>gi|26553474|ref|NP_757408.1| cysteinyl-tRNA synthetase [Mycoplasma penetrans HF-2] >gi|61216349|sp|Q8EX28|SYC_MYCPE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|26453480|dbj|BAC43812.1| cysteinyl-tRNA synthetase [Mycoplasma penetrans HF-2] (439 aa)
Score = 1982, Expect = 0.0e+00, Identities = 439/439 (100%), Positives = 439/439 (100%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL
  S:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
>gi|188524105|ref|ZP_03004185.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530862|ref|ZP_03005155.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867746|ref|ZP_03079747.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660058|gb|EDX53438.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660601|gb|EDX53857.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (436 aa)
Score = 849, Expect = 7.1e-89, Identities = 200/439 (45%), Positives = 285/439 (64%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLN--IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLR-NKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S ++K V +  K I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I NYIQK+++ +  Y V  DVYFDT K+  YG++S + L+  +VG + E+ + K NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +N+NN+KMSKSL+NFIL KDLL++Y+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    ++ +H +      +    FD+     + ++ +   IV  I   +K  + L++ NKN  EL      L Y+L  ILGI  ++L +DE + LLN W     +K+++++D+ RK L+   +L
  S:     1 MKLYD--SYSNKLVEISDKLISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIETKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIINYIQKLIDKQAGYFVGDDVYFDTKKALNYGQLSKRDLENDIVGMRIENVVNKRNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINAYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNVNNEKMSKSLNNFILVKDLLAQYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEIFKIKNTIYNAKNYLYFNHELKSLVPIDHFKPFDEL----INDDLDFVGIVDLIHISVKKINTLIKENKNINELKLNLVQLLYML-DILGIEFIDLHNDENLALLNAWKNYVDKKDYTKADELRKELINIGIL 436
>gi|171920807|ref|ZP_02695358.2| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188568723|ref|ZP_03005477.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 2] >gi|171903571|gb|EDT49860.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (436 aa)
Score = 848, Expect = 8.3e-89, Identities = 199/439 (45%), Positives = 287/439 (65%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLL--TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S +++ V ++ + I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I +YIQK+++ +  Y +  DVYFDT K+  YG++S + L+  +VG + E    K+NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +NINN+KMSKSL+NFIL KDLL+EY+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    K++L    +      + D   L +  + ++ +   IV  I   +K  +IL++    +++N+L  NL+ LL    ILGI  V+L +DE + LLN W     +K++ ++D+ RK L+   +L
  S:     1 MKLYD--SYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIIDYIQKLIDKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRIESAANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNINNEKMSKSLNNFILVKDLLAEYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNA---KNYLYFNHQLKSLT-QIDHFGLFDERINDDLDFVGIVDLIHISVKKINILIKKN--KDMNELKLNLTQLLYMLDILGINFVDLHNDENLALLNTWKNYVDKKDYVKADELRKQLINIGIL 436
>gi|185178726|ref|ZP_02964542.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024163|ref|ZP_02996889.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039644|ref|ZP_02998349.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 8] >gi|188518554|ref|ZP_03004015.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|184209327|gb|EDU06370.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018795|gb|EDU56835.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997891|gb|EDU66988.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (436 aa)
Score = 847, Expect = 1.0e-88, Identities = 199/439 (45%), Positives = 287/439 (65%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLL--TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S +++ V ++ + I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I +YIQK+++ +  Y +  DVYFDT K+  YG++S + L+  +VG + E    K+NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +NINN+KMSKSL+NFIL KDLL+EY+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    K++L    +      + D   L +  + ++ +   IV  I   +K  +IL++    +++N+L  NL+ LL    ILGI  V+L +DE + LLN W     +K++ ++D+ RK L+   +L
  S:     1 MKLYD--SYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIIDYIQKLIDKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRIESAANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNINNEKMSKSLNNFILVKDLLAEYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNA---KNYLYFNHQLKSLT-QIDHFRLFDERINDDLDFVGIVDLIHISVKKINILIKKN--KDMNELKLNLTQLLYMLDILGINFVDLHNDENLALLNTWKNYVDKKDYVKADELRKQLINIGIL 436
>gi|188592537|ref|ZP_03005862.1| cysteinyl-tRNA synthetase [Ureaplasma urealyticum serovar 10] (436 aa)
Score = 846, Expect = 1.3e-88, Identities = 198/439 (45%), Positives = 287/439 (65%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLN--IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLL--TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S +++ V ++ + I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I +YIQK+++ +  Y +  DVYFDT K+  YG++S + L+  +VG + E    K+NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +NINN+KMSKSL+NFIL KDLL+EY+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    ++ +H +      +    FD+     + ++ +   IV  I   +K  +IL++    +++N+L  NL+ LL    ILGI  V+L +DE + LLN W     +K++ ++D+ RK L+   +L
  S:     1 MKLYD--SYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIIDYIQKLIDKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRIESAANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNINNEKMSKSLNNFILVKDLLAEYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNAKNYLYFNHQLKSLTQIDHFGFFDE----RINDDLDFVGIVDLIHISVKKINILIKKN--KDMNELKLNLTQLLYMLDILGINFVDLHNDENLALLNTWKNYVDKKDYVKADELRKQLINIGIL 436
>gi|13357680|ref|NP_077954.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761946|ref|YP_001752206.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508782|ref|ZP_02958248.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|24418701|sp|Q9PR21|SYC_UREPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|11271610|pir||H82930 cysteinyl-tRNA synthetase UU123 [imported] - Ureaplasma urealyticum >gi|6899081|gb|AAF30529.1|AE002113_3 cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827523|gb|ACA32785.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675727|gb|EDT87632.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] (436 aa)
Score = 845, Expect = 1.8e-88, Identities = 199/439 (45%), Positives = 287/439 (65%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLL--TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S +++ V ++ + I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I +YIQK+++ +  Y +  DVYFDT K+  YG++S + L+  +VG + E    K+NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +NINN+KMSKSL+NFIL KDLL+EY+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    K++L    +      + D   L +  + ++ +   IV  I   +K  +IL++    +++N+L  NL+ LL    ILGI  V+L +DE + LLN W     +K++ ++D+ RK L+   +L
  S:     1 MKLYD--SYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIIDYIQKLIDKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRIESAANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNINNEKMSKSLNNFILVKDLLAEYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNA---KNYLYFNNQLKSLT-QIDHFELFDERINDDLDFVGIVDLIHISVKKINILIKEN--KDMNELKLNLTQLLYMLDILGINFVDLHNDENLALLNTWKNYVDKKDYVKADELRKQLINIGIL 436
>gi|186701979|ref|ZP_02971607.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700745|gb|EDU19027.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] (436 aa)
Score = 842, Expect = 4.7e-88, Identities = 198/439 (45%), Positives = 287/439 (65%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLL--TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S +++ V ++ + I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I +YIQK+++ +  Y +  DVYFDT K+  YG++S + L+  +VG + E    K+NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +NINN+KMSKSL+NFIL KDLL+EY+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    K++L    +      + D   L +  + ++ +   IV  I   +K  +IL++    +++N+L  NL+ LL    ILGI  V+L +D+ + LLN W     +K++ ++D+ RK L+   +L
  S:     1 MKLYD--SYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIIDYIQKLIDKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRIESAANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNINNEKMSKSLNNFILVKDLLAEYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNA---KNYLYFNNQLKSLT-QIDHFGLFDERINDDLDFVGIVDLIHISVKKINILIKEN--KDMNELKLNLTQLLYMLDILGINFVDLHNDKNLALLNTWKNYIDKKDYVKADELRKQLINIGIL 436
>gi|171920288|ref|ZP_02691052.2| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902701|gb|EDT48990.1| cysteinyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] (436 aa)
Score = 839, Expect = 8.6e-88, Identities = 198/439 (45%), Positives = 286/439 (65%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLL--TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD  S +++ V ++ + I +Y CGPTVYNH+HIGN RP+IT DVL R   +      ++ NITDIDDKI+N A   N+ ELE+S YY  +Y  I K +N  T  M  P+VS H+  I +YIQK++  +  Y +  DVYFDT K+  YG++S + L+  +VG + E    K+NP DF LWK+T  G+ W+  +  GRPGWH+ECSCLIN Y+G+Q+ IHGGGIDLKFPHHENEN QN  + NK+LA++WMH G +N+NN+KMSKSL+NFIL KDLL+EY+   VRWFFYQ  Y  P+ F+ E +  ++ +   ++N IYN    K++L    +      + D   L +  + ++ +   IV  I   +K  +IL++    +++N+L  NL+ LL    ILGI  V+L +DE + LLN W     +K++ ++D+ RK L+   +L
  S:     1 MKLYD--SYSNQLVEINDELISIYNCGPTVYNHIHIGNARPLITMDVLYRFLKKHNIKTKYVLNITDIDDKIINYALANNLKELEVSEYYFNEYLKIKKALN--TLEMINPKVSTHMDKIIDYIQKLIYKQAGYFIGDDVYFDTKKALNYGQLSKRDLENDIVGMRIESVANKHNPNDFILWKKTNKGIMWNTPWGIGRPGWHSECSCLINTYIGEQVSIHGGGIDLKFPHHENENAQNQVLYNKNLAKVWMHFGLVNVNNEKMSKSLNNFILVKDLLAEYDYQVVRWFFYQADYKQPIKFSHEIMKQNEKEILKIKNAIYNA---KNYLYFNNQLKSLT-QIDHFELFDERINDDLDFVGIVDLIHISVKKINILIKEN--KDMNELKLNLTQLLYMLDILGINFVDLHNDENLALLNTWKNYVDKKDYVKADELRKQLINIGIL 436
>gi|187608843|sp|Q7NAH7|SYC_MYCGA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (435 aa)
Score = 837, Expect = 1.6e-87, Identities = 191/439 (43%), Positives = 285/439 (64%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--------EFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+YD ++KT+  V +D   I +YVCGPTVY+H+HIGNLRPI+TFDVL RL       V F+HN+TDIDDKI+N+A+  N+ E E++  Y + YF+IL  +NI     K  +V+D +  I  YI+KI + ++AY +DGD+YFDTT+   YG +S +KLDE + G + + N  K +P DF LWK+T  G+ W+ +F  GRPGWHTEC+ +I++    +   IHGGGIDL FPHHENEN QN+A++NK+L   W+HVG+L I+N+KMSKSL+NFI  K L+  +N   +RW FY T+++ PLNF    +  ++  +E II  +N F++ LI     N+ N+        EF K+    L +N N  N    I + IK  +  +  K  +E    +  L + L +I GI+   + +++ I+ +N+W++L   K++ ++D  R  L+ KK+L
  S:     1 MKLYDTLTKTN--VDIDANEINIYVCGPTVYDHIHIGNLRPIVTFDVLRRLLEHSNKKVNFVHNLTDIDDKIINQAQRLNLSEEEVTKRYTSAYFEILDELNIKLP--KIVKVTDVMSGIIKYIEKIYDKQYAYELDGDIYFDTTRIADYGVLSKRKLDEQISGIRVKSNENKTSPNDFVLWKKTVEGIKWNSRFGLGRPGWHTECAYIIDQEFKQKGFVIHGGGIDLVFPHHENENAQNLALHNKNLVNCWVHVGYLLIDNEKMSKSLNNFIYVKHLIESHNYRAIRWVFYNTAHTQPLNFDGTIIKAAQKDVEKIISTVNRFRTFLIA----NKNNIPSSSLVCEEFKKA----LFDNLNFANATKVIWDLIKVLNESIAYKKIDENIWAYQQLIWCL-EIYGIVPDMIHNEQIIDQINQWSELLNNKDYEKADSIRNKLINKKVL 435
>gi|31544883|ref|NP_853461.1| cysteinyl-tRNA synthetase [Mycoplasma gallisepticum R] >gi|31541730|gb|AAP57029.1| CysS [Mycoplasma gallisepticum R] (462 aa)
Score = 826, Expect = 2.7e-86, Identities = 190/439 (43%), Positives = 285/439 (64%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--------EFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+YD ++KT+  V +D   I +YVCGPTVY+H+HIGNLRPI+TFDVL RL       V F+HN+TDIDDKI+N+A+  N+ E E++  Y + YF+IL  +NI     K  +V+D +  I  YI+KI + ++AY +DGD+YFDTT+   YG +S +KLDE + G + + N  K +P DF LWK+T  G+ W+ +F  GRPGWHTEC+ +I++    +   IHGGGIDL FPHHENEN QN+A++NK+L   W+HVG+L I+N+KMSKSL+NFI  K L+  +N   +RW FY T+++ PLNF    +  ++  +E II  +N F++ LI     N+ N+        EF K+    L +N N  N    I + IK  +  +  K  +E    +  L + L +I GI+   + +++ I+ +N+W++L   K++ ++D  R  L+ KK+L
  S:    28 VKLYDTLTKTN--VDIDANEINIYVCGPTVYDHIHIGNLRPIVTFDVLRRLLEHSNKKVNFVHNLTDIDDKIINQAQRLNLSEEEVTKRYTSAYFEILDELNIKLP--KIVKVTDVMSGIIKYIEKIYDKQYAYELDGDIYFDTTRIADYGVLSKRKLDEQISGIRVKSNENKTSPNDFVLWKKTVEGIKWNSRFGLGRPGWHTECAYIIDQEFKQKGFVIHGGGIDLVFPHHENENAQNLALHNKNLVNCWVHVGYLLIDNEKMSKSLNNFIYVKHLIESHNYRAIRWVFYNTAHTQPLNFDGTIIKAAQKDVEKIISTVNRFRTFLIA----NKNNIPSSSLVCEEFKKA----LFDNLNFANATKVIWDLIKVLNESIAYKKIDENIWAYQQLIWCL-EIYGIVPDMIHNEQIIDQINQWSELLNNKDYEKADSIRNKLINKKVL 462
