  L +G+  +L I ET      E  ++N+ LQ+   Q+   ++ +     V + Y+P +    G   +  D + I  +   IREFL  K    VA+++ ILYGG     +        DVDG L+
  S:    18 NFKMNGSKASIKEIVDRLNGASIPS--NVEVVIAPPAIYLDHAVALNKRKEVKISAQNAYSKASGAYTGENSVEQIKDVGAEWVILGHSERRTYFNETDEIVAEKTKFALDSGVKVILCIGETL-----EEKQQNITLQVVQRQLQAVLEKVQDWTNVVVAYEPVWAIGTGLAATAEDAQDIHHS---IREFLAEKLSRDVADSVRILYGGSANGKNAVTFKDKADVDGFLV 239
>gi|89898502|ref|YP_515612.1| triosephosphate isomerase [Chlamydophila felis Fe/C-56] >gi|123483065|sp|Q253S1|TPIS_CHLFF Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|89331874|dbj|BAE81467.1| triosephosphate isomerase [Chlamydophila felis Fe/C-56] (254 aa)
Score = 188, Expect = 1.7e-12, Identities = 67/229 (29%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGM---------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+  +  NWKM+        F      F  VK +   S +GI PS              ++ + + AQNV   S G  TG VS   L+++ +    LGH + +  F E++  +  K+    ++G+  VL I ET       +TK+ L    NQ+  G+  L     V I Y+P +    G++ S  D + +       RE L   F    +  + ILYGG +  D+ E   +  DVDG+L+
  S:     3 RKSYVFGNWKMHKTAEEAKDFLSVFCPF--VKEISPASIVGIAPSFTTLSACCESIKKMDSSIWLGAQNVHQDSSGAFTGEVSLPMLQEFHVNFVLLGHSECRHIFHEEDSTIALKVGAAARSGVVPVLCIGETLETRESGTTKDVLS---NQLILGLAQLPETASVIIAYEPVWAIGTGKVASTADVQEVHA---FCREVLSRIFSKEKSETISILYGGSVKADNAEGFARCPDVDGLLV 235
>gi|15605051|ref|NP_219835.1| triosephosphate isomerase [Chlamydia trachomatis D/UW-3/CX] >gi|6831705|sp|O84332|TPIS_CHLTR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|3328746|gb|AAC67921.1| Triosephosphate Isomerase [Chlamydia trachomatis D/UW-3/CX] (274 aa)
Score = 188, Expect = 1.7e-12, Identities = 61/242 (25%), Positives = 108/242 (44%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYL-GIVPSLGM-------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ +  NWKMN        F K+   F +  ++  P  + GI+P   +         ++ + + AQ       G  TG +S   LKD G+    +GH + +  F E+N  +  K    + +GM  VL I ET   L E+ +     + +NQ+  G+  L       + Y+P +          + +  T    R+ + + F   +A   PILYGG +  D+   +    DV+G+L+      S  ++SI+
  S:    25 KQFVFGNWKMNKTLTEAQTFLKS---FISSDILSNPQIITGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSERRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGET---LEEQESGATQDILLNQLTTGLSKLPEQASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNARSLSLCPDVNGLLVGGASLSSENFLSII 268
>gi|52783440|sp|Q6CJG5|TPIS_KLULA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) (248 aa)
Score = 188, Expect = 1.8e-12, Identities = 67/222 (30%), Positives = 114/222 (51%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQI--NQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI +        +IP+  NV+V++AP  + +  ++ ++K  +V++ AQN    + G +TG  S  ++KD G +   LGH + +  F E +  V  K +  L +G+  +L I ET      E  ++N+ LQ+   Q+   ++ +     V + Y+P +    G   +  D + I  +   IREFL  K    VA+++ ILYGG     +        DVDG L+
  S:    10 NFKMNGSKASIKEIVDRLNGASIPS--NVEVVIAPPAIYLDHAVALNKRKEVKISAQNAYSKASGAYTGENSVEQIKDVGAEWVILGHSERRTYFNETDEIVAEKTKFALDSGVKVILCIGETL-----EEKQQNITLQVVQRQLQAVLEKVQDWTNVVVAYEPVWAIGTGLAATAEDAQDIHHS---IREFLAEKLSRDVADSVRILYGGSANGKNAVTFKDKADVDGFLV 231
>gi|70997109|ref|XP_753309.1| triosephosphate isomerase [Aspergillus fumigatus Af293] >gi|66850945|gb|EAL91271.1| triosephosphate isomerase [Aspergillus fumigatus Af293] >gi|159126965|gb|EDP52081.1| triosephosphate isomerase [Aspergillus fumigatus A1163] (256 aa)
Score = 188, Expect = 1.8e-12, Identities = 60/222 (27%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    +I+   KN+   +   +V+V+++PS L ++ +   + + K+ V AQNV     G  TG +S  +LKD  I    +GH + +V  KE +  +  K +  +  G+N +L I ET  +     T + +R Q+  +   +   +   +V I Y+P +          E        IR++L        + N+ I+YGG +   +  ++ K  DVDG L+
  S:    10 NFKMNGVTDTITSIVKNLNEAKLDPSVEVVISPSALYLLLAR-QAADPKIGVAAQNVFDKPNGAFTGEISVEQLKDAKIDWVIIGHSERRVILKETDEFIARKTKAAIDGGLNVILCIGETLEEREAGKTIDVVRRQLTAVAKDLSK-EQWQKVVIAYEPVWAIGTGKVATTEQAQEVHAAIRKWLSDDVSAEASENVRIIYGGSVSEKNCRDLAKQPDVDGFLV 232
>gi|50842305|ref|YP_055532.1| triosephosphate isomerase [Propionibacterium acnes KPA171202] >gi|81826474|sp|Q6A9J2|TPIS_PROAC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|50839907|gb|AAT82574.1| triosephosphate isomerase [Propionibacterium acnes KPA171202] (259 aa)
Score = 187, Expect = 1.9e-12, Identities = 65/229 (28%), Positives = 113/229 (49%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI------PNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  I+  NWKMN D+V+ +   +++        +++ K   +V P +  I P   +    K+ +   AQ++S    G +TG VS   L   G +   +GH + +    E +  VNAK +K+++NGM  ++   E           E+   QI    +GI A + V ++ I Y+P +    GE  +  D + +    + IRE ++  +    A  + I YGG +   ++ EI    DVDG L+
  S:     3 RTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIIDGDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKAKKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGIPA-EQVAKLVIAYEPIWAIGTGETATADDAQEV---CQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV 240
>gi|15811126|gb|AAL08809.1|AF308662_2 hypothetical triosephosphate isomerase [Cowdria ruminantium] (240 aa)
Score = 187, Expect = 1.9e-12, Identities = 57/226 (25%), Positives = 110/226 (48%)
  Q:     5 ILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIF--NGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +++ NWKM+ D+ + S F K + N      + VKV++ P ++ +   +    N K     QN  + S G +TG +S   L + G     +GH + +  F E ++ V  K +  +++G+  ++ + ET +D      K+ L  Q ++ F  NG        +  I Y+P +    N     + I   + +IR +       YV++   I+YGG + + ++ +I   N + G+L+
  S:     4 LIVANWKMHGDFFTFSSFTKELSNRLINIEDKVKVVLCPPFIALSTYVNCPHNIKFG--GQNCCYVSSGKYTGEISASMLYNSGCSYVIVGHSERRSTFHETDHDVRLKAECAIESGLIPIICVGETLLDRENGMLKDTLLSQCSESFPKNG--------KFIIAYEPVWAIGNNKIPSTDVIIEALEIIRSY------DYVSD---IIYGGAVNHTNVGDIVSINQLSGVLV 217
>gi|52783449|sp|Q70JN8|TPIS_KLUMA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|34850299|emb|CAE12106.1| triosephosphate isomerase [Kluyveromyces marxianus] (248 aa)
Score = 187, Expect = 1.9e-12, Identities = 66/222 (29%), Positives = 109/222 (49%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI +  +     +IP+  NV+V++AP    +  ++ ++K A+V V AQN    + G  TG  S  ++KD G +   LGH + +  F E +  +  K +  L +G+  +L I ET  +  +  T E ++ Q+  +   +D +     V + Y+P +    G   +  D + I  +   IREFL  K     A  + ILYGG     +        DVDG L+
  S:    10 NFKMNGTKASIKEIVERLNSASIPS--NVEVVIAPPAAYLDHAVSLNKKAQVSVAAQNAYLKASGAFTGENSVEQIKDVGAEWVILGHSERRTYFHETDEFIADKTKFALDSGVKVILCIGETLEEKQKGITLEVVQRQLQAV---LDKVQDWTNVVVAYEPVWAIGTGLAATSDDAQAIHHS---IREFLAKKLSKDTAEKIRILYGGSANGKNAVTFKDKADVDGFLV 231
>gi|170733611|ref|YP_001765558.1| Triose-phosphate isomerase [Burkholderia cenocepacia MC0-3] >gi|169816853|gb|ACA91436.1| Triose-phosphate isomerase [Burkholderia cenocepacia MC0-3] (251 aa)
Score = 187, Expect = 2.0e-12, Identities = 62/242 (25%), Positives = 115/242 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIV---PSLGMSK----NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R K +I NWKM+            +   +    + A + +G+    P L   +    + +V   AQ+VS    G  TG V+   + ++G + A +GH + +    E N  V AK Q+ L  G+  V+ + ET  +    +T++ +  Q++ +   + A D   R+ + Y+P + +G   S    +      + +  FLRT+     A ++ +LYGG +  D+ EE+    D+DG LI      +  +++I
  S:     5 RTKRVIGNWKMHGRLAGNQALLNEV--VQGAGTVAAETSIGVCVPFPYLAQVQAQLGDGRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESNETVAAKTQRALAAGLVPVVCVGETLDERESGATEQVVGAQLDAVLAVLTA-DEAARIVVAYEPVWAIGTGKSATSAQ-----AQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKAEDFLAI 246
>gi|145249552|ref|XP_001401115.1| triose-phosphate-isomerase tpiA from patent WO8704464-A-Aspergillus niger >gi|134081797|emb|CAK42053.1| triose-phosphate-isomerase tpiA from patent WO8704464-A-Aspergillus niger (249 aa)
Score = 187, Expect = 2.0e-12, Identities = 60/222 (27%), Positives = 110/222 (49%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI+   KN+      E+ +V+V+P  L ++P+   +   K+ V AQNV     G  TG +S  +L+D  I    +GH + +V  KE +  +  K++  +  G++ +  I ET  +     T + +  Q+N +   +   +   +V I Y+P +    G++ +    + +      IR++L        A+N  I+YGG +   +  ++ K  DVDG L+
  S:    10 NFKMNGTADSITSIIKNLNAAKLDESAEVVVSPPTLYLLPAR-QAAGEKIGVAAQNVFDKPNGAFTGEISVEQLRDVKIDWTIIGHSERRVILKESDEFIARKVKAAIDGGLSVIFCIGETLEEREANKTIDVVTKQLNAVAKELTK-EQWAKVVIAYEPVWAIGTGKVATTAQAQEVHAA---IRKWLVDAISAEAADNTRIIYGGSVSEKNCRDLAKEADVDGFLV 232
>gi|195948111|ref|ZP_03089297.1| triosephosphate isomerase [Borrelia garinii PBr] (253 aa)
Score = 187, Expect = 2.1e-12, Identities = 62/244 (25%), Positives = 125/244 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++  +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L+E  + + L + +NQ+  G+D +    + R+ + Y+P +    G+  +K + E +   IR+  E ++  +   V++N+ I YGG + + +++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSTEASIVAKKIATEVKALKDDFVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLGETDEIINKKILTGLKHPFKYLILCVGET---LNERDSGKTLDVVLNQVKKGLDGVFESDIKRIILAYEPVWAIGTGKTATKEEAEEVHKAIRL--EIMKL-YSKSVSDNVIIQYGGSVNSSNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|163747024|ref|ZP_02154380.1| Triosephosphate isomerase [Oceanibulbus indolifex HEL-45] >gi|161379585|gb|EDQ03998.1| Triosephosphate isomerase [Oceanibulbus indolifex HEL-45] (249 aa)
Score = 187, Expect = 2.2e-12, Identities = 63/230 (27%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFK---NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQIN-QIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRT----KFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR KI   NWKMN    S+++       +P      V+  PS L +  +   +  + + + AQ+      G +TG +S   + D G     LGH + +   +E +  V AK       G+ A++ I E++     + T + +  Q++  + + +DA + V    I Y+P +    G++ S          I+ + +F+RT    +FG  + N LP+LYGG +   +  EI    +VDG L+
  S:     1 MRPKIAAGNWKMNGTAASLAELHSLATGLPENPPQVVICPPSTL-LFRATDATHGSPIRIGAQDCHAEDGGAYTGDISASMVADTGASHVILGHSERRDAHRETDADVQAKTCAAWGAGLTAIICIGESEAQRDADQTLDIIGSQLDGSLPDAVDAENTV----IAYEPIWAIGTGKVPS-------IAQIKEVHDFIRTRLIDRFGTEIGNALPLLYGGSVKAANAVEIFAVENVDGALV 229
>gi|167629686|ref|YP_001680185.1| triosephosphate isomerase [Heliobacterium modesticaldum Ice1] >gi|167592426|gb|ABZ84174.1| triosephosphate isomerase [Heliobacterium modesticaldum Ice1] (250 aa)
Score = 187, Expect = 2.3e-12, Identities = 58/230 (25%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+   A+ V +++  K        ++++ P +  +     + +++ + + AQN+ +   G  TG +S   LKD G     LGH + +  F E +  VN K++  L + +  ++ + ET        T+  +  Q      G+ A + V  + I Y+P +    G+  S  D + +   I  IR  +  +FG   A  + I YGG +   +   +    D+DG L+
  S:     1 MRRPIIAGNWKMHKTIAEAVQLAEALKRQQGEPQAEIVLCPPFTALAAVAAVIQDSPIALGAQNMHWEEQGAFTGEISPNMLKDVGCAYVILGHSERRQYFGETDELVNGKVKAALTHALTPIVCVGETLAQREAGETEAIVATQTRGALAGL-APEAVASLVIAYEPVWAIGTGKTASDDDAQQV---IAFIRATVAAEFGNAAAEAVRIQYGGSVKAANAASLLSRPDIDGALV 232
>gi|111114876|ref|YP_709494.1| triosephosphate isomerase [Borrelia afzelii PKo] >gi|167942805|ref|ZP_02529879.1| triosephosphate isomerase [Borrelia afzelii ACA-1] >gi|122956432|sp|Q0SPB0|TPIS_BORAP Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|110890150|gb|ABH01318.1| triosephosphate isomerase [Borrelia afzelii PKo] (253 aa)
Score = 187, Expect = 2.3e-12, Identities = 62/244 (25%), Positives = 123/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++  +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K++  LK+     +L + ET   L E  + + L + ++Q+  G+D +   D  R+ + Y+P +    G+  +K + E +   IR+  E ++  +    ++N+ I YGG +   +I+E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSAEASIVAKQIATEVKTLNDDFVIMITPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKIRAGLKHSFKYLILCVGET---LDERDSGKTLDVVLSQVKKGLDCVSESDIKRIILAYEPVWAIGTGKTATKEEAEEVHKAIRL--EIMKL-YSKSASDNIIIQYGGSVNASNIKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|195978426|ref|YP_002123670.1| triosephosphate isomerase TpiA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975131|gb|ACG62657.1| triosephosphate isomerase TpiA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (252 aa)
Score = 187, Expect = 2.3e-12, Identities = 59/243 (24%), Positives = 114/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G +TG  S   L D G     +GH + +  F E +  +N K + +  NG+  ++   E+            +  Q++    G+ A  +   V + Y+P +          E      + +R+ +   FG  VA+ + + YGG +  ++I+E     DVDG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKNPQEAKAFVEAVVSKLPSNDLVDVAVAAPAVDLVTTIEAAKDSVLKVAAQNCYFENSGAYTGETSPKVLADMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIICCGESLETYEAGQAVAFVGAQVSAALEGLSAEQVASLV-LAYEPIWAIGTGKSATQEDAQSMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENIKEYMACPDVDGALVGGASLEADSFLALL 248
>gi|57239133|ref|YP_180269.1| triosephosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58579081|ref|YP_197293.1| triosephosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58617139|ref|YP_196338.1| triosephosphate isomerase [Ehrlichia ruminantium str. Gardel] >gi|57161212|emb|CAH58126.1| triosephosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58416751|emb|CAI27864.1| Triosephosphate isomerase [Ehrlichia ruminantium str. Gardel] >gi|58417707|emb|CAI26911.1| Triosephosphate isomerase [Ehrlichia ruminantium str. Welgevonden] (240 aa)
Score = 187, Expect = 2.3e-12, Identities = 57/226 (25%), Positives = 110/226 (48%)
  Q:     5 ILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIF--NGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +++ NWKM+ D+ + S F K + N      + VKV++ P ++ +   +    N K     QN  + S G +TG +S   L + G     +GH + +  F E ++ V  K +  +++G+  ++ + ET +D      K+ L  Q ++ F  NG        +  I Y+P +    N     + I   + +IR +       YV++   I+YGG + + ++ +I   N + G+L+
  S:     4 LIVANWKMHGDFFTFSSFTKELSNRLINIEDKVKVVLCPPFIALSTYVNCPHNIKFG--GQNCCYVSSGKYTGEISASMLYNSGCSYVIVGHSERRSTFHETDHDVRLKAECAIESGLIPIICVGETLLDRENGMLKDTLLSQCSKSFPKNG--------KFIIAYEPVWAIGNNKIPSTDVIIEALEIIRSY------DYVSD---IIYGGAVNHTNVGDIVSINQLSGVLV 217
>gi|92399545|gb|ABE76514.1| apicoplast triose-phosphate isomerase 2 [Toxoplasma gondii] (374 aa)
Score = 187, Expect = 2.3e-12, Identities = 66/236 (27%), Positives = 108/236 (45%)
  Q:     9 NWKMN---ADYVSISKFFKNIP-NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFP-SLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFK----EKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWK N   A    +     + P +FE V V+VAP  L I       +  +V+V AQ+ S   + G  TG +S   +K+  I    LGH + +  F     E N  V  K++  L  G++ +L I ET  +     T++ L  Q+  +   +   D    + I Y+P +               T R IR +L       VA    ++YGG +   + +E+ +  DVDG L+    +L+  ++SI+
  S:   125 NWKCNGTTAKTQDLVDMLNSAPVSFEQVDVVVAPPSLFISQVQDSLRQPRVQVAAQDSSTQQAYGAFTGELSPKMIKEKNIPWVVLGHSERRAGFGGQPGESNQVVAKKVRAALNEGLSVILCIGETLEERESGQTQKVLSEQLEAVRQAVPEADAWKSIVIAYEPVWAIGTGKTATAALAQETHRDIRNWLAQAVSPKVAEATRVIYGGSVKGSNAKELFEGEDVDGFLVGGA-SLTGDFVSII 368
>gi|30249739|ref|NP_841809.1| triosephosphate isomerase [Nitrosomonas europaea ATCC 19718] >gi|39932357|sp|Q82TU1|TPIS_NITEU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|30180776|emb|CAD85690.1| Triosephosphate isomerase [Nitrosomonas europaea ATCC 19718] (252 aa)
Score = 187, Expect = 2.4e-12, Identities = 63/242 (26%), Positives = 117/242 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R   +  NWKM+   V   +    +     + +NV  +V   Y  I  +  + + + V    QNVS    G +TG VS   L D G +   +GH + +  F E N  V  K +   +  +  +L + ET      + T++ + +Q++ + +  GI+AL    +  I Y+P + +G   +    +      + + +F+R++   +   +A N+ ILYGG +  D+  E+    D+DG LI     ++ ++ISI
  S:     3 RAGFVAGNWKMHGSLVRNQELLDAVVSGTRSLQNVSCVVCVPYPYIAQTQSVLEGSHVLWGGQNVSQYHHGAYTGEVSADMLADLGCRYVIVGHSERRTLFGEGNQVVAEKFRAAQERSITPILCVGETLAQRESDETEQVIAMQLDAVIDLAGIEAL---GQSVIAYEPVWAIGTGKTATPQQ-----AQDVHKFIRSRIAVHSGGIAENIQILYGGSVKADNARELFTMPDIDGGLIGGASLVAAEFISI 246
>gi|114707418|ref|ZP_01440314.1| triosephosphate isomerase [Fulvimarina pelagi HTCC2506] >gi|114536977|gb|EAU40105.1| triosephosphate isomerase [Fulvimarina pelagi HTCC2506] (269 aa)
Score = 186, Expect = 2.6e-12, Identities = 64/243 (26%), Positives = 114/243 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN------FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQI-NQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           M   ++  NWKMN    S+++  K I +       E   V+V P    +  S G+  NA  +V  Q+    + G HTG V+   LKD G     +GH + + D  E +  V AK++   +  + A++ I E++ +  E  T + L  Q+   + +G  A    D + + Y+P +         ++ +      IR+ L  +FG    + + ILYGG +  D+  ++    +VDG L+      +  +I+I
  S:     1 MTTPLIAGNWKMNGTLRSLTEL-KGIADAIKDGRTEGTDVVVCPPATMLSASRGILHNA-AKVGGQDCHAEASGAHTGDVAAEMLKDVGATYVIVGHSERRADHGESDEMVRAKVEAAWRAKLTAIVCIGESQEERDEGRTLDRLGEQLAGSLPDGATA----DNLVVAYEPIWAIGTGRTATSDDVAEAHGFIRKTLSERFGGDTGSAIRILYGGSVKPDNAFDLLHTENVDGALVGGASLKAEDFIAI 244
>gi|71892364|ref|YP_278098.1| triosephosphate isomerase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|123640794|sp|Q491Y3|TPIS_BLOPB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|71796470|gb|AAZ41221.1| triosephosphate isomerase [Candidatus Blochmannia pennsylvanicus str. BPEN] (258 aa)
Score = 186, Expect = 2.6e-12, Identities = 62/244 (25%), Positives = 119/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-FENV---KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  ++I NWK+N +  +I+     + N F N+    V +AP  + +  +     N+++++ AQNV     G+ TG +S   L+D  ++ A +GH + ++  KE +  +  K   L K G+  +L + E K +     T+     QIN I    GI+A        I Y+P +     +    E      + IR+++ + +   +A+ + I YGG +  +++ +     D+DG+L+      +N +  I+
  S:     1 MRRLLIIGNWKLNGNKNTITNLIITLVNTFYNISKCNVAIAPPVMYLDITKRYLLNSRIQLCAQNVDIHLSGSFTGDISAEMLQDLNVRYALIGHSERRIHHKENDAYIAKKFFILKKVGLIPILCVGENKREYDSGYTQSVCINQINTIITLLGIEAF---KNSVIAYEPIWAIGSGASASPENAQLVHKSIRDYIAS-YDTSIADKITIQYGGSVTPENVTKFFDQKDIDGVLVGAASLNANSFSMIV 246
>gi|189463793|ref|ZP_03012578.1| hypothetical protein BACINT_00126 [Bacteroides intestinalis DSM 17393] >gi|189438743|gb|EDV07728.1| hypothetical protein BACINT_00126 [Bacteroides intestinalis DSM 17393] (251 aa)
Score = 186, Expect = 2.6e-12, Identities = 63/230 (27%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K    +   E  N  V++   ++ +     +   AK+ V A+N +    G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +    G+  +    + I      IR  +  K+G  VA+N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNEVLANEKPNCDVIICTPFIHLASVTPLVDPAKIGVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQLASVFS-LSAEDF-SKIVLAYEPVWAIGTGKTATPDQAQEIHA---FIRSLIADKYGKEVADNCSILYGGSAKPSNAKELFANPDVDGGLI 233
>gi|67623449|ref|XP_668007.1| triose-phosphate isomerase [Cryptosporidium hominis TU502] >gi|54659192|gb|EAL37781.1| triose-phosphate isomerase [Cryptosporidium hominis] (250 aa)
Score = 186, Expect = 2.7e-12, Identities = 64/222 (28%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE--NVKVMVAPSYLGIV---PSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K N    S+     +    E  N +V V P+ L I       G       ++ +QN+S    G  TG VS   LKD  I  + +GH + +  + E +  VN K++K L+NG+  VL I E+   LSE  T +   +   Q+   +  +  +  + I Y+P +          E        IRE++   +   V++NL I+YGG +  D+  E+ K  D+DG L+
  S:    10 NFKCNGTKESLKTLIDSFKQVESSNSEVYVFPTSLHISLVKEFFGNDHPGVFKIGSQNISCTGNGAFTGEVSCEMLKDMDIDCSLVGHSERRQYYSETDQIVNNKVKKGLENGLKIVLCIGES---LSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATPEQAQEAHAFIREYVTKMYNSQVSSNLRIIYGGSVTPDNCNELIKCADIDGFLV 233
>gi|171686402|ref|XP_001908142.1| unnamed protein product [Podospora anserina] >gi|170943162|emb|CAP68815.1| unnamed protein product [Podospora anserina] (295 aa)
Score = 186, Expect = 2.9e-12, Identities = 60/222 (27%), Positives = 109/222 (49%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI    KN+   +   +V+V++APS+L +  ++     + V V AQNV     G HTG VS  +LKD G+     GH + +    E +  V  K +  +  G++ +    E+  +    +T   +  Q+  +   +   D   ++ I Y+P +    G++ +    + +      IR++L+ K    VA+   ILYGG +   + +++ K  D+DG L+
  S:    10 NFKMNGTKESIKAIIKNLNEAQLDPSVEVVIAPSHLYLPIAVDAVTASTVSVSAQNVYAKPNGAHTGEVSVSQLKDLGLNWTITGHSERRAG-GESDENVADKTKAAIDGGLSVIWCCGESLEEREAGNTVAVVEKQLAALAAKLSG-DDWKKIVIAYEPIWAIGTGKVATTEQAQEVHAA---IRKWLKAKVSDAVADETRILYGGSVTAKNSKDLAKQPDIDGFLV 232
>gi|51243952|ref|YP_063836.1| triosephosphate isomerase [Desulfotalea psychrophila LSv54] >gi|50874989|emb|CAG34829.1| probable triosephosphate isomerase [Desulfotalea psychrophila LSv54] (251 aa)
Score = 186, Expect = 2.9e-12, Identities = 58/230 (25%), Positives = 109/230 (47%)
  Q:     1 MREKILIT-NWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M+ K LI  NWKM+   +   +    I     ++ + +V++AP    I     +   +K+ + + NV +   G  TG +S   L+D G   A +GH + +  F E +  +N +L+  L  G+  +L I ET  +    +T+  L  Q+ +    + A  +  +V + Y+P +          E +  T   +R+ +   +   +A  L ILYGG +   +++E+    D+DG L+
  S:     1 MKRKALIAGNWKMHMTVLEGCRLAAEIVASCKDYTDREVLLAPPCTIISEVSHILAGSKIILSSHNVCWEEKGAFTGEISPTMLQDAGASCAIVGHSERRQVFFESDEVINKRLKGALAFGLMGILCIGETLEEREAGNTQAVLERQVRKGLADVPASQM-KQVVLAYEPVWAIGTGVTASKEQVQETHAALRQLISEIYEKDIAEGLRILYGGSVKATNVDELMSQQDIDGALV 234