>gi|20808681|ref|NP_623852.1| cysteinyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] >gi|22257048|sp|Q8R7T3|SYC_THETN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|20517317|gb|AAM25456.1| Cysteinyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] (467 aa)
Score = 784, Expect = 2.0e-81, Identities = 173/439 (39%), Positives = 276/439 (62%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKN---QLENIIYNL----NIFKSHLIIEQ------KYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++Y+ +++T +E   L  K + MYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TDIDDKI+N+AKEEN  E E++  +  +YF     + I  + +  PR ++HI DI  +I+ +++  +AY+VDG+VYF+T K   YGK+S+K +DEL+ G + E + KK NP DFALWK    G   WD  +  GRPGWH ECS +  KYLG  +DIH GG DL FPHHENE  Q+ A  ++  ++ WMH+G+LN+NN+KMSKS  NF   ++L  +Y+   +R F     Y +P+NF+ + L  +K+   +L N + NL    NI K   + ++      K++E   +F+++    + ++FN  + +S + E  K ++  L   + ++L +    +   L+ +LG+ + N    + D+E + L+ +  K ++EKN+  +D+ R  L E+ ++
  S:     1 MRLYNTMTRTKEEFKPLKDKVVNMYVCGPTVYNYIHIGNARAFIVFDTVRRYLEYKGYTVNYVQNFTDIDDKIINRAKEENTTEKEIAERFIEEYFKDADALGIKRATVH-PRATEHIDDIIEFIKILIDKGYAYVVDGNVYFETAKFKDYGKLSHKNIDELMAGARVEIDEKKKNPLDFALWKAQKPGEPAWDSPWGKGRPGWHIECSVMSTKYLGKTLDIHAGGPDLIFPHHENEIAQSEAAYDQPFSKYWMHIGYLNVNNEKMSKSKGNFFTVRELTEKYDPEVLRLFMLMAHYRSPINFSLDLLDQAKSAYERLSNAVVNLKHLANITKDRELSDEEKDLIVKFDEYKKQFEEA----MDDDFNTADAISVLFEMAKTANANLSGNSSKKLVEYILEMFLKLSDVLGLSYKNAETEIEDEEILRLIEERQKARKEKNWKLADEIRDKLKERGII 453
>gi|134298071|ref|YP_001111567.1| cysteinyl-tRNA synthetase [Desulfotomaculum reducens MI-1] >gi|187629810|sp|A4J0Y9|SYC_DESRM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|134050771|gb|ABO48742.1| cysteinyl-tRNA synthetase [Desulfotomaculum reducens MI-1] (486 aa)
Score = 780, Expect = 6.6e-81, Identities = 167/421 (39%), Positives = 258/421 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI------IY---NLNIFKSHLI-----IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNK----LKQEK 421
           M+IY+ +++  +E +  DK ++ MYVCGPT YN +H+GN RP++ FD + R FL  GY V ++ N TD+DDKI+N+A EE I  LEL+  Y  ++F     +N+  ++   P+VS+HI++I + I+++ +   AY+VDGDVYF      +YGK+S + L+++  G + E + +K +P DFALWK    G  +WD  + +GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ A      AR WMH G + IN +KMSKSL NF L +++L+++  + VRW+   T Y +PL+F  E L+ S   LE I      +Y   +L +++   I      E+      LEF+K+    + ++FN    +S+  +  K  +I         + KL+  ++  + KIL         D+A  L+  +N+    LK++K
  S:     1 MQIYNTLARAKEEFIPRDKGHVSMYVCGPTTYNFIHLGNARPLVFFDTVRRYFLYKGYKVDYVQNFTDVDDKIINRAAEEKIDPLELAQKYIQEFFVDADALNVMRADTH-PKVSEHIEEIIDLIKRLEDQGHAYVVDGDVYFAVRSFAEYGKLSGRSLEDMQAGARVEVDPRKKDPMDFALWKAAKPGEPSWDSPWGSGRPGWHIECSAMAEKYLGNGFDIHGGGFDLIFPHHENEIAQSEAACKAPFARYWMHNGFITINQEKMSKSLGNFFLVREILAKFPPDVVRWYLLSTHYRSPLDFDDEKLVMSGKGLERIKTALRLLYEAMDLPVYEGEDIQGAENFEETLQRIRLEFEKA----MDDDFNTALAISYFFDLAKEVNIY--------VGKLNSKVTLEMRKIL---------DQAHTLIKDFNRVLGILKEDK 419
>gi|167756028|ref|ZP_02428155.1| hypothetical protein CLORAM_01548 [Clostridium ramosum DSM 1402] >gi|167704020|gb|EDS18599.1| hypothetical protein CLORAM_01548 [Clostridium ramosum DSM 1402] (449 aa)
Score = 779, Expect = 8.4e-81, Identities = 176/439 (40%), Positives = 276/439 (62%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG--DKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINK-YLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIF-KSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK-NFEELNKLHFNLSYLLTKILG-IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKI++ ++   +E   L +  + +YVCGPTVYN+VHIGN RP+I FDVL R F  LGY VTF+ N TD+DDKI+  AK E I E EL+  Y   Y D+ + +N+       PRV++ +  I  +I  +V + +AY VDGDVYF  +K ++YG++S  K+++L+ G  ++ ++N KK    DFALWK+T  G+ +D  +S GRPGWHTEC  +IN  + G +IDIHGGG DLKFPHHENE  Q++A ++  +A  WMH   +NI+NQKMSKSL N I AKD+++E   N V+WF   + Y NPLN T E L + K +   ++N+I +++++ + + I  + YN+  ++     +  L ++ N    ++ I +++K  ++  R K   ++   + +     +T ++G +      +   +E+   W + KQ K+F  +DK R  L+EK ++
  S:     5 MKIFNTLTNKKEEFKPLREGEVSIYVCGPTVYNYVHIGNTRPMIVFDVLRRTFEYLGYKVTFVSNFTDVDDKIIKAAKAEGITEKELTDKYIAAYEDVRRNLNLLFPTYA-PRVTNTMDAIIKFIDNLVKSGYAYEVDGDVYFRVSKIDEYGQLSGIKIEDLVAGASERIDENDKKEESTDFALWKKTDEGIRFDSPWSKGRPGWHTECVVMINDIFEGGKIDIHGGGQDLKFPHHENEIAQSMACHHHPIAHTWMHNQMINIDNQKMSKSLGNVIWAKDMVAELGCNVVKWFMLSSHYRNPLNLTEEVLNSVKKEVAKVDNVIKSVSLYLQVNHIANENYNKAAVD---GMVGALEDDLNTSLALTKILDQVKKLNLAFRQKEKNDKAIAIEYQTLLKMTAVIGFVFEPRKLNAAELEIYQAWLEAKQNKDFETADKLRTQLIEKGII 449
>gi|169190369|ref|ZP_02850341.1| cysteinyl-tRNA synthetase [Paenibacillus sp. JDR-2] >gi|169002976|gb|EDS49851.1| cysteinyl-tRNA synthetase [Paenibacillus sp. JDR-2] (470 aa)
Score = 774, Expect = 3.3e-80, Identities = 162/436 (37%), Positives = 270/436 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIF--KSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLR--NKNFEELNKLHFNLSYLLTKILGII-----HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           ++IY+ ++++ +  V  +   +KMYVCGPTVY+++HIGN RP+I FDV+ R     GY+V +I N TD+DDK++ KA++  +   E++  +   + + + ++ +H + +  PRV++HI  I  +IQ +V+  +AY  +GDVY+ T+K  +YGK+S++ L+EL  G + E   +K NPQDF LWK    G +NW+  +  GRPGWH ECS +  +YLGD +DIHGGG DL+FPHHE E  Q+ A+  K LA  WMH G+++INN+KMSKSL N I   +L+       +R+F   T Y +PLNFT E +  ++N ++       N+ + L+ F  +S      +  ++  +       ++ ++FN P+ ++ + E +  ++  +   + + E +  L   L  + T +LG++        L DDE   L+ +  + +  KN++ +D+ R LL EK
  S:     3 VQIYNTLTRSKEAFVPQEPGKVKMYVCGPTVYDYIHIGNARPVIFFDVVRRYLEYAGYDVNYIVNFTDVDDKLIKKAEQLGLTVPEVADKFINAFNEDIASLGVHKATLN-PRVTEHIPSIIAFIQGLVDTGYAYASEGDVYYRTSKFEEYGKLSHQNLEELQFGIRIEVGERKENPQDFVLWKGVKPGEINWESPWGPGRPGWHIECSAMAREYLGDTLDIHGGGHDLQFPHHECEVAQSEALTGKQLANYWMHNGYIHINNEKMSKSLGNGITVNELVKRVKPAAIRYFILSTHYRSPLNFTDETIAQAENSVDRIANCAANLKHRLSTFDGQSEGAAAGELGDRIAQLKAQFEAKMGDDFNTPDAITAVFELVTEANQYMNRADASSEGIAALLAALEQMNT-VLGLLPEAGTDAELLDDEIDALIVERTEARAAKNWARADEIRNLLTEK 454
>gi|160916264|ref|ZP_02078471.1| hypothetical protein EUBDOL_02291 [Eubacterium dolichum DSM 3991] >gi|158431988|gb|EDP10277.1| hypothetical protein EUBDOL_02291 [Eubacterium dolichum DSM 3991] (446 aa)
Score = 773, Expect = 4.3e-80, Identities = 169/439 (38%), Positives = 262/439 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN------IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK--NFEELNKLHFNLSYLLTKILGIIHVNL-FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+++ ++++ +E   L +  ++MYVCGPTVYN+ HIGN+RPI+ FD L R    +GYNV  + N TD+DDKI+  AKE  + E E++  +   Y +   +++    +   P+V++ +  I  +I  +V    AY+VDGDVYF     + YGK+SN+++++L+VG + ++N KK NP DF LWK+T  G+ W   +S GRPGWHTEC  +IN    +  IDIHGGG+DLKFPHHENE  Q+ A     +A+ W+H G +NI+ +KMSKSL N I AKD+++    N +RW    T Y +PLN   + +  ++ +L  ++  L           H+I E         F    L  + ++ N PN  + + E +K  +  LR +  ++ +L+K   ++  +L  ILGI    L   DE   L  KW    +EK+F ++D YR  L+E+ +L
  S:     3 MKLFNSMTQSIEEFKPLHEGEVRMYVCGPTVYNYPHIGNVRPIVVFDTLKRTLQAIGYNVKMVSNYTDVDDKIIKVAKEAGVSEKEITEKFIKAYNEDRLSLHAMMPDAA-PKVTETMDAIIAFINLLVEKGNAYVVDGDVYFRVNSVDDYGKLSNQQIEDLMVGARIDENSKKENPLDFTLWKRTEEGIRWQSPWSLGRPGWHTECVVMINDVFKEPIIDIHGGGMDLKFPHHENEIAQSKAAYGTAIAKYWIHNGMVNIDGEKMSKSLGNVIWAKDMIASIGGNVLRWLMLSTHYRSPLNINEDGIETARKELSKVMQPLKQAYVKLSLADHVIGEDHDEVLVAPF----LAAMEDDLNTPNAFAALFEAVKVFNQTLRQREIDYAKLSKQCVSIEKML-DILGIESQRLVLSDEDKALHGKWRAAVKEKDFEQADMYRAKLIERGIL 446
>gi|50364902|ref|YP_053327.1| cysteinyl-tRNA synthetase [Mesoplasma florum L1] >gi|61216193|sp|Q6F230|SYC_MESFL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|50363458|gb|AAT75443.1| cysteinyl-tRNA synthetase [Mesoplasma florum L1] (441 aa)
Score = 768, Expect = 1.8e-79, Identities = 187/439 (42%), Positives = 280/439 (63%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYL-GDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKY---NEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLF-DDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK++D +++  K +  +K+ I +Y CGPT+Y+++HIGN RPII  D L R     G  V F+ NITDIDDKI+ KA +EN  E E++  Y + +   LK + I   +   P +S+ I ++  +I  +V  + AY VDGDVYFD  K S++YGK+SNKK+++L+ G++ E   KKNNP DF++WK+T  G+ +D  F  GRPGWHTEC+ LI++Y  G+ IDIH GGIDL+FPHHENE IQ IA + K+++ IW+H GHL IN +KMSKSL N +   + L+ YN++ +RW F  T Y  PLN   ++LI   N+    I NL+     L+IE K+   N+ + E  K   I + N+ N   +++ +E+ +K  + L   K F++L     +L+Y+L  +   I++N F  DE   L   W K+  EK+F ++D+ RK+L+ K +L
  S:     1 MKLFDTLTQEQKNI--NKEVINIYSCGPTIYDYIHIGNARPIILMDTLIRFLESEGIKVNFLQNITDIDDKIIEKAIQENKTEKEITDKYLSAFLQNLKDLKIRMPDKLIP-ISEKISEMNLFIDDLVKLEAAYNVDGDVYFDIQKFSDEYGKLSNKKINDLISGNRVEIEDKKNNPLDFSVWKKTEKGITFDSNFGKGRPGWHTECALLIDEYFKGETIDIHSGGIDLQFPHHENERIQFIAKHGKEISDIWVHNGHLTINGEKMSKSLGNTMTLTNFLANYNSDILRWIFLTTYYKQPLNI-NDDLIEQANKFIQKINNLSKKIKQLLIENKFVKTNQFDEEIIKQFKIHMKNDLNTSRVLTLLEDTLKDINKLSTLKEFDDLFLKINSLNYILKTLGLSININTFVSDEEQNLFLLWKKIVSEKDFEKADEIRKVLISKGIL 441
>gi|150392183|ref|YP_001322232.1| cysteinyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] >gi|187629786|sp|A6TWK5|SYC_ALKMQ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|149952045|gb|ABR50573.1| cysteinyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] (464 aa)
Score = 767, Expect = 2.2e-79, Identities = 172/439 (39%), Positives = 271/439 (61%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFDKSNLIELT-----------NNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++Y+ ++ K +  V +++  ++MY CGPTVYN+ HIGN R  I FD L +  +  GY+VTF+ N TDIDDKI+ KA+EE +   E+S  +  +YF    T+ +  +++  P+V++++ +I  +IQ+++    AY V+GDVY+D ++   YGK+S + L+EL  G + E N  K N  DF LWK    G  +W+  + +GRPGWH ECS +  KYLG+ IDIHGGG DL FPHHENE  Q+ A   K  A  W+HVG+LNI+N+KMSKSL NF   +++  EY+  ++R+F     Y  P+NF+ E L ++K+ LE  +YN    K+HL  I+E    E+  E +K  +  LT           ++FN  + ++ I + ++  +  +  +  +E  K  + +   LT +LG++       D E   L+    + + EKNF++SD+ R  L EK ++
  S:     1 MRLYNTLTRKKEVFVPIEQGKVRMYACGPTVYNYFHIGNGRTFIVFDALRKYLVYRGYDVTFVQNFTDIDDKIIKKAQEEAVSAKEISERFIVEYFKDAATLGVDQADIH-PKVTENVPEIIAFIQELLEKNVAYEVNGDVYYDVSRFEDYGKLSKQNLEELQSGARIEVNEAKRNSLDFVLWKTAKPGEPSWESPWGSGRPGWHIECSAMAKKYLGETIDIHGGGGDLVFPHHENEIAQSEACTGKTFANYWIHVGYLNIDNKKMSKSLDNFFTPREIAEEYDLESLRFFMLSAHYRTPVNFSRELLESAKSGLER-LYNA---KNHLEHILENTKVEEMKETEKEWIDSLTHYSEEFNRVMDDDFNTADGIAVIFDLVRDMNTYITGEASKEAVKAAYGMLVELTGVLGLLRKEEESLDKEIGRLIEARQQARIEKNFTKSDEIRDYLKEKGIV 451
>gi|56418620|ref|YP_145938.1| cysteinyl-tRNA synthetase [Geobacillus kaustophilus HTA426] >gi|61216117|sp|Q5L429|SYC_GEOKA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56378462|dbj|BAD74370.1| cysteinyl-tRNA synthetase [Geobacillus kaustophilus HTA426] (466 aa)
Score = 764, Expect = 4.3e-79, Identities = 163/439 (37%), Positives = 267/439 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL--LTKILGII--HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++Y+ +++  +    L+   +KMYVCGPTVYN++HIGN R  I FD + R     GY+VT++ N TD+DDK++  A+E       ++  +   YF+ ++ +    +++  PRV+++I  I  +IQ +++  +AY VDGDVY+ T K  +YGK+S++ +DEL  G + E   KK++P DFALWK    G + WD  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  A+ W+H G+LNINN+KMSKSL NF+L  D++ E +   +R+F     Y +P+N++ E L +++  LE       N+ + L    +    ++++  +  +   S + E+ ++FN  N ++ + E  K +++ L+ K   E   +H  L     L  +LG+      L D+E   L+ K N+ ++ ++F+ +D+ R  L  K ++
  S:     4 IRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARAAIVFDTIRRYLEFRGYDVTYVSNFTDVDDKLIKAARELGESVPAIAERFIEAYFEDIQALGCKKADIH-PRVTENIDTIIEFIQALIDKGYAYEVDGDVYYRTRKFREYGKLSHQSIDELQAGARIEIGEKKDDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTIDIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDIIREIDPQVLRFFMLSVHYRHPINYSEELLESARRGLERLKTAYSNLQHRLQASTNLTDNDEEWVSRIADIRASFIREMDDDFNTANGIAVLFELAKQANLYLQEKTTSE-KVIHAFLREFEQLADVLGLTLKQDELLDEEIEALIQKRNEARKNRDFALADRIRDELRAKNII 453
>gi|138893764|ref|YP_001124217.1| cysteinyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] >gi|196251125|ref|ZP_03149804.1| cysteinyl-tRNA synthetase [Geobacillus sp. G11MC16] >gi|166200148|sp|A4IJG8|SYC_GEOTN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|134265277|gb|ABO65472.1| Cysteine-tRNA ligase [Geobacillus thermodenitrificans NG80-2] >gi|196209366|gb|EDY04146.1| cysteinyl-tRNA synthetase [Geobacillus sp. G11MC16] (467 aa)
Score = 763, Expect = 5.6e-79, Identities = 162/439 (36%), Positives = 269/439 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL--LTKILGII--HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++Y+ +++  +    L+   +KMYVCGPTVYN++HIGN R  I FD + R     GY+VT++ N TD+DDK++  A+E       ++  +   YF+ ++ +    +++  PRV+++I+ I  +IQ +++  +AY VDGDVY+ T K + YGK+S++ +DEL  G + E   KK++P DFALWK    G ++WD  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  A+ W+H G+LNINN+KMSKSL NF+L  D++ + +   +R+F     Y +P+N++ E L +++  LE       N+ + L    +    + ++  +  +   S + E+ ++FN  N ++ + E  K +++ L+ K   E N +H  L     L  +LG+      L D+E   L+ + N+ ++ ++F+ +D+ R  L  K ++
  S:     4 IRLYNTLTRKKETFEPLEPNKVKMYVCGPTVYNYIHIGNARAAIVFDTIRRYLEFRGYDVTYVSNFTDVDDKLIRAARELGESVPAIAERFIEAYFEDIEALGCKKADIH-PRVTENIETIIEFIQALIDKGYAYEVDGDVYYRTRKFDGYGKLSHQSIDELQAGARIEVGEKKDDPLDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMARKYLGDTIDIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDIIRQIDPQVLRFFMLSVHYRHPINYSEELLESARRGLERLRTAYGNLQHRLGASTNLTDNDGEWLSRLADIRASFIREMDDDFNTANGIAVLFELAKQANLYLQEKTTSE-NVIHAFLREFEQLMDVLGLTLKQEELLDEEIEALIRQRNEARKNRDFALADRIRDELKAKNII 453
>gi|146295747|ref|YP_001179518.1| cysteinyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|187629798|sp|A4XHE2|SYC_CALS8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|145409323|gb|ABP66327.1| cysteinyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] (465 aa)
Score = 759, Expect = 1.8e-78, Identities = 169/433 (39%), Positives = 263/433 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIY---NLNIFKSHLIIEQKYNEK---NLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI-----ELLNKWNKLKQEKNFSESDKYRKLL 433
           MK+Y+ ++ T +E   L++  +KMYVCGPTVY+ +HIGN RP+I FD L R F   GY V +I N TD++DK++N+A +E I   EL+  +  +Y+     +N+  +  K PR ++ I+D+   IQ++++  +AY+VDGDVYF T K  +YGK+S+K +++L+ G + + + KK +P DFALWK    G   W+  +  GRPGWH ECS +  KYLG  IDIH GG DL FPHHENE  Q+ A   K  AR W+H G++NINN+KMSKSL NF   ++++ +Y+   +R F  Q  Y  PLNF+ + +  ++  L+ I     NL     +     + ++K    +E  K+  I+ + ++ N      ++ E ++  +    + + E L     ++   L  ILGI+      +EAI     EL+ K N+ ++ KNF E+D+ R  L
  S:     1 MKLYNTLTMTKEEFEPLEEGKVKMYVCGPTVYDFIHIGNARPLIVFDTLRRYFEYKGYEVIYIQNFTDVEDKMINRANKEGITVFELAERFIQEYYKDADRLNVRRAT-KSPRATEEIEDMIALIQRLIDKGYAYVVDGDVYFRTRKFAEYGKLSHKNIEDLMAGARVDPSEKKEDPLDFALWKAKKEGEPAWNSPWGEGRPGWHIECSVMAMKYLGQTIDIHAGGQDLIFPHHENEIAQSEAATGKPFARFWLHNGYVNINNEKMSKSLGNFFTVREIIEKYHPEALRLFMLQAHYRKPLNFSIDLIEQAEVALKRIYTCYENLEFLIQNAASSSENDDKLKAAIEELKAKFIDAMEDDLNTAEATGYLFEMVREINTHANSCSKETLT-FAKDILKELCSILGILEQYSAKEEAIPQEILELVEKRNQARKAKNFLEADRIRDEL 445
>gi|89100736|ref|ZP_01173591.1| cysteinyl-tRNA synthetase [Bacillus sp. NRRL B-14911] >gi|89084553|gb|EAR63699.1| cysteinyl-tRNA synthetase [Bacillus sp. NRRL B-14911] (465 aa)
Score = 758, Expect = 2.3e-78, Identities = 168/439 (38%), Positives = 261/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDK-------SNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFE-ELNKLHFNLSYLLTKILGII--HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +S+  +E + L++  +KMYVCGPTVYN++HIGN RP I FD + R     GY+V +I N TD+DDK++  AKE       ++  +   YF+ +  +    +++  PRV++ +  I  +I+ ++   FAY  +GDVYF T + ++YGK+S + +DEL VG +     KK +  DFALWK    G ++W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NF+L  D++ +++   +R+F     Y +P+N++ E L N+++ LE I  +            +  + N E+ K         + E+ ++FN  N +S + E  + ++  L  KN   E+ +       +L  +LG+      L DDE   L+ K N+ ++E+NF  SD+ R  L E  ++
  S:     3 IAIYNTMSRQKEEFIPLEEGKVKMYVCGPTVYNYIHIGNARPPIVFDTVRRYLEFRGYDVQYISNFTDVDDKLIRAAKELGEDVPSIAERFIDAYFEDVSALGCKRADVH-PRVTESMDLIIQFIEALIEKGFAYESNGDVYFHTRRFDEYGKLSQQSIDELRVGARIAVGEKKQDALDFALWKTAKEGEISWESPWGKGRPGWHIECSAMARKYLGDTIDIHAGGQDLSFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFVLVHDIIKKHDPQVLRFFMLSVHYRHPINYSDELLENTRSGLERITTSYQNLAHRKEASAELTDNNSEWLKKIEDLHGEFIKEMDDDFNTANGISVLFELSRQANYYLLEKNTSVEVIEAFMKEFEILFDVLGLSLGGEELLDDEIDALIEKRNQARKERNFQLSDQIRDQLKEMNII 452
>gi|196163328|ref|ZP_03123859.1| cysteinyl-tRNA synthetase [Clostridium difficile QCD-23m63] (465 aa)
Score = 757, Expect = 2.8e-78, Identities = 179/435 (41%), Positives = 264/435 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN---IFKSHLIIEQKYNEKNLE-------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL-----LTKILGIIHV---NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MK+Y+ +++T +E V L++  +KMYVCGPTVYN++HIGN RP I FD L R     GY+VT++ N TD+DDKI+N++ EE I   E+++ Y  +YF     + I  + +  P+V+D+I+ I  +I+++ +  +AY V+GDVYFDT K   YGK+S +K ++L  G + E N +K +P DF LWK    G   WD  +  GRPGWH ECS +  +YLG+ IDIH GG DL FPHHENE  Q+ A + K  ++ WMH G++NIN++KMSKS  NF   +D+   Y+   VR+F     Y NP+NF+ E L  +K  LE  +YN      F    ++E    EK +E       F +  +  + ++ N  + VS I E  K     L N N +E + L F    L     LT +L I++     + D +  EL+ K    K+ K F  +D  R+ L++
  S:     1 MKVYNTLTRTKEEFVPLEEGKVKMYVCGPTVYNYIHIGNARPFIIFDTLRRYLEYRGYDVTYVQNFTDVDDKIINRSHEEGISPEEVAAKYIKEYFVDCDGLGIKRATVH-PQVTDNIQQIIEFIKELEDKGYAYAVNGDVYFDTNKFEGYGKLSGQKQEDLEAGARIEVNDQKRHPMDFVLWKAKKEGEPGWDSPWGEGRPGWHIECSVMSKRYLGETIDIHAGGQDLTFPHHENEIAQSEARSGKTFSKYWMHNGYININDEKMSKSKGNFFTVRDISKLYDLEIVRFFMLSAHYRNPVNFSDEMLNQAKAGLER-LYNTKEKLEFTLSNLVESPLTEKEVELVKELDGFRQKFIDAMDDDVNTADAVSVIFELAK-----LINSNVDENSSLEFAKKCLDEFNELTGVLNIVNKKKDTVLDKDIEELIQKRTDAKKNKEFQLADDIRQQLLD 448
>gi|158319520|ref|YP_001512027.1| cysteinyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] >gi|187629787|sp|A8MLB7|SYC_ALKOO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|158139719|gb|ABW18031.1| cysteinyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] (464 aa)
Score = 757, Expect = 3.4e-78, Identities = 168/439 (38%), Positives = 275/439 (62%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNL-NIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIH--VNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +++  +E + L++  ++MY CGPTVYN+ HIGN R  + FD L R  +  GY+VTF+ N TD+DDKI+ +A EE +   E+S  +  +YF    T+ I  +++  P+V++++ +I  ++ K+V    AY  +GDVYFD +K  +YGK+S + L++L  G + E N  K NP DFALWK    G  +W+  +  GRPGWH ECS +  +YLG+ IDIHGGG DL FPHHENE  Q+ A + K  A  W+HVG+LN++N+KMSKSL+NF   +++  E++   +R+F     Y NP+NF+ + L  +KN L+       N+ Y L N  +  +  E+K     L+  K+  I+ + ++FN  + ++ I + ++  +  +  KN ++  +  ++L   LT +LG++       ++E   L+ +  + +++KNF+ SDK R  L EK ++
  S:     1 MKLYNTLTRKKEEFIPLEEGKVRMYACGPTVYNYFHIGNARTFMVFDALRRYLIYRGYDVTFVQNFTDVDDKIIRRANEEGVAPEEISERFIKEYFYDAGTLGIEKADIH-PKVTENMAEIIAFVAKLVEKGHAYESNGDVYFDVSKYEEYGKLSKQSLEDLQAGARIEINEYKKNPLDFALWKSAKAGEPSWESPWGNGRPGWHIECSAMAKRYLGETIDIHGGGGDLVFPHHENEIAQSEACSGKKFANYWLHVGYLNVDNKKMSKSLNNFFTPREISEEFDLENLRFFMLSAHYRNPINFSRDLLEAAKNGLDRLYTGKNNLEYLLENAAEREVSEEEKNFIHGLQSFKNQFIDAVDDDFNTADGIAVIFDLVREINSHISEKNSKKAVEASYDLLMELTGVLGLLKREAEDLEEEIERLIAERQQARKDKNFALSDKIRDDLKEKGIV 451
>gi|168716313|ref|ZP_02748590.1| cysteinyl-tRNA synthetase [Clostridium difficile QCD-63q42] >gi|196126512|ref|ZP_03118261.1| cysteinyl-tRNA synthetase [Clostridium difficile ATCC 43255] (465 aa)
Score = 755, Expect = 4.7e-78, Identities = 179/435 (41%), Positives = 264/435 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN---IFKSHLIIEQKYNEKNLE-------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL-----LTKILGIIHV---NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MK+Y+ +++T +E V L++  +KMYVCGPTVYN++HIGN RP I FD L R     GY+VT++ N TD+DDKI+N++ EE I   E+++ Y  +YF     + I  + +  P+V+D+I+ I  +I+++ +  +AY V+GDVYFDT K   YGK+S +K ++L  G + E N +K +P DF LWK    G   WD  +  GRPGWH ECS +  +YLG+ IDIH GG DL FPHHENE  Q+ A + K  ++ WMH G++NIN++KMSKS  NF   +D+   Y+   VR+F     Y NP+NF+ E L  +K  LE  +YN      F    ++E    EK +E       F +  +  + ++ N  + VS I E  K     L N N +E + L F    L     LT +L I++     + D +  EL+ K    K+ K F  +D  R+ L++
  S:     1 MKVYNTLTRTKEEFVPLEEGKVKMYVCGPTVYNYIHIGNARPFIIFDTLRRYLEYRGYDVTYVQNFTDVDDKIINRSHEEGISPEEVAAKYIKEYFVDCDGLGIKRATVH-PQVTDNIQQIIEFIKELEDKGYAYAVNGDVYFDTNKFEGYGKLSGQKQEDLEAGARIEVNDQKRHPMDFVLWKAKKEGEPGWDSPWGEGRPGWHIECSVMSKRYLGETIDIHAGGQDLTFPHHENEIAQSEARSGKTFSKYWMHNGYININDEKMSKSKGNFFTVRDISKLYDLEIVRFFMLSAHYRNPVNFSDEMLNQAKAGLER-LYNTKEKLEFTLSNLVESPLTEKEVELVKELDDFRQKFIDAMDDDVNTADAVSVIFELAK-----LINSNVDENSSLEFAKKCLDEFNELTGVLNIVNKKKDTVLDKDIEELIQKRTDAKKNKEFQLADDIRQQLLD 448
>gi|168696136|ref|ZP_02728413.1| cysteinyl-tRNA synthetase [Clostridium difficile QCD-37x79] >gi|168725877|ref|ZP_02758154.1| cysteinyl-tRNA synthetase [Clostridium difficile QCD-76w55] >gi|168730321|ref|ZP_02762598.1| cysteinyl-tRNA synthetase [Clostridium difficile QCD-97b34] >gi|196161001|ref|ZP_03121562.1| cysteinyl-tRNA synthetase [Clostridium difficile CIP 107932] (465 aa)
Score = 753, Expect = 8.1e-78, Identities = 179/435 (41%), Positives = 264/435 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN---IFKSHLIIEQKYNEKNLE-------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL-----LTKILGIIHV---NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MK+Y+ +++T +E V L++  +KMYVCGPTVYN++HIGN RP I FD L R     GY+VT++ N TD+DDKI+N++ EE I   E+++ Y  +YF     + I  + +  P+V+D+I+ I  +I+++ +  +AY V+GDVYFDT K   YGK+S +K ++L  G + E N +K +P DF LWK    G   WD  +  GRPGWH ECS +  +YLG+ IDIH GG DL FPHHENE  Q+ A + K  ++ WMH G++NIN++KMSKS  NF   +D+   Y+   VR+F     Y NP+NF+ E L  +K  LE  +YN      F    ++E    EK +E       F +  +  + ++ N  + VS I E  K     L N N +E + L F    L     LT +L I++     + D +  EL+ K    K+ K F  +D  R+ L++
  S:     1 MKVYNTLTRTKEEFVPLEEGKVKMYVCGPTVYNYIHIGNARPFIIFDTLRRYLEYRGYDVTYVQNFTDVDDKIINRSHEEGISPEEVAAKYIKEYFVDCDGLGIKRATVH-PQVTDNIQQIIEFIKELEDKGYAYAVNGDVYFDTNKFEGYGKLSGQKQEDLEAGARIEVNDQKRHPMDFVLWKAKKEGEPGWDSPWGEGRPGWHIECSVMSKRYLGETIDIHAGGQDLTFPHHENEIAQSEARSGKIFSKYWMHNGYININDEKMSKSKGNFFTVRDISKLYDLEIVRFFMLSAHYRNPVNFSDEMLNQAKAGLER-LYNTKEKLEFTLSNLVESPLTEKEVELVKELDDFRQKFIDAMDDDVNTADAVSVIFELAK-----LINSNVDENSSLEFAKKCLDEFNELTGVLNIVNKKKDTVLDKDIEELIQKRTDAKKNKEFQLADDIRQQLLD 448
>gi|153814444|ref|ZP_01967112.1| hypothetical protein RUMTOR_00656 [Ruminococcus torques ATCC 27756] >gi|145848840|gb|EDK25758.1| hypothetical protein RUMTOR_00656 [Ruminococcus torques ATCC 27756] (469 aa)
Score = 752, Expect = 1.0e-77, Identities = 177/439 (40%), Positives = 267/439 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS-----EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIY---NLNIFKSHLIIEQKYNEKNLEFDKSN-LIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ +SK  +E V L++  +KMYVCGPTVYN +HIGN RP+I FD + R F   G+ V F+ N TD+DDKI+ KA EE +   E+S  Y  +    ++ +N+  +  K P  ++ I  +   I  ++   +AY  +G VY+ T K   YGK+S+K LD+L  G +S     ED  +K +P DF LWK    G   W+  +S GRPGWH ECS +  KYLG+QIDIH GG DL FPHHENE  Q+ A N K+ A+ WMH G LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ E +  +KN LE I+    NL    S+   E+    +   F+KS+  +E     + ++FN  + ++ I + +KY +      + +E  +   +   LLT +LGII +    + D E  E++ K    ++++NF+ +D+ R  L+ K ++
  S:     2 MKIYNTLSKRKEEFVPLEEGKVKMYVCGPTVYNFIHIGNARPMIAFDTVRRYFEYKGFEVNFVSNFTDVDDKIIKKAIEEGVSADEISKRYIAECKKDMEAMNVKPAT-KNPLATEEICGMVEMISTLIEKGYAYEKNGTVYYRTRKFEGYGKLSHKNLDDLRSGGRSLLVTGED--EKEDPLDFVLWKPKKEGEPAWESPWSEGRPGWHIECSEMSKKYLGEQIDIHAGGEDLIFPHHENEIAQSEAANGKEFAKYWMHNGFLNIDNKKMSKSLGNFFTVREIGEKYDLQILRFFMLSAHYRSPLNFSAELMEAAKNSLERILTAADNLKFLISNTSEEKMTESEKRLFEKSSEYVEAFERAMDDDFNTADAIAAIFDLVKYMNTTADGASSKEYLQNLLDRLCLLTDVLGIIVIKEEEMLDSEIEEMIEKRQAARKDRNFALADQIRDELLAKGII 456
>gi|167036780|ref|YP_001664358.1| cysteinyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167039500|ref|YP_001662485.1| cysteinyl-tRNA synthetase [Thermoanaerobacter sp. X514] >gi|166853740|gb|ABY92149.1| cysteinyl-tRNA synthetase [Thermoanaerobacter sp. X514] >gi|166855614|gb|ABY94022.1| cysteinyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] (466 aa)
Score = 752, Expect = 1.0e-77, Identities = 168/439 (38%), Positives = 267/439 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE----------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI----IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +S+T +E   L+ K + MYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TDIDDKI+ +A+EEN+   E++  Y  +YF     + I  + +  P+ ++HI+DI  +I+ +++  +AY+V+G+VYF+T K   YGK+S+K ++EL  G + E N +K NP DF LWK    G   WD  +  GRPGWH ECS +  KYLG  +DIH GG DL FPHHENE  Q+ A   +  ++ WMH+G+LNINN+KMSKS  NF   +++  +YN   +R F     Y +P+NF+ + +  +K+  E ++  +   K HL+   K  E N E  +               + ++FN  + +S + E  K ++  +   + ++L +   ++   L++ILG+    +   L D+E + L+ +  K ++EKN+  +D+ R  L EK ++
  S:     1 MKLYNTLSRTKEEFEPLNDKIVNMYVCGPTVYNYIHIGNARAFIVFDTVRRYLEYKGYKVNYVQNFTDIDDKIIKRAQEENVTTKEVAEKYIEEYFIDADNLGIKRATVH-PKATEHIEDIIEFIKILIDKGYAYVVNGNVYFETAKFKDYGKLSHKNIEELQAGARIEINEEKKNPLDFVLWKAQKPGEPAWDSPWGKGRPGWHIECSVMSTKYLGKTLDIHAGGPDLVFPHHENEIAQSEAAYGQPFSKYWMHIGYLNINNEKMSKSKGNFFTVREITEKYNPEVLRLFMLMAHYRSPINFSLDLMEQAKSAYERLLNAVANLK-HLLTVCKDRELNEEEKRIKEKFEEYKKEFEDAMDDDFNTADAISVLFEMSKTANTNISGNSSKKLVEYILDIFLKLSEILGLSYRGVETELNDEEILALIEERQKARKEKNWKLADEIRDRLREKGII 453
>gi|126697618|ref|YP_001086515.1| cysteinyl-tRNA synthetase [Clostridium difficile 630] >gi|122974209|sp|Q18CD5|SYC_CLOD6 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|115249055|emb|CAJ66866.1| cysteinyl-tRNA synthetase [Clostridium difficile 630] (468 aa)