>gi|159038864|ref|YP_001538117.1| Triose-phosphate isomerase [Salinispora arenicola CNS-205] >gi|157917699|gb|ABV99126.1| Triose-phosphate isomerase [Salinispora arenicola CNS-205] (263 aa)
Score = 186, Expect = 2.9e-12, Identities = 61/229 (26%), Positives = 114/229 (49%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIP------NFENVKVMVAPSY--LGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTK-ENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  ++  NWKMN +++  +   + +          +V+ +V P +  L  V +        V   AQ++S  + G HTG ++   L   G     +GH + + D  E +  VN K+Q  L +G+  +L + E  +D+ E+ ++      Q++    G+ A + V +V + Y+P +    G+  +  D + + G    +R+ L   FG   A+ + ILYGG + + ++  I    DVDG L+
  S:     6 RRPLMAGNWKMNLNHLEANLLVQKLAASLTAKQLTDVEAVVLPPFTDLRTVQTAVDGDKLLVGYGAQDLSPHASGAHTGDIAGPMLAKLGCTYVVVGHSERRADHHEDDAVVNVKVQAALTHGLTPILCVGE-GLDIREQGSQVAYCNDQLDAALKGLSA-EQVAQVVVAYEPVWAIGTGKTATPEDAQEVCGA---LRQRLAGHFGQDTADQVRILYGGSVKSSNVAAIMAQTDVDGALV 241
>gi|163803555|ref|ZP_02197423.1| triosephosphate isomerase [Vibrio campbellii AND4] >gi|159172642|gb|EDP57498.1| triosephosphate isomerase [Vibrio campbellii AND4] (256 aa)
Score = 186, Expect = 2.9e-12, Identities = 65/230 (28%), Positives = 106/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  +++ NWK+N     +++    I       E V V VAP   Y+G+   +      KV + AQN    + G  TG +S   LKD+G     +GH + +    E +  +  K   L +NG+  V  I E++       T+     QIN + +  G++AL   +   I Y+P +    G+  +  D + I  +IR     L       VA  + I YGG +  ++ E      D+DG L+
  S:     1 MRRPVVMGNWKLNGSKAMVTELLAGINAELEGVEGVDVAVAPPALYIGVAECVIAEGGNKVILGAQNTDLNNSGAFTGDMSPEMLKDFGASHIIIGHSERREYHNESDEFIAKKFNFLKENGLTPVFCIGESEAQNEAGETEAVCARQINAVIDTCGVEAL---NGAIIAYEPIWAIGTGKAATAEDAQRIHASIRA----LIAAKDKAVAEQVIIQYGGSVKPENAEAYFSQPDIDGALV 234
>gi|187756721|tpg|DAA06180.1| TPA_inf: chloroplast triosephosphate isomerase [Volvox carteri] (287 aa)
Score = 186, Expect = 3.0e-12, Identities = 59/235 (25%), Positives = 106/235 (45%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           NWK N    S+ K        ++P    V ++ AP ++ I   +      K ++ AQN      G +TG VS  +L+D+G+    LGH + +    E N  V  K    L  G+  +  + ET   L + ++    ++   Q+   +D +    +V I Y+P +          E        +R F ++K G  VA+ L I+YGG + + + +E+    D+DG L+       + +++I
  S:    44 NWKCNGSVASVRKLVDELNSGSVP--RGVDIVCAPPFIYIDYVMQHLDKDKYQLAAQNCWIGGNGAYTGEVSAEQLQDFGLPWVILGHSERRSLCGETNQVVAKKTAHALDVGLGVIACVGET---LDQRNSGAMFQVLDGQMQALVDEVKDWSKVVIAYEPVWAIGTGVVATPEQAQEVHAYLRRFCQSKLGTSVADQLRIIYGGSVNDANCKELSVQEDIDGFLVGGASLKGSAFVTI 278
>gi|21672574|ref|NP_660641.1| triosephosphate isomerase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|2501315|sp|Q59179|TPIS_BUCAP Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|1448956|gb|AAC05431.1| triosephosphate isomerase [Buchnera aphidicola] >gi|21623202|gb|AAM67852.1| triosephosphate isomerase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (254 aa)
Score = 186, Expect = 3.0e-12, Identities = 67/244 (27%), Positives = 121/244 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFF----KNIPNF-ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKN-GMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M++KI+  NWK+N    +IS F       I +F +N  +++AP  + +        +  + + AQN+     G  TG  S L +KD G+K   +GH + ++   E N ++ AK   L+KN  +  +L I ET+ +     T++ L+ Q+N IFN        + V I Y+P +        D + +    + I+ +++ K+    A NL + YGG + + +     K  D+DG+LI        +++ I+
  S:     1 MKKKIIAANWKLNGSIKTISYFLTFLKSQISSFLKNNIIIIAPPTVFLERVYKDINSINIHLAAQNIDVNLTGAFTGENSALMMKDIGVKYIIIGHSERRLLHNENN-EIIAKKFCLVKNLNLVPILCIGETEAEKKSNKTEKILKEQLNSIFNSFGEKAFRNAV-IAYEPIWSIGTGVSADPKNVQLIHKFIKNYIK-KYDIVSAENLIVQYGGSVTSLNAGNFLKQPDIDGLLIGSASLKHEEFLKII 247
>gi|119357648|ref|YP_912292.1| triosephosphate isomerase [Chlorobium phaeobacteroides DSM 266] >gi|160185012|sp|A1BHJ1|TPIS_CHLPD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|119354997|gb|ABL65868.1| triosephosphate isomerase [Chlorobium phaeobacteroides DSM 266] (249 aa)
Score = 186, Expect = 3.1e-12, Identities = 61/244 (25%), Positives = 107/244 (43%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP-----NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+KI++ NWKMN            +       F    V +AP +  +   +G    +++ +VAQN  F   G  TG VS   +++ G      GH + +  F E N  VN K++  L  G+  ++   ET        T + +  Q+ +   G+  +D +  + I Y+P +         +E       +IR  +   FG   A  L I YGG +   + +E+    ++DG LI      +  +++I+
  S:     1 MRKKIVVGNWKMNKTVTESLVLAAEVTAALGEGFTGCDVGIAPPFTALY-EVGKLTGSRLALVAQNCHFEPDGAFTGEVSASMVREAGCSAVIAGHSERRHCFGETNAIVNRKVKHALSEGLQVIMCAGETLEQREGGVTGDVVTAQVRE---GLLGIDDISNIVIAYEPVWAIGTGKTATSEQAEEVHLLIRNTVSDLFGEEAAGRLRIQYGGSVKPSNAKELFSMPNIDGGLIGGASLNAADFVAIV 245
>gi|163740996|ref|ZP_02148389.1| triosephosphate isomerase [Phaeobacter gallaeciensis 2.10] >gi|161385987|gb|EDQ10363.1| triosephosphate isomerase [Phaeobacter gallaeciensis 2.10] (250 aa)
Score = 186, Expect = 3.2e-12, Identities = 60/230 (26%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQI-NQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K+   NWKMN    ++++      + ++ K  V++ P    +  +  +  ++KV + AQ+    + G HTG +S   L D G     LGH + + D  E +  V AK +  +  G+ A++ + ET  D     T + +R Q+   + +      +V    + Y+P +          E I      +R  L  +FG   AN + +LYGG +   + +EI     VDG L+
  S:     1 MRRKLAAGNWKMNGTASALTELGNLAYSCKSAKAEVLICPPATLLYRAANVCVDSKVSIGAQDCHSATYGAHTGDLSAEMLHDAGATAVILGHSERRADHGETDETVRAKAKTAIAAGLTAIICVGETLSDREAGKTLDVVRAQLAGSLPDDTSGTTVV----VAYEPVWAIGTGKVPTVEQIAEVHNDLRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALV 229
>gi|18310284|ref|NP_562218.1| triosephosphate isomerase [Clostridium perfringens str. 13] >gi|110799000|ref|YP_695952.1| triosephosphate isomerase [Clostridium perfringens ATCC 13124] >gi|110802901|ref|YP_698621.1| triosephosphate isomerase [Clostridium perfringens SM101] >gi|168207663|ref|ZP_02633668.1| triosephosphate isomerase [Clostridium perfringens E str. JGS1987] >gi|168211756|ref|ZP_02637381.1| triosephosphate isomerase [Clostridium perfringens B str. ATCC 3626] >gi|168215120|ref|ZP_02640745.1| triosephosphate isomerase [Clostridium perfringens CPE str. F4969] >gi|168218201|ref|ZP_02643826.1| triosephosphate isomerase [Clostridium perfringens NCTC 8239] >gi|169343205|ref|ZP_02864220.1| triosephosphate isomerase [Clostridium perfringens C str. JGS1495] >gi|182626597|ref|ZP_02954343.1| triosephosphate isomerase [Clostridium perfringens D str. JGS1721] >gi|123341810|sp|Q0STD6|TPIS_CLOPS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|123344773|sp|Q0TQY8|TPIS_CLOP1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|20140599|sp|Q8XKU1|TPIS_CLOPE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|18144964|dbj|BAB81008.1| triosephosphate isomerase [Clostridium perfringens str. 13] >gi|110673647|gb|ABG82634.1| triosephosphate isomerase [Clostridium perfringens ATCC 13124] >gi|110683402|gb|ABG86772.1| triosephosphate isomerase [Clostridium perfringens SM101] >gi|169298664|gb|EDS80743.1| triosephosphate isomerase [Clostridium perfringens C str. JGS1495] >gi|170661004|gb|EDT13687.1| triosephosphate isomerase [Clostridium perfringens E str. JGS1987] >gi|170710284|gb|EDT22466.1| triosephosphate isomerase [Clostridium perfringens B str. ATCC 3626] >gi|170713471|gb|EDT25653.1| triosephosphate isomerase [Clostridium perfringens CPE str. F4969] >gi|177908077|gb|EDT70650.1| triosephosphate isomerase [Clostridium perfringens D str. JGS1721] >gi|182379783|gb|EDT77262.1| triosephosphate isomerase [Clostridium perfringens NCTC 8239] (248 aa)
Score = 185, Expect = 3.2e-12, Identities = 57/230 (24%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+    + V + +  K +      +V+V P+++ +       +   ++V AQN+ F   G  TG ++   L+   I    +GH + +  F E +   N K++    + +  +L   ET       +T + ++ QI     G+   +  ++V I Y+P +         ++    TI  IR  +   FG  VA+ + I YGG +  + I E    +D+DG L+
  S:     1 MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTK-EQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALV 232
>gi|107023190|ref|YP_621517.1| triosephosphate isomerase [Burkholderia cenocepacia AU 1054] >gi|116690272|ref|YP_835895.1| triosephosphate isomerase [Burkholderia cenocepacia HI2424] >gi|194558640|ref|YP_002093666.1| Triosephosphate isomerase [Burkholderia cenocepacia PC184] >gi|105893379|gb|ABF76544.1| triosephosphate isomerase [Burkholderia cenocepacia AU 1054] >gi|116648361|gb|ABK09002.1| triosephosphate isomerase [Burkholderia cenocepacia HI2424] >gi|124872431|gb|EAY64147.1| Triosephosphate isomerase [Burkholderia cenocepacia PC184] (251 aa)
Score = 185, Expect = 3.2e-12, Identities = 62/242 (25%), Positives = 114/242 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIV---PSLGMSK----NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R K +I NWKM+            +   +    + A + +G+    P L   +      +V   AQ+VS    G  TG V+   + ++G + A +GH + +    E N  V AK Q+ L  G+  V+ + ET  +    +T++ +  Q++ +   + A D   R+ + Y+P + +G   S    +      + +  FLRT+     A ++ +LYGG +  D+ EE+    D+DG LI      +  +++I
  S:     5 RTKRVIGNWKMHGRLAGNQALLNEV--VQGAGTVAAETSIGVCVPFPYLAQVQAQLGGGRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESNETVAAKTQRALAAGLVPVVCVGETLDERESGATEQVVGAQLDAVLAVLTA-DEAARIVVAYEPVWAIGTGKSATSAQ-----AQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKAEDFLAI 246
>gi|53801486|gb|AAU93945.1| triose phosphate isomerase [Helicosporidium sp. ex Simulium jonesii] (252 aa)
Score = 185, Expect = 3.3e-12, Identities = 59/222 (26%), Positives = 102/222 (45%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    S+S   K      +P+ + V V+VAP++L +  +L  S  ++VEV AQN      G  TG +S  ++ D G K   LGH + +    E +  V  K+   L  G+  +  I E    LSE      + +   Q+      +    R+ + Y+P +    G++ +    + + G   + R ++       VA    I+YGG +   +  ++    D+DG L+
  S:    10 NWKCNGTKESVSALVKALSAAKLPSADKVDVVVAPTFLHLSQALS-SLPSRVEVSAQNCWIKGGGAFTGEISAEQIVDLGAKWVILGHSERRHIMGESDATVADKVAYALSKGLGVIFCIGE---QLSEREANHTMDVCTRQMAALASKISDWSRIVVAYEPVWAIGTGKVATPDQAQEVHG---LCRRWVAQHVSPAVAETTRIIYGGSVTAGNCRDLAAQPDIDGFLV 232
>gi|17231877|ref|NP_488425.1| triosephosphate isomerase [Nostoc sp. PCC 7120] >gi|20140608|sp|Q8YP17|TPIS_ANASP Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|17133521|dbj|BAB76084.1| triosephosphate isomerase [Nostoc sp. PCC 7120] (241 aa)
Score = 185, Expect = 3.4e-12, Identities = 58/230 (25%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM        +F K  +P  E      +V++   +  +         + V++ AQNV +   G +TG +S   L + G++   +GH + +  F E +  VN +LQ   K G+  +L + ETK       T+  +  Q+++    +D  ++V    I Y+P +        +       I +IR  L+        +++PI YGG +  ++I+EI    ++DG+L+
  S:     1 MRKIVIAGNWKMFKTQAESQEFLKEFLPALEETPQEREVLLCVPFTDLAILSQSLHGSLVQLGAQNVHWAENGAYTGEISGPMLTEIGVRYVIVGHSERRQFFGETDETVNLRLQAAQKYGLTPILCVGETKQQRDSGETESLIVSQLDKDLINVDQTNLV----IAYEPIWAIGTGDTCETTEANRVIGLIRSQLKN-------SDVPIQYGGSVKPNNIDEIMAQPEIDGVLV 224
>gi|15149252|gb|AAK85204.1|AF387821_1 triosephosphate isomerase B [Xiphophorus maculatus] (247 aa)
Score = 185, Expect = 3.4e-12, Identities = 69/236 (29%), Positives = 115/236 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMV-APS-YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN D  S+ +  + + + +   NV+V+  APS YL    S     +AK  V AQN    S G  TG +S   +KD G+    LGH + +  F E +  +  K    L++G+  +  I E K+D  E    E +     ++    D +    +V + Y+P +    G+  S    + +   +R    +L+T     VAN++ I+YGG +     +E+    DVDG L+    +L  ++I I+
  S:    10 NWKMNGDKKSLGELIQTLNSGKVDSNVEVVCGAPSIYLDFARS---KLDAKFGVAAQNCYKVSKGAFTGEISPAMIKDCGVNWVILGHSERRHVFGESDELIGQKTAHALESGLGVIACIGE-KLDEREGGITEKVVFAQTKVI--ADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHEKLRA---WLKTNVSDAVANSVRIIYGGSVTGGTCKELASQKDVDGFLVGGA-SLKPEFIDII 243
>gi|126729650|ref|ZP_01745463.1| Triosephosphate isomerase [Sagittula stellata E-37] >gi|126709769|gb|EBA08822.1| Triosephosphate isomerase [Sagittula stellata E-37] (248 aa)
Score = 185, Expect = 3.5e-12, Identities = 63/244 (25%), Positives = 103/244 (42%)
  Q:     1 MREKILITNWKMNADYVSISKF-FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR K+   NWKMN    S+ +            +V++ P    I  +   ++N  V V  Q+      G HTG ++   LKD G     LGH + + D  E+N  V  K       G+ AV+ + ET   L +  +   L +   Q+   I        + + Y+P +          + I      IR  L  +FG  V  ++ ILYGG +   + EEI   ++VDG L+      ++ ++ I+
  S:     1 MRTKLAAGNWKMNGTIASLDELDAMAEAAKGAAEVLICPPATLISAASARAEN--VAVGGQDCHGKPSGAHTGDIAAEMLKDAGASYVILGHSERRTDHDERNDTVRDKCDAAWAAGLTAVVCVGET---LDQRESSNTLDIIGGQLAGSIPDAATGHNLVVAYEPVWAIGTGKVPTTDQIGEVHDFIRARLERRFGEGVGRSVRILYGGSVKAANAEEIFATSNVDGALVGGASLKASDFVPII 240
>gi|56697463|ref|YP_167831.1| triosephosphate isomerase [Silicibacter pomeroyi DSS-3] >gi|81676182|sp|Q5LQ75|TPIS_SILPO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56679200|gb|AAV95866.1| triosephosphate isomerase [Silicibacter pomeroyi DSS-3] (251 aa)
Score = 185, Expect = 3.5e-12, Identities = 60/230 (26%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKF--FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI-DALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K+   NWKMN    ++          +   V +++ P    +  +  +++ ++V +  Q+    + G HTG +S + L D G     LGH + + D  E + QV  K +  L+ G+ A++ I ET   L++    + L +   Q+   + D +D   RV + Y+P +          E I      +R+ L  +FG   A  + +LYGG +   +  EI   ++VDG L+
  S:     1 MRRKLAAGNWKMNGTGAALDALEAIAGAHSAAAVDLLICPPATLLYRAAQVAEGSRVRIGGQDCHAVTAGAHTGDISAMMLADAGASAVILGHSERRADHGETDAQVCDKARAALEAGLIAIICIGET---LAQREAGQTLDVVCAQLAGSVPDGIDGT-RVVVAYEPVWAIGTGLVPTLEQIAEVHDTLRQQLIGRFGSETAEAIRLLYGGSVKPGNAAEIFAVSNVDGALV 229
>gi|77414686|ref|ZP_00790820.1| triosephosphate isomerase [Streptococcus agalactiae 515] >gi|77159264|gb|EAO70441.1| triosephosphate isomerase [Streptococcus agalactiae 515] (246 aa)
Score = 185, Expect = 3.6e-12, Identities = 54/236 (22%), Positives = 106/236 (44%)
  Q:     9 NWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN +      F +     +P+ E V+  +A   L +   L  +K +++++ AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+   + V  + I Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++ E     DVDG L+      +  ++++L
  S:     4 NWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSELKIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFANGLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSE-EQVSSLVIAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLEAESFLALL 242
>gi|156838518|ref|XP_001642963.1| hypothetical protein Kpol_1071p12 [Vanderwaltozyma polyspora DSM 70294] >gi|156113546|gb|EDO15105.1| hypothetical protein Kpol_1071p12 [Vanderwaltozyma polyspora DSM 70294] (248 aa)
Score = 185, Expect = 3.7e-12, Identities = 68/222 (30%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVSISKFFK--NIPNF-ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N D  SI +  +  N  N  ENV+V++ P    I  ++ +    +V V  QN    + G  TG  S  ++KD G K   LGH + +  F E +  V  K +  L NG+  +L I ET  +     T E +  Q+N +   I  +     V I Y+P +    G   +  D + I  +   IR+FL +K G   A  + ILYGG     +        D+DG L+
  S:    10 NFKLNGDKKSIKEIVERLNTANLAENVEVVICPPAAYIDYTVQLVNKPQVTVGGQNTYLKASGAFTGENSVDQIKDLGAKWVILGHSERRTYFHEDDKIVADKTKFALDNGVGVILCIGETLEEKKAGITLEVVERQLNAV---IAEVKDWTNVVIAYEPVWAIGTGLAATAEDAQDIHAS---IRKFLVSKIGEKAAEEIRILYGGSANGGNCSTFKDKKDIDGFLV 231
>gi|88805992|ref|ZP_01121510.1| triosephosphate isomerase [Robiginitalea biformata HTCC2501] >gi|88783601|gb|EAR14772.1| triosephosphate isomerase [Robiginitalea biformata HTCC2501] (239 aa)
Score = 185, Expect = 3.7e-12, Identities = 55/214 (25%), Positives = 107/214 (50%)
  Q:    31 NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           + +VMVAP ++ +  ++   +++K+E +AQN+ F   G +TG V+   L   G+ T  LGH + +  F E +  +  K+ + ++ GM  +    E   +L +    ++  +  +Q+ N +  L  +   R+ + Y+P +    GE  S    + +      IR+ +   +   VA  + ILYGG +   +  EI    DVDG LI      ++ +++I+
  S:    23 SAEVMVAPVFVNLAEAVRRLEHSKIEAIAQNMHFADSGAYTGEVAADMLLGIGVDTVILGHSERRAYFGEDDDLLAKKVGQAIEKGMRTIFCFGE---ELKDRQAGKHFEVVESQLKNALFQLPEEAWGRIVLAYEPVWAIGTGETASPEQAQEMHA---FIRKIVSDAYTDAVAQKVSILYGGSVKPGNAAEIFSKPDVDGGLIGGASLKADDFVAII 235
>gi|1431731|pdb|1BTM|A Chain A, Triosephosphate Isomerase (Tim) Complexed With 2- Phosphoglycolic Acid >gi|1431732|pdb|1BTM|B Chain B, Triosephosphate Isomerase (Tim) Complexed With 2- Phosphoglycolic Acid (252 aa)
Score = 185, Expect = 3.8e-12, Identities = 60/229 (26%), Positives = 108/229 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKM+       +F +++     P  E + V+ AP +L +   +  +    +++ AQ + F   G +TG VS + LKD G+    LGH + +  F E +  VN K+      G+  ++   E+  +     T   +  Q+ +   G+   + V +  I Y+P +    G+ ++  D   + G IR +   L   FG   A  + I YGG +  D+I +      +DG L+
  S:     1 RKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAP-FLFLDRLVQAADGTDLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTP-EQVKQAVIAYEPIWAIGTGKSSTPEDANSVCGHIRSVVSRL---FGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLV 232
>gi|166154538|ref|YP_001654656.1| triosephosphate isomerase [Chlamydia trachomatis 434/Bu] >gi|166155413|ref|YP_001653668.1| triosephosphate isomerase [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930526|emb|CAP04021.1| triosephosphate isomerase [Chlamydia trachomatis 434/Bu] >gi|165931401|emb|CAP06975.1| triosephosphate isomerase [Chlamydia trachomatis L2b/UCH-1/proctitis] (274 aa)
Score = 185, Expect = 3.8e-12, Identities = 61/242 (25%), Positives = 108/242 (44%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYL-GIVPSLGM-------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ +  NWKMN        F K+   F +  ++  P  + GI+P   +         ++ + + AQ       G  TG +S   LKD G+    +GH + +  F E+N  +  K    + +GM  VL I ET   L E+ +     + +NQ+  G+  L       + Y+P +          + +  T    R+ + + F   +A   PILYGG +  D+   +    DV+G+L+      S  ++SI+
  S:    25 KQFVFGNWKMNKTLTEAQTFLKS---FLSSDILSNPQIITGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSERRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGET---LEEQESGATQDILLNQLTIGLSKLPEQASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNARSLSLCPDVNGLLVGGASLSSENFLSII 268
>gi|104773735|ref|YP_618715.1| triosephosphate isomerase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513734|ref|YP_812640.1| triosephosphate isomerase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275496|sp|Q04BH0|TPIS_LACDB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|122983989|sp|Q1GB25|TPIS_LACDA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|3122974|sp|O32757|TPIS_LACDE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|2624193|emb|CAA04016.1| triosephosphate isomerase [Lactobacillus delbrueckii] >gi|103422816|emb|CAI97466.1| Triosephosphate isomerase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093049|gb|ABJ58202.1| triosephosphate isomerase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (252 aa)
Score = 185, Expect = 3.9e-12, Identities = 56/243 (23%), Positives = 119/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R  I+  NWK+N +     +F       +P+   V+ ++    + +   L  ++ + + V A+N  + + G  TG  S   LK+ G++   +GH + +  F E +  +N K + +  NG+  +L   E+    + E+ KEN    ++QI  G++ L  + V ++ I Y+P +         ++      + IRE ++  +    A N+ I YGG +   +++E+    ++DG L+     + + Y++++
  S:     3 RTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNLHVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFANGLTPILCCGESLE--TREAGKEN-EWVVSQIKAGLEGLTSEQVSKLVIAYEPIWAIGTGKTASSDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMAKPNIDGGLVGGASLVPDSYLALV 248
>gi|47271422|ref|NP_705954.2| triosephosphate isomerase 1b [Danio rerio] >gi|31418987|gb|AAH53294.1| Triosephosphate isomerase 1b [Danio rerio] >gi|156230739|gb|AAI52272.1| Tpi1b protein [Danio rerio] (248 aa)
Score = 185, Expect = 4.0e-12, Identities = 67/236 (28%), Positives = 112/236 (47%)
  Q:     9 NWKMNADYVSISKFFKNIP----NFENVKVMVAPS-YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN D  SI +    +     N +   V  AP+ YL    S     N  ++V AQN    + G  TG +S   +KD G+K   LGH + +  F E +  +  K+   L+NG+  +  I E K+D  E    E +     +     D +    +V + Y+P +    G+  S    + +      +R++L+T     VAN++ I+YGG +     +E+    D+DG L+    +L  ++I I+
  S:    11 NWKMNGDKKSIEELANTLNSAKLNPDTEVVCGAPTIYLDYARS---KLNPNIDVAAQNCYKVAKGAFTGEISPAMIKDCGVKWVILGHSERRHVFGESDELIGQKVAHALENGLGVIACIGE-KLDEREAGITEKVVFAQTKFI--ADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHDK---LRQWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDLDGFLVGGA-SLKPEFIDII 244
>gi|90407733|ref|ZP_01215912.1| triosephosphate isomerase [Psychromonas sp. CNPT3] >gi|90311202|gb|EAS39308.1| triosephosphate isomerase [Psychromonas sp. CNPT3] (250 aa)
Score = 185, Expect = 4.1e-12, Identities = 58/244 (23%), Positives = 116/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR  +++ NWK+N    S+    + +        NV+V V P  + +     ++ N  ++  AQ+VS    G +TG  S + +K++G   + +GH + +    E N  V AK   +  +G+  VL I ET  +     T + +  Q+  + + +  ++  +   I Y+P +    G++ +    + +      IR +L+ +    VA  + ILYGG +     +E+    D+DG L+     +  +++ I+