Score = 751, Expect = 1.4e-77, Identities = 178/435 (40%), Positives = 264/435 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN---IFKSHLIIEQKYNEKNLE-------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL-----LTKILGIIHV---NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           +K+Y+ +++T +E V L++  +KMYVCGPTVYN++HIGN RP I FD L R     GY+VT++ N TD+DDKI+N++ EE I   E+++ Y  +YF     + I  + +  P+V+D+I+ I  +I+++ +  +AY V+GDVYFDT K   YGK+S +K ++L  G + E N +K +P DF LWK    G   WD  +  GRPGWH ECS +  +YLG+ IDIH GG DL FPHHENE  Q+ A + K  ++ WMH G++NIN++KMSKS  NF   +D+   Y+   VR+F     Y NP+NF+ E L  +K  LE  +YN      F    ++E    EK +E       F +  +  + ++ N  + VS I E  K     L N N +E + L F    L     LT +L I++     + D +  EL+ K    K+ K F  +D  R+ L++
  S:     4 VKVYNTLTRTKEEFVPLEEGKVKMYVCGPTVYNYIHIGNARPFIIFDTLRRYLEYRGYDVTYVQNFTDVDDKIINRSHEEGISPEEVAAKYIKEYFVDCDGLGIKRATVH-PQVTDNIQQIIEFIKELEDKGYAYAVNGDVYFDTNKFEGYGKLSGQKQEDLEAGARIEVNDQKRHPMDFVLWKAKKEGEPGWDSPWGEGRPGWHIECSVMSKRYLGETIDIHAGGQDLTFPHHENEIAQSEARSGKTFSKYWMHNGYININDEKMSKSKGNFFTVRDISKLYDLEIVRFFMLSAHYRNPVNFSDEMLNQAKAGLER-LYNTKEKLEFTLSNLVESPLTEKEVELVKELDDFRQKFIDAMDDDVNTADAVSVIFELAK-----LINSNVDENSSLEFAKKCLDEFNELTGVLNIVNKKKDTVLDKDIEELIQKRTDAKKNKEFQLADDIRQQLLD 451
>gi|125974555|ref|YP_001038465.1| cysteinyl-tRNA synthetase [Clostridium thermocellum ATCC 27405] >gi|196251918|ref|ZP_03150583.1| cysteinyl-tRNA synthetase [Clostridium thermocellum DSM 4150] >gi|187629806|sp|A3DH43|SYC_CLOTH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|125714780|gb|ABN53272.1| cysteinyl-tRNA synthetase [Clostridium thermocellum ATCC 27405] >gi|196198676|gb|EDX93508.1| cysteinyl-tRNA synthetase [Clostridium thermocellum DSM 4150] (468 aa)
Score = 751, Expect = 1.4e-77, Identities = 173/439 (39%), Positives = 264/439 (60%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNIFKSHLIIEQKYN-EKNLEFD----KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL--LTKILGIIHVN---LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++Y+ +++  +E   +D+K +KMY CGPTVYN+ HIGN RP I FD L R     GYNV F+ N TDIDDK++ +A EE I   EL+  +  +YF   K + I  + +  PR +++I  I   I+K+    FAY VDGDVYF   K  +YGK+S++ L++L +G + + + +K +P DFALWK    G   WD  +  GRPGWH ECS + NKYLG+ IDIH GG DL FPHHENE  Q+ A N K  AR W+H G +N++ +KM+KS  NF   +D+   ++   +R+F     Y +P+NF+ E L  +KN LE   N + NL   K H   E+  + E+ L+      K+  IE + ++ N  + ++ I + +K  +  +   +      + F+LS +  L  +LGI   +   + D E  EL+ +  K ++EK++  +D+ R  L E  ++
  S:     1 MRLYNTLTRKKEEFHPIDEKEVKMYSCGPTVYNYFHIGNARPFIIFDTLRRYLEYKGYNVKFVQNFTDIDDKMIKRANEEGITVKELADKFINEYFVDAKGLGIKEATVH-PRATENIDAIIEMIKKLEEKGFAYNVDGDVYFSARKFTEYGKLSHQSLEDLELGARIDVDERKKDPMDFALWKAQKPGEPAWDSPWGKGRPGWHIECSAMANKYLGETIDIHSGGQDLVFPHHENEIAQSEAANGKPFARFWLHNGFINVDGEKMAKSKGNFFTVRDIAKTFDYEVIRFFMLSAHYRSPINFSAELLEQAKNGLERIYNCLDNLEYLKEHAQAEKITDSERELQNRLLGIKAKFIEAMDDDINTADAIAAIFDIVKEVNTNINATSNSSKEIIDFSLSLIKELGGVLGIAQKSRQKVLDKEIEELIERRQKARKEKDWKTADEIRDKLKEMGII 454
>gi|56961911|ref|YP_173633.1| cysteinyl-tRNA synthetase [Bacillus clausii KSM-K16] >gi|61216140|sp|Q5WLT3|SYC_BACSK Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56908145|dbj|BAD62672.1| cysteinyl-tRNA synthetase [Bacillus clausii KSM-K16] (466 aa)
Score = 751, Expect = 1.4e-77, Identities = 169/434 (38%), Positives = 257/434 (59%)
  Q:     6 FVSKTDKE---VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLN---IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRN-KNFEELNKLHFNLSYLLTKILGIIHVN----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           F S T+K+   V +++  +KMY CGPTVYN++HIGN RP I +D++ R     GY+VTF+ N TD+DDKI+  A E       ++  +   Y+     +N+  +++  PRV++ + DI  +I  +    FAY   GDVYF T K N YGK+S + LD+L  G + E + +K +P DF LWK      ++W   +  GRPGWH ECS +I K LGD IDIH GG DL FPHHENE  Q+ A+  K LA  WMH G +NINN+KMSKSL NF+LA D++ +Y+   VR+F     Y  P+NF+ E L  ++  LE   N + NL       + +  E+++ EK     +  + E+ ++FN  N +S + +  K ++I +   +  +++      L     ++LG+        L D E   L+ + N  ++E+NF+ +D+ R LL EK ++
  S:     5 FNSLTNKKEPFVPIEEGKVKMYCCGPTVYNYIHIGNARPPIVYDMVRRYLTYRGYDVTFVSNFTDVDDKIIRAANELGEEVAAVAERFIKAYYADTCALNVKEADLH-PRVTETMDDIIAFIADLEKKGFAYEAGGDVYFRTRKFNGYGKLSGQALDDLQSGARIEVDERKEDPLDFVLWKAAKPNEISWSSPWGEGRPGWHIECSAMIKKSLGDTIDIHAGGKDLTFPHHENEIAQSEALTGKKLANYWMHNGFVNINNEKMSKSLGNFVLAHDIIQQYSPEVVRFFMLTAHYRTPINFSDELLKGAEAGLERLKNTVANLQHRLAETADMGAEEEWLEKIAGAKQRFIEEMDDDFNSANAISVLFDLAKEANIYMSEAQTSKKVLNAFLELFAEFGEVLGVSFTQQEEELLDAEIEALIEERNVARKERNFARADEIRDLLKEKNIV 452
>gi|145956358|ref|ZP_01805354.1| hypothetical protein CdifQ_04000052 [Clostridium difficile QCD-32g58] (467 aa)
Score = 749, Expect = 2.6e-77, Identities = 178/435 (40%), Positives = 264/435 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN---IFKSHLIIEQKYNEKNLE-------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL-----LTKILGIIHV---NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           +K+Y+ +++T +E V L++  +KMYVCGPTVYN++HIGN RP I FD L R     GY+VT++ N TD+DDKI+N++ EE I   E+++ Y  +YF     + I  + +  P+V+D+I+ I  +I+++ +  +AY V+GDVYFDT K   YGK+S +K ++L  G + E N +K +P DF LWK    G   WD  +  GRPGWH ECS +  +YLG+ IDIH GG DL FPHHENE  Q+ A + K  ++ WMH G++NIN++KMSKS  NF   +D+   Y+   VR+F     Y NP+NF+ E L  +K  LE  +YN      F    ++E    EK +E       F +  +  + ++ N  + VS I E  K     L N N +E + L F    L     LT +L I++     + D +  EL+ K    K+ K F  +D  R+ L++
  S:     3 VKVYNTLTRTKEEFVPLEEGKVKMYVCGPTVYNYIHIGNARPFIIFDTLRRYLEYRGYDVTYVQNFTDVDDKIINRSHEEGISPEEVAAKYIKEYFVDCDGLGIKRATVH-PQVTDNIQQIIEFIKELEDKGYAYAVNGDVYFDTNKFEGYGKLSGQKQEDLEAGARIEVNDQKRHPMDFVLWKAKKEGEPGWDSPWGEGRPGWHIECSVMSKRYLGETIDIHAGGQDLTFPHHENEIAQSEARSGKIFSKYWMHNGYININDEKMSKSKGNFFTVRDISKLYDLEIVRFFMLSAHYRNPVNFSDEMLNQAKAGLER-LYNTKEKLEFTLSNLVESPLTEKEVELVKELDDFRQKFIDAMDDDVNTADAVSVIFELAK-----LINSNVDENSSLEFAKKCLDEFNELTGVLNIVNKKKDTVLDKDIEELIQKRTDAKKNKEFQLADDIRQQLLD 450
>gi|160881448|ref|YP_001560416.1| cysteinyl-tRNA synthetase [Clostridium phytofermentans ISDg] >gi|187629805|sp|A9KSM5|SYC_CLOPH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|160430114|gb|ABX43677.1| cysteinyl-tRNA synthetase [Clostridium phytofermentans ISDg] (470 aa)
Score = 747, Expect = 4.3e-77, Identities = 169/439 (38%), Positives = 260/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI---------IYNLNIFKSHLIIEQKYNEKNL--EFD---KSNLIELTNNFNLPNIVSFIEEKIKYSSILLR-NKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ ++K  +E + L +  + MYVCGPTVYN++HIGN RP++ FD + R     GY+V F+ N TD+DDKI+ KA EE +   E+S  Y  +Y    + +N+     + P+ ++ I  + + I++++    AY  +G VYF T    QYGK+S K +D+L  G +     +K++P DF LWK   +G   W   +  GRPGWH ECS +  KYLGDQIDIH GG DL FPHHENE  Q      K+ A+ WMH G LN++N+KMSKS  NF   +++ +EY    +R+F    +Y +P+NF+ + + +SKN LE I         +  +   K  L  E   +E  L  EFD   K     + ++FN  + +S I E +K S+  +    + E + K+  N++     ILG+       + D+E  +L+      ++ K+F++SD+ R LL+EK ++
  S:     1 MKIYNTLTKAKEEFIPLQEGKVSMYVCGPTVYNYIHIGNARPVVVFDTVRRYLEYKGYDVNFVSNFTDVDDKIIKKANEEGVSAHEISERYIKEYLKDTEALNVLPVTTR-PKATEEIDGMIDMIEELIEKGHAYEKNGTVYFKTRSFKQYGKLSKKNIDDLEAGARIAVADEKDDPMDFVLWKPKKVGEPAWSAPWCDGRPGWHIECSVMSKKYLGDQIDIHAGGEDLIFPHHENEIAQTECCTGKEFAKYWMHNGFLNVDNKKMSKSEGNFFTVREIFAEYAPAVLRFFLLSVNYRSPINFSRDIIESSKNGLERIQTAVEQLHFLAKVKAEKGELSTELTESESTLLKEFDALIKKFEDAMDDDFNTADAISSIFEMVKLSNTYVTVESSVEMIQKVLSNIT-TFCDILGLETEKKAEILDEEIEQLIADRQSARKAKDFAKSDEIRNLLLEKGII 457
>gi|153855861|ref|ZP_01996836.1| hypothetical protein DORLON_02858 [Dorea longicatena DSM 13814] >gi|149751829|gb|EDM61760.1| hypothetical protein DORLON_02858 [Dorea longicatena DSM 13814] (468 aa)
Score = 746, Expect = 5.3e-77, Identities = 175/439 (39%), Positives = 266/439 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS-----EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIY---NLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKI++ ++K  +E V L++  +KMYVCGPTVYN +HIGN RP+I FD + R F   GY+V ++ N TD+DDKI+ KA EE +   E+S  Y  +    +  +NI  +  K P  ++ I  + + IQ +++  FAY  +G VY+ T K   YGK+S+K LD+L  G++S     ED  +K +P DF LWK    G   W+  +S GRPGWH ECS +  KYLG+QIDIH GG DL FPHHENE  Q+ A N K+ AR WMH   LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ + +  SKN LE I+    NL     +   E   + +   F K+          + ++FN  + V+ I + +KY +     ++ +E  +  F+L   LT +LG+I      + D++  +L+ +    ++ K+F+ +D  R  L+EK ++
  S:     1 MKIFNTMTKKKEEFVPLEEGKVKMYVCGPTVYNFIHIGNARPMIVFDTVRRYFEYKGYDVNYVSNFTDVDDKIIKKAIEEGVTADEISKRYIAECKKDMDGMNIKPAT-KNPLATEEICGMVDMIQTLIDKGFAYEKNGTVYYSTRKFKDYGKLSHKNLDDLRSGERSLLVSGED--EKEDPLDFVLWKPKKEGEPAWESPWSEGRPGWHIECSEMSKKYLGEQIDIHAGGEDLVFPHHENEIAQSEAANGKEFARYWMHNAFLNIDNRKMSKSLGNFRTVREISEQYDLQVLRFFMLSAHYRSPLNFSADLMEASKNGLERIVNAADNLKFLMENAKAEAITDAEAENFAKTEEFVAGFEKAMDDDFNTADAVAAIFDLVKYINTTTDAESSKEYLQKLFDLLVKLTGVLGLIVDKKEEILDEDIEKLIEERQAARKAKDFARADAIRDELLEKGII 455
>gi|110004174|emb|CAK98512.1| probable cysteinyl-trna synthetase protein [Spiroplasma citri] (445 aa)
Score = 746, Expect = 5.6e-77, Identities = 192/439 (43%), Positives = 274/439 (62%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDL-----KFSTGRPGWHTECSCLINKYL-GDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI-IEQKYNEKNLEFD-KSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNL-SYLLTKILGIIHVN----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +++   + S  KK I +Y CGPTVYN++HIGN R IIT D+L          V +I N TDIDDKI+ KA  E+  E E++ +Y   + + +  +N+ T   K+ RV+DH+KDI  +IQK+V    AY V+G VYFD  K   QYG+++NKK+ EL    + E +  K++  DFALWKQTT G+++       K   GRPGWHTEC+ LI+K+   + IDIH GGIDL FPHHENE IQ  A NNK++A+IWMH GHLN+ ++KMSKSL+N IL +D +  Y  NT+R+  Y T+Y+ PLN T   +I+++ + E I   L     +L+  +  YN      + K  L EL NN N PN+++ I +  K  +  LR+K      KL+  L S     I  I++ N    L   E  + L +W K K  K+F ++D+ RK+L+EK +L
  S:     1 MKLYNTLTRNFTDYSQTKK-INIYGCGPTVYNYIHIGNARAIITVDLLVSFLQFQQIEVNYIQNYTDIDDKIIAKAAAEHKTEQEIAEFYIKAFEEDVFNLNVRTPT-KWVRVTDHVKDIVTFIQKLVKINAAYEVNGSVYFDIAKYQTQYGQLANKKISELEANARIEHDANKHSQYDFALWKQTTEGISFPFYDQKGKLYQGRPGWHTECAVLIDKFFHKETIDIHAGGIDLVFPHHENERIQFFAKNNKEIAKIWMHNGHLNVADKKMSKSLNNTILVRDFIKLYGANTLRYLLYATNYTQPLNVTETLIISAQGETEKIFKVLKAINLYLVEYDLNYNLTQHGHNVKEVLAELANNLNSPNVLNIISKMTKIINTQLRDK------KLNLQLASDFYNIIFNIMNFNFKLPLISSEIRKYLLEWIKSKNNKDFVKADELRKVLVEKDIL 445
>gi|42561475|ref|NP_975926.1| cysteine-tRNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61216209|sp|Q6MS23|SYC_MYCMS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|42492974|emb|CAE77568.1| cysteine-tRNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (441 aa)
Score = 745, Expect = 7.2e-77, Identities = 188/419 (44%), Positives = 272/419 (64%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL---EFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           I +Y CGPTVYN++HIGN RPI+  DVL R        V ++ NITDIDDKI+ KA E N+ ELE+S  Y + Y + LK++NI+  + K   +S  + ++ ++I+ +V+   AY++DGDVYFD  K  N+Y K+S  KLDEL+ G + E + KK+   DF+LWK+T IG+ WD  F  GRPGWHTEC  LI++Y   Q IDIH GGIDLKFPHHENE IQ IA NNK+LA IW+H GHL IN++KMSKSL N IL +D + ++N NT+RW F  T+Y+ PLN  +++LI   N+    + NL+      II++    K++   E+       + ++ N   ++S I+  IK  +  + +KN +  N L  +L+Y+L  +LG  +V    FD++  EL  KW +L + K F+++D  R  L+E+ +L
  S:    19 INLYCCGPTVYNYIHIGNARPILLVDVLIRYLKSRSIKVNYLQNITDIDDKIILKALENNLNELEVSQKYTSAYLEDLKSLNINQPD-KIILISQKMNEMIDFIKNLVDINAAYVLDGDVYFDIKKYENEYCKLSGYKLDELISGKRVEIDSKKHYSLDFSLWKKTDIGIKWDSVFGLGRPGWHTECVLLIDEYFNHQTIDIHVGGIDLKFPHHENERIQFIAKNNKELAHIWLHNGHLQINDEKMSKSLGNVILVRDFIKKHNKNTLRWIFLTTNYTQPLNI-SDDLIYQANKFFEKLTNLSKKTIQFIIKKDLKIKSINSSEYINKFNEYMEDDLNTSLVLSLIDLLIKQINKNIVDKNLDNFNLLIGSLNYIL-DVLGFDNVFNYKFDNKTKELFLKWQELVKNKEFNKADLIRNKLIEQGIL 441
>gi|15606347|ref|NP_213726.1| cysteinyl-tRNA synthetase [Aquifex aeolicus VF5] >gi|6831683|sp|O67163|SYC_AQUAE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|2983551|gb|AAC07125.1| cysteinyl-tRNA synthetase [Aquifex aeolicus VF5] (495 aa)
Score = 744, Expect = 1.0e-76, Identities = 167/435 (38%), Positives = 268/435 (61%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNLNIFKSHLIIEQKYN------EKNLEFDKSNLIELTNNFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYLLT---KILGIIH------------------VNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLME 435
           ++IY+ +S K ++ V ++   + +Y CG TVY+  H+G+ R +I FDV  R    LGY V F+ N TD+DDKI+N+AK+E    + ++  Y  +Y+  ++ I +  ++++ PRV++HI +I   IQK+V   +AY+V+GDVYF   K   YGK+S + ++EL+ G + E + KK +P DFALWK +  G   WD  +  GRPGWHTEC  ++ K+LG+ IDIHGGG+DL FPHHENE  Q  A+  K  AR WMH G + +  QKMSKSL N++  +++ ++Y+ + +R     T Y +PL+F+ E +   + +  +L+N I +L + K   ++E K        E+  EF+++    L+++FN P  +S + +      K+K  +         EL+   F    LL    KI G++                     +FD++ I+ L+   N  ++EK F  +D  R  L E