  S:     1 MRTPLVMGNWKLNGTKASVKSLIEGLEAAADAATNVEVAVCPPAIFMEQVANLTANNSIKFGAQDVSTHIDGAYTGETSPVMVKEFGATYSLVGHSERRQYHNETNEVVAAKFVAIQAHGLVPVLCIGETLEERESNVTSQVVETQLKAVID-VAGINAFENCVIAYEPIWAIGTGKVATSAQAQEVHAH---IRNWLKAQ-SEVVAEKVQILYGGSVKAASAKELFAQADIDGGLVGGAALIITEFVGII 246
>gi|187281708|ref|NP_001119730.1| triosephosphate isomerase [Bombyx mori] >gi|125987866|sp|P82204|TPIS_BOMMO Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|52222824|gb|AAU34185.1| triosephosphate isomerase [Bombyx mori] (248 aa)
Score = 184, Expect = 4.2e-12, Identities = 64/229 (27%), Positives = 107/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNI------PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN D   I++   N+      PN E V V V   YL  V ++ +  N  VEV AQN      G  TG +S   +KD G+    LGH + +  F EK+  V  K+   L++G+  +  I ET  +     T+E +  Q+  + + I   D  + + + Y+P +          +        +R +L       V++ + I YGG +   + +E+    D+DG L+
  S:     3 RKFVVGGNWKMNGDKNQINEIVNNLKKGPLDPNVE-VIVGVPAIYLSYVKTI-IPDN--VEVAAQNCWKSPKGAFTGEISPAMIKDVGVNWVILGHSERRTIFGEKDELVAEKVAHALESGLKVIACIGETLEERESGKTEEVVFRQLKALVSAIG--DKWENIVLAYEPVWAIGTGKTATPQQAQDVHHALRNWLSANVSGSVSDAVRIQYGGSVTAANAKELASCKDIDGFLV 231
>gi|78067048|ref|YP_369817.1| triosephosphate isomerase [Burkholderia sp. 383] >gi|77967793|gb|ABB09173.1| triosephosphate isomerase [Burkholderia sp. 383] (251 aa)
Score = 184, Expect = 4.2e-12, Identities = 61/242 (25%), Positives = 114/242 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIV---PSLGMSK----NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R K +I NWKM+            +   +    + A + +G+    P L   +      +V   AQ+VS    G  TG V+   + ++G + A +GH + +    E+N  V AK Q+ L  G+  V+ + ET  +    +T++ +  Q++ +   + A D   R+ + Y+P + +G   S    +      + +  FLR +     A ++ +LYGG +  D+ EE+    D+DG LI      +  +++I
  S:     5 RTKRVIGNWKMHGRLAGNQALLNEV--VQGAGAVAAETSIGVCVPFPYLAQVQAQLDGGRVAWGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGERNETVAAKTQRALAAGLTPVVCVGETLDERESGATEQVVGAQLDAVLAVLTA-DEATRIVVAYEPVWAIGTGKSATSAQ-----AQDVHAFLRARLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKAEDFLAI 246
>gi|167575816|ref|ZP_02368690.1| triosephosphate isomerase [Borrelia valaisiana VS116] (253 aa)
Score = 184, Expect = 4.4e-12, Identities = 62/244 (25%), Positives = 124/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++  +M+ P +  +       K++ + + AQN+S+   G  T  +S L L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L E  + + L + +NQ+  G+  +   D  R+ + Y+P +    G+  +K + E +   IR+  E ++  +    ++N+ I YGG + + +++E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSEEASIVAKKIATEVKSLKDDCVIMITPPFTALSKVSECIKDSNILLGAQNMSYMESGARTSEISPLMLLEFGVEYVILGHSECRLYLTETDEIINKKILTGLKHSFKYLILCVGET---LDERDSGKTLDVVLNQVKKGLKNVSESDIKRIILAYEPVWAIGTGKTATKEEAEEVHKAIRL--EIMKL-YSKSASDNIIIQYGGSVNSSNVKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|136061|sp|P00941|TPIS_LATCH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) (247 aa)
Score = 184, Expect = 4.4e-12, Identities = 64/222 (28%), Positives = 110/222 (49%)
  Q:     9 NWKMNADYVSISKFFKNIPNFENV----KVMVAP--SYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN D  S+ +  + + N   V    +++ AP  +YL       +  + K  V AQN    S G  TG +S   +KD G+    LGH + +  F E +  +  K+   L  G+  V  I E K+D  E    E +  ++ ++     A D+ D  +V + Y+P +    G+  S   ++ + G    +R++L+      VA+++ I+YGG +     +E+    DVDG L+
  S:    10 NWKMNGDKKSLGELIQTL-NAAKVPFTGEIVCAPPEAYLDFAR---LKVDPKFGVAAQNCYKVSKGAFTGEISPAMIKDCGVTWVILGHSERRHVFGESDELIGQKVSHALSEGLGVVACIGE-KLDEREAGITEGVVFEVTEVI----ADDVKDWSKVVLAYEPVWAIGTGKTASPQQSQELHGK---LRKWLKENVSETVADSVRIIYGGSVTGATCKELASEPDVDGFLV 230
>gi|160890812|ref|ZP_02071815.1| hypothetical protein BACUNI_03257 [Bacteroides uniformis ATCC 8492] >gi|156859811|gb|EDO53242.1| hypothetical protein BACUNI_03257 [Bacteroides uniformis ATCC 8492] (251 aa)
Score = 184, Expect = 4.4e-12, Identities = 61/230 (26%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K        E  N  V++   ++ +     +   AK+ V A+N +    G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +          E        IR  +  K+G  +A+N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNETLANEKPNCDVIICTPFIHLASVTPLVDAAKIGVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQLASVFS-LSAEDF-SKIILAYEPVWAIGTGKTATAEQAQEIHAFIRSLIAEKYGKEIADNCSILYGGSCKPSNAKELFANPDVDGGLI 233
>gi|15835221|ref|NP_296980.1| triosephosphate isomerase [Chlamydia muridarum Nigg] >gi|13878828|sp|Q9PK66|TPIS_CHLMU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|7190642|gb|AAF39435.1| triosephosphate isomerase [Chlamydia muridarum Nigg] (270 aa)
Score = 184, Expect = 4.6e-12, Identities = 59/236 (25%), Positives = 105/236 (44%)
  Q:     9 NWKMNADYVSISKFFKNIPNFENVKVMVAPSYL-GIVPSLGM-------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN  +     F K+   F + +++  P  + GI+P   +        KN  + + AQ +     G  TG +S   LKD G+    +GH + +  F E+N+ +  KL   ++NG+  VL I ET   L E+       + + Q+  G+  L       + Y+P +        + + +       R  ++       A   PILYGG +  D+   +    DV+G+L+         +++I+
  S:    27 NWKMNKTFSEAQTFLKD---FVSCEILSNPKIITGIIPPFTLLSSCQQIIKNTPIRLGAQTLHEVDSGAFTGEISAPMLKDIGVDFVLIGHSERRHIFHEQNHSLAEKLLAAIRNGIVPVLCIGET---LEEQEAGATQDILLEQLTVGLSRLPEHAPFILAYEPVWAIGTGKVANPDLVQEIHAFCRNVVKDLISKDAAERTPILYGGSVKADNTRALTLCPDVNGLLVGGASLSVESFLAII 264
>gi|134301294|ref|YP_001121262.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134049071|gb|ABO46142.1| triosephosphate isomerase [Francisella tularensis subsp. tularensis WY96-3418] (248 aa)
Score = 184, Expect = 4.7e-12, Identities = 65/222 (29%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          E I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:     3 NWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLEQIQETHQFIRSLL-AKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLI 225
>gi|88770676|gb|ABD51941.1| chloroplast triose phosphate isomerase [Guillardia theta] (374 aa)
Score = 184, Expect = 4.7e-12, Identities = 59/243 (24%), Positives = 116/243 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKN--IPNFENVKVMVAPSYLGIVPSLG----MSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVD--FKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R  ++  NWKMN + +  +K   +  + + ++VK  V        P L     + K+++V++ AQ++     G  TG VS  +++  G K   +GH + +      E N  +N K++  + +G+ A L I ETK +   +  KE    Q+ +   G+    + + V + Y+P +          E        +R++L   +    A ++ ILYGG +  D+++++    D+DG L+     +  K+  I+
  S:   122 RRFLIAGNWKMNPETMDEAKALASSVVESAKSVKKGVDICICCPHPFLATCAQICKDSEVKIGAQDIFTEEKGAFTGGVSIKQVESIGCKYVLIGHSERRHGNIASESNAMINKKVKMTIDSGLVACLCIGETKAEFEAKKNKEVCAKQLAEGLAGVTKEQLAN-VVLAYEPVWAIGTGYTASPEIAQDVHNYVRQWLEQNYDKATAESVRILYGGSVTPDNVDQLMACPDIDGALVGGASLVGEKFARIM 371
>gi|182415633|ref|YP_001820699.1| Triose-phosphate isomerase [Opitutus terrae PB90-1] >gi|177842847|gb|ACB77099.1| Triose-phosphate isomerase [Opitutus terrae PB90-1] (256 aa)
Score = 184, Expect = 4.9e-12, Identities = 68/229 (29%), Positives = 115/229 (50%)
  Q:     2 REKILITNWKMN---ADYVSISKFFKNIPNFEN-VKVMVAPSYLGIVPSLGMS-KNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+K++  NWKMN   AD V++ K         N V ++V P ++ I  S+G + + + V++ AQN+   + G  TG VS   L+        LGH + +  F E +  +N K+   LKN +  +L + ET   L+E      L++   Q+  G++ +  +    V I Y+P +    G++ +    + +      IR  L   FG  +A  + ILYGG +   +  E+    D+DG LI
  S:     4 RKKLIAGNWKMNKTPADGVALVKEIVAAAGKNNDVDMVVCPPFVAI-ESVGKALEGSNVKLGAQNMHPEASGAFTGEVSAPMLRAVFATHVILGHSERRAYFAETDAFINKKVLAALKNQLKPILCVGET---LAEREAGSTLKVVQTQLEGGLEGVSKEQAATVVIAYEPVWAIGTGKVATTDQAQEVHA---FIRGLLVKLFGDAIAAKVRILYGGSMKPSNAPELLAQKDIDGGLI 235
>gi|163739791|ref|ZP_02147199.1| triosephosphate isomerase [Phaeobacter gallaeciensis BS107] >gi|161387021|gb|EDQ11382.1| triosephosphate isomerase [Phaeobacter gallaeciensis BS107] (250 aa)
Score = 184, Expect = 4.9e-12, Identities = 62/230 (26%), Positives = 104/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K+   NWKMN    ++++      + ++ K  V++ P    +  +  +  ++KV + AQ+    + G HTG +S   L D G     LGH + + D  E +  V AK +  +  G+ A++ + ET  D     T + +R Q+       DA      V + Y+P +          E I      +R  L  +FG   AN + +LYGG +   + +EI     VDG L+
  S:     1 MRRKLAAGNWKMNGTASALTELGNLAYSCKSAKAEVLICPPATLLYRAANVCVDSKVSIGAQDCHDATYGAHTGDLSAEMLHDAGATAVILGHSERRADHDETDETVRAKAKTAIAAGLTAIICVGETLNDREAGKTLDVVRAQLAGSLPD-DASGTT--VVVAYEPVWAIGTGKVPTVEQIAEVHNDMRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALV 229
>gi|160883186|ref|ZP_02064189.1| hypothetical protein BACOVA_01155 [Bacteroides ovatus ATCC 8483] >gi|156111411|gb|EDO13156.1| hypothetical protein BACOVA_01155 [Bacteroides ovatus ATCC 8483] (251 aa)
Score = 184, Expect = 5.0e-12, Identities = 64/230 (27%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K        E  N  V++   ++ +     +   AK+ V A+N +  + G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +    G+  S    + I   IR I   +  K+G  +A+N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKIGVGAENCADKASGAYTGEVSAEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQMESVFS-LSAEDF-SKIVLAYEPVWAIGTGKTASPEQAQEIHAFIRSI---VANKYGKEIADNTSILYGGSCKPSNAKELFANPDVDGGLI 233
>gi|94268754|ref|ZP_01291275.1| Triosephosphate isomerase [delta proteobacterium MLMS-1] >gi|93451476|gb|EAT02310.1| Triosephosphate isomerase [delta proteobacterium MLMS-1] (250 aa)
Score = 184, Expect = 5.0e-12, Identities = 65/230 (28%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-------PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  +L  NWKM+ D  + ++    +       P  E   VM+AP +  +  + G +   +V + AQNV + + G  TG ++   L++ G   A +GH + +  F E N  +N +L   L +G+  VL I ET  +   + T E L  Q+ +   GI +LD   ++ + Y+P +          E      + +R  L   +   +A+ + ILYGG +   +++ I    DVDG L+
  S:     1 MRTPLLAGNWKMHLDQAAAAELAAAVAKVAAACPERE---VMIAPPFTALA-AAGQAAGQQVILAAQNVCWEAQGAFTGEIAPPMLRELGCGMALVGHSERRQLFHEDNSMINRRLGGALAHGLVPVLCIGETLAEREADRTMEVLASQLREGLAGI-SLDDPRQLVVAYEPVWAIGTGKTAGPEQAQEAHQFVRGLLAELYQKNIADGVRILYGGSVNAANVDTIMAQPDVDGALV 232
>gi|85374121|ref|YP_458183.1| triosephosphate isomerase [Erythrobacter litoralis HTCC2594] >gi|84787204|gb|ABC63386.1| triosephosphate isomerase [Erythrobacter litoralis HTCC2594] (254 aa)
Score = 184, Expect = 5.1e-12, Identities = 67/238 (28%), Positives = 113/238 (47%)
  Q:     6 LITNWKMNADYVSISK---FFKNIPNFENVKVMVAPSYLGIVPSLGMSKNA-KVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL-DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           ++ NWKMN     +S+     +    +  V+V VAP +  I     + + A ++ V AQ+      G HTG +S     D G K   LGH + + D  E N  V +K +  L+ G+  +L   E +    E   +E +  Q+    +  DA+ D+V+R+ I Y+P +    G   +  D   + G IR    FL  +FG      + ILYGG +  ++  EI    +V G L+      ++ +++I
  S:     7 IVGNWKMNGTRAMLSEARAIDRAAQRYMKVEVAVAPPFTLI---HAVHREAEQIAVGAQDCHADPDGAHTGDISATMAADAGAKFVILGHSERRQDHGESNELVRSKAEAALEAGLKVILCCGEPEEKRDEGKAEEFVLTQLK--LSLPDAMEDVVERLTIAYEPIWAIGTGRTPTLDDIAAMHGAIRA---FLVERFGEEDGGQIRILYGGSVKPENAREILGVANVGGALVGGASLTADSFMNI 244
>gi|29349337|ref|NP_812840.1| triosephosphate isomerase [Bacteroides thetaiotaomicron VPI-5482] >gi|39932388|sp|Q8A0U2|TPIS_BACTN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|29341245|gb|AAO79034.1| triosephosphate isomerase [Bacteroides thetaiotaomicron VPI-5482] (252 aa)
Score = 184, Expect = 5.2e-12, Identities = 64/230 (27%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K        E  N  V++   ++ +     +   AK+ V A+N +  + G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +    G+  S    + I   IR I   +  K+G  +A+N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKIGVGAENCADKASGAYTGEVSAEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQMESVFS-LSAEDF-SKIILAYEPVWAIGTGKTASPEQAQEIHAFIRSI---VADKYGKEIADNTSILYGGSCKPSNAKELFSNPDVDGGLI 233
>gi|75909497|ref|YP_323793.1| triosephosphate isomerase [Anabaena variabilis ATCC 29413] >gi|123608891|sp|Q3M7Y8|TPIS_ANAVT Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|75703222|gb|ABA22898.1| triosephosphate isomerase [Anabaena variabilis ATCC 29413] (241 aa)
Score = 184, Expect = 5.3e-12, Identities = 58/230 (25%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM        +F K  +P  E      +V++   +  +         + V++ AQNV +   G +TG +S   L + G++   +GH + +  F E +  VN +LQ   K G+  +L + ETK       T+  +  Q+++    +D  ++V    I Y+P +        +       I +IR  L+         ++PI YGG +  ++I+EI    ++DG+L+
  S:     1 MRKIVIAGNWKMFKTQAESQEFLKEFLPALEETPQEREVLLCVPFTDLAILSQSLHGSLVQLGAQNVHWAENGAYTGEISGPMLTEIGVRYVIVGHSERRQFFGETDETVNLRLQAAQKYGLTPILCVGETKQQRDSGETESLIVSQLDKDLINVDQTNLV----IAYEPIWAIGTGDTCETTEANRVIGLIRSQLKNP-------DVPIQYGGSVKPNNIDEIMAQPEIDGVLV 224
>gi|21674265|ref|NP_662330.1| triosephosphate isomerase [Chlorobium tepidum TLS] >gi|34222896|sp|Q8KCH7|TPIS_CHLTE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|21647435|gb|AAM72672.1| triosephosphate isomerase [Chlorobium tepidum TLS] (245 aa)
Score = 183, Expect = 5.6e-12, Identities = 67/239 (28%), Positives = 117/239 (48%)
  Q:     6 LITNWKMN---ADYVSISKFFKNIPNFENVK--VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNG-IDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRV-IREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           ++ NWKMN   A+ V ++         + V+  V +AP++  +     + + + + + AQN  + S G  TG VS   L   G     LGH + +  F E N  VN K++K L  G++ +L + ET   L E       ++   Q+  G ID  DI  ++ I Y+P +    G+  +K   + +   IR  + E     +G   A++L I YGG +   +  E+    D+DG LI      ++ +++I+
  S:     1 MVGNWKMNNTIAESVDLATAIAEKVGADGVQCEVGIAPTFPALYEVCKVIEWSGIRLCAQNCHYESDGPFTGEVSTRMLAAAGCSYVILGHSERRQLFGETNATVNLKVKKALAEGLSVILCVGET---LDERERGVTGQIVTAQVVEGLIDVTDI-SKLVIAYEPVWAIGTGKTATKEQAQEVHALIRAKVTEL----YGQKAADHLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNADDFMAIV 241
>gi|168021813|ref|XP_001763435.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162685228|gb|EDQ71624.1| predicted protein [Physcomitrella patens subsp. patens] (269 aa)
Score = 183, Expect = 5.7e-12, Identities = 63/222 (28%), Positives = 101/222 (45%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    SI K  +++ + +   +V V+VAP +L I   +G S   ++EV AQN      G  TG +S  +L D G+K    GH + +    E N  V  K    L  G+  +  + E    L E        +   Q+    D +    +V I Y+P +    G++ S    + +      IR +L  K    V++   I+YGG +   +  E+ K  D+DG L+
  S:    25 NWKCNGTTESIKKLVEDLNSAQIEDDVDVVVAPPFLYISQVVG-SLTDRIEVSAQNSWVGKGGAFTGEISADQLVDVGVKWVIQGHSERRHVIGESNSTVGKKSAYALSKGLGLIACVGEL---LEEREAGRTTDVVFEQLQAYADEISDWSKVVIAYEPVWAIGTGKVASPQQAQEVHSA---IRSWLSDKISPEVSSATRIIYGGSVNGANSAELAKQEDIDGFLV 245
>gi|33240351|ref|NP_875293.1| triosephosphate isomerase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|39932305|sp|Q7VC41|TPIS_PROMA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|33237878|gb|AAP99945.1| Triosephosphate isomerase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (243 aa)
Score = 183, Expect = 5.7e-12, Identities = 58/230 (25%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVK-VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+    S    I KF      F + + V++AP +  I     + +   +++ +QNV +   G  T  +S   L ++ ++ A +GH + +  F E + Q+N + +    NG+  ++ + E+   + +    E  R+   Q+  G++  D+  ++ I Y+P +    G+     +   I G IR    F          ++L I YGG +   +I+EI   +D+DG+L+
  S:     1 MRKTVIAGNWKMHMTCSSAKEYIDKFIPFSKEFPSDRHVVIAPPFTAISTLASLLQGTNIQLSSQNVHWEDTGAFTAEISPSMLLEHDVRYAIVGHSEPRKYFSESDEQINLRARSAQSNGLIPIVCVGES---IEQRERGEAERVIRRQVEQGLEQTDLT-KLVIAYEPIWAIGTGKTCESNEANRICGLIREWAGF----------SDLIIQYGGSVKPANIDEIMSMSDIDGVLV 224
>gi|195962585|ref|ZP_03098790.1| triosephosphate isomerase [Borrelia spielmanii A14S] (253 aa)
Score = 183, Expect = 5.9e-12, Identities = 63/244 (25%), Positives = 122/244 (50%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMN-AVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+  L  NWKM+      S   K I        ++  +M+ P +  +       K + + + AQN+S+   G  T  +S   L ++G++   LGH + ++   E +  +N K+   LK+     +L + ET   L E  + + L + +NQ+  G+D +   D  R+ + Y+P +    G+  +K + E +   IR+  E ++  +    ++N+ I YGG +   +I+E+    ++DG LI      +  ++SI+
  S:     1 MRKTFLAGNWKMHYTSEEASIVAKQIATEVKTLKDDFVIMLTPPFTALSKVSECIKGSNILLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILAGLKHSFKYLILCVGET---LDERDSGKTLDVVLNQVKKGLDCVSESDIKRIILAYEPVWAIGTGKTATKEEAEEVHKAIRL--EIMKL-YSKSASDNIIIQYGGSVNASNIKELMNEPNIDGALIGGASLKAESFLSII 249
>gi|29840073|ref|NP_829179.1| triosephosphate isomerase [Chlamydophila caviae GPIC] >gi|33301714|sp|Q823U7|TPIS_CHLCV Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|29834421|gb|AAP05057.1| triosephosphate isomerase [Chlamydophila caviae GPIC] (254 aa)
Score = 183, Expect = 6.3e-12, Identities = 67/229 (29%), Positives = 106/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGM---------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+  +  NWKM+        F      F  VK +   S +GI P+              ++ + + AQNV   S G  TG VS   L+++ +    LGH + +  F E++  +  K+    ++G+  VL I ET       +TKE L    NQ+  G+  L     V I Y+P +    G++ S  D + +       RE L   F    +  + ILYGG +  D+ E   +  DVDG+L+
  S:     3 RKSYVFGNWKMHKTAKEAKDFLSIFCPF--VKEISPASLVGIAPAFTTLSACCESIKEMDSSIWLGAQNVHQDSSGAFTGEVSLPMLQEFHVNFVLLGHSECRHIFHEEDATIALKVGAAARSGVVPVLCIGETLEARENGTTKEVLS---NQLMLGLAQLPETAPVIIAYEPVWAIGTGKVASTADVQEVHA---FCREVLSRIFSKEKSEIISILYGGSVKADNAEGFARCPDVDGLLV 235
>gi|154305175|ref|XP_001552990.1| hypothetical protein BC1G_08882 [Botryotinia fuckeliana B05.10] >gi|150853624|gb|EDN28816.1| hypothetical protein BC1G_08882 [Botryotinia fuckeliana B05.10] (247 aa)
Score = 183, Expect = 6.7e-12, Identities = 63/240 (26%), Positives = 114/240 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           N+KMN    SI K   N+ + +   N +V++AP  L ++ +    +   +EV AQNV     G  TG +S  +LKD  I    LGH + +V  +E +  V  K +  L  G+  +    ET   L +  + + + +   Q+    D +    ++ I Y+P +    G++ S    + +      IR +L+ +     A    I+YGG +   + +++ K  D+DG L+    +L   ++ I+  HL
  S:    10 NFKMNGSVDSIKKIVGNLNDAKLDPNTEVVIAPPALYLLLTREHLRPG-LEVAAQNVFDKPNGAFTGEISVEQLKDSNITWTLLGHSERRVILQEDDSFVACKTKAALDGGVGVIFCCGET---LEQRESNKTIEVVTAQLKAVKDKVQDWSKIVIAYEPIWAIGTGKVASTEQAQEVHAA---IRSWLKKEVSEKAAEETRIIYGGSVSEKNCKDLSKQEDIDGFLVGGA-SLKPAFVDIINSHL 247
>gi|15616917|ref|NP_240130.1| triosephosphate isomerase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11135227|sp|P57393|TPIS_BUCAI Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|25292531|pir||H84965 triose-phosphate isomerase (EC 5.3.1.1) [imported] - Buchnera sp. (strain APS) >gi|10038981|dbj|BAB13016.1| triosephosphate isomerase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (255 aa)
Score = 183, Expect = 6.7e-12, Identities = 58/244 (23%), Positives = 119/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRT---KFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M++  +  NWK+N +   IS FFK +  +     E   V++AP  + +        N  + + +QNV     G  TG  S L L+D G+K   +GH + +    E +  +  K   + K+ +  +L + ET+++     T++ ++ Q+N I   +        + I Y+P +        D E     +++I  F++    K+     N++ I YGG I + ++++  +  D++G+LI +    + +++ I+
  S:     1 MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPTIYLERVCKNISNMNIFLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHHETDDIIAKKFHLIKKSNLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNL-GTSAFKNIIIAYEPIWAIGTGVSADPEH----VQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSAKEFLEII 247
>gi|73540662|ref|YP_295182.1| triosephosphate isomerase [Ralstonia eutropha JMP134] >gi|123625487|sp|Q473U5|TPIS_RALEJ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|72118075|gb|AAZ60338.1| triosephosphate isomerase [Ralstonia eutropha JMP134] (245 aa)
Score = 183, Expect = 6.9e-12, Identities = 67/243 (27%), Positives = 116/243 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI---PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDI--VDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           MR+K++I NWKM+    + +   + I   P    + V     YL    +L     ++V   AQ+VS  + G  TG V+   L ++G   A +GH + +    E +  V AK  + L+ G+  V+ + ET   L++    E   +   Q+   +DAL +  + RV + Y+P +         +E      + +  FLR +       VA+ + ILYGG +  D+  E+   +D+DG LI      S  +++I
  S:     1 MRQKLVIGNWKMHGSLAANAALLEGIKAAPARARLAVCAPFPYLAQCQAL--LNGSQVAWGAQDVSAEARGAFTGEVAASMLGEFGCTYALVGHSERRTYHGESDAVVAAKALRALEFGIIPVICVGET---LAQREAGETEVVVGRQLQAALDALSVEQLGRVVLAYEPVWAIGTGKTASSE----QAQAVHAFLRAEVRERDAGVADRMAILYGGSVKPDNAAELFSMSDIDGGLIGGASLKSEDFLAI 242
>gi|126211567|gb|ABN80450.1| triose phosphate isomerase B [Poecilia reticulata] (247 aa)
Score = 182, Expect = 7.2e-12, Identities = 68/236 (28%), Positives = 114/236 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVA-PS-YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN D  S+ +  + + + +   NV+V+   PS YL    S     +AK  V AQN      G  TG +S   +KD G+    LGH + +  F E +  +  K    L++G+  +  I E K+D  E    E +     ++    D +    +V + Y+P +    G+  S    + +      +RE+L+T     VAN++ I+YGG +     +E+    DVDG L+    +L  ++I I+
  S:    10 NWKMNGDKKSLGELIQTLNSGKVDSNVEVVCGTPSIYLDFARS---KLDAKFGVAAQNCYKVPKGAFTGEISPAMIKDCGVNWVILGHSERRHVFGESDELIGQKTAHALESGLGVIACIGE-KLDEREGGITEKVVFAQTKVI--ADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVH---EKLREWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDVDGFLVGGA-SLKPEFIDII 243
>gi|149190847|ref|ZP_01869111.1| triosephosphate isomerase [Vibrio shilonii AK1] >gi|148835307|gb|EDL52280.1| triosephosphate isomerase [Vibrio shilonii AK1] (258 aa)
Score = 182, Expect = 7.6e-12, Identities = 66/244 (27%), Positives = 118/244 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-FENVKVMVAPSYLGIVPSLG-MSKNAKVEVV---AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFI----EETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           M++  + T+WKMN D  S + +   +    E     + P  +   P L  M++    + +   AQN+ +   G  TG VS L LKD G+    +GH + +  F E +  VN K+   LK+G+  ++ +    EE    +S ES    +++ +  +      LD V  V + Y+P + +GE  +    E        IR+ L   +G  VA+N+ +LYGG +   +  E+    ++DG+ +      +  Y+ +L
  S:     1 MKKIWVGTSWKMNKDAASAASWAAAVEQAVERSDGRIQPFVIPPFPYLSQMAQTINADAIKLGAQNMCWQDSGAFTGEVSPLMLKDCGVSIVEIGHSERRAMFGETDKTVNLKVLAALKHGLTPLVCVGDTAEEKMWGVSVESVVRQVKIALYDV-----PLDKVANVVLAYEPVWAIGEGGTPATKEEAEKVHCAIRDALVECYGQEVADNVVLLYGGSVNLTNASELLDQANIDGVFVGRTAWNAEGYVELL 249
>gi|56554276|pdb|1VGA|A Chain A, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum >gi|56554277|pdb|1VGA|B Chain B, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum >gi|56554278|pdb|1VGA|C Chain C, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum >gi|56554279|pdb|1VGA|D Chain D, Structures Of Unligated And Inhibitor Complexes Of W168f Mutant Of Triosephosphate Isomerase From Plasmodium Falciparum >gi|56554383|pdb|1WOA|A Chain A, Structure Of The Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed With Glycerol-2-Phosphate >gi|56554384|pdb|1WOA|B Chain B, Structure Of The Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed With Glycerol-2-Phosphate >gi|56554385|pdb|1WOA|C Chain C, Structure Of The Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed With Glycerol-2-Phosphate >gi|56554386|pdb|1WOA|D Chain D, Structure Of The Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed With Glycerol-2-Phosphate >gi|56554387|pdb|1WOB|A Chain A, Structure Of A Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed To Sulfate >gi|56554388|pdb|1WOB|B Chain B, Structure Of A Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed To Sulfate >gi|56554389|pdb|1WOB|C Chain C, Structure Of A Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed To Sulfate >gi|56554390|pdb|1WOB|D Chain D, Structure Of A Loop6 Hinge Mutant Of Plasmodium Falciparum Triosephosphate Isomerase, W168f, Complexed To Sulfate (248 aa)
Score = 182, Expect = 7.9e-12, Identities = 65/243 (26%), Positives = 112/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWK N    SI     +  N +     + V+V P  +    +  + + +K     QNVS    G++TG VS    KD  I+   +GH + +  F E +  V  KLQ  LKN + AV+   E+   L +    + + +   Q+   +D +D  D V +VY+P F          E      + IR+ ++   G   AN + ILYGG +  ++   + +  D+DG L+ +  +L   ++ I+
  S:     3 RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQ-SKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGES---LEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLFAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNA-SLKESFVDII 244
>gi|152978356|ref|YP_001343985.1| triosephosphate isomerase [Actinobacillus succinogenes 130Z] >gi|150840079|gb|ABR74050.1| Triose-phosphate isomerase [Actinobacillus succinogenes 130Z] (256 aa)
Score = 182, Expect = 8.3e-12, Identities = 57/229 (24%), Positives = 108/229 (47%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPN----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFG---YYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ +++ NWK+N       +  + +       E   V +AP  + +  +     ++K+ + +QNV     G  TG +S   LKD+G K   +GH + +   KE +  +  K   L + G+  VL I ET+ +     T+E +  QI+ + N +  ++  +   I Y+P + +G   S    +      + +  F+R         VA+ + I YGG + + +  E+    D+DG L+
  S:     4 RKPLVMGNWKLNGSKAFTRELIEGLKTELAGVEGCDVAIAPPVMYLAEAETALADSKIALGSQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKFSALKEAGLTPVLCIGETEEENEAGKTEEVVSRQIDAVINAL-GVEAFNGAVIAYEPIWAIGTGKSATPAQ-----AQAVHAFIRAHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALV 234
>gi|167767886|ref|ZP_02439939.1| hypothetical protein CLOSS21_02427 [Clostridium sp. SS2/1] >gi|167710215|gb|EDS20794.1| hypothetical protein CLOSS21_02427 [Clostridium sp. SS2/1] (257 aa)
Score = 182, Expect = 8.5e-12, Identities = 58/230 (25%), Positives = 102/230 (44%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN   ++  ++ +  K +   E   V+     + I  ++  +  + + + A+N+ F   G +TG ++   L D G+K   LGH + +  F E +  VN K+ K  ++G+  ++   ET     +  T + +R QI   F G+ A D      I Y+P +          E        IR  +   +    A  + I YGG +      E+    D+DG L+
  S:    10 MRKTIVAGNWKMNKTPSEAKALIEELKPLVASETSDVVFCVPAIDIPAAIEAAAGSNIAIGAENMYFEESGAYTGEIAPNMLTDLGVKYVILGHSERREYFAETDETVNKKVLKAFEHGITPIVCCGETLAQREQGVTIDFVRQQIKIAFQGVSA-DQAKTAVIAYEPIWAIGTGKVATTEQAQEVCAAIRACIAEVYDEATAEAIRIQYGGSVSAASAPELFAQPDIDGGLV 241
>gi|168060091|ref|XP_001782032.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162666523|gb|EDQ53175.1| predicted protein [Physcomitrella patens subsp. patens] (275 aa)
Score = 182, Expect = 8.5e-12, Identities = 63/222 (28%), Positives = 103/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    SI K    + +    E V+V+V+P YL I   LG   N ++EV AQN      G  TG +S  +L D G+K    GH + +    E +  +  K    L  G+  +  + E   D     T + +  Q+    +  G D  +IV    + Y+P +    G++ S    + +      IR++L+ K    V++   I+YGG +   +  E+    D+DG L+
  S:    30 NWKCNGTTESIKKLVDELNSVMLEEGVEVVVSPPYLYISQVLGSLSN-RIEVAAQNSWVGKGGAFTGEISAEQLADAGVKWVIQGHSERRHVIGETDAMIGKKSAYALSQGLGVIACVGEKLEDREANRTTDVVFEQLQAYADAVGSDWSNIV----VAYEPVWAIGTGKVASPQQAQEVHAA---IRQWLKEKVSDDVSSKTRIIYGGSVNGANSAELATQEDIDGFLV 251
>gi|151967128|gb|ABS19444.1| multivalent antigen sjTPI-97 [synthetic construct] (1138 aa)
Score = 182, Expect = 8.9e-12, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:    12 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVHN---FLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 235
>gi|153807321|ref|ZP_01959989.1| hypothetical protein BACCAC_01599 [Bacteroides caccae ATCC 43185] >gi|149129683|gb|EDM20895.1| hypothetical protein BACCAC_01599 [Bacteroides caccae ATCC 43185] (252 aa)
Score = 182, Expect = 9.0e-12, Identities = 61/230 (26%), Positives = 106/230 (46%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K        E  N  V++   ++ +     +   AK+ V A+N +  + G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +          E        IR  +  K+G  +A+N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKIGVGAENCADKASGAYTGEVSAEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQMESVFS-LSAEDF-SKIILAYEPVWAIGTGKTATPEQAQEIHAFIRSIVANKYGKEIADNTSILYGGSCKPSNAKELFSNPDVDGGLI 233
>gi|54025557|ref|YP_119799.1| triosephosphate isomerase [Nocardia farcinica IFM 10152] >gi|81822972|sp|Q5YTQ6|TPIS_NOCFA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|54017065|dbj|BAD58435.1| putative triosephosphate isomerase [Nocardia farcinica IFM 10152] (261 aa)
Score = 182, Expect = 9.0e-12, Identities = 67/229 (29%), Positives = 113/229 (49%)
  Q:     2 REKILITNWKMNADYVS----ISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRL-QINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN +++     + K    +P   FE V V V P ++ I     + +  K+ +   AQ+VS    G +TG +S   L   G     +GH + +    E +  V  K +K L++G+  ++ I E  +++ E  T     L Q+     G+ A  I  +V I Y+P +    G++ S  D + + G IR     L    G  VA  + +LYGG +   ++ E+    DVDG L+
  S:     3 RKPLIAGNWKMNLNHLEAIALVQKIAFALPEKYFEKVDVAVIPPFVDIRSVQTLVEGDKLLLTYGAQDVSVHESGAYTGEISASMLAKLGCTFVVVGHSERRQYHHEDDATVLGKAKKALEHGLTPIVCIGE-GLNVREAGTHVEYNLEQLRGSLKGLSAEQIA-KVVIAYEPVWAIGTGKVASAADAQEVCGAIRA---ELAELAGPEVAAQVRVLYGGSVNAKNVGELVAQPDVDGALV 238
>gi|170698107|ref|ZP_02889187.1| Triose-phosphate isomerase [Burkholderia ambifaria IOP40-10] >gi|170136965|gb|EDT05213.1| Triose-phosphate isomerase [Burkholderia ambifaria IOP40-10] (251 aa)
Score = 182, Expect = 9.1e-12, Identities = 61/242 (25%), Positives = 113/242 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIV---PSLGMSKN----AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R K +I NWKM+            +   +    + A + +G+    P L   +      +V   AQ+VS    G  TG V+   + ++G   A +GH + +    E+N  V AK Q+ L  G+  V+ + ET  +    +T++ +  Q++ +   + A D   R+ + Y+P + +G   S    +      + +  FLR +     A ++ +LYGG +  D+ EE+    D+DG LI      +  +++I
  S:     5 RTKRVIGNWKMHGRLAGNQALLNEV--VQGAGAVAAETSIGVCVPFPYLAQVQAQLGAGRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRALAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTA-DEAARIVVAYEPVWAIGTGKSATSAQ-----AQEVHAFLRARLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKAEDFLAI 246
>gi|151967136|gb|ABS19448.1| multivalent antigen sj97-TPI [synthetic construct] (1138 aa)
Score = 182, Expect = 9.2e-12, Identities = 59/222 (26%), Positives = 105/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN           ++       + ++++A  ++  +  +  S   ++ V AQN      G  TG +S   +KD G     LGH + +  F E +  V  K+Q  L  G++ V  I ET  +     T+E    Q+N I N I ++D   RV + Y+P +    G++ S    + +      +R++ +T     V   + I+YGG +   + +E+ + +DVDG L+
  S:   898 NWKMNGSRADNKVLIHSLSEAHFCGDTEILIAAPFV-YLNEVRQSLAKEIHVAAQNCYKVPKGAFTGEISPSMIKDVGCDWVILGHSERRSIFNESDELVAEKVQHALAGGLSVVACIGETLSERESGKTEEVCVRQLNAIANKIKSIDEWKRVVVAYEPVWAIGTGKVASPGQAQEVHN---FLRKWFKTNTPSGVDQQIRIIYGGSVTAANCKELAQQHDVDGFLV 1121
>gi|169625443|ref|XP_001806125.1| hypothetical protein SNOG_15994 [Phaeosphaeria nodorum SN15] >gi|111055453|gb|EAT76573.1| hypothetical protein SNOG_15994 [Phaeosphaeria nodorum SN15] (248 aa)
Score = 181, Expect = 9.6e-12, Identities = 58/222 (26%), Positives = 101/222 (45%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI +   ++   +   N +V+VAP  L ++ +    +   +EV AQN+     G  TG +S  +LKD GI    LGH + +    E +  V +K +  L  G+  +L   E+   L +    + + +   Q+    D +    ++ + Y+P +          E      + IRE+L+ +     A    ILYGG +   +  E+ K  D+DG L+
  S:    10 NFKMNGTIKSIKEILGHLSQAKLDPNTEVVVAPPALYLLLAREHLRPG-LEVAAQNIFDKPSGAFTGEISADQLKDSGITWTILGHSERRTILNEDDAFVASKTKAALDCGLGVILCCGES---LEQREANKTIEVVTKQLKAVADKVKDWSKIVVAYEPIWAIGTGKVATTEQAQEVHKAIREWLQKEVSAEAAEKTRILYGGSVSEKNCNELAKQPDIDGFLV 230
>gi|161075771|gb|ABX56633.1| triosephosphate isomerase [Verrucomicrobiae bacterium V4] (256 aa)
Score = 181, Expect = 1.0e-11, Identities = 63/249 (25%), Positives = 114/249 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFF-----KNIPNFENVKVMVAPSYLGI--VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHLF 249
           +R+KI+  NWKMN   VS +K F     K +  +    V+V P +  +  V  L     ++V + AQN+   S G +TG +S   L+++      +GH + ++   E +  +N K++  L   ++ +L I E   +  +   KE +  Q+      ++   + D + I Y+P +          E        IRE +   F +  A  + I YGG +  ++ +++    DVDG+LI         + SI+    F
  S:     3 IRKKIIAGNWKMNKT-VSEAKAFMQVLLKELEEYSASDVVVCPPFTALQSVSDLLNQSASQVRLGAQNLFPASHGAYTGEISPWMLREFFCHYVIVGHSERRIHLGETDIFINKKVKAALSASLHPILCIGENFDERQQGLWKEKISTQLQLGLKEVEEQKLADCI-IAYEPIWAIGTGKNATPEQAQEVHHFIREEITRLFSFQSAQKVRIQYGGSVTAENAQDLLLCPDVDGLLIGGASLDVRSFCSIILNSKF 256
>gi|146419545|ref|XP_001485734.1| triosephosphate isomerase [Pichia guilliermondii ATCC 6260] >gi|146389149|gb|EDK37307.1| triosephosphate isomerase [Pichia guilliermondii ATCC 6260] (248 aa)
Score = 181, Expect = 1.0e-11, Identities = 67/240 (27%), Positives = 108/240 (45%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           N+KMN    SI+K    +      ENV+V++AP    +  ++  +K   VEV AQNV   + G +TG +S  ++KD G K    GH + +   KE +  + AK +  L+ G+  +L I ET   L E      L +   Q+      +     + + Y+P +          +    T + IR  L    G   A  + ILYGG +   +  E     DVDG L+    +L  +++ I+   L
  S:    10 NFKMNGTKESITKIVDGLNKSDLPENVEVVIAPPAPYLALAVSENKQKTVEVGAQNVFDKASGAYTGEISPEQVKDLGAKWTLTGHSERRTIIKESDDFIAAKTKFALEQGLKVILCIGET---LDERKANVTLDVCARQLDAVSKIVSDWSNIVVAYEPVWAIGTGLAATPDDAQETHKGIRAHLEKTIGADQAKKVRILYGGSVNGKNAGEFKDKPDVDGFLVGGA-SLKPEFVDIIKSRL 248
>gi|163942821|ref|YP_001647705.1| triosephosphate isomerase [Bacillus weihenstephanensis KBAB4] >gi|163865018|gb|ABY46077.1| Triose-phosphate isomerase [Bacillus weihenstephanensis KBAB4] (251 aa)
Score = 181, Expect = 1.0e-11, Identities = 66/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFK-NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN   A+ VS  +  K  IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +  +     A  + I YGG +  ++I+E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTLAEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAKAEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTLAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKVTVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEAVSPE----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 233
>gi|53715240|ref|YP_101232.1| triosephosphate isomerase [Bacteroides fragilis YCH46] >gi|60683174|ref|YP_213318.1| triosephosphate isomerase [Bacteroides fragilis NCTC 9343] >gi|81313773|sp|Q5L923|TPIS_BACFN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|81824915|sp|Q64P83|TPIS_BACFR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|52218105|dbj|BAD50698.1| triosephosphate isomerase [Bacteroides fragilis YCH46] >gi|60494608|emb|CAH09409.1| putative triosephosphate isomerase [Bacteroides fragilis NCTC 9343] (251 aa)
Score = 181, Expect = 1.0e-11, Identities = 63/230 (27%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K        E  N  V++   ++ +     +   AK+ V A+N +    G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +    G+  S    + I      IR  +  K+G  +A+N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKIGVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVEILKDKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQLASVFD-LSAEDF-SKIVLAYEPVWAIGTGKTASPAQAQEIHA---FIRSAVAEKYGKEIADNTSILYGGSCKPSNAKELFANPDVDGGLI 233
>gi|189219043|ref|YP_001939684.1| Triosephosphate isomerase [Methylokorus infernorum V4] >gi|189185901|gb|ACD83086.1| Triosephosphate isomerase [Methylacidiphilum infernorum V4] (259 aa)
Score = 181, Expect = 1.0e-11, Identities = 63/249 (25%), Positives = 114/249 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFF-----KNIPNFENVKVMVAPSYLGI--VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHLF 249
           +R+KI+  NWKMN   VS +K F     K +  +    V+V P +  +  V  L     ++V + AQN+   S G +TG +S   L+++      +GH + ++   E +  +N K++  L   ++ +L I E   +  +   KE +  Q+      ++   + D + I Y+P +          E        IRE +   F +  A  + I YGG +  ++ +++    DVDG+LI         + SI+    F
  S:     6 IRKKIIAGNWKMNKT-VSEAKAFMQVLLKELEEYSASDVVVCPPFTALQSVSDLLNQSASQVRLGAQNLFPASHGAYTGEISPWMLREFFCHYVIVGHSERRIHLGETDIFINKKVKAALSASLHPILCIGENFDERQQGLWKEKISTQLQLGLKEVEEQKLADCI-IAYEPIWAIGTGKNATPEQAQEVHHFIREEITRLFSFQSAQKVRIQYGGSVTAENAQDLLLCPDVDGLLIGGASLDVRSFCSIILNSKF 259
>gi|124023096|ref|YP_001017403.1| triosephosphate isomerase [Prochlorococcus marinus str. MIT 9303] >gi|160196547|sp|A2C9H8|TPIS_PROM3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|123963382|gb|ABM78138.1| Triosephosphate isomerase [Prochlorococcus marinus str. MIT 9303] (243 aa)
Score = 181, Expect = 1.0e-11, Identities = 55/230 (23%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKF-------FKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+       ++        +  PN  +  V++AP +  I          ++E+ +QNV +   G +T  VS   L ++ ++ A +GH + +  F E + Q+N + +    +G+  ++ + E+         +  +R Q+ Q     D     D++ + Y+P +    G+     +   I G IR          G+  A+ L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRKPVIAGNWKMHMTCAQAREYTAMFLPLIEATPN--DRHVVIAPPFTAISSMAEAVGGTRLELSSQNVHWEDDGAYTAEVSPTMLLEHQVRYAIVGHSEPRKYFSESDEQINRRARSAQAHGLIPIVCVGESDEQRERGEAERVIRRQVEQGLEDTDP----DKLVVAYEPIWAIGTGKTCEASEANRICGLIR----------GWVGASELIIQYGGSVKPGNIDELMAMSDIDGVLV 224
>gi|90580892|ref|ZP_01236694.1| triosephosphate isomerase [Vibrio angustum S14] >gi|90437963|gb|EAS63152.1| triosephosphate isomerase [Vibrio angustum S14] (256 aa)
Score = 181, Expect = 1.1e-11, Identities = 67/230 (29%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP----NFENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRV-IREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  +++ NWK+N     +S   K +       E V V +AP   YL +   L    N+K+ + +QNV   + G  TG +S   LK++G     +GH + +    E +  V  K   L +NG+  VL I E++       T      Q++ + N  G++AL   +   I Y+P +    G+  +  D + I   IR  I E         VA N+ I YGG +  ++        D+DG L+
  S:     1 MRHPVVMGNWKLNGSKEMVSGLIKGLDAALNGVEGVDVAIAPPVMYLDLAEQLLSKANSKIILGSQNVDLHNNGAFTGDISPAMLKEFGASHIIIGHSERREYHNESDEFVAQKFAFLKENGLTPVLCIGESEAQNEAGETVAVCARQLDAVINTQGVEAL---NGAIIAYEPIWAIGTGKAATADDAQRIHAAIRAHIAEKSEE-----VAKNVVIQYGGSVKPENAAAYFAQPDIDGALV 234
>gi|108760209|ref|YP_631034.1| triosephosphate isomerase [Myxococcus xanthus DK 1622] >gi|123374590|sp|Q1D8I9|TPIS_MYXXD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|108464089|gb|ABF89274.1| triosephosphate isomerase [Myxococcus xanthus DK 1622] (256 aa)
Score = 181, Expect = 1.2e-11, Identities = 59/229 (25%), Positives = 104/229 (45%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R KI+  NWKMN          +++        + V+V+VAP ++ + P     + A + + AQN  + S G  TG +S   L + G     +GH + +  F + + QVN + + +   GM  ++ + ET  +     T   +  Q+     G  A ++   V + Y+P +    G   +    + +   IR + E L   +    A  + I YGG +  D+  E+    DVDG L+
  S:     6 RRKIVAGNWKMNKSVPEALALVRDLRGQVASLGDTVEVVVAPPFVALQPLHVALEGAPLALAAQNCHWESSGAFTGEISAPMLAELGCAYVIVGHSERRQLFGDTDEQVNKRAKAVRAAGMTPIICVGETLAEREANQTLAVVERQVRGALEGFGAKEVAGFV-LAYEPVWAIGTGRNATAAQAQEVHAAIRGLVERL---YDGETAGRVRIQYGGSVKPDNAAELLGQPDVDGALV 238
>gi|15603505|ref|NP_246579.1| hypothetical protein PM1640 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12722043|gb|AAK03724.1| TpiA [Pasteurella multocida subsp. multocida str. Pm70] (349 aa)
Score = 181, Expect = 1.2e-11, Identities = 51/200 (25%), Positives = 105/200 (52%)
  Q:    31 NVKVMVAPSYLGI---VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           ++++ V PSY+ +   V +       K+ + AQN++    G  TG +S L LK+ G++   +GH + +   KE + + N K+   LK+G   +L + ET    + + + E LR Q+    +G+ ++  +  ++I Y+P + +GE       ++     ++I++ L   FG   +  +P+LYGG +  ++  E+     +DG+ +
  S:    39 DIELFVIPSYIALKDAVHAAASETTHKILIGAQNMNAKDKGQFTGEISPLMLKELGVQLVMIGHSERRHVLKETDQEENEKVLSALKHGFKTLLCVGETLEQKNYQISDEVLRTQLKIGLHGV-SVKQLPHLFIAYEPVWAIGEGGIPATAQYADEKQKIIKQCLFEMFGEE-SKKIPVLYGGSVNLENANELIMQPHIDGLFV 240
>gi|154508829|ref|ZP_02044471.1| hypothetical protein ACTODO_01339 [Actinomyces odontolyticus ATCC 17982] >gi|153798463|gb|EDN80883.1| hypothetical protein ACTODO_01339 [Actinomyces odontolyticus ATCC 17982] (252 aa)
Score = 181, Expect = 1.2e-11, Identities = 64/222 (28%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIP--------NFENVKVMVAPSYLGI--VPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRL-QINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN D++  +   + +         ++   +V+V P +  I  V ++  +    ++  AQ+VS    G +TG +S   L   G+    +GH + +    E +  V AK +K+   GM  +L   E  +++ +  T     L QI     G    ++  ++ I Y+P +    GE  S  D + + G IR     L   FG   A +  ILYGG    D+I+E+    DVDG L+
  S:     4 NWKMNLDHLEANHLVQGLAMALSDAGHDYSKCEVLVIPPFTDIRTVQTIVDADELGIKYGAQDVSIHDNGAYTGEISTDMLTKLGVSYVVMGHSERREYHGESDELVGAKARKVFDAGMTPILCCGEA-LEVRKAGTYVEFVLGQIRAALAGWKPEEVA-KIVIAYEPIWAIGTGETASAEDAQEVCGAIRAA---LAEDFGAETAESTRILYGGSAKPDNIKELMAQPDVDGGLV 234
>gi|189424677|ref|YP_001951854.1| Triose-phosphate isomerase [Geobacter lovleyi SZ] >gi|189420936|gb|ACD95334.1| Triose-phosphate isomerase [Geobacter lovleyi SZ] (251 aa)
Score = 180, Expect = 1.2e-11, Identities = 58/230 (25%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMN---ADYVS-ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++  NWK+    AD  + I +    + + ++V+++VAP +  I      +    V+V AQ+  +   G  TG VS   LKD G     +GH + +  F E +  VN K +  ++ G+  +L + E+        T + +  Q+      I A ++  ++ + Y+P +    G+  S    + +   IR +   +   +G   A+ + ILYGG +  ++I+ +    D+DG L+
  S:     1 MRTPLIAGNWKLFKTLADATALIDELVPLVSDVKDVEIVVAPVFTAINTVAKAAGKTGVKVAAQDCYWEDEGAFTGEVSPKLLKDAGCSHVIIGHSERRQYFGETDGTVNLKTKAAIRAGLTVLLCVGESLAQRESNDTFKVIETQVRGGLADIPAAELT-QIVVAYEPVWAIGTGKTASDAQAQEVHAFIRTL---VAQIYGPSEADAMRILYGGSVKPENIKGLMSQPDIDGALV 233
>gi|121543761|gb|ABM55553.1| putative triosephosphate isomerase [Maconellicoccus hirsutus] (247 aa)
Score = 180, Expect = 1.2e-11, Identities = 65/236 (27%), Positives = 113/236 (47%)
  Q:     9 NWKMNADYVSISKF---FKNIPNFENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN D   I++     K  P  ++V+V+VAP   YL    S+ + +N  V+V AQN    + G  TG +S   +KD GI    +GH + +  F E +  +  K+   L+ G++ +  I E   +     T+  +  Q+  I   I        V I Y+P +          +      + +RE+++ +    VA  + I+YGG +   + +E+ K  D+DG L+    +L  ++I I+
  S:    10 NWKMNGDKKFINELVECLKKCPIEQSVEVVVAPPTIYLDYTKSI-VPQN--VQVAAQNSYKVAKGAFTGEISPAMIKDIGIDWVIIGHSERRNVFGENDNLIAEKVAHALETGLSVIACIGEKLEEREAGQTEAVVFQQVKAIAGKIGEW---KNVVIAYEPVWAIGTGKTATPQQAQEVHQKLREYIKKEISEKVAKEIRIIYGGSVTGANAKELAKEKDIDGFLVGGA-SLKPEFIDII 243