  S:     3 LRIYNTLSGKVEEFVPINPPKVLIYTCGVTVYDDSHVGHGRSLIVFDVFRRFLEHLGYQVKFVRNFTDVDDKIINRAKQECTDFMTIADRYIARYYVDMENIRVRPADVE-PRVTEHIPEIIEVIQKLVEKGYAYVVEGDVYFSVKKFKDYGKLSKRDIEELIAGARVEPSEKKRDPLDFALWKASKAGEPAWDSPWGKGRPGWHTECVAMVFKHLGETIDIHGGGLDLVFPHHENEIAQAEAITGKPFARYWMHNGLVTVGGQKMSKSLGNYVTLREVYTKYHPDVLRLLVLFTHYRSPLDFSWEKMEETLKAYERLKNAIEDLELLKKLQVVESKEGGTHPLYEQVKEFEENFYASLSDDFNTPEALSHVYKLVGELNKVKNKAYSEGKITDRELSAYEFASKSLLNTMKKIFGLLEDLYPECKVERVVERELEAGQVFDEKLIQILIEARNIARKEKVFKVADYIRDKLKE 475
>gi|169350895|ref|ZP_02867833.1| hypothetical protein CLOSPI_01669 [Clostridium spiroforme DSM 1552] >gi|169292481|gb|EDS74614.1| hypothetical protein CLOSPI_01669 [Clostridium spiroforme DSM 1552] (460 aa)
Score = 742, Expect = 1.5e-76, Identities = 173/439 (39%), Positives = 270/439 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG--DKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGD-QIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQ---LENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKL-HFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++++ ++   +E   L    + +YVCGPTVYN+VHIGN RP+I FDVL R F  LGY V F+ N TD+DDKI+  AK+E I E EL+  Y   Y D+ + +N+       PRV++ ++ I ++I  +V   +AY VDGDVYF  +K  +YG++S  K+++L+ G  ++ ++N KK    DFALWK+T  G+ +D  +S GRPGWHTEC  +IN    D +IDIHGGG DLKFPHHENE  Q++A ++  +A  WMH   +NI+NQKMSKSL N I AKD++++   N  +WF   + Y NPLN T   L N K +   ++N++  ++++    +     NE   E     +  L ++ N    ++ I  ++K  + L+R K  ++ + L ++N    +  ++G ++  +    + +EL  KW + K+ KNF  +DK R  L+ K ++
  S:    16 MRLFNTLTNKKEEFKPLRDGEVSIYVCGPTVYNYVHIGNTRPMIVFDVLRRTFEYLGYKVIFVSNFTDVDDKIIKAAKQEGISEKELTDKYIKAYEDVRRDLNLLFPTYA-PRVTNTMEAIISFIDDLVKTGYAYEVDGDVYFRVSKIEEYGQLSGIKIEDLVAGASERVDENNKKEESTDFALWKKTDEGIRFDSPWSKGRPGWHTECVVMINDIFQDGKIDIHGGGQDLKFPHHENEIAQSMACHHHPIAHTWMHNQMINIDNQKMSKSLGNVIWAKDMINDLGCNVYKWFMLSSHYRNPLNLTDAVLNNVKKEVAKVDNVVKTVSLYLQ--VNGLDGNEYCKETVDVMVDALEDDLNTSLALTQILNQVKVLNQLMRVKEKDDESILMNYNTLMKMVTVIGFVYQPHQLSLDELELYKKWLEAKEVKNFDVADKLRSELISKGII 460
>gi|13508095|ref|NP_110044.1| cysteinyl-tRNA synthetase [Mycoplasma pneumoniae M129] >gi|2500964|sp|P75423|SYC_MYCPN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|1674171|gb|AAB96128.1| cysteinyl-tRNA synthetase [Mycoplasma pneumoniae M129] (437 aa)
Score = 740, Expect = 2.9e-76, Identities = 162/430 (37%), Positives = 257/430 (59%)
  Q:    10 TDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++ V L++K I +Y+CGPTVYN +H+GN RP+I FDVL R+     Y V F+ NITDIDDKI+  A+++ I E +L     T Y  +LK +NI    +K  +V+D I  +  YI ++V   FAY+   G+ YF  ++  QYG ++N+ ++   + D++ D   K N  DF LWKQTT G+ W+  +  GRPGWH EC+ LI+    DQ+ IHGGG+DLKFPHHENEN  ++A+ +K L + WMH+GHL   NQKMSKSL NF+LA D L+ ++   +RW FYQ  Y +PL+ +   +  + + ++ I   +N+ ++  +  ++      +  +     L NN N  N ++ I + +K  +  +  +N   L +   +L + L  ILGI   ++     ++L+ KW  L++     ++D+ R+ L++K LL
  S:    15 SNQSVVLEQKQINIYLCGPTVYNDLHLGNTRPLIVFDVLQRVLQAAQYKVQFVQNITDIDDKIIKIAQQQEISEAQLCKQQITAYKSLLKKLNILP--IKHLQVTDKIDKMPGYIARLVKKGFAYVSPLGNTYFSVSQLPQYGILANRVVET--IEDEATD---KRNKLDFVLWKQTTAGVKWNSPWGWGRPGWHVECAFLIDYSFKDQLTIHGGGVDLKFPHHENENAMHMALYDKPLTQHWMHIGHLMFENQKMSKSLQNFLLAVDFLTIHDFRILRWLFYQKHYYHPLDLSQSLIEQACSDIKRIQKAVNVCRTWFVYSEQSAIPAPKQFEPVFKALLNNLNFANAITHIWKLVKQINHDVSKQNLSGLKEHLSHLEWALN-ILGIGFKSIHTKLNVQLIKKWASLRKNGQLDKADEVRQKLIKKGLL 437
>gi|83319731|ref|YP_424102.1| cysteinyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|109894910|sp|Q2ST11|SYC_MYCCT Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|83283617|gb|ABC01549.1| cysteinyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (441 aa)
Score = 739, Expect = 3.6e-76, Identities = 200/439 (45%), Positives = 280/439 (63%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNF-----NLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++YD +SKT K ++  KK I +Y CGPTVYN++HIGN RP+I  DVL R        + ++ NITDIDDKI+ KA + N+ ELE+S  Y   Y + L+++NI+  + K   +S+ + ++  +I+ +V+ K AY +DGDVYFD  K  N+Y K+S  KLDEL+ G + E + KK    DF+LWK+T IG+ WD  F  GRPGWHTEC  LI++Y   Q IDIH GGIDLKFPHHENE IQ IA NNK+LA IW+H GHL IN++KMSKSL N IL KD + ++N NT+RW F  T+Y+ PLN  +++LI   N+    + NL+      II  K + K     +S  I+  NN+     N   ++S I+  IK  +  + +   +  N L  +LSY+L  +LG   V    F  E  EL  KW +L ++K F ++D  RK L+E+ +L
  S:     1 MQLYDSLSKTKKNLN--KKTINLYCCGPTVYNYIHIGNARPVILVDVLTRYLKSRNIKINYLQNITDIDDKIILKALDNNLTELEISQKYTKAYLEDLESLNINQPD-KIILISEKMNEMVKFIKDLVDIKAAYELDGDVYFDIKKYQNEYCKLSGYKLDELISGKRIEIDSKKKYSLDFSLWKKTQIGIKWDSFFGLGRPGWHTECVLLIDEYFNHQTIDIHVGGIDLKFPHHENERIQFIAKNNKELADIWLHNGHLQINDEKMSKSLGNVILVKDFIKKHNKNTLRWIFLTTNYTQPLNI-SDDLIYQANKFFEKLTNLSKKTIQFII--KNDLKISLIKQSKYIDQFNNYMDDDLNTSLVLSLIDSLIKQINKNILDNISDNFNLLISSLSYIL-DVLGFKDVFNYKFKKEIKELFLKWQQLVKDKEFDKADLIRKDLIEQGIL 441
>gi|160893352|ref|ZP_02074139.1| hypothetical protein CLOL250_00902 [Clostridium sp. L2-50] >gi|156865044|gb|EDO58475.1| hypothetical protein CLOL250_00902 [Clostridium sp. L2-50] (468 aa)
Score = 739, Expect = 3.8e-76, Identities = 164/439 (37%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL-------KKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE-----FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKI++ +++T +E V +++  + +YVCGPTVY+++HIGN RP+I FD L R     GY+V ++ N TD+DDKI+ +A EE +    +S  +  +    +  +N+  +    P+ ++ I D+   I+ ++    AY V+G VYF T     YGK+S+K +D+L  G ++E++        +K +P DF LWK    G   W+  +  GRPGWH ECS +  KY+GD IDIH GG DL FPHHENE  Q+ A N+K+ AR WMH G L INN+KMSKSL NF   +++  +Y    +R+F     Y +PLNF+ + +  SKN LE I+  ++  KS    + + ++ ++E     + K     + ++ N  + +S I E +KY++I + N   ++   L       L  ILGII      L D +   L+N+  + ++ KNF+ +D+ R +L +K ++
  S:     1 MKIFNTLTRTKEEFVPINEGKVGIYVCGPTVYDYIHIGNARPMIVFDTLRRYLTYKGYDVNYVSNFTDVDDKIIKRANEEGVDSKVISERFIAETKKDMAAMNVQEATTH-PKATEEIPDMIEMIKTLIEKGHAYEVNGTVYFRTRSFADYGKLSHKNIDDLESGHRAENHQLKVSGQDEKEDPLDFVLWKPKKEGEPFWESPWGEGRPGWHLECSVMSKKYIGDIIDIHAGGEDLIFPHHENEIAQSEAANDKEFARYWMHNGFLKINNEKMSKSLGNFFTVREIADKYPLQVIRFFMLSAHYRSPLNFSADLVEASKNGLERILTAVDKLKSLAPADVEGSDVSVEAELDGYTKRFETAMDDDLNTADAISVIFELVKYTNINISNDTPKKTVDLAIRTIEKLCDILGIITEREEELLDSDIEALINERQEARKAKNFARADEIRNMLSDKGII 455
>gi|147676630|ref|YP_001210845.1| cysteinyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] >gi|187629838|sp|A5D5M0|SYC_PELTS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|146272727|dbj|BAF58476.1| cysteinyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] (484 aa)
Score = 737, Expect = 6.6e-76, Identities = 137/327 (41%), Positives = 199/327 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL 327
           M+IY+ +++  +     +   + MYVCGPT YN++H+GN RP++ FD + R  +  GY V F+ N TD+DDKI+N+A+EE    L L+  Y  +YF     +N+  ++ + P VS+HI DI   + ++V    AY+VDG+VYF+  K   YGK+S + L+++  G + E + +K +P DFALWK    G   WD  +  GRPGWH ECS +  KYLG   DIHGGG DL FPHHENE  Q+ A   +   R WMH G + +N +KMSKSL NF L +D+L+++    VR+F   T Y +PL+F  E +  +   LE I  +L +    L
  S:     1 MEIYNTLTRRKENFQPREPGRVCMYVCGPTTYNYIHLGNARPLVFFDTVRRYLIHKGYEVLFVQNFTDVDDKIINRAQEEGDDPLALARRYIGEYFKDADALNVRRAD-RHPLVSEHIPDIIKMVDELVKKGAAYVVDGNVYFEVRKFAGYGKLSGRTLEDMQAGARVEVDPRKRDPLDFALWKAAKPGEPCWDSPWGPGRPGWHIECSAMSLKYLGTNFDIHGGGYDLIFPHHENEIAQSEAATGQPFVRYWMHNGFITVNEEKMSKSLGNFFLVRDILAKFPPELVRFFLLSTHYRSPLDFDGEKMAAAGRGLERIKTSLRLLYEAL 328
>gi|152973937|ref|YP_001373454.1| cysteinyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|187629791|sp|A7GK01|SYC_BACCN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|152022689|gb|ABS20459.1| cysteinyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] (465 aa)
Score = 735, Expect = 9.3e-76, Identities = 169/439 (38%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++K +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       I E  + +Y+E       K   +H      PRV++++  I  +IQ++VN  +AY  +GDVY+ T +   YGK+S++ +++L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    EF  +    + ++FN  N ++ +     +++  LL     + + + + N   +L +ILG++     L D E   L+ K  + ++ ++F+ +DK R  L E+ ++
  S:     3 IHIYNTLTRQKEEFIPLEEKKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEHKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIAERFIEAYFEDVTALGCKHATVH------PRVTENMDIIIEFIQELVNKGYAYESEGDVYYRTKEFEGYGKLSHQAIEDLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGKGRPGWHIECSAMARKYLGDSIDIHAGGQDLSFPHHENEIAQSEALTGKPFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTTYRNLKHRIESSTDLTDHNEKWLAEMKEFQSAFEAAMDDDFNTANAITELYNLANHANQYLLEEHTSKVVIEAYINQLEMLFRILGLVFTKEELLDKEIEALIQKRIEARKNRDFALADKIRDDLKERNII 452
>gi|164686505|ref|ZP_02210533.1| hypothetical protein CLOBAR_00070 [Clostridium bartlettii DSM 16795] >gi|164604516|gb|EDQ97981.1| hypothetical protein CLOBAR_00070 [Clostridium bartlettii DSM 16795] (474 aa)
Score = 735, Expect = 1.2e-75, Identities = 169/439 (38%), Positives = 269/439 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENII-------YNLNIFKSHLIIEQ--KYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV----NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+Y+ +S+  +E   +++  +KMYVCGPTVYN +HIGN RP I FD L R     GY+VTF+ N TD+DDKI+ ++ EENI   E+++ Y  +YF     + I  +++  P+V+D+I+ I  +++++ +  +AY V+GDVYFDT K   YGK+S  K +EL  G + E N +K +P DF LWK    G   W   +  GRPGWH ECS + N+YLG+ IDIH GG DLKFPHHENE  Q+ A + K+ +  W+H  ++N+NN+KMSKSL NF   +++   Y+   VR F   T Y NP+NF+ E L  SK  LE +        + +N  +   + E+  K  ++   F +  +  + ++ N  + VS I E  K+ +  +   + +E  +   +    LT +L I++     ++ D+E  +L+ +  + K+ KNF  +D+ R+ L++K ++
  S:     9 VKLYNTLSRKKEEFKPIEEGKVKMYVCGPTVYNFIHIGNARPFIIFDTLRRYLEYRGYDVTFVQNFTDVDDKIIKRSHEENITPEEVATKYIKEYFVDADGLGIKRASVH-PQVTDNIEQIIAFVKELEDKGYAYAVNGDVYFDTKKFKDYGKLSGIKQEELEAGARIEVNDQKRHPMDFVLWKAKKEGEPGWASPWGEGRPGWHIECSVMSNRYLGETIDIHAGGQDLKFPHHENEIAQSEARSGKNFSNYWLHNEYINVNNEKMSKSLGNFFTVREISEIYDLEVVRLFMLSTHYRNPINFSDEILNQSKAGLERLYNAKEKAEFTINNLEDSKMTEEEAKLQDELASFRQKFIDAMDDDVNTADAVSAIFELAKFMNSNITENSSKEFAQKALDEFNELTGVLNIVNKDKKEDILDEEIEKLIEQRTEAKKNKNFQLADEIRQQLLDKGIV 461
>gi|78044929|ref|YP_361143.1| cysteinyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|109894889|sp|Q3A9P1|SYC_CARHZ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|77997044|gb|ABB15943.1| cysteinyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] (465 aa)
Score = 734, Expect = 1.3e-75, Identities = 168/439 (38%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNL---NIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY-LLTKILGIIHVNLFDDEAIE--------LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ ++KT +E +  +   + MYVCGPT YN++HIGN RPI+ FD + R F   G+ V ++ N TDIDDKI+N+A EE I  +EL   Y  +YF     + +  + +  P+V++HI +I   ++ ++   +AY V+G+VYF     + YGK+S + L+EL  G + E + KK NP DFALWK+   G   W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ A   K  AR WMH G + +N +KMSKSL NF L +++L ++    VR+F   T Y +PL+F  + L  +K  LE   N + NL   N       IE +    N   D +  +E  ++FN    ++ + E +++ +  + + N    +K  F  +  + T++ G I   + +  A E        L+    +LK+EK +  +D  R  L ++ ++
  S:     1 MKIYNTLTKTKEEFIPREPGKVYMYVCGPTTYNYIHIGNARPIVFFDTVRRYFEYKGFEVIYVQNFTDIDDKIINRALEEGISPIELGQKYIIEYFKDADRLGVKRATVH-PKVTEHIPEIIEMVKGLIEKGYAYEVEGNVYFAVDSFSDYGKLSGRDLEELKAGARVEVDEKKKNPLDFALWKKAKPGEPYWESPWGPGRPGWHIECSAMSLKYLGENFDIHGGGADLVFPHHENEVAQSEAFTGKPFARYWMHNGFITVNQEKMSKSLGNFFLVREILEKFPGRVVRFFLLSTHYRSPLDFDDKKLNEAKAALERVDNFVQNLKEVNPLPGEARIEIQEKITNFLRDFNEAME--DDFNTAQAMASLFELVRFGNTQIASGNLTAGDKKLFEEALNVYTQVFG-IEFGVLEKIAGEDITPFVELLIEVRARLKKEKKYDLADFIRDELKKQGII 452
>gi|154502843|ref|ZP_02039903.1| hypothetical protein RUMGNA_00658 [Ruminococcus gnavus ATCC 29149] >gi|153796726|gb|EDN79146.1| hypothetical protein RUMGNA_00658 [Ruminococcus gnavus ATCC 29149] (468 aa)
Score = 732, Expect = 2.4e-75, Identities = 171/439 (38%), Positives = 269/439 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS-----EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENII-------YNLNIFKSHLIIEQKYNE--KNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +SKT +E V L++  +KMYVCGPTVYN +HIGN RP+I FD + R F   GY+V F+ N TD+DDKI+ KA EE +   E+S  Y  +    ++ +N+  +  K P  ++ I  + + IQ +++  +AY  +G VY+ T K   YGK+S+K LD+L  G +S     ED  +K +  DF LWK    G   W+  +S GRPGWH ECS +  KYLG+QIDIH GG DL FPHHENE  Q+ A N KD ++ W+H G LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ E +  +KN LE I+       + L   K+  + E++  +  K+ EF +     + ++FN  + ++ + + +K+ +     ++ +E  +   +    LT +LGII      +  D+   L+ +    ++E+NF+ +D+ R  L+ K ++
  S:     1 MKLYNTMSKTKEEFVPLEEGKVKMYVCGPTVYNFIHIGNARPMIVFDTVRRYFEYKGYDVNFVSNFTDVDDKIIKKANEEGVTAEEISKRYIEECKKDMEGMNVKPAT-KNPLATEEIGGMIDMIQTLIDKGYAYEKNGTVYYRTRKFEGYGKLSHKNLDDLQSGGRSLLVTGED--EKEDSLDFVLWKPKKEGEPAWESPWSEGRPGWHIECSEMSKKYLGEQIDIHAGGEDLIFPHHENEIAQSEAANGKDFSKYWLHNGFLNIDNRKMSKSLGNFFTVREIGEKYDLQVLRFFMLSAHYRSPLNFSAELMEAAKNGLERIVTAAEHLKFLLEGAKTENMTEKEQAKIVKSQEFTRKFEKAMDDDFNTADAIAAVFDLVKFINTNTDGESSKEYLQNLLSQLVALTDVLGIIVEKEQEMLADDIEALIAERQAARKERNFARADEIRDELLAKGII 455
>gi|163764763|ref|ZP_02171817.1| translation initiation factor IF-1 [Bacillus selenitireducens MLS10] >gi|160354789|gb|EDP81448.1| translation initiation factor IF-1 [Bacillus selenitireducens MLS10] (467 aa)
Score = 732, Expect = 2.4e-75, Identities = 151/424 (35%), Positives = 260/424 (61%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL-------ENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKN-----FEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++  +KMYVCGPTVYN++HIGN RP + FD++ R     GY+VT++ N TD+DDKI+  A E +   + ++  Y   Y++  + + +  +++  PRV++ + DI  +I ++++  +AY   GDVYF T K + YG++S + LD+L  G + +   KK +P DF LWK    G + W   +  GRPGWH ECS ++ K+LGD IDIH GG DL FPHHENE  Q+ A+N + +A  W+H G++NI+N+KMSKSL+NFIL  D++ +++ + VR+F     Y +P+NF+ E L  +K  L       EN+ Y L         + K+     +  +  +  + ++FN  N V+ + + ++ ++I L  K+      E   K   ++++    +LGI       L D++  +L+ +  + +++++F+ +D+ R  L ++ ++
  S:    19 IEEGKVKMYVCGPTVYNYIHIGNARPAVVFDMVRRYLEYRGYDVTYVSNFTDVDDKIIKAANELDEDVMTVAERYIAAYYNDTEALGVRKADLH-PRVTESMDDIITFITRLIDKGYAYESSGDVYFRTRKFDTYGQLSQQSLDDLQAGARIQVEEKKEDPLDFVLWKTAKEGEIAWSSPWGEGRPGWHIECSAMVKKHLGDTIDIHAGGQDLSFPHHENEIAQSEALNEQRMANYWIHNGYINIDNEKMSKSLNNFILVHDIIRQFDPDVVRFFIVNAHYRSPINFSDEQLETAKTSLERIQTTYENLTYRLGESADLGGGQDKWFALIRKEGERFIASMDDDFNSANAVAVMFDLVRQANIYLTEKHTSKEVLEAFLKQFDDMAF----VLGIAVKRQAELLDEDVEQLIEERIQARKDRDFARADEIRDSLKDQGII 453
>gi|15896425|ref|NP_349774.1| cysteinyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] >gi|21264018|sp|Q97ED6|SYC_CLOAB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|15026246|gb|AAK81114.1|AE007813_1 Cysteinyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] (464 aa)
Score = 731, Expect = 2.7e-75, Identities = 168/439 (38%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNE-----KNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ +++  +E V +    ++MYVCGPTVYN  HIGN R  I FD + + F   GY V FI N TDIDDK++ KA  E +   EL   Y  +Y++    +N+  +    PR +++I  I ++++ + +  +AY +DGDVYF+T    +YGK+S + L++ + G     + +K +P DFALWK    G  +W+  +  GRPGWH ECSC+    LGD IDIH G IDL FPHHENE  Q+ A   K  ++ WMH  +LNINN+KMSKSL+NF+ A+D+L EY+   +R F     Y  PLNFT E++  +K  LE +   +N   S L    + N+     K L+  +   IE + ++FN  + +S I +  K  +I +  K+ +   +   +L   L K LGI   +  +  +DE   L+ +    ++ K+++ +DK R  L E+ ++
  S:     1 MKIYNTMTRKKEEFVPVKPNEVQMYVCGPTVYNFFHIGNARTFIVFDTVRKYFEYRGYKVNFIQNFTDIDDKMIAKANNEGVSVKELGDRYIKEYYEDADGLNLERATCN-PRATEYIGKIIDFVKGLQDEGYAYEIDGDVYFNTNAFKEYGKLSGQNLEDRMAGATIAVDDRKKSPADFALWKSEKPGEPSWESPWGKGRPGWHIECSCMARDLLGDTIDIHAGAIDLIFPHHENEIAQSEARTGKPFSKYWMHAAYLNINNEKMSKSLNNFLTARDILKEYDAEVIRLFLLSAHYRTPLNFTEESIEAAKTSLERLYNTINNLGSLLNNTAESNDDSEYLKALDSYREKFIEKMDDDFNTADGISVIFDLAKDINININGKSSKAAVEKAISLMRELGKPLGILQKVEKHNLEDEIQNLIEQRQNARKNKDWALADKIRDDLKERGIV 449
>gi|23097554|ref|NP_691020.1| cysteinyl-tRNA synthetase [Oceanobacillus iheyensis HTE831] >gi|30316161|sp|Q8ETZ9|SYC_OCEIH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|22775777|dbj|BAC12055.1| cysteinyl-tRNA synthetase [Oceanobacillus iheyensis HTE831] (468 aa)
Score = 731, Expect = 3.0e-75, Identities = 170/439 (38%), Positives = 268/439 (61%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELT------------NNFNLPNIVSFIEEKIKYSSILLRNK--NFEELNKLHFNLSYLLTKILGIIHVNLFD------DEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++IY+ +++  KE+   L++  +KMYVCGPTVYN++HIGN RP I FD + R     G++V ++ N TD+DDKI+  AK+       L+  +   Y + +  + +  +  K PRV D + DI  +I  ++   +AY  DGDVYF     + YGK+S++ +DEL  G + +   KK +P DFALWKQ     + W   +  GRPGWH ECS ++ K+LGD IDIH GG DL FPHHENE  Q+ A+N +  A  WMH G++NI+N+KMSKSL NF+LA+DL+  ++   +R+F     Y NP+NFT   L ++K  LE I         H +  ++ +  NL  D +  ++L             ++FN  N +S + +  K +++ L+    + E ++     +S +LT +LGI   N+ +      DE IE L+ + N+ ++ +NF+ +D+ R +L EK ++
  S:     3 IQIYNTLTR-QKEIFKPLEEGKVKMYVCGPTVYNYIHIGNARPAIVFDTVRRYLEYRGFDVDYVLNFTDVDDKIIKTAKDVGEEVPVLADRFVNAYLEDVGALGVKKAT-KNPRVMDTMDDIIAFISALIEKGYAYEADGDVYFKPRSFDTYGKLSHQSIDELRSGARIQVGEKKEDPLDFALWKQAKDDEIAWKSPWGEGRPGWHIECSAMVKKHLGDTIDIHAGGQDLTFPHHENEIAQSEAMNGETFANYWMHNGYINIDNEKMSKSLGNFVLARDLIQAHDPRVLRFFMLSVHYRNPINFTEALLESAKTSLERIQT-----AYHNLSHRRDSSLNLTNDDAKWLQLVSAAMSKFEQDMDDDFNTANAISVLFDLSKEANVYLQENQTSTEVIDAFQDAISQILT-VLGI---NILEDEETLLDETIEALIKERNEARKNRNFARADEIRDMLKEKGIV 454
>gi|168187713|ref|ZP_02622348.1| cysteinyl-tRNA synthetase [Clostridium botulinum C str. Eklund] >gi|169294420|gb|EDS76553.1| cysteinyl-tRNA synthetase [Clostridium botulinum C str. Eklund] (466 aa)
Score = 729, Expect = 4.8e-75, Identities = 169/439 (38%), Positives = 265/439 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLNIFKSHLII-----EQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD---EAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+++ +++  +E   +    + MYVCGPTVYN+ HIGN R  + FD + R F   GY V FI N TDIDDK++ KA EENI   EL   +  +Y+     +NI  + +  PR ++++ +I  +++ +++  +AY V+GDVYF+T +  +YGK+S + LD+L  G +   + +K +P DFA+WK    G  +WD  +  GRPGWH ECSC+ +K LGD IDIH GG DL FPHHENE  Q+ A N K  A  WMH  +LNI+N+KMSKSL+NF   +++L +Y+   VR F     Y  PLNF+ E L ++K    +L N I NL      + I     ++K   KNL   K   IE + ++FN  + ++ I + +K  +  +  ++ +EL +    L   L K LGI+  +   D   E  +L+ +  + +++++++ +DK R  L  + ++
  S:     1 MKLFNTMTRQKEEFKPIKDGQVSMYVCGPTVYNYFHIGNGRTFLVFDTIRRYFEYRGYKVNFIQNFTDIDDKMIKKANEENITVKELGDRFIQEYYKDADGLNIKRATVN-PRATEYMDEIIEFVRDLIDKGYAYEVNGDVYFNTKQFKEYGKLSGQNLDDLQAGARISIDERKKDPMDFAIWKSEKPGEPSWDCPWGKGRPGWHIECSCMAHKLLGDTIDIHAGGADLVFPHHENEIAQSEARNGKAFAHYWMHSAYLNIDNKKMSKSLNNFFTTREILEKYDAEVVRLFMLSAHYRTPLNFSNELLQSAKASNERLYNAIGNLERLLDEVKIDKITEDEKEYVKNLNSYKEKYIEKMDDDFNTADAIAVIFDLVKDINTNINTESSKELVEYSLELIRELGKPLGILQKSTILDLNTEIEKLIEQRQQARKDRDWALADKIRDDLKARGIV 452
>gi|118442910|ref|YP_877177.1| cysteinyl-tRNA synthetase [Clostridium novyi NT] >gi|187629804|sp|A0PXS5|SYC_CLONN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|118133366|gb|ABK60410.1| cysteinyl-tRNA synthetase [Clostridium novyi NT] (466 aa)
Score = 728, Expect = 6.1e-75, Identities = 169/439 (38%), Positives = 264/439 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLNIFKSHLIIE-----QKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD---EAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+++ +++  +E   +    + MYVCGPTVYN+ HIGN R  + FD + R F   GY V FI N TDIDDK++ KA EENI   EL   +  +Y+     +NI  +    PR ++++ +I  +++ +++  +AY V+GDVYF T +  +YGK+S + LD+L  G +   + +K +P DFA+WK    G  +W+  +  GRPGWH ECSC+ +K LGD IDIH GG DL FPHHENE  Q+ A N K  A  WMH  +LNINN+KMSKSL+NF   +++L +Y+   +R F     Y  PLNF+ + L ++K    +L N I NL      + ++     +K   KNLE  K   IE + ++FN  + +S I + +K  +  +  ++ +EL +    L   L K LGI+  +   D   E  +L+ +  + +++K+++ +DK R  L  + ++
  S:     1 MKLFNTMTRQKEEFKPIKDGEVSMYVCGPTVYNYFHIGNGRTFLVFDTIRRYFEYRGYKVNFIQNFTDIDDKMIKKANEENITVKELGDRFIHEYYKDADGLNIKRATAN-PRATEYMDEIIQFVKDLIDKGYAYEVNGDVYFSTKQFKEYGKLSGQNLDDLQAGARISVDERKKDPMDFAIWKSEKPGEPSWNCPWGKGRPGWHIECSCMAHKLLGDTIDIHAGGADLVFPHHENEIAQSEARNGKTFANYWMHSAYLNINNKKMSKSLNNFFTTREILEKYDAEVIRLFMLSAHYRTPLNFSDDLLQSAKASNERLYNAIGNLERLLDEVKVDKVTENEKEYVKNLESYKEKYIEKMDDDFNTADAISVIFDLVKDINTNINTESSKELVEYSLELIRELGKPLGILQKSTMLDLNAEIEKLIEQRQQARKDKDWALADKIRDDLKARGIV 452
>gi|121535688|ref|ZP_01667492.1| cysteinyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] >gi|121305719|gb|EAX46657.1| cysteinyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] (370 aa)
Score = 728, Expect = 6.4e-75, Identities = 134/316 (42%), Positives = 198/316 (62%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNK-DLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +++Y+ ++K  +E V  +   +KMYVCG T YNH HIGN RP IT+DV+ R     G+ V  + N TDIDDKI+N A +E +    +++ Y   YF+++  +N+  +++ +PRVSDHI DI   +Q++++  +AY V GDVY+   K   YG++S + L+++  G + + + +K +P DFALWK    G   WD  +  GRPGWH ECS +  KYLG+  D HGGG DL FPHHENE  Q+ A   +    R W+H G + +N +KMSKSL NF L KD+L+ Y    +R+F   T Y +PL+F+ E L  +   LE +
  S:     3 LRVYNTLTKQKEEFVPREPGKVKMYVCGVTPYNHPHIGNARPFITWDVIRRYLEHRGFAVFHVQNFTDIDDKIINTANQEGVTWDTIANRYIAAYFEVMDKLNVRRAHV-YPRVSDHIGDIIAIVQRLIDKGYAYTVGGDVYYSVEKFAPYGQLSGRSLEDMKAGARIDVDERKRHPMDFALWKSAKPGEPAWDSPWGPGRPGWHIECSAMALKYLGNGFDFHGGGSDLIFPHHENEIAQSEAYTGEAPFVRYWLHNGFITVNEEKMSKSLGNFFLVKDILAHYPPEVLRFFILSTHYRSPLDFSDERLAEAGRSLERL 320
>gi|188159025|ref|ZP_02998470.1| cysteine-tRNA ligase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (441 aa)
Score = 728, Expect = 7.0e-75, Identities = 198/439 (45%), Positives = 283/439 (64%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNF--------NLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++YD +SKT K ++  KK I +Y CGPTVYN++HIGN RP++  DVL R        V ++ NITDIDDKI+ KA + N+ ELE+S  Y T Y + LK++NI+  + K   +S  + ++ ++I+ +V+   AY++DGDVYFD  K  N+Y K+S  KLDEL+ G + E + KK+   DF+LWK+T IG+ W+  F  GRPGWHTEC  LI++Y   Q IDIH GGIDLKFPHHENE IQ IA NNK+LA IW+H GHL IN++KMSKSL N IL +D   ++N NT+RW F  T+Y+ PLN  +++LI   N+    + NL+      II+      +L+    N  E  N F        N   ++S I+  IK  +  + +KN +  N L  +L+Y+L  +LG  +V    FD++  EL  KW +L + K F+++D  R  L+E+ +L
  S:     1 MQLYDSLSKTKKNLN--KKTINLYCCGPTVYNYIHIGNARPVLLVDVLIRYLKSRNIKVNYLQNITDIDDKIILKALDNNLNELEVSQKYTTAYLEDLKSLNINQPD-KIILISQKMNEMIDFIKNLVDINAAYVLDGDVYFDIKKYENEYCKLSGYKLDELISGKRIEIDSKKHYSLDFSLWKKTDIGIKWNSVFGLGRPGWHTECVLLIDEYFNHQTIDIHVGGIDLKFPHHENERIQFIAKNNKELAHIWLHNGHLQINDEKMSKSLGNVILVRDFNKQHNKNTLRWIFLTTNYTQPLNI-SDDLIYQANKFFEKLTNLSKKTIQFIIKN-----DLKIQSINSSEYINKFNEYMEDDLNTSLVLSLIDLLIKQINKDIVDKNLDNFNLLIGSLNYIL-DVLGFNNVFNYKFDNKTKELFLKWQELVKNKEFNKADIIRNKLIEQGIL 441
>gi|116493238|ref|YP_804973.1| cysteinyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] >gi|122265298|sp|Q03E41|SYC_PEDPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116103388|gb|ABJ68531.1| cysteinyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] (470 aa)
Score = 728, Expect = 7.4e-75, Identities = 163/435 (37%), Positives = 259/435 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS----EDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLN--IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK--NFEELNKLHFNLSYLLTKILGIIHVNLFDDEA--IELLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +S+T +    L    + MYVCGPTVYN++HIGN R II FD + R F   G+ V F+ N TD+DDK++N A+E+ I   EL+  Y   + + ++ +N+  + +  PR +++I DI  +I  +++  FAY VDGDVY+   K ++YG +S++ +DEL  G       E+  +K +P DFALWK      + W   + TGRPGWH ECS +  KYLGD  DIHGGG DL+FPHHENE  Q+ A   K  AR WMH G + +  +N+KMSKSL NF+   DL+ + N   +R+    T Y  P+ +T  +L ++KN LE   N   NLN  +  +    +    E+  + +   +  + ++FN  N ++ + E  +  ++       N E++N+L  + +  +  + GI    + +D+A   EL+ + ++ + +++F  SD+ R  L E
  S:     2 IKIYNTMSRTKETFKPLVDHKVSMYVCGPTVYNYIHIGNARSIIAFDTIRRYFEYRGFEVKFVSNFTDVDDKMINSAREQGITVPELADRYIGAFKEDVQAVNVEPATLN-PRATENIDDIIAFIADLMDKGFAYAVDGDVYYRARKFSKYGALSHQNIDELEQGASQHVDDEETARKEDPIDFALWKAAKGDEIAWKAPWGTGRPGWHIECSVMSTKYLGDTFDIHGGGEDLQFPHHENEIAQSEAKTGKQFARYWMHNGFVTVGDDNEKMSKSLGNFVTVHDLVQKINPQVLRFLMSTTQYRRPIQYTQASLQDAKNNLEKLQNAFINLNYRLQGAQGAADATVAEQAAQLETDFITAMDDDFNAQNGITVVYEFARLINVYSEKTAVNAEQINQLLTSYAK-MAAVFGIELKQIENDDAEIDELVKQRDQARADRDFETSDRLRNQLKE 451
>gi|15900500|ref|NP_345104.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] >gi|111657664|ref|ZP_01408394.1| hypothetical protein SpneT_02001141 [Streptococcus pneumoniae TIGR4] >gi|149005703|ref|ZP_01829442.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|149021553|ref|ZP_01835608.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|168490519|ref|ZP_02714662.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|168576506|ref|ZP_02722380.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] >gi|21264019|sp|Q97S25|SYC_STRPN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|14972066|gb|AAK74744.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] >gi|147762643|gb|EDK69603.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|147930249|gb|EDK81234.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|183575011|gb|EDT95539.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|183577730|gb|EDT98258.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] (447 aa)
Score = 727, Expect = 1.0e-74, Identities = 163/436 (37%), Positives = 252/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F+ +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFATADQIRDQLVTQ 431
>gi|169834403|ref|YP_001694075.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] >gi|168996905|gb|ACA37517.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] (457 aa)