>gi|83943248|ref|ZP_00955708.1| triosephosphate isomerase [Sulfitobacter sp. EE-36] >gi|83846256|gb|EAP84133.1| triosephosphate isomerase [Sulfitobacter sp. EE-36] (249 aa)
Score = 180, Expect = 1.2e-11, Identities = 58/230 (25%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFENVKV--MVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQI-NQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K+   NWKMN     +          ++ +   ++ P    ++P++  ++   V + AQ+      G  TG +S   +K+ G     +GH + +  + E +  V+AK +     G+ A++ I E++ D S  +T + +  Q+   + +G    + V    + Y+P +          + I      IR  L  +FG  V++ L +LYGG +  D+  EI K ++VDG LI
  S:     1 MRRKLAAGNWKMNGTLAGLDMLADVAAAMDSTRAEAVICPPAPYLLPAVTKAQGTPVGIGAQDCHAEPKGAFTGDISASMIKEVGATYVIIGHSERRDAYGETDADVSAKARAAWDAGLTAIICIGESEADRSAGTTLDVIAEQLAGSLPDGCTGENTV----VAYEPIWAIGTGKIPTLDQIVEVHDFIRATLAERFGTDVSDALRLLYGGSVKPDNAAEIFKVDNVDGALI 229
>gi|89075176|ref|ZP_01161607.1| triosephosphate isomerase [Photobacterium sp. SKA34] >gi|89048998|gb|EAR54565.1| triosephosphate isomerase [Photobacterium sp. SKA34] (256 aa)
Score = 180, Expect = 1.2e-11, Identities = 67/230 (29%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP----NFENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRV-IREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  +++ NWK+N     +S   K +       E V V +AP   YL +   L    ++K+ + +QNV   + G  TG +S   LK++G     +GH + +    E +  V  K   L +NG+  VL I E++       T      Q++ + N  G+DAL   +   I Y+P +    G+  +  D + I   IR  I E         VA N+ I YGG +  ++        D+DG L+
  S:     1 MRHPVVMGNWKLNGSKEMVSGLIKGLDAALNGVEGVDVAIAPPVMYLDLAEQLLNKADSKIILGSQNVDLHNNGAFTGDISPAMLKEFGASHIIIGHSERREYHHESDEFVAQKFAFLKENGLTPVLCIGESEAQNEAGETVAVCARQLDAVINTQGVDAL---NGAIIAYEPIWAIGTGKAATADDAQRIHAAIRAHIAEKSEE-----VAKNVVIQYGGSVKPENAASYFAQPDIDGALV 234
>gi|168143016|ref|ZP_02586245.1| triosephosphate isomerase [Bacillus cereus G9842] (251 aa)
Score = 180, Expect = 1.3e-11, Identities = 63/230 (27%), Positives = 106/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +  +     A  + I YGG +  ++I+E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTLAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEAVSPE----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 233
>gi|114319091|gb|ABI63547.1| triosephosphate isomerase [Blattella germanica] (247 aa)
Score = 180, Expect = 1.3e-11, Identities = 66/222 (29%), Positives = 102/222 (45%)
  Q:     9 NWKMNADYVSIS---KFFKNIPNFENVKVMVAPSYLGIVPSLGM--SKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN D   I    KF    P   NV+V+V       +P++ +  +KN   + V   AQN      G  TG +S   L D GI    LGH + +  F EK+  ++ K+   L++G+N V  I E   +     T+E +  Q   I    D +    +V I Y+P +          E      + +RE+L       VA +  I+YGG +   +  E+ +  D+DG L+
  S:    10 NWKMNGDKKGIEEIVKFLAAGPLDPNVEVVVG------IPAIYLESTKNILPSNVAAAAQNCYKVPKGAFTGEISPAMLNDIGINWVILGHSERRNVFGEKDDLISDKVVHALESGLNVVACIGEKLEEREGGKTEEVVFQQTKAI---ADKIKDWSKVVIAYEPVWAIGTGKTATPEQAQDVHKKLREWLSKNVSEQVAQDTRIVYGGSVTGANCNELAREADIDGFLV 230
>gi|91201955|emb|CAJ75015.1| strongly similar to triose-phosphate isomerase [Candidatus Kuenenia stuttgartiensis] (261 aa)
Score = 180, Expect = 1.3e-11, Identities = 53/229 (23%), Positives = 107/229 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +  I++ NWKMN       ++ ++    I     +   + P Y+ +     + + + + V AQN+   + G  TG ++   LK+ G     +GH + +  F E ++ +N K++K +   +  +L I ET  +    +TK+ +  Q+     G+  ++++  + I Y+P +          E        IR  L   +G  +A  L I+YGG +  D+ E +    ++DG+L+
  S:     8 KRPIILGNWKMNKSLKEGVQYARSLKAAIAGKTWIMCGICPPYVFLKDICAILEGSTICVSAQNMHSEASGAFTGEIAAPMLKEVGCSHVLVGHSERRHIFGEDDFFINDKIKKAISFELVPILCIGETLEEREAGNTKDIVLRQLKNGLRGV-GIELIKCIIIAYEPVWAIGTGRTASPEQANEVHSFIRTILSEDYGKDIAKKLSIIYGGSVKADNTEALIHQPEIDGLLV 239
>gi|15149248|gb|AAK85202.1|AF387819_1 triosephosphate isomerase B [Danio rerio] (248 aa)
Score = 180, Expect = 1.3e-11, Identities = 66/236 (27%), Positives = 112/236 (47%)
  Q:     9 NWKMNADYVSISKFFKNIP----NFENVKVMVAPS-YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           NWKMN D  SI +    +     N +   V  AP+ YL    S     +  ++V AQN    + G  TG +S   +KD G+K   LGH + +  F E +  +  K+   L+NG+  +  I E K+D  E    E +     +     D +    +V + Y+P +    G+  S    + +      +R++L+T     VAN++ I+YGG +     +E+    D+DG L+    +L  ++I I+
  S:    11 NWKMNGDKKSIEELANTLNSAKLNPDTEVVCGAPTIYLDYARS---KLDPNIDVAAQNCYKVAKGAFTGEISPAMIKDCGVKWVILGHSERRHVFGESDELIGQKVAHALENGLGVIACIGE-KLDEREAGITEKVVFAQTKFI--ADNVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHDK---LRQWLKTNVSEAVANSVRIIYGGSVTGGTCKELASQKDLDGFLVGGA-SLKPEFIDII 244
>gi|118603036|ref|YP_904251.1| triosephosphate isomerase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|160196643|sp|A1AXX3|TPIS_RUTMC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|118567975|gb|ABL02780.1| triosephosphate isomerase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (248 aa)
Score = 180, Expect = 1.4e-11, Identities = 65/230 (28%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-PNFENVKVMVAPSYLGIVPSLGMSK------NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMNA   + +     I     +VK  V    +  VPSL MS+      ++++ + AQN++   LG  TG +S   +KD+G K   +GH + +  + E +  V  K+Q  L N +  +  I E   D    +TK  +  QI  + + +  ++    + + Y+P +    N     +    T   IR  L  ++   +A    ILYGG + + +  E+    D+DG LI
  S:     1 MRQIIIAGNWKMNASKEATNTLVIGILSGMADVKSKV----IVCVPSLYMSQVEVLVVDSQLNLGAQNLNVNKLGAFTGEISADMIKDFGAKYVIVGHSERRSLYGETDEIVAQKVQVALDNNLTPLFCIGELLEDRESNNTKSVVSKQIQVVIDRV-GIEAFKNIIVAYEPVWAIGTNVTATPQQAQDTHAFIRSML-AEYDADIAQITSILYGGSMNSRNAAELLNCKDIDGGLI 231
>gi|86605117|ref|YP_473880.1| triosephosphate isomerase [Synechococcus sp. JA-3-3Ab] >gi|123507736|sp|Q2JX75|TPIS_SYNJA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|86553659|gb|ABC98617.1| triosephosphate isomerase [Synechococcus sp. JA-3-3Ab] (255 aa)
Score = 180, Expect = 1.4e-11, Identities = 59/230 (25%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-PNFENVKVMVAPSYLGI--VPSLGM------SKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++  NWKM+       +F +   P  +     V P    I  VP   +      ++ + + V AQN+ +   G  TG +S   L + G++   +GH + +  F E +  VN +L    ++G+  +L + E+     +  T+  +  Q+++   GID  ++V    I Y+P +    G+  +  +   + G IR           +  A++LPILYGG +   +I+E+     +DG+L+
  S:     1 MRPILIAGNWKMHKTQAEARQFLREFRPALQASSAGVRPQRQIILCVPFTDLAVVVEETRGSGMAVGAQNLHWEDQGAFTGEISGPMLAELGVRYVIVGHSERRQYFGETDETVNRRLAAAQRHGLTPILCVGESLQQREQGLTESWIVGQLDRALPGIDLRNLV----IAYEPIWAIGTGKTCAAAEANRVIGLIR----------QHLGADHLPILYGGSVKASNIDELMAQPQIDGVLV 228
>gi|6320255|ref|NP_010335.1| Triose phosphate isomerase, abundant glycolytic enzyme; mRNA half-life is regulated by iron availability; transcription is controlled by activators Reb1p, Gcr1p, and Rap1p through binding sites in the 5' non-coding region; Tpi1p [Saccharomyces cerevisiae] >gi|136069|sp|P00942|TPIS_YEAST Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|798902|emb|CAA89080.1| Tpi1p [Saccharomyces cerevisiae] >gi|1197083|gb|AAA88757.1| triose phosphate isomerase >gi|45269201|gb|AAS55980.1| YDR050C [Saccharomyces cerevisiae] >gi|151942040|gb|EDN60396.1| triosephosphate isomerase [Saccharomyces cerevisiae YJM789] >gi|190404980|gb|EDV08247.1| triosephosphate isomerase [Saccharomyces cerevisiae RM11-1a] (248 aa)
Score = 180, Expect = 1.4e-11, Identities = 67/222 (30%), Positives = 108/222 (48%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI-DALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N    SI +  +     +IP  ENV+V++ P    +  S+ + K  +V V AQN    + G  TG  S  ++KD G K   LGH + +  F E +  +  K +  L  G+  +L I ET  +     T + +  Q+N +   + D  ++V    + Y+P +    G   +  D + I  +   IR+FL +K G   A+ L ILYGG     +        DVDG L+
  S:    10 NFKLNGSKQSIKEIVERLNTASIP--ENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKWVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVV----VAYEPVWAIGTGLAATPEDAQDIHAS---IRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLV 231
>gi|230405|pdb|1YPI|A Chain A, Structure Of Yeast Triosephosphate Isomerase At 1.9- Angstroms Resolution >gi|230406|pdb|1YPI|B Chain B, Structure Of Yeast Triosephosphate Isomerase At 1.9- Angstroms Resolution >gi|230791|pdb|2YPI|A Chain A, Crystallographic Analysis Of The Complex Between Triosephosphate Isomerase And 2-Phosphoglycolate At 2.5- Angstroms Resolution. Implications For Catalysis >gi|230792|pdb|2YPI|B Chain B, Crystallographic Analysis Of The Complex Between Triosephosphate Isomerase And 2-Phosphoglycolate At 2.5- Angstroms Resolution. Implications For Catalysis >gi|443550|pdb|7TIM|A Chain A, Structure Of The Triosephosphate Isomerase- Phosphoglycolohydroxamate Complex: An Analogue Of The Intermediate On The Reaction Pathway >gi|443551|pdb|7TIM|B Chain B, Structure Of The Triosephosphate Isomerase- Phosphoglycolohydroxamate Complex: An Analogue Of The Intermediate On The Reaction Pathway (247 aa)
Score = 180, Expect = 1.4e-11, Identities = 67/222 (30%), Positives = 108/222 (48%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI-DALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N    SI +  +     +IP  ENV+V++ P    +  S+ + K  +V V AQN    + G  TG  S  ++KD G K   LGH + +  F E +  +  K +  L  G+  +L I ET  +     T + +  Q+N +   + D  ++V    + Y+P +    G   +  D + I  +   IR+FL +K G   A+ L ILYGG     +        DVDG L+
  S:     9 NFKLNGSKQSIKEIVERLNTASIP--ENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKWVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVV----VAYEPVWAIGTGLAATPEDAQDIHAS---IRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLV 230
>gi|167997073|ref|XP_001751243.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162697224|gb|EDQ83560.1| predicted protein [Physcomitrella patens subsp. patens] (256 aa)
Score = 180, Expect = 1.4e-11, Identities = 64/235 (27%), Positives = 105/235 (44%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           NWK N    SI K    + +    E+V+V+VAP +L I   +G S   ++ V AQN      G  TG +S  +L D G+K    GH + +    E N  +  K    L  G+  +  + E    L E  +     +   Q+    DA+     V I Y+P +    G++ S    + +   IR    +L  K    +A+   I+YGG +   +  E+ K  D+DG L+        ++++I
  S:    12 NWKCNGTTESIKKLVGELNDGKFEESVEVVVAPPFLYIGQVIG-SLTDRIAVSAQNSWVGKGGAFTGEISADQLVDAGVKWVIQGHSERRHVIGESNETIGKKSAYALSKGLGVIACVGEK---LEERESNRTTDVVFEQLQAYADAISDWSNVVIAYEPVWAIGTGKVASPEQAQEVHAAIR---SWLGDKISPDLASATRIIYGGSVNGANCAELAKKEDIDGFLVGGASLKGPEFVTI 245
>gi|187735068|ref|YP_001877180.1| Triose-phosphate isomerase [Akkermansia muciniphila ATCC BAA-835] >gi|187425120|gb|ACD04399.1| Triose-phosphate isomerase [Akkermansia muciniphila ATCC BAA-835] (254 aa)
Score = 180, Expect = 1.4e-11, Identities = 62/229 (27%), Positives = 112/229 (48%)
  Q:     2 REKILITNWKMNADYVSISKF---FKNIPNFENV--KVMVAPSYLGIVPSL--GMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKMN      ++F   FKN+   ++V   V++ P +  I PS+   +   + +   AQNVS    G +TG +S   L +  +K   LGH + +  F E +  +N+K++K +  G+  +  I ETK +      +  L +Q+      +   ++ + V I Y+P +         ++        IR+ +   FG   A  + I YGG +  +++EE+    D+DG L+
  S:     3 RKPIIAANWKMNIGPAEGTQFIESFKNLIKGKDVACDVVIIPPFTTI-PSVQNALGGCSCIAAGAQNVSQYDNGAYTGEISTSMLNELNLKYVVLGHSERRQYFGETDAIINSKIKKAIAAGITPIFCIGETKDERLGGILEPVLEIQLKGGLKDLTPEEVSNLV-IAYEPVWAIGTGLTATSKEAQEAHSFIRKVISDVFGADAAAKVRIQYGGSVKPENVEELMAQPDIDGALV 236
>gi|49478893|ref|YP_039125.1| triosephosphate isomerase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140432|ref|YP_086397.1| triosephosphate isomerase [Bacillus cereus E33L] >gi|167939619|ref|ZP_02526694.1| triosephosphate isomerase [Bacillus cereus AH1134] >gi|168136186|ref|ZP_02579415.1| triosephosphate isomerase [Bacillus cereus B4264] >gi|196032845|ref|ZP_03100258.1| triosephosphate isomerase [Bacillus cereus W] >gi|81824128|sp|Q631M0|TPIS_BACCZ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|81828143|sp|Q6HBF1|TPIS_BACHK Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|39932246|sp|P60180|TPIS_BACCR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|121957162|sp|Q4MQ55|TPIS_BACCE Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|49330449|gb|AAT61095.1| triosephosphate isomerase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973901|gb|AAU15451.1| triosephosphate isomerase [Bacillus cereus E33L] >gi|195994274|gb|EDX58229.1| triosephosphate isomerase [Bacillus cereus W] (251 aa)
Score = 180, Expect = 1.5e-11, Identities = 63/230 (27%), Positives = 106/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +  +     A  + I YGG +  ++I+E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEAVSPE----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 233
>gi|125717702|ref|YP_001034835.1| triosephosphate isomerase [Streptococcus sanguinis SK36] >gi|125497619|gb|ABN44285.1| Triosephosphate isomerase, putative [Streptococcus sanguinis SK36] (254 aa)
Score = 180, Expect = 1.6e-11, Identities = 53/243 (21%), Positives = 106/243 (43%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWKMN +      F +     +P+ + V+  +A   L +   L  +K + ++V AQN  F   G  TG  S   L + G+    +GH + +  F E +  +N K   + +NG+  ++   E+          + +  Q++     + A  +   V I Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++       DVDG L+      +  ++++L
  S:     5 RKPFIAGNWKMNKNPEEAKAFVEAVAAKLPSSDLVEAGIAAPALDLTTVLAAAKGSNLKVAAQNAYFEDAGAFTGENSPKVLAEVGVDYIVIGHSERRDYFHETDQDINKKAHAIFRNGLVPIICCGESLETYEAGKAVDFVGAQVSAALKDLTAEQVASLV-IAYEPIWAIGTGKSATQDDAQKMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLEAESFLALL 250
>gi|113475099|ref|YP_721160.1| triosephosphate isomerase [Trichodesmium erythraeum IMS101] >gi|123352523|sp|Q115Y7|TPIS_TRIEI Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|110166147|gb|ABG50687.1| triosephosphate isomerase [Trichodesmium erythraeum IMS101] (241 aa)
Score = 179, Expect = 1.6e-11, Identities = 57/230 (24%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM    +   +F + +        E  +V++   +  +     +   + + + AQNV +   G +TG +S L LKD G+    +GH + +  F E +  VN +L+   K+G+  +L + ETK       T+ ++  Q+      +D  ++V    I Y+P +    G+     +   + G IR          G    +N+ I YGG +  +++++I    ++DG L+
  S:     1 MRKTIIAGNWKMYKTQLEAKEFLEGLMSQLTKTPEEREVVLCTPFTALDFMSKILHGSLIRLGAQNVHWEDEGAYTGEISGLMLKDVGVSYVIVGHSERRQYFGETDETVNMRLKAAQKHGLTPILCVGETKQQRDSGETESHIFSQLANDLVDVDQENLV----IAYEPIWAIGTGDTCEAKEANRVIGLIR----------GKLNNSNVTIQYGGSVKPNNVDDIMAQEEIDGALV 224
>gi|30265163|ref|NP_847540.1| triosephosphate isomerase [Bacillus anthracis str. Ames] >gi|47778395|ref|YP_022025.2| triosephosphate isomerase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187973|ref|YP_031226.1| triosephosphate isomerase [Bacillus anthracis str. Sterne] >gi|165869952|ref|ZP_02214609.1| triosephosphate isomerase [Bacillus anthracis str. A0488] >gi|170687999|ref|ZP_02879212.1| triosephosphate isomerase [Bacillus anthracis str. A0465] >gi|170707735|ref|ZP_02898186.1| triosephosphate isomerase [Bacillus anthracis str. A0389] >gi|177652993|ref|ZP_02935320.1| triosephosphate isomerase [Bacillus anthracis str. A0174] >gi|190567774|ref|ZP_03020686.1| triosephosphate isomerase [Bacillus anthracis Tsiankovskii-I] >gi|39932348|sp|Q81X76|TPIS_BACAN Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|30259840|gb|AAP29026.1| triosephosphate isomerase [Bacillus anthracis str. Ames] >gi|47552100|gb|AAT34500.2| triosephosphate isomerase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181900|gb|AAT57276.1| triosephosphate isomerase [Bacillus anthracis str. Sterne] >gi|164714275|gb|EDR19795.1| triosephosphate isomerase [Bacillus anthracis str. A0488] >gi|170127292|gb|EDS96168.1| triosephosphate isomerase [Bacillus anthracis str. A0389] >gi|170668108|gb|EDT18858.1| triosephosphate isomerase [Bacillus anthracis str. A0465] >gi|172081768|gb|EDT66838.1| triosephosphate isomerase [Bacillus anthracis str. A0174] >gi|190561190|gb|EDV15163.1| triosephosphate isomerase [Bacillus anthracis Tsiankovskii-I] (251 aa)
Score = 179, Expect = 1.6e-11, Identities = 63/230 (27%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +        A  + I YGG +  ++I+E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEVVSPA----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 233
>gi|65317109|ref|ZP_00390068.1| COG0149: Triosephosphate isomerase [Bacillus anthracis str. A2012] >gi|167635272|ref|ZP_02393587.1| triosephosphate isomerase [Bacillus anthracis str. A0442] >gi|167529315|gb|EDR92067.1| triosephosphate isomerase [Bacillus anthracis str. A0442] (254 aa)
Score = 179, Expect = 1.6e-11, Identities = 63/230 (27%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +        A  + I YGG +  ++I+E    +D+DG L+
  S:     4 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEVVSPA----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 236
>gi|83592694|ref|YP_426446.1| triosephosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83575608|gb|ABC22159.1| triosephosphate isomerase [Rhodospirillum rubrum ATCC 11170] (258 aa)
Score = 179, Expect = 1.6e-11, Identities = 54/223 (24%), Positives = 99/223 (44%)
  Q:     8 TNWKMNADYVSISKFFKNI---PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           T+WKM+        +   +   P  + V+  + P +  +        +A V + AQ + +   G  TG +S L L+D G+    LGH + +    E +  VNAK+   L++G+  ++ + +   DL   ++ E +  Q+     GID   +  R  I Y+P + +GE     +       +  +   LR   G      LP+LYGG +   +   +    +VDG+ +
  S:     9 TSWKMHKTIAEAEAYVGELTASPLLDRVEAFIVPPFTALAAVHRALGDAPVHLGAQTMHWQDEGAQTGEISPLMLRDCGVGIVELGHSERRASHGETDATVNAKVASALRHGLRPLICVGDQGDDLDAGASIETVLRQVKLAIKGIDTASL-GRALIAYEPVWAIGEAGRPAEP----AHVAEVHGALRAMLGQRGLAALPLLYGGSVDRANAGALTALANVDGLFV 230
>gi|123968574|ref|YP_001009432.1| triosephosphate isomerase [Prochlorococcus marinus str. AS9601] >gi|160196560|sp|A2BRB4|TPIS_PROMS Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|123198684|gb|ABM70325.1| Triosephosphate isomerase [Prochlorococcus marinus str. AS9601] (241 aa)
Score = 179, Expect = 1.7e-11, Identities = 57/230 (24%), Positives = 113/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+        + K  IP  +++    KV++AP +  I      S    +++ +QN+ +   G  T  +S   L ++G+  A +GH + +  F E + Q+N +      +G+  ++ + ET   L +    E +R+   Q+  G++  D  + + + Y+P +    G+     D   I   IR +  F          +++ I YGG +  ++I+EI   +D+DG+L+
  S:     1 MRKSVIAGNWKMHMTCAEAKSYLKEFIPLIKDINEDRKVVIAPPFTAISTFSNHSDFDYLDISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSSGLTPIVCVGET---LEQRERGEAVRVITRQVEQGLENTDPSNLI-VAYEPIWAIGTGKTCQAEDANKICSLIRKLIGF----------DDVIIQYGGSVKPNNIDEIMSMSDIDGVLV 224
>gi|86609604|ref|YP_478366.1| triosephosphate isomerase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123501515|sp|Q2JJQ9|TPIS_SYNJB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|86558146|gb|ABD03103.1| triosephosphate isomerase [Synechococcus sp. JA-2-3B'a(2-13)] (250 aa)
Score = 179, Expect = 1.7e-11, Identities = 54/230 (23%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIP---------NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVAN-NLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++  NWKM+       +F + +          +    ++++   +  +      S+ + + V AQN+ +   G  TG +S   L + G++   +GH + +  F E +  VN +L    ++G+  +L + E++    +  T+  +  Q+++   GID  ++V    I Y+P +    G+  +  +   + G IR            ++ N  LPILYGG +   +I+E+    ++DG+L+
  S:     1 MRPILIAGNWKMHKTQAEAREFLRELGLALRSSPSGSASQRQIILCVPFTDLAVVAEQSRGSDIAVGAQNLHWEDQGAFTGEISGPMLAELGVRYVIVGHSERRQYFGETDETVNRRLAAAQRHGLTPILCVGESQQQREQGLTESWIVGQLDRALQGIDLENLV----IAYEPIWAIGTGQTCAAQEANRVIGLIR-----------QHLGNAQLPILYGGSVKAGNIDELMAQPEIDGVLV 228
>gi|46124649|ref|XP_386878.1| hypothetical protein FG06702.1 [Gibberella zeae PH-1] (247 aa)
Score = 179, Expect = 1.7e-11, Identities = 66/222 (29%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI-DALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI +  +N+ N +   N +V+V+P  L  +P +  +   ++EV AQNV     G  TG +S  +LKD  I  A LGH + +    E +  +++K +   +NG+  +    E+        T E +  QI  + + I D  +IV    I Y+P +          E      + IR+ LR+     VA+   ILYGG +   +  E+ K  D+DG L+
  S:    10 NFKMNGSKSSIKEIVENLNNADLDKNAEVVVSPPAL-YLPLVRETLRKEIEVAAQNVYDKPNGAFTGEISVSQLKDSDINWAILGHSERRTIIGESDEVISSKTKYATENGLKVIWCCGESLETREAGKTIEFVSAQIESLKSQISDWSNIV----IAYEPIWAIGTGKVATTEQAQEVHKAIRDLLRS-ISDKVADETRILYGGSVNEKNCGELSKQADIDGFLV 229
>gi|193216724|ref|YP_001999966.1| triosephosphate isomerase [Mycoplasma arthritidis 158L3-1] >gi|193002047|gb|ACF07262.1| triosephosphate isomerase [Mycoplasma arthritidis 158L3-1] (243 aa)
Score = 179, Expect = 1.7e-11, Identities = 61/227 (26%), Positives = 107/227 (47%)
  Q:     4 KILITNWKMNADYVSISKFFKNI------PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           K L+ N KMN  Y    K+   +       N +NV + VAPS   +   L   K+       QN+ +   G +TG VS    K++G+     GH + +  F E N  +N K+  + +  +  +L I E   + +++ TK+ L  QI      +D+   +D + I Y+P +        +N +I   + +I++    K+         +LYGG +   +IEE+ K  ++DG L+