Score = 726, Expect = 1.3e-74, Identities = 163/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   +KMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+AKEE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F+ +D+ R  L+ +
  S:    12 IKIYDTMSRDLREFVPIEDGKVKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYEVAYISNFTDVDDKIINRAKEEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMDDIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSAKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFATADQIRDQLVTQ 441
>gi|150015023|ref|YP_001307277.1| cysteinyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] >gi|187629800|sp|A6LPP1|SYC_CLOB8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|149901488|gb|ABR32321.1| cysteinyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] (466 aa)
Score = 725, Expect = 1.6e-74, Identities = 162/439 (36%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNIFKSHLI------IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD---EAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++++ +++  +E + +    +KMYVCGPTVYN  HIGN R  I FD + R     GY V F+ N TDIDDK++NKA +E I   EL   Y  +Y+    ++ I  + +  PR +++I DI  ++++++   FAY VDGDVY+ T K + YG++  + LD+L VG +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LGD IDIH GG+DL+FPHHENE  Q+ A+  K  A  W+H   +N++N+KMSKSL+NF  A+++L EY+++ +R+      Y   +NFT E L ++K+ +E   N I NL   K  +        E+KY +   ++ +  + ++ ++FN  + +S + +  K  +  +   +  EL +   ++   L   LGI+   +  D   E  EL+ K  + ++ K+F+ +DK R  L  + ++
  S:     1 MRVFNTLTRQKEEFIPIITGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYLEYRGYKVRFVQNFTDIDDKMINKANDEGITVKELGDKYIKEYYQDADSLKIERATVN-PRATEYIHDIIKFVEELIEAGFAYEVDGDVYYSTKKFDNYGRLVGQNLDDLQVGARISVDERKKDPMDFAVWKAQKPGEPAWESPWGPGRPGWHIECSCMAKKLLGDTIDIHAGGMDLRFPHHENEIAQSEALTGKTFANYWLHAAFVNVDNKKMSKSLNNFFTAREVLEEYSSDAIRFLMLSGHYRIQINFTKELLDSAKSSIERLYNCINNLENLKDEVTKKLMDEAEEKYLKSLDKYREKFIEKMDDDFNTADAISVLFDLTKDINNNVNINSSSELCEKAESMVRELGNPLGILQDRIEKDLETEIQELIEKRQQARKNKDFALADKIRDDLKSRNII 452
>gi|15902563|ref|NP_358113.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae R6] >gi|116517189|ref|YP_816017.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae D39] >gi|30316153|sp|Q8DQS8|SYC_STRR6 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|15458093|gb|AAK99323.1| Cysteinyl-tRNA synthetase [Streptococcus pneumoniae R6] >gi|116077765|gb|ABJ55485.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae D39] (447 aa)
Score = 725, Expect = 1.7e-74, Identities = 163/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F  +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIERGFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFETADQIRDQLVTQ 431
>gi|69245493|ref|ZP_00603457.1| Cysteinyl-tRNA synthetase, class Ia [Enterococcus faecium DO] >gi|68195744|gb|EAN10181.1| Cysteinyl-tRNA synthetase, class Ia [Enterococcus faecium DO] (470 aa)
Score = 724, Expect = 2.0e-74, Identities = 170/439 (38%), Positives = 259/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS---EDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--EFDKSNLI---------ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEE--LNKLHFNLSYLLTKILGIIHV--NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +++  +E + + K ++ MYVCGPTVYN++HIGN R  I FD + R F   GY V F+ N TD+DDKI+  A E  I   E++  +   + +  K +N+  + +  PRV DH+ DI  +IQ +V   +AY   GDVY+ T K   YGK+S++ +DEL VG      E+  +K +P DFALWKQ   G ++WD  +  GRPGWH ECS +  K+LG+ IDIHGGG DL+FPHHENE  Q+ A   K  A  WMH G++ I  +++KMSKSL NFI   +++   +   +R+F   T Y  P+ ++   +  +   L+ +    N F  +L   Q+   +NL  + DK  L+         E+ ++FN  N ++ + E  K+ +  L         L +     S  L+ I GI+     L D+E  +L+ + N+ +  ++F  SD+ R LL EK +L
  S:     2 IKIYNTLTRKKEEFIPIQKGHVGMYVCGPTVYNYIHIGNARSTIAFDTIRRYFEYRGYKVDFVSNFTDVDDKIIRTANELGITAPEVADRFIRAFEEDTKALNVEPATLH-PRVMDHMPDILAFIQVLVEKGYAYESSGDVYYRTRKFENYGKLSDQSIDELEVGASQRTGEEQQQKEDPLDFALWKQAKPGEISWDSPWGKGRPGWHIECSVMATKHLGETIDIHGGGQDLEFPHHENEIAQSEAKTGKKFANYWMHNGYVTIGEDDEKMSKSLGNFITVHEMIKNVDPQVLRFFMATTQYRRPIRYSETTMKEAATNLQRL---KNTF-DNLKFRQETASENLADDADKIALLENLEQRFIEEMDDDFNAANGITVVYELAKWLNTYLDQPKVSAAVLAQGEALFSQWLS-IFGILFTAEELLDEEIEQLIEERNQARSNRDFVRSDEIRDLLKEKGIL 456
>gi|153952840|ref|YP_001393605.1| cysteinyl-tRNA synthetase [Clostridium kluyveri DSM 555] >gi|187629803|sp|A5N4M6|SYC_CLOK5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|146345721|gb|EDK32257.1| CysS [Clostridium kluyveri DSM 555] (465 aa)
Score = 724, Expect = 2.0e-74, Identities = 171/439 (38%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI---IYNLNIFKSH------LIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M+I++ +++  +E V L    IKMYVCGPTVYN  HIGN R  + FD + R F   GY V F+ N TDIDDK++ KA +ENI   +L   +  +Y+     +NI  + +  PR + +I  I  +IQ +++  +AY VDGDVYF+  K N YGK+S + +++L  G + + + +K NP DFA+WK    G  +W+  +  GRPGWH ECSC+    LG+ IDIH GG DLKFPHHENE  Q+     K  A+ WMH   +NINNQKMSKSL+NF   +++L +Y  + +R F     Y  P+NF+ E L ++K+ L+ I   I NL    S       L  E KY E    + +  + ++ ++FN  + +S I + I+  +  +   +  E+ K    L   L   LGI+  +     + E   L+ K  K +++KN++ +DK R  L +K ++
  S:     1 MRIFNTMTRRKEEFVPLIPGEIKMYVCGPTVYNFFHIGNARTFVVFDTVRRYFEYKGYKVNFVQNFTDIDDKMIKKANDENITVQQLGDRFIDEYYRDADALNIKRATVN-PRATLYISKIIEFIQDLIDKGYAYSVDGDVYFNAKKFNNYGKLSGQNIEQLQSGARIDIDERKKNPMDFAVWKSEKKGEPSWESPWGMGRPGWHIECSCMAYNILGETIDIHAGGSDLKFPHHENEIAQSEGRTGKVFAKYWMHSAFVNINNQKMSKSLNNFFTTREILDKYEPDVIRLFMLSGHYRTPINFSIELLDSTKSALDRICNSIINLEELSSKVKNDGILDSEIKYKEHLNSYKQRYIEKMDDDFNTADAISVIFDLIRDINTNIDENSSMEIIKYSLALIRELGSPLGILQKSKRGSIETEVELLIEKRQKARKDKNWALADKIRDDLKDKGII 452
>gi|194396665|ref|YP_002037254.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae G54] >gi|194356332|gb|ACF54780.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae G54] (447 aa)
Score = 724, Expect = 2.1e-74, Identities = 163/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F  +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIERGFAYESQGDVYFRVEKSHNYAKLANKTLEDLDLGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFETADQIRDQLVTQ 431
>gi|167758881|ref|ZP_02431008.1| hypothetical protein CLOSCI_01226 [Clostridium scindens ATCC 35704] >gi|167663621|gb|EDS07751.1| hypothetical protein CLOSCI_01226 [Clostridium scindens ATCC 35704] (468 aa)
Score = 724, Expect = 2.1e-74, Identities = 168/439 (38%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS-----EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIY---NLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +SK  +E V L++  +KMYVCGPTVYN +HIGN RP+I FD + R F   GY+V ++ N TD+DDKI+ +A EE +   E+S  Y  +    +  +NI  +  K P  ++ I  + + IQ +++  +AY  +G VY+ T K  +YGK+S+K LD+L  G++S     ED  +K +P DF LWK    G   W+  +S GRPGWH ECS +  KYLG+QIDIH GG DL FPHHENE  Q+ A N K+ A+ WMH   LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ + +  SK+ LE I+    NL     +   E    E+   F K+          + ++FN  + ++ + + +KY +        +E  +  F+L   LT +LG+I      +  ++  +++ +    ++ K+F+ +D  R  L+ K ++
  S:     1 MKLYNTLSKQKEEFVPLEEGKVKMYVCGPTVYNFIHIGNARPMIVFDTVRRYFEYKGYDVNYVSNFTDVDDKIIKRAIEEGVSSDEISKRYIAECKKDMDGMNIKPAT-KNPMATEEICGMVDMIQTLIDKGYAYEKNGTVYYRTRKFEEYGKLSHKNLDDLRSGERSLLVTGED--EKEDPLDFVLWKPKKEGEPAWESPWSDGRPGWHIECSEMSKKYLGEQIDIHAGGEDLVFPHHENEIAQSEAANGKEFAKYWMHNAFLNIDNRKMSKSLGNFRTVREISQQYDLQILRFFMLSAHYRSPLNFSADLMEASKSGLERIVNAADNLKFLLGNAKSESMTQEEEAAFAKTAEYVQEFERAMDDDFNTADAIASVFDLVKYINTTADADKSKEFLQNLFDLLVKLTDVLGLIVDKKEEMLAEDIEKMIEERQAARKAKDFARADAIRDELLAKGIV 455
>gi|182683526|ref|YP_001835273.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CGSP14] >gi|182628860|gb|ACB89808.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CGSP14] (447 aa)
Score = 724, Expect = 2.2e-74, Identities = 164/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V    D  IE L+ K  + +  ++F+ +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDADIEDLIQKRQEARANRDFATADQIRDQLVTQ 431
>gi|148998267|ref|ZP_01825736.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|147755910|gb|EDK62954.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] (447 aa)
Score = 724, Expect = 2.2e-74, Identities = 163/433 (37%), Positives = 249/433 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F  +D+ R  L
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLDLGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMTKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFETADQIRDQL 428
>gi|148983973|ref|ZP_01817292.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] >gi|148992298|ref|ZP_01822021.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|149010789|ref|ZP_01832160.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|168482827|ref|ZP_02707779.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|168488279|ref|ZP_02712478.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP195] >gi|168492751|ref|ZP_02716894.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] >gi|147765270|gb|EDK72199.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147924120|gb|EDK75232.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] >gi|147928924|gb|EDK79936.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|172043769|gb|EDT51815.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|183573040|gb|EDT93568.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP195] >gi|183576856|gb|EDT97384.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] (447 aa)
Score = 723, Expect = 2.8e-74, Identities = 163/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F  +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFETADQIRDQLVTQ 431
>gi|163783157|ref|ZP_02178151.1| cysteinyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881491|gb|EDP75001.1| cysteinyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1] (489 aa)
Score = 722, Expect = 3.1e-74, Identities = 166/435 (38%), Positives = 263/435 (60%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLNIFKSHLIIEQK-----YNEKNLEFDKSNLIELTNNFNLP----NIVSFIEE--KIKYSSILLRNKNFEELNKLHFNLSYLLT---KILGIIH------------------VNLFDDEAIELLNKWNKL-KQEKNFSESDKYRKLLME 435
           MKI++ ++ K ++ V ++   + +Y CG TVY+  H+G+ R +I FD   R    LGY+VTF+ N TD+DDKI+N+AKEE    + +++ Y   Y+  ++ I +  ++++ PRV++H+K+I + IQ ++   +AY  DGDVYF       YGK+S +  +E+  G + E + KK +P DFALWK    G  +WD  +  GRPGWHTEC  +I K+LG+ IDIHGGG+DL FPHHENE  Q  AV  K  AR WMH G + +  QKMSKSL N++  K++ ++Y+ + +R     T Y +PL+F+ E +  ++   ++L+  I +  + K   +I  K       +K  E ++S    L+++FN P    +I S + E  K+K  +      +  EL    +   +LL    KI G++                     + D + ++LL +   L +QEK F  +D  R  L E
  S:     1 MKIHNTLTGKVEEFVPVNPPKVLIYTCGVTVYDDSHVGHGRSLIVFDTFRRFLEHLGYDVTFVRNFTDVDDKIINRAKEECTDFMTIANRYIASYYRDMEAIRVKPADVE-PRVTEHMKEIVDVIQSLIEKGYAYESDGDVYFSVRSFKDYGKLSKRSPEEMEAGARVEPSEKKRDPLDFALWKSAKAGEPSWDSPWGKGRPGWHTECVAMIFKHLGETIDIHGGGLDLVFPHHENEIAQAEAVTGKPFARYWMHNGLVTVGGQKMSKSLGNYVTLKEIYTKYHPDILRLLVLFTHYRSPLDFSWEKMEETQRAYDRLKGAIEDYEVLKELEVIPGKGGAHPLYDKVKEVEESFFESLSDDFNTPEALSHIFSLVSELGKVKNRTYSEGKIDESELGAYEYASRFLLNTLKKIFGLLEDLYPECEVRRVVERELEAGEVLDTKLVDLLIEVRTLARQEKQFRIADLIRDRLKE 472
>gi|168485706|ref|ZP_02710214.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] >gi|183571202|gb|EDT91730.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] (447 aa)
Score = 722, Expect = 3.2e-74, Identities = 163/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+   K V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F+ +D+ R  L+ +
  S:     2 IKIYDTMSRDLRKFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFATADQIRDQLVTQ 431
>gi|160947200|ref|ZP_02094367.1| hypothetical protein PEPMIC_01133 [Peptostreptococcus micros ATCC 33270] >gi|158446334|gb|EDP23329.1| hypothetical protein PEPMIC_01133 [Peptostreptococcus micros ATCC 33270] (461 aa)
Score = 722, Expect = 3.2e-74, Identities = 173/435 (39%), Positives = 259/435 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN--WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNF--------NLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD--DEAIE-LLNKWNKLKQEKNFSESDKYRKLLME 435
           MKIY+ +++  ++   +      +YVCGPTVYN++HIGN RP+I +D L R  L +GY+V F+ N TDIDDKI+N+AKEEN+   +++  Y   Y +    +N+  S+   P+ ++ I ++  +++ +     AY VDG+VYFD TK+  YGK+S K +D+L  G + + + +K NP DFALWK+        W+  +  GRPGWH ECS +  KYLGD IDIH GG DL+FPHHENE  Q+   N K  A  WMH G +NI+N KMSKS  NF   KD+  EY+   +R +   T Y NPLNF+ E +  +KN L+  +YN    K HL    +  E+  + D S L+EL   F        N  + +S + E I+Y++    N + + + K    L      +LG+++    D  DE +E L+ +  + ++ K+F  +D+ R  L E
  S:     1 MKIYNTLTRKKEDFKPIQAGKALIYVCGPTVYNYIHIGNSRPMIVYDTLRRYLLYIGYDVKFVSNFTDIDDKIINRAKEENVPFTDITKKYIDAYLEDSYGLNLFESHTIHPKATECINEMIEFVKVLEEKGIAYNVDGNVYFDITKAKDYGKLSKKNIDDLRAGARIDISDEKKNPLDFALWKKRKDETEPAWESPWGMGRPGWHLECSVMAKKYLGDTIDIHAGGEDLQFPHHENEIAQSECCNGKVFANYWMHNGMINIDNVKMSKSKGNFFTIKDIQKEYDLEVIRLWILSTHYRNPLNFSREVMEQTKNGLDR-MYN---GKEHLERLLEICEEKEDGDISKLVELKKEFLDCMDDDLNTADAISKVYELIRYTNTFGENTDLKVV-KGAVKLLSDFASVLGLLYKEEDDNLDEKVEKLIKEREEARKNKDFKRADEIRDALKE 444