  S:     2 KYLLGNLKMNFTYQECEKYLDTLEKALSEANLKNVILGVAPSAEAMSLILKF-KDRHFLFGTQNIFYKDKGAYTGEVSIRSAKEFGLDFTLTGHSERRHTFGETNDLINKKIMAINQTTIQPILCIGENLEEFNQKRTKDVLTEQITSALKNVDS--NLDNLIISYEPVYSIGNGQVPENNYIEQVVSLIKKITNNKY--------KVLYGGSVAPKNIEELNKIKNLDGYLV 223
>gi|126741368|ref|ZP_01757043.1| triosephosphate isomerase [Roseobacter sp. SK209-2-6] >gi|126717534|gb|EBA14261.1| triosephosphate isomerase [Roseobacter sp. SK209-2-6] (270 aa)
Score = 179, Expect = 1.7e-11, Identities = 62/230 (26%), Positives = 109/230 (47%)
  Q:     1 MREKILITNWKMN------ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGI-DALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+K+   NWKMN      A+  +++K  K        ++++ P    +  +        V +  Q+    S G HTG +S   L++ G     LGH + + D  E N  V AK     ++G+ AV+ + ET   L E  +   L++   Q+   + D  + V+ V + Y+P +          E I      +R  L ++FG  +A+++ +LYGG +   +  EI   ++VDG L+
  S:    22 MRQKLAAGNWKMNGMGPALAELETLTKTHKK----SACEILICPPATLLSRASEAVNGNPVAIGGQDCHANSSGAHTGDLSAEMLREAGATAVILGHSERRADHGESNKTVAAKTMAAWESGLIAVVCLGET---LEERESGSTLKIVGTQLAASLPDGANGVNSV-VAYEPVWAIGTGKVPTLEQIAEVHNFLRTELTSRFGEEIADSIRLLYGGSVKPGNAAEIFATSNVDGALV 250
>gi|194324375|ref|ZP_03058148.1| triosephosphate isomerase [Francisella tularensis subsp. novicida FTE] >gi|194321440|gb|EDX18925.1| triosephosphate isomerase [Francisella tularensis subsp. novicida FTE] (248 aa)
Score = 179, Expect = 1.8e-11, Identities = 64/222 (28%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWKMN +  SI +    I   +     V + V PS + +   +      KV V  QN++F   G +TG +S   L+D G     +GH + +  F E +  V  KL K++   +  V+ I E+  D      K+ L  Q++ I   + +++ + +V I Y+P +          + I  T + IR  L  K    +A N+ I+YGG +  ++ ++I    DVDG LI
  S:     3 NWKMNGNSTSIKELCSGISQAQYDTSRVAIAVFPSSVYVKEVISQLPE-KVGVGLQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCIGESLDDRQSGKLKQVLATQLSLILENL-SVEQLAKVVIAYEPVWAIGTGVVASLDQIQETHQFIRSLL-AKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLI 225
>gi|118487691|gb|ABK95670.1| unknown [Populus trichocarpa] (313 aa)
Score = 179, Expect = 1.8e-11, Identities = 58/222 (26%), Positives = 102/222 (45%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    SI+    ++ + +   +V V+VAP ++  +  +  S   ++E+ AQN      G  TG +S  +LKD G K   LGH + +    E +  +  K    L  G+  +  I E    L E    +   +   Q+    DA+   D + I Y+P +    G + +    + +      +R++L+      VA+   I+YGG +   +  E+ K  D+DG L+
  S:    69 NWKCNGTKESITTLISDLNSAKLESDVDVVVAPPFI-YIDQVKSSLTDRIEISAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEDDQFIGKKAAYALSQGVGVIACIGEL---LEEREAGKTFDVCYQQLKAYADAVPSWDNIVIAYEPVWAIGTGVVATPAQAQEVH---VAVRDWLKNNVSAEVASKTRIIYGGSVNGGNCAELAKQEDIDGFLV 289
>gi|19745720|ref|NP_606856.1| triosephosphate isomerase [Streptococcus pyogenes MGAS8232] >gi|23822269|sp|Q8P1W3|TPIS_STRP8 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|19747857|gb|AAL97355.1| putative triosephosphate isomerase [Streptococcus pyogenes MGAS8232] (252 aa)
Score = 179, Expect = 1.8e-11, Identities = 56/243 (23%), Positives = 114/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+ A  +   V + Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++++     DVDG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIICCGESLETYEAGKAAEFVGAQVSAALAGLSAEQVASLV-LAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEADSFLALL 248
>gi|33865357|ref|NP_896916.1| triosephosphate isomerase [Synechococcus sp. WH 8102] >gi|39932285|sp|Q7U804|TPIS_SYNPX Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|33632526|emb|CAE07338.1| triosephosphate isomerase [Synechococcus sp. WH 8102] (243 aa)
Score = 179, Expect = 1.8e-11, Identities = 53/230 (23%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++  NWKM+        +    +P  E      ++++AP +  +      ++++ V + +QNV +   G  T  +S   L ++G+    +GH + +  F E + Q+N + +     G+  ++ + E+         +  +R QI Q   G+DA    +++ + Y+P +    G+     +   I G IR           +  A +L I YGG +   +I+E+   +D+DG+L+
  S:     1 MRRPVIAGNWKMHMTCAQARDYMAAFLPQIERAPQDREIVLAPPFTALSTMAAAAEHSVVGLASQNVHWQDHGAFTAEISAEMLLEHGVAYTIVGHSEPRKYFSESDEQINHRARCSQAKGLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDA----NKLVVAYEPIWAIGTGKTCEAAEANRICGLIR----------SWVGATDLIIQYGGSVKPTNIDELMAMSDIDGVLV 224
>gi|15639526|ref|NP_218976.1| triosephosphate isomerase (tpi) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025765|ref|YP_001933537.1| triosephosphate isomerase [Treponema pallidum subsp. pallidum SS14] >gi|6094503|sp|O83548|TPIS_TREPA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|3322828|gb|AAC65522.1| triosephosphate isomerase (tpi) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018340|gb|ACD70958.1| triosephosphate isomerase [Treponema pallidum subsp. pallidum SS14] (249 aa)
Score = 179, Expect = 1.8e-11, Identities = 57/230 (24%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR   +  NWKM+   A+ V++++             M+APS+  +     + + + V + AQ+VS    G HTG VS L+L+D G++   +GH + +    E +  +N K++++L++G+  +L + E   +     T E +  Q+      +    ++  V + Y+P +    G+  +      +   IR +   +R  +G  +A  L I YGG +  ++   +     +DG LI
  S:     1 MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTALDAVGKVLRGSNVLLGAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHGRGENDKLINQKVRRVLESGLRVILCVGERLQEYEAGCTNEVVGTQVRAGMADVCG-SLMHNVTVAYEPVWAIGTGKTATPAQANAVHAHIRSV---VREMYGAAIAEALCIQYGGSMKAENARALLAEEHIDGGLI 232
>gi|66362312|ref|XP_628120.1| triosephosphate isomerase [Cryptosporidium parvum Iowa II] >gi|46227407|gb|EAK88342.1| triosephosphate isomerase [Cryptosporidium parvum Iowa II] (250 aa)
Score = 179, Expect = 1.9e-11, Identities = 63/222 (28%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE--NVKVMVAPSYLGIV---PSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K N    S+     +    E  N +V V P+ L I       G       ++ +QN+S    G  TG VS   LKD  +  + +GH + +  + E +  VN K++K L+NG+  VL I E+   LSE  T +   +   Q+   +  +  +  + I Y+P +    G + +    +        IRE++   +   V++NL I+YGG +  D+  E+ K  D+DG L+
  S:    10 NFKCNGTKESLKTLIDSFKQVESSNSEVYVFPTSLHISLVKEFFGNDHPGVFKIGSQNISCTGNGAFTGEVSCEMLKDMDVDCSLVGHSERRQYYSETDQIVNNKVKKGLENGLKIVLCIGES---LSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATPGQAQEAHA---FIREYVTRMYNPQVSSNLRIIYGGSVTPDNCNELIKCADIDGFLV 233
>gi|94676508|ref|YP_588630.1| triosephosphate isomerase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|160184952|sp|Q1LTT4|TPIS_BAUCH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|94219658|gb|ABF13817.1| triosephosphate isomerase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (256 aa)
Score = 179, Expect = 2.0e-11, Identities = 67/230 (29%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-FENV----KVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  ++I NWK+N     +S F  ++ N   N+     V +AP  + +  +      + + + AQNV     G  TG +S   LKD G K   +GH + ++  KE N  +  K   L   G+  VL I ETK +  ++ TK     Q++ I N +      + V I Y+P +      K  N      I+ I +F+R+    +   +A  + I YGG +   +  E+    DVDG L+
  S:     1 MRHPLVIGNWKLNGSKHMVSNFIISLRNQLSNMINCCNVAIAPPMIYLDRAKSYLTGSHIALGAQNVDLHVSGAFTGEISAKMLKDIGAKYIIIGHIERRLYHKESNEDIANKFACLKNEGLIPVLCIGETKEENEKDQTKAICVRQLDYILNIVGTQAFKNAV-IAYEPIW-AIATGKSANPL---QIQKIHKFIRSYLFNHDQAIAEQVIIQYGGSVNASNAAELFNQPDVDGALV 233
>gi|115352340|ref|YP_774179.1| triosephosphate isomerase [Burkholderia ambifaria AMMD] >gi|172061211|ref|YP_001808863.1| Triose-phosphate isomerase [Burkholderia ambifaria MC40-6] >gi|115282328|gb|ABI87845.1| triosephosphate isomerase [Burkholderia ambifaria AMMD] >gi|171993728|gb|ACB64647.1| Triose-phosphate isomerase [Burkholderia ambifaria MC40-6] (251 aa)
Score = 179, Expect = 2.0e-11, Identities = 61/242 (25%), Positives = 113/242 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIV---PSLGMSKN----AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R K +I NWKM+            +   +    + A + +G+    P L   +      +V   AQ+VS    G  TG V+   + ++G   A +GH + +    E+N  V AK Q+ L  G+  V+ + ET  +    +T++ +  Q++ +   + A D   R+ + Y+P + +G   S    +      + +  FLR +     A ++ +LYGG +  D+ EE+    D+DG LI      +  +++I
  S:     5 RTKRVIGNWKMHGRLAGNQALLNEV--VQGAGAVAAETSIGVCVPFPYLAQVQAQLGAGRVVFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRALAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTA-DEAARIVVAYEPVWAIGTGKSATSAQ-----AQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKAQDFLAI 246
>gi|125747035|gb|ABN55898.1| triose phosphate isomerase [Candida glycerinogenes] (250 aa)
Score = 179, Expect = 2.1e-11, Identities = 63/222 (28%), Positives = 104/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI    +NI N     NV+V++ P    +  +  ++K A V+V AQN    + G  TG VS L +KD G +    GH + +  F E +  V  K +  +  G+  +L I E+  +     T +  + +++ +   +   D    + + Y+P +    G   +  D + I      IR++L ++ G   A  + ILYGG     D  E     DVDG L+
  S:    10 NFKMNGSKASIKTIVENINNSSIPSNVEVVLCPPAPYLSYTADLNKQANVQVGAQNCYPKASGAFTGEVSPLAVKDSGAEWVITGHSERRQYFNESDEFVAEKTKFAIDQGLKVILCIGESIDEKKAGKTLDVCKRELSAVIKAVAPEDW-PPLSLPYEPVWAIGTGLAATAQDAQDIHAE---IRKYLASQLGESTAQAVRILYGGSANGKDAPEFKDKADVDGFLV 233
>gi|94993924|ref|YP_602022.1| triosephosphate isomerase [Streptococcus pyogenes MGAS10750] >gi|160196652|sp|Q1J7N3|TPIS_STRPF Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|94547432|gb|ABF37478.1| Triosephosphate isomerase [Streptococcus pyogenes MGAS10750] (252 aa)
Score = 179, Expect = 2.1e-11, Identities = 56/244 (22%), Positives = 115/244 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           +R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+ A  +   V + Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++++     DVDG L+      ++ ++++L
  S:     2 LRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLV-LAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEADSFLALL 248
>gi|171316301|ref|ZP_02905522.1| Triose-phosphate isomerase [Burkholderia ambifaria MEX-5] >gi|171098527|gb|EDT43328.1| Triose-phosphate isomerase [Burkholderia ambifaria MEX-5] (251 aa)
Score = 178, Expect = 2.1e-11, Identities = 61/242 (25%), Positives = 113/242 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFENVKVMVAPSYLGIV---PSLGMSKN----AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           R K +I NWKM+            +   +    + A + +G+    P L   +      +V   AQ+VS    G  TG V+   + ++G   A +GH + +    E+N  V AK Q+ L  G+  V+ + ET  +    +T++ +  Q++ +   + A D   R+ + Y+P + +G   S    +      + +  FLR +     A ++ +LYGG +  D+ EE+    D+DG LI      +  +++I
  S:     5 RTKRVIGNWKMHGRLAGNQALLNEV--VQGAGAVAAETSIGVCVPFPYLAQVQAQLGAGRVAFGAQDVSAHEQGAFTGEVAAGMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRALAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTA-DEAARIVVAYEPVWAIGTGKSATSAQ-----AQDVHAFLRARLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKAEDFLAI 246
>gi|145478531|ref|XP_001425288.1| hypothetical protein GSPATT00028925001 [Paramecium tetraurelia strain d4-2] >gi|124392357|emb|CAK57890.1| unnamed protein product [Paramecium tetraurelia] (253 aa)
Score = 178, Expect = 2.1e-11, Identities = 59/230 (25%), Positives = 100/230 (43%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPN-----FENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR   +  NWK N            + N        V+V+VAP  L  VP +  +    V+V  QN S   +G +TG +S  ++KD GI    LGH + +    E N  V  K +  L   +N +  + E + +     T + ++ Q+  I   +  ++   +V + Y+P +          E        IR +L+++ G        I+YGG +   +  ++ K  DVDG L+
  S:     1 MRRYFVGGNWKCNNTIAQTQSLINTVINKLVFDINKVEVVVAPISLH-VPWVQANIQKNVQVSIQNSSSTKMGAYTGEISVEQVKDLGIPWVILGHSERRQYNGETNEIVGKKTRIALDYQLNVIACVGEKQAERESGQTTQVIQAQLESIKKEL-TIEQWAKVVVAYEPVWAIGTGQTASPEQAQEVHAFIRAWLKSQIGTQAEQATRIIYGGSVTEKNAADLIKQPDVDGFLV 233
>gi|27364742|ref|NP_760270.1| triosephosphate isomerase [Vibrio vulnificus CMCP6] >gi|37681209|ref|NP_935818.1| triosephosphate isomerase [Vibrio vulnificus YJ016] >gi|31077028|sp|Q8DCQ3|TPIS_VIBVU Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|39932254|sp|Q7MH47|TPIS_VIBVY Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|27360887|gb|AAO09797.1|AE016801_116 Triosephosphate isomerase [Vibrio vulnificus CMCP6] >gi|37199960|dbj|BAC95789.1| triosephosphate isomerase [Vibrio vulnificus YJ016] (256 aa)
Score = 178, Expect = 2.1e-11, Identities = 65/230 (28%), Positives = 107/230 (46%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFN--GIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  +++ NWK+N     +++        +   E V V VAP   Y+ +   L      K+ + AQN    + G  TG +S   LKD+G     +GH + +    E +  V  K   L +NG+  V  I ET+       T+     QIN + +  G++AL   +   I Y+P +    G+  +  D + I  +IR +   +  K    VA  + I YGG +  ++ E      D+DG L+
  S:     1 MRRPVVMGNWKLNGSKTMVAELLTGLNAELEGVEGVDVAVAPPALYIDLAERLIAEGGNKIILGAQNTDINNSGAFTGDMSPAMLKDFGATHIIIGHSERREYHNESDEFVAKKFAFLKENGLKPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEAL---NGAIIAYEPIWAIGTGKAATAEDAQRIHASIRAM---IAAK-DAAVAEQVIIQYGGSVKPENAEAYFAQPDIDGALV 234
>gi|111024129|ref|YP_707101.1| triosephosphate isomerase [Rhodococcus sp. RHA1] >gi|123045347|sp|Q0S0J3|TPIS_RHOSR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|110823659|gb|ABG98943.1| triose-phosphate isomerase [Rhodococcus sp. RHA1] (261 aa)
Score = 178, Expect = 2.2e-11, Identities = 67/229 (29%), Positives = 115/229 (50%)
  Q:     2 REKILITNWKMNADYVS----ISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQI---FNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN +++     + K   ++P   F+ V V V P +  I     + +  K+ +   AQ+VS    G +TG +S   L   G     +GH + +    E N  V AK +  LKNG+  ++ I E  +D+ E    E++   + Q+     G+   DI  +V I Y+P +    G + S  + + +   IR     L ++    VA+ + +LYGG +   ++ EI    DVDG L+
  S:     3 RKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFDKVDVTVIPPFTDIRSVQTLVEGDKLLLTYGAQDVSAHDSGAYTGEISGSMLAKLGCTFVVVGHSERRTLHCEDNDTVLAKTKAALKNGITPIVCIGE-GLDVREAG--EHVSYNVEQLRGSLAGLSGEDIA-KVVIAYEPVWAIGTGRVASAANAQEVCAAIRATLGELASQ---DVASGVRVLYGGSVNAKNVGEIVGQTDVDGALV 238
>gi|52783470|sp|Q9C401|TPIS_ZYGBA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|12276170|gb|AAG50278.1| triose phosphate isomerase [Zygosaccharomyces bailii] (248 aa)
Score = 178, Expect = 2.3e-11, Identities = 65/222 (29%), Positives = 103/222 (46%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N    SI +  + + N +    V+V++ P    +  ++ + K ++V V AQN    + G  TG  S  ++KD G K   LGH + +  F+E +  +  K    L  G+  +L I ET   L ++     L++   Q+   ID +     V I Y+P +    G   +  D + I  +   IREFL  K G   A    ILYGG     +        DVDG L+
  S:    10 NFKLNGTKSSIKEIVERLNNAKLDPKVEVVLCPPAPYLDYTVSLVKKSQVSVGAQNAYLKASGAFTGENSVDQIKDVGAKWVILGHSERRQYFREDDQLIAEKTAFALSQGVGVILCIGET---LDQKKAGTTLQVVERQLQAVIDKVKDWSNVVIAYEPVWAIGTGLAATPEDAQEIHHS---IREFLAKKLGEKTAQETRILYGGSANGKNAVTFKDKPDVDGFLV 231
>gi|166983007|ref|ZP_02254431.1| triosephosphate isomerase [Bacillus cereus AH187] >gi|166996680|ref|ZP_02263140.1| triosephosphate isomerase [Bacillus cereus AH820] >gi|168162037|ref|ZP_02597270.1| triosephosphate isomerase [Bacillus cereus H3081.97] >gi|196045690|ref|ZP_03112920.1| triosephosphate isomerase [Bacillus cereus 03BB108] >gi|196023521|gb|EDX62198.1| triosephosphate isomerase [Bacillus cereus 03BB108] (251 aa)
Score = 178, Expect = 2.4e-11, Identities = 63/230 (27%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +        A  + I YGG +  ++I+E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEAVSPA----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 233
>gi|118480174|ref|YP_897325.1| triosephosphate isomerase [Bacillus thuringiensis str. Al Hakam] >gi|118419399|gb|ABK87818.1| triosephosphate isomerase [Bacillus thuringiensis str. Al Hakam] (254 aa)
Score = 178, Expect = 2.4e-11, Identities = 63/230 (27%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +        A  + I YGG +  ++I+E    +D+DG L+
  S:     4 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEAVSPA----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 236
>gi|42784286|ref|NP_981533.1| triosephosphate isomerase [Bacillus cereus ATCC 10987] >gi|81699600|sp|Q72XY3|TPIS_BACC1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|42740217|gb|AAS44141.1| triosephosphate isomerase [Bacillus cereus ATCC 10987] (251 aa)
Score = 178, Expect = 2.4e-11, Identities = 63/230 (27%), Positives = 105/230 (45%)
  Q:     1 MREKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIR-VIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN        F +     IP    V  +V    L +   +  ++   ++V AQN+ F   G  TG +S + L D  +    LGH + +  F E +  VN K     ++G+  ++   ET   L E  + +   L   Q+   +  L  + V    I Y+P +    G+ +S  D   +   IR V+ E +        A  + I YGG +  ++I+E    +D+DG L+
  S:     1 MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQVGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHGLTPIVCCGET---LEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSSADANEVCAHIRKVVAEAVSPA----AAEAVRIQYGGSVKPENIKEYMAQSDIDGALV 233
>gi|27904779|ref|NP_777905.1| triosephosphate isomerase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|29428173|sp|P59462|TPIS_BUCBP Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|27904177|gb|AAO27010.1| triosephosphate isomerase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (252 aa)
Score = 178, Expect = 2.4e-11, Identities = 58/230 (25%), Positives = 114/230 (49%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF-------ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M++KI+I NWK+N +   +    K + NF        ++K+++ P Y+ + P   +  ++ + + +QNV    +G  TG VS   LKD G+    +GH + +   +E +  +  K + +  + +  VL I ET+ +     T++  + QI+ IF+ +      + V I Y+P +    N+     FI   +  I+ ++  K    +     + YGG +   +I E+    ++DG L+
  S:     1 MKKKIIIANWKLNGNIQLLQTLLKPLVNFYIRHKNKSSIKLVIMPPYVYLYPMKSIISHSSILLGSQNVDINLIGAFTGEVSINMLKDVGVSYVLVGHSERRQYHRENDVIIAKKFKIVKDSHLIPVLCIGETEHEYLSCKTEKICKFQIDAIFDLLGPSGFNNSV-IAYEPKWAIGTNTIPSINFIQKILMFIQNYIFNKQNSTI-KLFSLQYGGSVNEHNIIELYDVKNIDGFLV 235
>gi|28374002|pdb|1NF0|A Chain A, Triosephosphate Isomerase In Complex With Dhap >gi|28374003|pdb|1NF0|B Chain B, Triosephosphate Isomerase In Complex With Dhap (247 aa)
Score = 178, Expect = 2.4e-11, Identities = 67/222 (30%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N    SI +  +     +IP  ENV+V++ P    +  S+ + K  +V V AQN    + G  TG  S  ++KD G K   LGH + +  F E +  +  K +  L  G+  +L I ET   L E+   + L +   Q+   ++ +     V + Y+P      G   +  D + I  +   IR+FL +K G   A+ L ILYGG     +        DVDG L+
  S:     9 NFKLNGSKQSIKEIVERLNTASIP--ENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKYVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGET---LEEKKAGKTLDVVERQLNAVLEEVKDFTNVVVAYEPVXAIGTGLAATPEDAQDIHAS---IRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLV 230
>gi|14719493|pdb|1I45|A Chain A, Yeast Triosephosphate Isomerase (Mutant) >gi|14719494|pdb|1I45|B Chain B, Yeast Triosephosphate Isomerase (Mutant) (248 aa)
Score = 178, Expect = 2.4e-11, Identities = 67/222 (30%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N    SI +  +     +IP  ENV+V++ P    +  S+ + K  +V V AQN    + G  TG  S  ++KD G K   LGH + +  F E +  +  K +  L  G+  +L I ET   L E+   + L +   Q+   ++ +     V + Y+P      G   +  D + I  +   IR+FL +K G   A+ L ILYGG     +        DVDG L+
  S:    10 NFKLNGSKQSIKEIVERLNTASIP--ENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKYVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGET---LEEKKAGKTLDVVERQLNAVLEEVKDFTNVVVAYEPVXAIGTGLAATPEDAQDIHAS---IRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLV 231
>gi|167765293|ref|ZP_02437406.1| hypothetical protein BACSTE_03681 [Bacteroides stercoris ATCC 43183] >gi|167696921|gb|EDS13500.1| hypothetical protein BACSTE_03681 [Bacteroides stercoris ATCC 43183] (251 aa)
Score = 178, Expect = 2.5e-11, Identities = 62/230 (26%), Positives = 108/230 (46%)
  Q:     1 MREKILITNWKMNA---DYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKMN    + ++++K        E  N  V++   ++ +     +   AK+ V A+N +    G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E   +       E +  Q+  +F+ + A D   ++ + Y+P +    G+  +    + I      IR  +  K+G  +A N  ILYGG     + +E+  N DVDG LI
  S:     1 MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKIGVGAENCADKESGAYTGEVSAAMVASTGAKYVILGHSERRAYYGETVEILEEKVKLALANGLTPIFCIGEVLEEREANKQNEVVAAQLASVFS-LSAEDF-SKIILAYEPVWAIGTGKTATPAQAQEIHA---FIRSAVAEKYGKEIAENCSILYGGSCKPSNAKELFANPDVDGGLI 233
>gi|2624735|pdb|1YDV|A Chain A, Triosephosphate Isomerase (Tim) >gi|2624736|pdb|1YDV|B Chain B, Triosephosphate Isomerase (Tim) >gi|27065616|pdb|1M7O|A Chain A, Plasmodium Falciparum Triosephosphate Isomerase (Pftim) Compled To Substrate Analog 3-Phosphoglycerate (3pg) >gi|27065617|pdb|1M7O|B Chain B, Plasmodium Falciparum Triosephosphate Isomerase (Pftim) Compled To Substrate Analog 3-Phosphoglycerate (3pg) >gi|27065619|pdb|1M7P|A Chain A, Plasmodium Falciparum Triosephosphate Isomerase (Pftim) Compled To Substrate Analog Glycerol-3-Phosphate (G3p). >gi|27065620|pdb|1M7P|B Chain B, Plasmodium Falciparum Triosephosphate Isomerase (Pftim) Compled To Substrate Analog Glycerol-3-Phosphate (G3p). >gi|28373557|pdb|1LYX|A Chain A, Plasmodium Falciparum Triosephosphate Isomerase (Pftim)- Phosphoglycolate Complex >gi|28373560|pdb|1LZO|A Chain A, Plasmodium Falciparum Triosephosphate Isomerase- Phosphoglycolate Complex >gi|28373561|pdb|1LZO|B Chain B, Plasmodium Falciparum Triosephosphate Isomerase- Phosphoglycolate Complex >gi|28373562|pdb|1LZO|C Chain C, Plasmodium Falciparum Triosephosphate Isomerase- Phosphoglycolate Complex >gi|28373563|pdb|1LZO|D Chain D, Plasmodium Falciparum Triosephosphate Isomerase- Phosphoglycolate Complex >gi|42543142|pdb|1O5X|A Chain A, Plasmodium Falciparum Tim Complexed To 2-Phosphoglycerate >gi|42543143|pdb|1O5X|B Chain B, Plasmodium Falciparum Tim Complexed To 2-Phosphoglycerate (248 aa)
Score = 178, Expect = 2.5e-11, Identities = 64/243 (26%), Positives = 112/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNFE----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWK N    SI     +  N +     + V+V P  +    +  + + +K     QNVS    G++TG VS    KD  I+   +GH + +  F E +  V  KLQ  LKN + AV+   E+   L +    + + +   Q+   +D +D  D V +VY+P +          E      + IR+ ++   G   AN + ILYGG +  ++   + +  D+DG L+ +  +L   ++ I+
  S:     3 RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQ-SKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGES---LEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNA-SLKESFVDII 244
>gi|145295707|ref|YP_001138528.1| triosephosphate isomerase [Corynebacterium glutamicum R] >gi|160185058|sp|A4QEG0|TPIS_CORGB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|80973079|gb|ABB53269.1| triosephosphate isomerase [Corynebacterium glutamicum] >gi|140845627|dbj|BAF54626.1| hypothetical protein [Corynebacterium glutamicum R] (259 aa)
Score = 178, Expect = 2.6e-11, Identities = 70/229 (30%), Positives = 114/229 (49%)
  Q:     2 REKILITNWKMNADYV----SISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTK-ENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN D+     ++ K    +P   FE V V V   +  I     + +  K+EV   AQ+VS    G +TG VS   L         +GH + +    E +  V AK +  L NG++ ++ + E  +++ E  T  E +  Q  +   G+DA ++ + V I Y+P +    G++ S  D + +    + IR  +    G  VA  L ILYGG +  + + EI    DVDG L+
  S:     3 RKPLIAGNWKMNLDHQQAIGTVQKLAFALPKEYFEKVDVAVTVPFTDIRSVQTLVEGDKLEVTFGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNESDELVAAKAKAALSNGISPIVCVGE-PLEIREAGTHVEYVVEQTRKSLAGLDATELANTV-IAYEPVWAIGTGKVASAADAQEV---CKAIRGLIVELAGDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLV 238
>gi|156040910|ref|XP_001587441.1| triosephosphate isomerase [Sclerotinia sclerotiorum 1980] >gi|154695817|gb|EDN95555.1| triosephosphate isomerase [Sclerotinia sclerotiorum 1980] (247 aa)
Score = 178, Expect = 2.6e-11, Identities = 62/240 (25%), Positives = 115/240 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           N+KMN    SI K    + + +   N +V++AP  L ++ +    +   +EV AQNV     G  TG +S  +LKD  I    LGH + +V  +E +  V +K +  L  G+N +    E+   L +  + + + +   Q+    D +    ++ I Y+P +    G++ S    + +      IR +L+ +     A    I+YGG +   + +++ K  D+DG L+    +L   ++ I+  HL
  S:    10 NFKMNGSVESIKKIVGYLNDAKLDPNTEVVIAPPALYLLLTREHLRPG-LEVAAQNVFDKPNGAFTGEISVEQLKDSNITWTLLGHSERRVVLQEDDSFVASKTKAALDGGINVIFCCGES---LEQRESGKTIEVVTAQLKAVKDKVQDWSKIVIAYEPIWAIGTGKVASTEQAQEVHAA---IRSWLKKEVSEKAAEETRIIYGGSVSEKNCKDLSKQEDIDGFLVGGA-SLKPAFVDIINSHL 247
>gi|28374000|pdb|1NEY|A Chain A, Triosephosphate Isomerase In Complex With Dhap >gi|28374001|pdb|1NEY|B Chain B, Triosephosphate Isomerase In Complex With Dhap (247 aa)
Score = 178, Expect = 2.7e-11, Identities = 67/222 (30%), Positives = 106/222 (47%)
  Q:     9 NWKMNADYVSISKFFK-----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+K+N    SI +  +     +IP  ENV+V++ P    +  S+ + K  +V V AQN    + G  TG  S  ++KD G K   LGH + +  F E +  +  K +  L  G+  +L I ET   L E+   + L +   Q+   ++ +     V + Y+P      G   +  D + I  +   IR+FL +K G   A+ L ILYGG     +        DVDG L+
  S:     9 NFKLNGSKQSIKEIVERLNTASIP--ENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKYVILGHSERRSYFHEDDKFIADKTKFALGQGVGVILCIGET---LEEKKAGKTLDVVERQLNAVLEEVKDFTNVVVAYEPVXAIGTGLAATPEDAQDIHAS---IRKFLASKLGDKAASELRILYGGSANGSNAVTFKDKADVDGFLV 230
>gi|40500|emb|CAA42047.1| triosephosphate isomerase [Corynebacterium glutamicum] (259 aa)
Score = 178, Expect = 2.7e-11, Identities = 70/229 (30%), Positives = 114/229 (49%)
  Q:     2 REKILITNWKMNADYV----SISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTK-ENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN D+     ++ K    +P   FE V V V   +  I     + +  K+EV   AQ+VS    G +TG VS   L         +GH + +    E +  V AK +  L NG++ ++ + E  +++ E  T  E +  Q  +   G+DA ++ + V I Y+P +    G++ S  D + +    + IR  +    G  VA  L ILYGG +  + + EI    DVDG L+
  S:     3 RKPLIAGNWKMNLDHQQAIGTVQKLAFALPKEYFEKVDVAVTVPFTDIRSVQTLVEGDKLEVTFGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNESDELVAAKAKAALSNGISPIVCVGE-PLEIREAGTHVEYVVEQTRKSLAGLDAAELANTV-IAYEPVWAIGTGKVASAADAQEV---CKAIRGLIVELAGDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLV 238
>gi|19552798|ref|NP_600800.1| triosephosphate isomerase [Corynebacterium glutamicum ATCC 13032] >gi|62390468|ref|YP_225870.1| triosephosphate isomerase [Corynebacterium glutamicum ATCC 13032] >gi|21903480|sp|P19583|TPIS_CORGL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|21324355|dbj|BAB98979.1| Triosephosphate isomerase [Corynebacterium glutamicum ATCC 13032] >gi|41325805|emb|CAF21594.1| TRIOSEPHOSPHATE ISOMERASE [Corynebacterium glutamicum ATCC 13032] (259 aa)
Score = 177, Expect = 2.8e-11, Identities = 70/229 (30%), Positives = 114/229 (49%)
  Q:     2 REKILITNWKMNADYV----SISKFFKNIPN--FENVKVMVAPSYLGIVPSLGMSKNAKVEVV--AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTK-ENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ ++  NWKMN D+     ++ K    +P   FE V V V   +  I     + +  K+EV   AQ+VS    G +TG VS   L         +GH + +    E +  V AK +  L NG++ ++ + E  +++ E  T  E +  Q  +   G+DA ++ + V I Y+P +    G++ S  D + +    + IR  +    G  VA  L ILYGG +  + + EI    DVDG L+
  S:     3 RKPLIAGNWKMNLDHQQAIGTVQKLAFALPKEYFEKVDVAVTVPFTDIRSVQTLVEGDKLEVTFGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNESDELVAAKAKAALSNGISPIVCVGE-PLEIREAGTHVEYVVEQTRKSLAGLDAAELANTV-IAYEPVWAIGTGKVASAADAQEV---CKAIRGLIVELAGDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLV 238
>gi|21426775|ref|NP_653352.1| resection-induced TPI (rs11) [Rattus norvegicus] >gi|3213193|gb|AAC23442.1| resection-induced TPI [Rattus norvegicus] (254 aa)
Score = 177, Expect = 2.8e-11, Identities = 69/229 (30%), Positives = 110/229 (48%)
  Q:     2 REKILITNWKMNADYVSI---SKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQI-FNGIDALDIV------DRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R  ++  N+K N D+  I   ++  K IP   NV+V VAPS + +       K   +EV AQNV +   G  TG ++   L D G+KT  +GH + +    E N Q   K  + +  GM     I ET   L E +       +++++ F  ++AL  V        V I Y+P +    G + S    + +  +   IR++L  K    VA+   I YGG +   +   + K  D+DG L+
  S:     4 RRPVVGGNFKCNGDFAFIKTHTEVLKTIPK-NNVEVYVAPSAIHLKTLADNLKGTHIEVAAQNVYYEKPGAWTGELNVEMLLDCGLKTVIIGHSERRRIMGETNEQSAKKAARAISLGMTVAFCIGET---LEERNAG-----KVDEVNFAQLEALRAVLKEADWKNVIIAYEPVWSIGTGVVASPEQAQEVHAS---IRKWLGEKVSKAVADATRIQYGGSVNAANCAALGKCPDIDGFLV 233
>gi|83815814|ref|YP_446015.1| triosephosphate isomerase [Salinibacter ruber DSM 13855] >gi|83757208|gb|ABC45321.1| triosephosphate isomerase [Salinibacter ruber DSM 13855] (260 aa)
Score = 177, Expect = 2.9e-11, Identities = 60/238 (25%), Positives = 104/238 (43%)
  Q:     9 NWKMNADYVSISKFFKNIP--------NFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           NWKMN D          I         +  +V  +V P Y+ +        +  V V AQ++     G +TG VS   L   G     LGH + +  + E + +VNAK Q+   + +  ++ + ET            +R Q++   + + ++D  D + + Y+P +          E       VIR+ LR ++G  VA+ +P+LYGG +   +   +    D+DG LI      +  ++ I  K
  S:     6 NWKMNTDVPEGRALADAIAEGLSSTAADRGDVDFLVCPPYVHLPAVREALADVPVAVGAQDMHAQDEGAYTGDVSAPMLSSIGCDAVILGHSERRTYYDETDAEVNAKAQQARAHDLVPIVCVGETLEQRKAGEADTVVRSQVDGALSDV-SIDGADELIVAYEPIWAIGTGESAAAEQAQAMHAVIRDDLRERYGGDVADEVPLLYGGSMKPHNAYGLLSQPDIDGGLIGSASLEAESFLGIAEK 250
>gi|191162800|ref|ZP_03024678.1| Triose-phosphate isomerase [Geobacter sp. M21] >gi|190995915|gb|EDV71365.1| Triose-phosphate isomerase [Geobacter sp. M21] (251 aa)
Score = 177, Expect = 3.0e-11, Identities = 61/230 (26%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKM----NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMS-KNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWK+    N     I +    +   +NV+++VAP +  ++P+L  +     + + AQ+V +   G  TG VS   L D G     +GH + +  F E    VN K++  LK  +  ++ I ET   L      +  ++   Q+  G++ L       V + Y+P +    G++ S    +     IR +   L   FG   A+ + ILYGG +  ++++ +    D+DG L+
  S:     1 MRKPVIAGNWKLFKTKNEALALIEELAPLVSGVDNVEIVVAPVFT-VLPTLPAALAGTGISLAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETEETVNKKVKAALKGALVPIVCIGET---LEAREAGDTFKVLEGQLKGGLEGLTGTQFAPVILAYEPVWAIGTGKVASDDQAQEAHAFIRGVIAGL---FGKSAADKVRILYGGSVKPENVKGLMSRTDIDGALV 233
>gi|116207868|ref|XP_001229743.1| hypothetical protein CHGG_03227 [Chaetomium globosum CBS 148.51] >gi|88183824|gb|EAQ91292.1| hypothetical protein CHGG_03227 [Chaetomium globosum CBS 148.51] (250 aa)
Score = 177, Expect = 3.0e-11, Identities = 63/240 (26%), Positives = 116/240 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           N+KMN    SI    + +   +   NV+V++AP  L +  +    K A V+V AQNV     G +TG +S  +LKD  I    LGH + +    E +  V +K +  +  G++ V    E+  +    +T   +  Q+  +   +   D   ++ I Y+P +    G++ +    + +      IR++L+ K    VA    ILYGG +   + +++ K  D+DG L+    +L  +++ I+  +L
  S:    10 NFKMNGTKESIKSIVQGLNKAQLDPNVEVVIAPPALYLQLAQDEVKQATVKVSAQNVYDKPNGAYTGEISVAQLKDSEIHWTILGHSERRTILGETDEVVASKTKSAIDGGVSVVWCCGESLEEREAGNTVAVVERQLAALAAKVSG-DDWKKIVIAYEPIWAIGTGKVATVQQAQEVH---EAIRKWLKAKVSDAVAEETRILYGGSVNGKNCKDLAKEKDIDGFLVGGA-SLKPEFVDIINSNL 250
>gi|67154729|ref|ZP_00416474.1| Triosephosphate isomerase [Azotobacter vinelandii AvOP] >gi|67088862|gb|EAM08328.1| Triosephosphate isomerase [Azotobacter vinelandii AvOP] (246 aa)
Score = 177, Expect = 3.1e-11, Identities = 63/230 (27%), Positives = 99/230 (43%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-PNFENVK---VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K++I NWKMN    +  +  + + P    VK   V V P +  +     + + + V + AQN+     G  TG V    L++ G +   +GH + +  F E +  V  K +  L+ G+  VL + ET     + ST+  +  Q+  +   +    I   V I Y+P +          E      R IR  L        A   PILYGG +  D+   +    D+DG LI
  S:     1 MRGKLVIGNWKMNGSLDANRRLLQELLPPLAAVKGLEVAVCPPFPYLAQVGALLEGSSVALGAQNLHSAGQGAFTGEVGAGMLEELGCRYVLVGHSERRSLFGESDETVAEKFEAALRAGLVPVLCVGETLAQRRDGSTEAVIAGQVRAVLQRVGGAGIAAGV-IAYEPVWAIGTGETASPEQAQAVHRHIRALLGE------ATATPILYGGSVKPDNAAALFAQPDIDGGLI 227
>gi|20140681|sp|Q93GB7|TPIS_LACDL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) (Lactacin B inducer protein) (IP) >gi|15865598|gb|AAL09962.1|AF288619_1 triosephosphate isomerase [Lactobacillus delbrueckii subsp. lactis] (252 aa)
Score = 177, Expect = 3.2e-11, Identities = 54/243 (22%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R  I+  NWK+N +     +F       +P+   V+ ++    + +   L  ++ + + V A+N  + + G  TG  S   LK+ G++   +GH + +  F E +  +N K + +  NG+  +L   E+         KE +  QI     G+ + + V ++ I Y+P +         ++      + IRE ++  +    A N+ I YGG +   +I+E+    ++DG L+     + + Y++++
  S:     3 RTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNLHVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFANGLTPILCCGESLEIREAGKEKEWVVSQIKADLEGLTS-EQVSKLVIAYEPIWAIGTGKTASSDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANIKELMAKPNIDGGLVGGASLVPDSYLALV 248
>gi|54020428|ref|YP_115790.1| triosephosphate isomerase [Mycoplasma hyopneumoniae 232] >gi|71893458|ref|YP_278904.1| triosephosphate isomerase [Mycoplasma hyopneumoniae J] >gi|123645974|sp|Q4AAM8|TPIS_MYCHJ Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|76363862|sp|P0C0J6|TPIS_MYCH2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|76363863|sp|P0C0J5|TPIS_MYCHY Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|1113131|gb|AAA83219.1| triosephosphate isomerase >gi|53987601|gb|AAV27802.1| triosephosphate isomerase [Mycoplasma hyopneumoniae 232] >gi|71851585|gb|AAZ44193.1| triosephosphate isomerase [Mycoplasma hyopneumoniae J] (242 aa)
Score = 177, Expect = 3.2e-11, Identities = 63/228 (27%), Positives = 111/228 (48%)
  Q:     3 EKILITNWKMNADYVSISKFFKNIPNF---------ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +KI+I NWKMN        F +    F         E++   +APS++ +   +  S   K+E+ AQN+S    G  TG +S   L+D G K   +GH + +  FKEK+ ++  K+ +  K  +  V  + E+ ++     TK+ +  QIN I + ++      +  I Y+P +    G+  +    E + G I       +  FG     N  ++YGG + + +I E+     +DG L+
  S:     2 KKIIIGNWKMNKTVSETRDFIQKFDIFYQENVGKIKEDLDFAIAPSFISL-SLISKSLTKKLEIAAQNLSQFDSGAFTGEISGKMLQDLGTKYVIIGHSERREIFKEKDEELKNKILQAQKYDLIPVFCVGESLLEFEAGLTKKVIISQINAIKSVLN----FQKAIIAYEPIWAIGTGKTATAAIAEKVCGLI-------KENFG----KNTMVIYGGSVNSKNINELVSQKSIDGALV 225
>gi|192358825|ref|YP_001980709.1| triosephosphate isomerase [Cellvibrio japonicus Ueda107] >gi|190684990|gb|ACE82668.1| triosephosphate isomerase [Cellvibrio japonicus Ueda107] (256 aa)
Score = 177, Expect = 3.3e-11, Identities = 58/229 (25%), Positives = 107/229 (46%)
  Q:     2 REKILITNWKMNADY----VSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDR-VYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+I NWK+N        S++ F   I    + ++ + P YL +   +   + +++++ +QNVS    G +TG  S   LK  G     +GH + +  F E N     K++  L +G+  VL + E + +     T+E L  Q+++   G+  +++  R + I Y+P +                 + IR  L   F    A  + ILYGG +   +  ++    D+DG+L+
  S:     4 RKPIVIANWKLNGGLDLICTSVASF---IGKHVDAQIAICPPYLYMRDMMTFLQFSELQIGSQNVSRYESGAYTGETSAQMLKQAGCSLCLIGHSERRAMFAENNEGCQIKVRTALNHGLLPVLCVGENQAEREANITEEVLYKQLSE---GLANIELNGRDLCIAYEPVWAIGTGLAATPAIAQSVHQYIRAELARIFDADSAARVRILYGGSVNKTNARDLLLQEDIDGLLV 231
>gi|115399504|ref|XP_001215341.1| triosephosphate isomerase [Aspergillus terreus NIH2624] >gi|114192224|gb|EAU33924.1| triosephosphate isomerase [Aspergillus terreus NIH2624] (249 aa)
Score = 177, Expect = 3.3e-11, Identities = 58/222 (26%), Positives = 108/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI+   KN+ + +   + +V+++P  L ++ +  ++ N+ + V AQNV     G  TG +S  +L+D  I    +GH + +V  KE +  +  K++  +  G++ +  I ET  +     T + +  Q+N +   +   +   +V I Y+P +          E        IR++L       V++N  I+YGG +   +  E+ K  DVDG L+
  S:    10 NFKMNGTADSITSIIKNLNDAKLDSSSEVVISPPALYLLLAREVA-NSNIGVAAQNVFDKPNGAFTGEISVEQLRDAKIDWTLIGHSERRVILKESDEFIARKVKAAIDGGVSVIFCIGETLEEREAGKTIDVVTRQLNAVAKELSK-EQWAKVVIAYEPVWAIGTGKVATTEQAQEVHAAIRKWLTETISPEVSDNTRIIYGGSVSEKNCRELAKQPDVDGFLV 232
>gi|149277996|ref|ZP_01884135.1| triosephosphate isomerase [Pedobacter sp. BAL39] >gi|149231194|gb|EDM36574.1| triosephosphate isomerase [Pedobacter sp. BAL39] (260 aa)
Score = 177, Expect = 3.4e-11, Identities = 67/229 (29%), Positives = 104/229 (45%)
  Q:     2 REKILITNWKMNADYVSISKFFKNIPNF-------ENVKVMVAP-SYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+KI+  NWKMN DY      F  I N        + + V+ AP  +L  +  LG      V++ AQN      G +TG  S   +K  G +   +GH + +  F E +  +  K    L+NG+  +  I ET   L E +      +  +Q+ NG+  L+  D  ++ I Y+P +          E        IR+ +  K+   VA+   ILYGG     +  E+    D+DG LI
  S:     9 RKKIVAGNWKMNLDYAEGISLFSEIVNIVRDEKKGDQLAVICAPFIHLNSLAKLG---GDTVKIGAQNCHQNESGAYTGETSAKMIKSVGCEYVIIGHSERRQYFAESDELLAQKTVIALQNGLTPLFCIGET---LDERNNGTYFEVLKSQLTNGVFGLNAEDFAKIVIAYEPVWAIGTGLTATAEQAQEVHAFIRKEIAAKYDASVADATSILYGGSCNPKNAAELFAQADIDGGLI 241
>gi|51891382|ref|YP_074073.1| triosephosphate isomerase [Symbiobacterium thermophilum IAM 14863] >gi|81826255|sp|Q67SW4|TPIS_SYMTH Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|51855071|dbj|BAD39229.1| triosephosphate isomerase [Symbiobacterium thermophilum IAM 14863] (256 aa)
Score = 177, Expect = 3.4e-11, Identities = 62/230 (26%), Positives = 103/230 (44%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDAL--DIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWKM+       +F  +          V++++ P +  +    G     +V + AQN+S    G  TG VS   L D G +   LGH + +  F E +  V AK++  L++G+  +L I ET   L E+   E   +   Q+  G++ L  + V  + I Y+P +        D       I  +R  +   FG   A  + I YGG +  +++       D+DG L+
  S:     1 MRTPIVAANWKMHKTQPEARQFLADFLPREAGMSGVEIVICPPFTALAAVAGGLTGTRVGLGAQNMSDKPSGAFTGEVSGAMLVDAGCRYVILGHSERRRLFGESDEVVGAKVRAALQHGLIPILCIGET---LEEQQAGEADAVNRRQLLAGLEGLTPEQVANLVIAYEPVWAIGTGRNCDPGDAQARIAAVRAVVAEAFGPEAAARVRIQYGGSVKPENMAAYMAQPDIDGALV 233
>gi|114330923|ref|YP_747145.1| Triose-phosphate isomerase [Nitrosomonas eutropha C91] >gi|122314160|sp|Q0AHK2|TPIS_NITEC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|114307937|gb|ABI59180.1| triosephosphate isomerase [Nitrosomonas eutropha C91] (252 aa)
Score = 177, Expect = 3.4e-11, Identities = 57/244 (23%), Positives = 111/244 (45%)
  Q:     2 REKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILY 245
           R   +  NWKM  + V     ++     IP+ +N    V   Y  +  +  + K   V    QN+S    G +TG VS   L D+G +   +GH + +  + E N  V  K     +  +  +L + ET        T++ +  Q++ +  G+  ++ + +  I Y+P +    GE  +           + +  F+R +   +   +A ++ I+YGG +  ++  E+    D+DG LI     ++ ++ISI +
  S:     3 RAGFVAGNWKMYGNLVQNQELLAAIVLGIPSLQNASCAVCVPYPYLAQAQSVLKGTHVAWGGQNISQHHQGAYTGEVSAGMLTDFGCRYVIVGHSERRTLYGEDNQMVAEKFHSAQEQSLVPILCVGETLAQREANETEQVIARQLDAVI-GLVGVNAIKQSVIAYEPVWAIGTGETATP-------QQAQDVHAFVRNRIAAHNSEIAADIQIVYGGSVKANNASELFAMPDIDGGLIGGASLVAAEFISICF 248
>gi|196016205|ref|XP_002117956.1| hypothetical protein TRIADDRAFT_38509 [Trichoplax adhaerens] >gi|190579429|gb|EDV19524.1| hypothetical protein TRIADDRAFT_38509 [Trichoplax adhaerens] (248 aa)
Score = 176, Expect = 3.6e-11, Identities = 62/229 (27%), Positives = 103/229 (44%)
  Q:     2 REKILITNWKMNADYVSIS---KFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R+ I+  NWKMN    SI    +F K  P  E+ +V+V P ++  +  +  +   KV + AQN  + S G  TG +S     D G +   LGH + +  F E +  +  K+   L +G+  +  I E   +  E  T + L  QI  I + I       +V I Y+P +          +        +R +L+      VA +  I+YGG +   + +++    DVDG L+
  S:     4 RKFIVGGNWKMNGSRESIDGIIQFLKQGPLNESTEVVVGPPFV-YLSYVKENLPDKVSIAAQNCYYASKGAFTGEISAEMAVDIGCEWVILGHSERRNVFGETDEIIGKKVAHALTSGLKVIACIGELLSEREEGRTFDVLSRQIKAIADNISDW---SKVVIAYEPVWAIGTGKTATPQQAQQVHLQLRNWLKEHISDSVAASCRIMYGGSVNAGNCKDLAVQPDVDGFLV 231
>gi|170077220|ref|YP_001733858.1| triosephosphate isomerase [Synechococcus sp. PCC 7002] >gi|169884889|gb|ACA98602.1| triosephosphate isomerase [Synechococcus sp. PCC 7002] (241 aa)
Score = 176, Expect = 3.7e-11, Identities = 62/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSY--LGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ I+  NWKM         F K +      + E  +V++   +  LG+     MSK+    +V + AQN+ +   G  TG +S   L + G++   +GH + +  F E +  VN +L+   ++G+  +L + E+K       T+  +  Q+ Q    ID  ++V    + Y+P +        D       I +IRE L  K       N+ I YGG +  ++++EI    ++DG L+
  S:     1 MRKIIIAGNWKMYKTQAESLDFLKALLPKIADDHEEREVVLCTPFTDLGL-----MSKSLHGTRVRLGAQNIHWADEGAFTGEISGSMLTEMGVRYVIVGHSERRQYFGETDETVNQRLKAAQRHGLTPILCVGESKAQRDAGETEAVIFAQLEQDLVDIDQNNLV----VAYEPIWAIGTGDTCDATEANRVIGLIREKLTNK-------NVTIQYGGSVKPNNVDEIMAQPEIDGALV 224
>gi|15674692|ref|NP_268866.1| triosephosphate isomerase [Streptococcus pyogenes M1 GAS] >gi|21909969|ref|NP_664237.1| triosephosphate isomerase [Streptococcus pyogenes MGAS315] >gi|28896334|ref|NP_802684.1| triosephosphate isomerase [Streptococcus pyogenes SSI-1] >gi|56808524|ref|ZP_00366260.1| COG0149: Triosephosphate isomerase [Streptococcus pyogenes M49 591] >gi|71903154|ref|YP_279957.1| triosephosphate isomerase [Streptococcus pyogenes MGAS6180] >gi|71910322|ref|YP_281872.1| triosephosphate isomerase [Streptococcus pyogenes MGAS5005] >gi|94988130|ref|YP_596231.1| triosephosphate isomerase [Streptococcus pyogenes MGAS9429] >gi|94992018|ref|YP_600117.1| triosephosphate isomerase [Streptococcus pyogenes MGAS2096] >gi|123640232|sp|Q48UK4|TPIS_STRPM Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|160196649|sp|Q1JCT5|TPIS_STRPB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|160196650|sp|Q1JMR2|TPIS_STRPC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56755037|sp|P69887|TPIS_STRP1 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|56755038|sp|P69888|TPIS_STRP3 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|13621811|gb|AAK33587.1| putative triosephosphate isomerase [Streptococcus pyogenes M1 GAS] >gi|21904158|gb|AAM79040.1| putative triosephosphate isomerase [Streptococcus pyogenes MGAS315] >gi|28811585|dbj|BAC64517.1| putative triosephosphate isomerase [Streptococcus pyogenes SSI-1] >gi|71802249|gb|AAX71602.1| triosephosphate isomerase [Streptococcus pyogenes MGAS6180] >gi|71853104|gb|AAZ51127.1| triosephosphate isomerase [Streptococcus pyogenes MGAS5005] >gi|94541638|gb|ABF31687.1| triosephosphate isomerase [Streptococcus pyogenes MGAS9429] >gi|94545526|gb|ABF35573.1| Triosephosphate isomerase [Streptococcus pyogenes MGAS2096] (252 aa)
Score = 176, Expect = 3.7e-11, Identities = 56/243 (23%), Positives = 114/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+ A  +   V + Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++++     DVDG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLV-LAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEADSFLALL 248
>gi|171913373|ref|ZP_02928843.1| triosephosphate isomerase [Verrucomicrobium spinosum DSM 4136] (271 aa)
Score = 176, Expect = 3.8e-11, Identities = 72/243 (29%), Positives = 117/243 (48%)
  Q:     2 REKILITNWKMNADYVSISKFFKN----IPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVV---AQNVS-FPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN       KF +     +P    V+V+V PS++ +  +  + +  + EVV   AQN+S +PS G +TG  S L LK+ G++   LGH + +  F E N  VNAK+   L+  ++ +L + ET  +      ++ L  Q  +    + +  + D V I Y+P +          E        IR+ L   F    A  + I YGG +   +++EI    DVDG L+      S  +  I+
  S:     6 RKPIVAANWKMNNPPSETEKFLRAFLRLMPEKSPVQVVVVPSFVSLSLAQTLIQGGRTEVVELGAQNMSQYPS-GAYTGETSALMLKECGVRHVILGHSERRALFGETNQIVNAKVIAALEARLHPILCVGETLEERDGGRIEQVLESQTRESLANVGSRRLQD-VVIAYEPVWAIGTGRTASPEQAQEAHAFIRKVLGEMFDADTAQKIRIQYGGSVKPSNMDEIIAMPDVDGALVGGASLESGSFYEIV 254
>gi|156100529|ref|XP_001615992.1| triosephosphate isomerase, putative [Plasmodium vivax SaI-1] >gi|148804866|gb|EDL46265.1| triosephosphate isomerase, putative [Plasmodium vivax] (248 aa)
Score = 176, Expect = 3.9e-11, Identities = 66/243 (27%), Positives = 109/243 (44%)
  Q:     2 REKILITNWKMNADYVSISKFFK--NIPNFENVKVMVAPSYLGIVPSLGMSK-NAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+  +  NWK N    S+       N  +F+  K+ V    + +   L  S    K     QNVS    G++TG +S    KD  I+   +GH + +  F E +  V  KLQ+ LKN +  V+   E+     +  T + +  Q+N   + ID     D V + Y+P +          E      + IR  ++ K G   AN + ILYGG +  D+   + K  D+DG L+ +  +L + ++ I+
  S:     3 RKYFVSANWKCNGTQESVKALAASFNELDFDPAKLDVVVFPVSVHYELAKSLLKPKFHTGIQNVSKFGSGSYTGEISAEIAKDLNIEYVIIGHFERRKYFNETDEDVKDKLQQCLKNNLKVVVCFGESLEQREKNQTIDVITKQVNSFVHLIDNF---DNVVLAYEPIWAIGTGKTATPEQAQEVHKEIRNIVKEKCGEKNANQIRILYGGSVNTDNCASLIKQEDIDGFLVGNA-SLKSSFVEII 244
>gi|78223155|ref|YP_384902.1| triosephosphate isomerase [Geobacter metallireducens GS-15] >gi|123571733|sp|Q39U97|TPIS_GEOMG Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|78194410|gb|ABB32177.1| triosephosphate isomerase [Geobacter metallireducens GS-15] (251 aa)
Score = 176, Expect = 3.9e-11, Identities = 57/230 (24%), Positives = 102/230 (44%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR  I+  NWK+         F    IP  +   +V++++AP +  +        +  + + AQ+  +   G  TG +S   L D G     +GH + +  F E +  VN K++  +  G+  +  I ET  +   + T E LR QI     G+   D+  ++ I Y+P +         +E        IR+ +   F   +A  + ILYGG +  +++  +    D+DG L+
  S:     1 MRTPIIAGNWKLFKKSSEAQDFVAELIPLVQKTTDVEIVIAPVFTVLSAVKRAIADCNIMLSAQDCFWEEEGAFTGEISPGMLVDAGCSHVIIGHSERRQYFGETDETVNRKIKAAITAGLTVLFCIGETLAEREADKTFEVLRTQIENGLAGLARGDLA-KIVIAYEPVWAIGTGKTATDEQAQIAHAFIRKVVGELFTVQIAETIRILYGGSVKPENVRGLMNQPDIDGALV 233
>gi|37520609|ref|NP_923986.1| triosephosphate isomerase [Gloeobacter violaceus PCC 7421] >gi|39932271|sp|Q7NLT1|TPIS_GLOVI Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|35211603|dbj|BAC88981.1| triosephosphate isomerase [Gloeobacter violaceus PCC 7421] (240 aa)
Score = 176, Expect = 4.1e-11, Identities = 60/230 (26%), Positives = 110/230 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR K+L  NWKM         F +       P  EN +V++   +  +   L  ++     V AQNV +   G +TG ++   L + G+    +GH + +  F E +  VN +L     + +  +L + ET+    +  T+ ++R Q+++       L++VD  R+ I Y+P +    G+     +   +   IR    F            +PILYGG +  ++I+E+   +D+DG+L+
  S:     1 MRRKVLAGNWKMYKTRGEARAFLEAFVPLISPGAENREVILCGPFTCL--DLLSAQAGPYAVGAQNVHWADHGAYTGEIAPQMLVELGVHYVIVGHSERREYFNETDSTVNRRLNNAQDHDLVPILCVGETESVRKDGITEAHIRSQLDR------DLELVDMRRLIIAYEPIWAIGTGKTCEANEANRVCAMIRKHVNF----------EGVPILYGGSVKPENIDELMAQSDIDGVLV 222
>gi|62184937|ref|YP_219722.1| triosephosphate isomerase [Chlamydophila abortus S26/3] >gi|81312891|sp|Q5L6H0|TPIS_CHLAB Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|62148004|emb|CAH63755.1| triosephosphate isomerase [Chlamydophila abortus S26/3] (254 aa)
Score = 176, Expect = 4.2e-11, Identities = 71/229 (31%), Positives = 113/229 (49%)
  Q:     2 REKILITNWKMNA------DYVSISKFFKNIPNFENVKVMVAP-SYLGIVPSLGMSKNAKVEVV----------AQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           R++ +  NWKM+       DY+S+       P  E V    AP S +GI P+   + +A  E +          AQNV   + G  TG +S   LK++ +    LGH + +  F E++  +  K+    + G+  VL I ET +++ E+   E   +  NQ+  G+  L     V I Y+P +    G++ S  D +         RE L   F    A  + ILYGG +  D+ E   +  DVDG+L+
  S:     3 RKRYIFGNWKMHKTAKEAKDYLSVF-----CPLLEEV----APVSCVGITPAF-TALHACCESIKFFHSPLWLGAQNVHQDTSGAFTGEISLPMLKEFDVNFVLLGHSECRHIFHEEDTTIALKVGAAAREGIIPVLCIGET-LEVREKGATE--AMLSNQLMLGLAQLPETASVIIAYEPVWAIGTGKVASAVDVQEAHA---FCREVLANIFSKEKAEEISILYGGSVKADNAEGFARCPDVDGLLV 235
>gi|150009293|ref|YP_001304036.1| triosephosphate isomerase [Parabacteroides distasonis ATCC 8503] >gi|160196515|sp|A6LFF0|TPIS_PARD8 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|149937717|gb|ABR44414.1| triosephosphate isomerase [Parabacteroides distasonis ATCC 8503] (251 aa)
Score = 176, Expect = 4.2e-11, Identities = 66/244 (27%), Positives = 111/244 (45%)
  Q:     1 MREKILITNWKMN---ADYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           MR+ I+  NWKMN   A+ ++++K        +  N  V++   +  +          K+ V A+N +    G +TG VS   +   G K   LGH + +  + E    +  K++  L NG+  +  I E    L E    ++  +   QI   +  L   D  ++ + Y+P +    G+  S    E I   IR     L  K+G  VA+N  ILYGG     + +E+    +VDG LI       +K++ I+
  S:     1 MRKNIVAGNWKMNTTLAEGLALAKGLDEALKGKTPNCDVIIGTPFTHLASVAAAIDTNKIGVAAENCADKEKGAYTGEVSAAMVASTGAKYVILGHSERRAYYHETPEILKTKVELALANGLTPIFCIGEV---LEEREAGKHFEVVDAQIAGSLFDLSAEDFGKIILAYEPVWAIGTGKTASAEQAEEIHAHIRAT---LAAKYGNEVADNCTILYGGSCNAGNAKELFAKPNVDGGLIGGASLAVDKFMPII 248
>gi|88860507|ref|ZP_01135145.1| triosephosphate isomerase [Pseudoalteromonas tunicata D2] >gi|88817705|gb|EAR27522.1| triosephosphate isomerase [Pseudoalteromonas tunicata D2] (249 aa)
Score = 176, Expect = 4.3e-11, Identities = 61/243 (25%), Positives = 115/243 (47%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNFE--NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYY---VANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISI 243
           +R++++  NWKMN     +++    I   E   V V+V P Y    P L  +   ++ V AQ+VS    G +TG +    L + G K   +GH + +  + E +  V +K Q+    G+  VL + E++ +  +  T+  +  QI+ + N +  + +V  V I Y+P +          E      + + +F+R K       V+ +L +LYGG +   + E +    D+DG L+       + +++I
  S:     3 LRKQMVAGNWKMNGSVELVNQIANAISAVELDKVDVVVFPPY----PLLNNALQNELVVGAQSVSEHEAGAYTGEIDAQLLAELGCKYTLVGHSERRSIYGESDEVVASKFQRAQCQGLIPVLCVGESEQEREQNLTESVVSRQIDAVINKLGVVSLVKSV-IAYEPVWAIGTGKTATPE----QAQQVHKFIRDKIASLDDAVSQSLILLYGGSVNEKNSELLFAQPDIDGGLVGGASLNPDSFVNI 241
>gi|94990012|ref|YP_598112.1| triosephosphate isomerase [Streptococcus pyogenes MGAS10270] >gi|160196651|sp|Q1JHV5|TPIS_STRPD Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|94543520|gb|ABF33568.1| Triosephosphate isomerase [Streptococcus pyogenes MGAS10270] (252 aa)
Score = 176, Expect = 4.4e-11, Identities = 56/243 (23%), Positives = 114/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+ A  +   V + Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++++     DVDG L+      ++ ++++L
  S:     3 RKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIESAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLV-LAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEADSFLALL 248
>gi|113967769|gb|ABI49147.1| triosephosphate isomerase [Trimastix pyriformis] (256 aa)
Score = 176, Expect = 4.4e-11, Identities = 63/222 (28%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNI-----PNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQI---FNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N    S+     ++     P  E   ++++P YL  + ++      +V V AQ+ +   +G +TGS+S   L ++GI T  LGH + +  F E + +V  K +K L  G++ V  I E +        +E L  + N+I        A  I D   V + Y+P +    G + +    +    T   +R + R      VAN + I+YGG +   +  E+ +  DVDG L+
  S:    12 NWKCNGTRASVEALITSLNAATLPAPEAADIVISPPYL-FLETVQARIRPEVHVAAQDCNAKGMGAYTGSISAEMLHEFGINTVILGHSERRDIFHETSEEVALKCKKALSLGLDIVPCIGEHR--------EERLSGRTNEICFAQLAALAAQITDWSHVVVAYEPVWAIGTGLVATPAQAQ---ETHAALRGWFREHVSAEVANTIRIVYGGSVSGANSAELARCPDVDGFLV 234
>gi|13431949|sp|Q9M4S8|TPIC_FRAAN Triosephosphate isomerase, chloroplast precursor (TIM) (Triose-phosphate isomerase) >gi|7650502|gb|AAF66071.1|AF257322_1 triosephosphate isomerase [Fragaria x ananassa] (314 aa)
Score = 176, Expect = 4.6e-11, Identities = 59/222 (26%), Positives = 102/222 (45%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           NWK N     ISK   ++ + +   +V V+VAP +L  +  +  S   ++E+  QN      G  TG +S  +LKD G K   LGH + +    E +  +  K    L  G+  +  I E    L E    +   +   Q+    DA+   + + + Y+P +    G++ S    + +      +RE+L+      VA+   I+YGG +   +  E+ K  D+DG L+
  S:    70 NWKCNGTKDLISKLVSDLNSAKLEPDVDVVVAPPFL-YLDQVKSSLTDRIEISGQNSWVAKGGAFTGEISVEQLKDIGRKWVILGHSERRHVIGEDDQFIGKKAAYALNEGLGVIACIGEK---LEEREAGKTFDVCYEQLKAFADAVPSWENIVVAYEPVWAIGTGKVASPQQAQEVH---VAVREWLKKNVSAEVASKTRIIYGGSVNGGNSAELAKEEDIDGFLV 290
>gi|157413408|ref|YP_001484274.1| triosephosphate isomerase [Prochlorococcus marinus str. MIT 9215] >gi|166988101|sp|A8G507|TPIS_PROM2 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|157387983|gb|ABV50688.1| Triosephosphate isomerase [Prochlorococcus marinus str. MIT 9215] (241 aa)
Score = 175, Expect = 4.6e-11, Identities = 57/230 (24%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENVK----VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+        + +  IP  +N+K    V++AP +  I      S    +++ +QN+ +   G  T  +S   L ++G+  A +GH + +  F E + Q+N +      +G+  ++ + ET   L +    E  R+   Q+  G++  D  + + + Y+P +    G+     D   I   IR +  F          +++ I YGG +  ++I+EI   +D+DG+L+
  S:     1 MRKSVIAGNWKMHMTCAEAKSYLEEFIPLIKNIKDDRKVVIAPPFTAISTFSNHSDFDYLDISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSSGLTPIVCVGET---LEQRERGEADRIITRQVEQGLENTDPSNLI-VAYEPIWAIGTGKTCEAEDANKICSLIRKLIGF----------DDVIIQYGGSVKPNNIDEIMSMSDIDGVLV 224
>gi|85091767|ref|XP_959063.1| triosephosphate isomerase [Neurospora crassa OR74A] >gi|52783452|sp|Q7S2Z9|TPIS_NEUCR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|28920460|gb|EAA29827.1| triosephosphate isomerase [Neurospora crassa OR74A] (248 aa)
Score = 175, Expect = 4.7e-11, Identities = 66/240 (27%), Positives = 113/240 (47%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYKHL 248
           N+KMN     +     N+ N +   N +V++AP   YL  V       N  VEV AQNV     G  TG +S  +L D G+K   LGH + + +  E +  + +K +  L NG++ +    E+K         E ++   NQ+      ++    V I Y+P +    G + +K   + +      IR +L+      VA    ILYGG +   + +++ K  D+DG L+    +L  +++ I+  +L
  S:    10 NFKMNGTRKDLKAIVDNLNNAQLDPNAEVVIAPPALYLDFVKQNLQKPN--VEVAAQNVFNKPNGAFTGEISATQLLDLGVKWVILGHSERRNELGESDEFIASKTKYALDNGISVIWCCGESK---DTRQAGETIKFVENQLAALAKEINDWKNVVIAYEPIWAIGTGLVATKEQAQEVHAA---IRSWLKQNVSDKVAEETRILYGGSVNAKNCKDLAKEQDIDGFLVGGA-SLKPEFVDIINANL 248
>gi|86360774|ref|YP_472661.1| triosephosphate isomerase [Rhizobium etli CFN 42] >gi|97202973|sp|Q2JZQ2|TPIS2_RHIEC Triosephosphate isomerase 2 (TIM 2) (Triose-phosphate isomerase 2) >gi|86284876|gb|ABC93934.1| triosephosphate isomerase protein [Rhizobium etli CFN 42] (267 aa)
Score = 175, Expect = 4.8e-11, Identities = 61/239 (25%), Positives = 107/239 (44%)
  Q:     8 TNWKMNADYVSISKFFKNIPNFE-----NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINS-KFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISILYK 246
           T++KMN        F + + + +      V+  V PS+  +     +   + V+V AQN+ +   G  TG +S L LKD  +    LGH + +  F E +  V  K    +++G+  ++ I ET  + +E      LR Q+     G+D       + + Y+P +   +N      ++     R I E  ++  G  V    P+LYGG +   + EE+    D+DG+ I         Y+ IL +
  S:     7 TSFKMNKTLEEALAFARRLADADLERDPRVQRFVIPSFTAVREVKRVLTESSVKVGAQNMHWEDAGAWTGEISPLMLKDCRLDLVELGHSERREHFGETDETVGLKAAAAIRHGLTPLICIGETLQERNEGRADAVLRRQVEAALRGVDTEAGEAPILLAYEPVWAIGVNGIPATADYASERHRGIAEVAKSILGRPV----PVLYGGSVNPGNCEELIGQPDIDGLFIGRSAWSVEGYLDILAR 247
>gi|52783468|sp|Q96VN5|TPIS_PARBR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|40805818|gb|AAP02959.2| triose phosphate isomerase [Paracoccidioides brasiliensis] >gi|41614796|gb|AAK71466.2| triosephosphate isomerase [Paracoccidioides brasiliensis] (249 aa)
Score = 175, Expect = 4.8e-11, Identities = 56/222 (25%), Positives = 111/222 (50%)
  Q:     9 NWKMNADYVSISKFFKNIPNFE---NVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN    SI+    N+ + +   + ++++AP  + +V +  ++ N +V V AQNV     G  TG +S  +L+D  I     GH + +V  +E +  V  K +  +  G+N +L I E+  +     T + +  Q++ +   +   +  ++V I Y+P +    G++ +    + +  +   IR++L  K     A N  ++YGG +   +  ++    DVDG L+
  S:    10 NFKMNGTAKSITHIITNLNSAKLDPSTEIVIAPPAIYLVLARQLA-NGQVAVSAQNVFDKPNGAFTGELSVEQLRDEKITWTLAGHSERRVLLREDDEFVARKTKAAINGGLNVILCIGESLEEREAGKTIDVVTRQLDAVAEEVSPAEW-NKVVIAYEPIWAIGTGKVATTEQAQEVHAS---IRKWLNEKISPEAAENTRVIYGGSVTESNCRDLAAQPDVDGFLV 232
>gi|67541460|ref|XP_664504.1| TPIS_EMENI TRIOSEPHOSPHATE ISOMERASE (TIM) [Aspergillus nidulans FGSC A4] >gi|136053|sp|P04828|TPIS_EMENI Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|217921|dbj|BAA00908.1| triosephosphate isomerase [Emericella nidulans] >gi|40739109|gb|EAA58299.1| TPIS_EMENI TRIOSEPHOSPHATE ISOMERASE (TIM) [Aspergillus nidulans FGSC A4] (249 aa)
Score = 175, Expect = 4.9e-11, Identities = 57/222 (25%), Positives = 107/222 (48%)
  Q:     9 NWKMNADYVSISKFFKNIPNF---ENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           N+KMN +  S +   KN+ +    ++V+V+V+P  L ++ +  ++ N ++ V AQNV     G  TG +S  +L++  I    LGH + +V  KE +  +  K +  ++ G+  +  I ET  +     T + +  Q+N     +   +   +V I Y+P +          E        IR++L+       A N  I+YGG +   + +++ K  D+DG L+
  S:    10 NFKMNGNAESTTSIIKNLNSANLDKSVEVVVSPPALYLLQAREVA-NKEIGVAAQNVFDKPNGAFTGEISVQQLREANIDWTILGHSERRVILKETDEFIARKTKAAIEGGLQVIFCIGETLEEREANKTIDVVTRQLNAAAKELSK-EQWAKVVIAYEPVWAIGTGKVATTEQAQEVHSAIRKWLKDAISAEAAENTRIIYGGSVSEKNCKDLAKEADIDGFLV 232
>gi|139474179|ref|YP_001128895.1| triosephosphate isomerase [Streptococcus pyogenes str. Manfredo] >gi|160196653|sp|A2RFQ3|TPIS_STRPG Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|134272426|emb|CAM30682.1| triosephosphate isomerase [Streptococcus pyogenes str. Manfredo] (252 aa)
Score = 175, Expect = 4.9e-11, Identities = 56/243 (23%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+ A  +   V + Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++++     DVDG L+      +  ++++L
  S:     3 RKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLV-LAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEAGSFLALL 248
>gi|197088079|gb|ACH39350.1| triosephosphate isomerase [Geobacter bemidjiensis Bem] (251 aa)
Score = 175, Expect = 4.9e-11, Identities = 61/230 (26%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKM----NADYVSISKFFKNIPNFENVKVMVAPSYLGIVPSLGMS-KNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD--RVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWK+    N     I +    +   ++V+++VAP +  ++P+L  +     + + AQ+V +   G  TG VS   L D G     +GH + +  F E    VN K++  LK  +  ++ I ET   L      +  ++   Q+  G++ L       V + Y+P +    G++ S    +     IR +   L   FG   A+ + ILYGG +  D+++ +    D+DG L+
  S:     1 MRKPVIAGNWKLFKTKNEALALIEELAPLVSGVDSVEIVVAPVFT-VLPTLPAALAGTGISLAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETEETVNKKVKAALKGALVPIVCIGET---LEAREAGDTFKVLERQLKGGLEGLTGTQFAPVIVAYEPVWAIGTGKVASDDQAQEAHAFIRGVIAGL---FGKSAADKVRILYGGSVKPDNVKGLMSRPDIDGALV 233
>gi|116515124|ref|YP_802753.1| hypothetical protein BCc_188 [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|122285480|sp|Q057N9|TPIS_BUCCC Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|116256978|gb|ABJ90660.1| triose phosphate isomerase [Buchnera aphidicola str. Cc (Cinara cedri)] (254 aa)
Score = 175, Expect = 5.4e-11, Identities = 68/230 (29%), Positives = 118/230 (51%)
  Q:     1 MREKILITNWKMNADYVSISKFFKNIPNF-----ENVKVMVAPS--YLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF-MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           M + I++ NWK+N     I  F K +  F     +   V++AP   Y  ++ ++  S      + AQN+     G  TG +S + LKD GIK   +GH + +++ KE N  +  K   L +  +  +L I ETK +  ++ TK+  + QI+ IFN +   +  D   I Y+P + +G  NS    E +      IR ++++K  + + N   I YGG +  ++ +E+    D+DG L+
  S:     1 MIKPIIVGNWKLNGSKKLIESFLKQLNQFLIKYYKICTVVIAPPVLYSHLIQNMFSSDKKNFFLGAQNIDIHFSGPFTGEISPIMLKDIGIKYVIIGHSERRLNHKETNEIIAKKFCMLKEENLVPILCIGETKKEKIDKKTKDICKKQIDIIFN-MYGSNAFDNSIIAYEPIWSIGSGNSAAPKE-VQCIAHFIRNYVKSKSNHNIENFF-IQYGGSVTKNNAKELIYQKDIDGFLV 235
>gi|50913876|ref|YP_059848.1| triosephosphate isomerase [Streptococcus pyogenes MGAS10394] >gi|56749687|sp|Q5XD48|TPIS_STRP6 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|50902950|gb|AAT86665.1| Triosephosphate isomerase [Streptococcus pyogenes MGAS10394] (252 aa)
Score = 175, Expect = 5.4e-11, Identities = 56/243 (23%), Positives = 113/243 (46%)
  Q:     2 REKILITNWKMNADYVSISKFFK----NIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILIEDERALSNKYISIL 244
           R+ I+  NWKMN +      F +     +P+ + V V VA   + +V ++  +K++ ++V AQN  F + G  TG  S   L + G     +GH + +  F E +  +N K + +  NG+  ++   E+          E +  Q++    G+ A  +   V + Y+P +          +      + +R+ +   FG  VA+ + + YGG +  +++++     DVDG L+      +  ++++L
  S:     3 RKPIIAGNWKMNKNPQEARAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVLKVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFANGLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLV-LAYEPIWAIGTGKSATQDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLEAGSFLALL 248
>gi|126696379|ref|YP_001091265.1| triosephosphate isomerase [Prochlorococcus marinus str. MIT 9301] >gi|160196542|sp|A3PD39|TPIS_PROM0 Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|126543422|gb|ABO17664.1| Triosephosphate isomerase [Prochlorococcus marinus str. MIT 9301] (241 aa)
Score = 175, Expect = 5.5e-11, Identities = 57/230 (24%), Positives = 112/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFKN-IPNFENVK----VMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTF---MGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWKM+        + +  IP  +N+K    V++AP +  I      S    +++ +QN+ +   G  T  +S   L ++G+  A +GH + +  F E + Q+N +      +G+  ++ + ET   L +    E  R+   Q+  G++  D  + + + Y+P +    G+     D   I   IR +  F          +++ I YGG +  ++I+EI   +D+DG+L+
  S:     1 MRKSVIAGNWKMHMTCAEAKSYLEEFIPLIKNIKDDRKVVIAPPFTAISTFSDHSDFEYLDISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSSGLTPIVCVGET---LEQRERGEADRVITRQVEQGLENTDPSNLI-VAYEPIWAIGTGKTCEAEDANKICSLIRKLIGF----------DDVIIQYGGSVKPNNIDEIMSMSDIDGVLV 224
>gi|22298509|ref|NP_681756.1| triosephosphate isomerase [Thermosynechococcus elongatus BP-1] >gi|39932393|sp|Q8DKA0|TPIS_SYNEL Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|22294689|dbj|BAC08518.1| triosephosphate isomerase [Thermosynechococcus elongatus BP-1] (265 aa)
Score = 175, Expect = 5.5e-11, Identities = 63/230 (27%), Positives = 111/230 (48%)
  Q:     1 MREKILITNWKMNADYVSISKFFK-------NIPNFENVKVMVAPSYLGIVPSLGMSKN---AKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVD----RVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           +R K+L  NWKM+        F +       + P+   V + V  + L +     +SK+    +V++ AQNV +   G  TG +S   L + G++   +GH + +  F E +  VN +L+    +G+  +L + ETK   +   T+       N IF  + ALD+VD     + I Y+P +        +       I +IR  L          ++PI YGG +  ++I+ I    ++DG+L+
  S:    23 VRPKVLAGNWKMHKTQQEAVAFLQEFLGELVDTPSDREVVLCVPYTCLSV-----LSKSLHGTRVKLGAQNVHWADQGAFTGEISPPMLVELGVRYVIIGHSERRQYFGETDATVNQRLRAAQSHGLTPILCVGETKAQRAAGETE-------NHIFQQL-ALDLVDVDQTNLVIAYEPIWAIGTGDTCEETEANRVIGLIRSQLHNP-------DVPIQYGGSVNANNIDAIMAQPEIDGVLV 246
>gi|148264116|ref|YP_001230822.1| Triose-phosphate isomerase [Geobacter uraniireducens Rf4] >gi|189036011|sp|A5G381|TPIS_GEOUR Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) >gi|146397616|gb|ABQ26249.1| triosephosphate isomerase [Geobacter uraniireducens Rf4] (251 aa)
Score = 175, Expect = 5.6e-11, Identities = 58/230 (25%), Positives = 102/230 (44%)
  Q:     1 MREKILITNWKMNADYVS----ISKFFKNIPNFENVKVMVAPSYLGIVPSLGMSKNAKVEVVAQNVSFPSLGNHTGSVSWLELKDYGIKTAFLGHPDVKVDFKEKNYQVNAKLQKLLKNGMNAVLFIEETKVDLSEESTKENLRLQINQIFNGIDALDIVDRVYIVYKPTFMGEINSKFDNEFIFGTIRVIREFLRTKFGYYVANNLPILYGGEIINDDIEEICKNNDVDGILI 230
           MR+ ++  NWK+          +++    + N   V+++VAP +  +       K   + + AQ+  +   G +TG VS   L D G     +GH + +  F E +  VN K    L+ G+  +  I ET  +  E  T   L  QI+   +GI   D +  V I Y+P +         ++      + IR  +        A N+ ILYGG +  ++++ +    D+DG L+
  S:     1 MRKPVIAGNWKLYKTTSEALELVNELIPLVKNASGVEIVVAPVFTVLSTVKNALKGTNINLAAQDCFWDEQGAYTGEVSSTMLLDAGCSHVIIGHSERRQFFGETDETVNKKNIAALRAGLTILFCIGETLHEREENQTFTVLERQISGGISGITK-DELKNVIIAYEPVWAIGTGKTATDDQAQEAHKFIRGVVAKLCDSESAENIRILYGGSVKPENVKGLMAQKDIDGALV 233