>gi|149002271|ref|ZP_01827213.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] >gi|147759586|gb|EDK66577.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] (447 aa)
Score = 722, Expect = 3.8e-74, Identities = 162/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   IKMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE +   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F  +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGVTPQEVADKYIAAFREDVAALGVKPAT-RHPRVVEFMADIIRFVEDLIEKDFAYESQGDVYFRVEKSHNYAKLANKTLEDLELGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFETADQIRDQLVTQ 431
>gi|182420105|ref|ZP_02951339.1| cysteinyl-tRNA synthetase [Clostridium butyricum 5521] >gi|182376142|gb|EDT73729.1| cysteinyl-tRNA synthetase [Clostridium butyricum 5521] (466 aa)
Score = 721, Expect = 4.0e-74, Identities = 166/439 (37%), Positives = 260/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTT----------ENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M++Y+ +++  +E V +    +KMYVCGPTVYN+ HIGN R  I FD + R     GY VTFI N TDIDDK++NKA  E I   EL   +  +Y+     + +  + +  PR +++I ++  +++ +++  FAY +DGDVYF T K  +YGK+  + L++L  G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LGD IDIHGGG+DLKFPHHENE  Q+ AV  +  A  WMH   +N++N+KMSKS +NF+ A++ L +YN++ +R+      Y   +NF+           E L N  N LEN+I  +N  +      +K   K+L+  +   IE + ++FN  + +S I + IK  +  +   +  EL +   NL   L   LGI+        + E  EL++K  + ++ ++F+ +DK R  L  + ++
  S:     1 MRLYNSLTRQKEEFVPIVPGEVKMYVCGPTVYNYFHIGNGRTFIIFDTIRRYLEYRGYKVTFIQNFTDIDDKMINKANAEGITVKELGDKFIDEYYQDADGLQVKRATIN-PRATEYIDEVVEFVKDLIDRGFAYEIDGDVYFSTKKFEEYGKLCGQNLEDLQSGARISVDERKKDPMDFAVWKSQKPGEPAWESPWGLGRPGWHIECSCMAKKLLGDTIDIHGGGMDLKFPHHENEIAQSEAVTGQKFANYWMHAAFVNVDNKKMSKSENNFVTAREALKKYNSDVIRFLMLSGHYRTQINFSAELLDSAKSSVERLYNCVNNLENLINEVN--RKEANDSEKAYLKSLDKHREKFIEKMDDDFNTADGISVIFDLIKDINNNVSIDSSSELCEGTLNLIRELGSPLGILQKTEEKSLEVEIQELIDKRQEARKNRDFALADKIRDDLKARNII 452
>gi|148988955|ref|ZP_01820355.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] >gi|147925452|gb|EDK76529.1| cysteinyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] (447 aa)
Score = 721, Expect = 5.1e-74, Identities = 162/436 (37%), Positives = 251/436 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD +S+  +E V ++   +KMYVCGPTVYN++H+GN R  + FD + R F   GY V +I N TD+DDKI+N+A+EE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ ++   FAY   GDVYF   KS+ Y K++NK L++L +G      E+  +K NP DFALWK +  G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + +++  L+   Y  N ++          E    F    +  +  +FN  N ++ + E  K+    + + N++   K    L+ +L +I GI+ V  + D E  +L+ K  + +  ++F  +D+ R  L+ +
  S:     2 IKIYDTMSRDLREFVPIENGKVKMYVCGPTVYNYIHVGNARSTVAFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALGVKPAT-RHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLDLGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHDALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLK---YLKNTYEQPFTGNVDAQELQ-NFKDKFVAAMDEDFNAANGITVVFEMAKW----INSGNYDASVKQ--ALADML-EIFGIVFVEEVLDAEIEDLIQKRQEARANRDFETADQIRDQLVTQ 431
>gi|188997490|ref|YP_001931741.1| cysteinyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932557|gb|ACD67187.1| cysteinyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1] (487 aa)
Score = 720, Expect = 5.6e-74, Identities = 150/371 (40%), Positives = 229/371 (61%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE---------LTNNFNLPNIVSFIEEKIKYSSIL 371
           +KIY+ ++ K +    +    +K+Y CG TVY++ H+G+ R +I FD++ R    LGYNV F+ N TD+DDKI+N+AK E +    +S  +  +YFD  +   I  ++++ PRV+ HI DI N+IQK+V+  +AY  DGDVYF   K  +YGK+S + +DELL G + E   KK +P DFALWK    G   W+  +  GRPGWHTEC  +I K+LG+ IDIHGGG+DL FPHHENE  Q  A+  K  AR W+H G + +N QKMSKSL N+I  K++ S+Y  + +R       Y +PL+F+ + +  +K   E +    N  +   ++ +   ++N E D  N I+         ++++FN P  ++ +   ++  +IL
  S:     3 LKIYNTLTGKKEDFAPIKPGEVKIYTCGVTVYDYNHVGHGRSLIVFDMIRRYLRYLGYNVIFVRNFTDVDDKIINRAKNECLPFSVISDKFIKEYFDDAEKFRIEPADIE-PRVTTHIPDIINFIQKLVDAGYAYEADGDVYFSVRKFKEYGKLSKRSIDELLAGARIEPGEKKKDPLDFALWKSAKAGEPYWESPWGKGRPGWHTECCAMIFKHLGETIDIHGGGLDLTFPHHENEIAQAEALTGKPFARYWIHNGLVTVNGQKMSKSLGNYIKLKEIYSKYEPDILRLLVLSVHYRSPLDFSWDKMEETKKAYERL---KNAIEEAEVLNKLPIDENFEGDLYNAIQKAQSGFYSAMSDDFNTPEALASLFGLVREMNIL 380
>gi|6899996|emb|CAB71305.1| cysteinyl tRNA synthetase [Clostridium sticklandii] (443 aa)
Score = 719, Expect = 6.9e-74, Identities = 162/411 (39%), Positives = 249/411 (60%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK-------NQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIH---VNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           MYVCGPTVYN  HIGN RP + FD         GY VT++ N TD+DDKI+ +A EE I  +E++  Y  +YF     + I  + +  PRV+++I++I  +I+ +++  FAY ++GDVYF++    +YGK+S + L+EL +G + + N +K +P DFALWK    G + W   +  GRPGWH ECS +  +YLGD IDIH GG DL FPHHENE  Q+ A + K  AR WMH G++N++NQKMSKSL NF   +D+LSE++   +R+F     Y NP+NF+ E ++ +K       N  E +++ ++  K  +   +      LE  +   IE + ++ N  + +S I E  ++S+  +   +  E  + + +L   LT +L II     +  D+E IE L+    + K+ K+F+ +D  R  L
  S:     1 MYVCGPTVYNFFHIGNARPFMIFDAFRNYMEYRGYEVTYVQNFTDVDDKIIKRANEEGISPIEVAEKYIAEYFKDADALGIKRATVH-PRVTENIENIITFIEDLISKGFAYELNGDVYFNSQAYKEYGKLSKQNLEELNLGARIDVNDEKKHPIDFALWKAKKEGEIGWQSPWGEGRPGWHIECSVMSARYLGDTIDIHAGGQDLIFPHHENEIAQSEARSGKQFARYWMHNGYINVDNQKMSKSLGNFFTVRDILSEFSGQVIRFFLLSAHYRNPVNFSKELILQAKAGMERLANSKERLVFTISHAKGQMNESELELVSALENHRDRFIEAMDDDINTADAISIIFELARFSNTNVTENSSLEWAEKNLSLFNELTGVLNIIKAEDTDSNDNEQIEKLIKDRVEAKKNKDFALADAIRDEL 423
>gi|193216531|ref|YP_001999773.1| cysteinyl-tRNA synthetase [Mycoplasma arthritidis 158L3-1] >gi|193001854|gb|ACF07069.1| cysteinyl-tRNA synthetase [Mycoplasma arthritidis 158L3-1] (401 aa)
Score = 719, Expect = 7.5e-74, Identities = 173/416 (41%), Positives = 249/416 (59%)
  Q:    24 YVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYL-GDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPN----IVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI-IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           Y+CGPTVYN+ HIGN+RPI+TFD++ R    LG  + ++HNITDIDDKI+NK+ EEN  E E++S+YE  Y ++    N+     K  RV+D + D+ NYIQ++++ K AY V  +V+FD  K  N YG ISN+K+  L   +  ED  +KNNP DFALWK+T+ G+ +   F  GRPGWHTECSC I+KY  G  IDIH GGIDL FPHHENENIQ+ A++++ +A+ WMH G LN  NQKMSKS+ N I   D L +Y  +T +     T+Y+ P+N T E L+ ++NQ    I    +  S  ++E+ ++  + E   +++I L  + N       ++   + K KY++ +                   + KILG          E  EL  +W      KNF ++D  R  L++K L+
  S:     6 YLCGPTVYNYPHIGNMRPIVTFDLMIRAQRYLGDEIFYLHNITDIDDKIINKSLEENKSEKEITSFYEKYYLNLFTLFNLEMPT-KVIRVTDSLDDMYNYIQRLIDIKAAYQVGKNVFFDIEKYQNTYGSISNQKIANL---NYDEDKFQKNNPFDFALWKETSKGIKFASPFGEGRPGWHTECSCFIDKYFEGKTIDIHAGGIDLIFPHHENENIQHFALHHQPIAKNWMHFGTLNYKNQKMSKSIGNLIYPHDFLEKYEADTYKLLMLTTNYAKPINLTDEMLVLNQNQ----INKFKVIASKCLLEKMHDSIDQE-KVNHIIALIASLNFAKANEELIKLTKSKEKYTTFI------------------AIMKILGFNFASKTITKEDEELYQQWKNEVANKNFEQADTLRAKLIKKGLI 401
>gi|126654401|ref|ZP_01726146.1| cysteinyl-tRNA synthetase [Bacillus sp. B14905] >gi|126589151|gb|EAZ83335.1| cysteinyl-tRNA synthetase [Bacillus sp. B14905] (466 aa)
Score = 718, Expect = 8.8e-74, Identities = 163/439 (37%), Positives = 260/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE-----------QKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNF-EELNKLHFNLSYLLTKILGIIHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++I++ +S+  +  V L++  +KMYVCGPTVYN++HIGN RP+I +D + R F   GY+V F+ N TD+DDKI+  A E      EL+  +   YF+ +  +    +++  PRV++H+ DI  +IQ ++   +AY   GDVY+ T K N YGK+S++ +D+L +G + E   KK++  DFALWK    G + W+  +  GRPGWH ECS +  ++LGD IDIH GG DL FPHHENE  Q+ A N+K  AR WMH G++NI+N+KMSKSL NFIL  D+  + +   +R+F     Y +P+NF  + +  +   LE I    N  K  L               K  E+  +F+++    + ++FN  N +S + E  + ++I L   N  +++ +       +L  +LGI      +    E   LL +  + ++ ++F+ SD+ R  L  + ++
  S:     3 IQIFNSLSRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNSRPVIVYDTVRRYFQYKGYDVKFVSNFTDVDDKIIKAANELGEEVHELTERFIAAYFEDVTALGCKKADVH-PRVTEHMTDIIQFIQILIEKGYAYESAGDVYYRTRKFNGYGKLSHQSVDDLKIGARIEAGEKKDDALDFALWKAAKPGEIFWESPWGNGRPGWHIECSVMAREHLGDTIDIHAGGQDLTFPHHENEIAQSEAHNDKTFARYWMHNGYINIDNEKMSKSLGNFILVNDIRKQIDPQVLRFFMLSVHYRHPINFAKDLVEAAAAGLERIRTAYNNVKHRLTTTVSLGDHSDEWLNKITEQKAQFEEA----MDDDFNTANGISVLFELARIANIYLNETNTCKKVLETFIETFEVLGDVLGIKFAKEEELLDEEIDALLQERVEARKNRDFARSDEIRDHLQAQGII 453
>gi|194017569|ref|ZP_03056180.1| cysteinyl-tRNA synthetase [Bacillus pumilus ATCC 7061] >gi|194010841|gb|EDW20412.1| cysteinyl-tRNA synthetase [Bacillus pumilus ATCC 7061] (466 aa)
Score = 718, Expect = 9.2e-74, Identities = 158/433 (36%), Positives = 254/433 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT-IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEF------DKSNLI-ELTNNFNLPNIVSFIEEKIKYSSILLRNKNF-EELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +++  +E V L+   +KMYVCGPTVYN++HIGN RP I +D + +     GY+V F+ N TD+DDK++  A E       ++  +   YF+ +  +    +++  PRV++++ DI  +I  ++   +AY  DGDVY+ T     YGK+S++ +DEL  G +     KK +  DFALWK      ++WD  +  GRPGWH ECS ++ KYLGD IDIH GG DL FPHHENE  Q+ A+  K  A+ WMH G++NI N+KMSKSL NF+L  D++ E + + +R+F     Y +P+N++ + L ++K+    +  +       L       E N E+       ++  I E+ ++FN  N +S + E  K ++  + N +  EE+ K    L   +T +LG  +   +  D+E   L+ K N+ ++ ++F+ SD+ R  L
  S:     3 INIYNTLTRKKEEFVPLEPGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRKYLEYSGYDVNFVSNFTDVDDKLIKAANELGEDVPTIADRFIQAYFEDVSALGCKKADLH-PRVTENMDDIIAFIATLIEKGYAYEADGDVYYSTRSFEGYGKLSHQSIDELKTGARIRVGEKKRDALDFALWKAAKDQEISWDSPWGEGRPGWHIECSAMVKKYLGDTIDIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWMHNGYINIENEKMSKSLGNFVLVHDIVKEQDPDVLRFFMLSVHYRHPINYSMDLLESTKSAFNRLKTSYANLHHRLESSTNITEDNAEWLAKVEEQRATFISEMNDDFNTANAISVLFELAKQANYYMENDHTSEEVIKAFIGLFQEITSVLGFSLEEKHTLDEEVEALIEKRNEARRNRDFALSDQIRDQL 446
>gi|163785456|ref|ZP_02180059.1| cysteinyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1] >gi|159879275|gb|EDP73176.1| cysteinyl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1] (436 aa)
Score = 718, Expect = 9.2e-74, Identities = 149/371 (40%), Positives = 229/371 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE---FDKSNLIE------LTNNFNLPNIVSFIEEKIKYSSIL 371
           +K+Y+ +S   +E V ++   +K+Y CG TVY+  H+G+ R +I FD++ R    LGYNV F+ N TD+DDKI+N+AK E +    ++  Y  +YF   +   I  ++++ PRV+ HI DI ++IQK+++  +AY V+GDVYF   K   YGK+S + +DEL+ G + E   KK +P DFALWK +  G   WD  +  GRPGWHTEC  +I K+LG+ IDIHGGG+DL FPHHENE  Q  A++ K  AR W+H G + +N QKMSKSL N+I  K++ S+Y  + +R       Y +PL+F+ E +  +K   E +    N    + I+E+     + E   +D     E      ++++FN P  ++ +   ++  +IL
  S:     3 LKVYNTLSGQKEEFVPINPGEVKIYTCGVTVYDVNHVGHGRSLIVFDMIRRYLRYLGYNVKFVRNFTDVDDKIINRAKNECLPFTVIADRYIKEYFQDAENFRIEPADVE-PRVTTHIPDIIDFIQKLIDKGYAYEVEGDVYFSVRKFKDYGKLSKRSVDELIAGARVEPGEKKKDPLDFALWKASKAGEPAWDSPWGKGRPGWHTECCAMIFKHLGETIDIHGGGLDLTFPHHENELAQAEALSEKPFARYWIHNGLVTVNGQKMSKSLGNYITLKEIYSKYEPDILRLLVLSVHYRSPLDFSWEKMEETKKAYERL---KNAMDEYEILEKLPENPDFEGHLYDAIAKAEQGFYAAMSDDFNTPEALAALFSLVREMNIL 380
>gi|169830058|ref|YP_001700216.1| cysteinyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] >gi|168994546|gb|ACA42086.1| Cysteinyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] (466 aa)
Score = 717, Expect = 1.4e-73, Identities = 151/376 (40%), Positives = 230/376 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE-----------QKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKN 376
           ++I++ +S+  +  V L++  +KMYVCGPTVYN++HIGN RP+I +D + R F   GY+V F+ N TD+DDKI+  A E      EL+  +   YF+ +  +    +++  PRV++H+ DI  +IQ ++   +AY   GDVY+ T K N YGK+S++ +D+L +G + E   KK++  DFALWK    G + W+  +  GRPGWH ECS +  ++LGD IDIH GG DL FPHHENE  Q+ A N+K  AR WMH G++NI+N+KMSKSL NFIL  D+  + +   +R+F     Y +P+NF  + +  +   LE I    N  K  L               K  E+  +F+++    + ++FN  N +S + E  + ++I L   N
  S:     3 IQIFNSLSRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNSRPVIVYDTVRRYFQYKGYDVKFVSNFTDVDDKIIKAANELGEEVHELTERFIAAYFEDVTALGCKKADVH-PRVTEHMADIIQFIQVLIEKGYAYESAGDVYYRTRKFNGYGKLSHQSVDDLKIGARIEAGEKKDDALDFALWKAAKPGEIFWESPWGNGRPGWHIECSVMAREHLGDTIDIHAGGQDLTFPHHENEIAQSEAHNDKTFARYWMHNGYINIDNEKMSKSLGNFILVNDIRKQIDPQVLRFFMLSVHYRHPINFAKDLVEAASAGLERIRTAYNNVKHRLTTTVSLGDHSDEWLNKITEQKAQFEEA----MDDDFNTANGISVLFELARIANIYLNETN 386
>gi|52078589|ref|YP_077380.1| cysteinyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52783950|ref|YP_089779.1| cysteinyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|61216165|sp|Q65PC8|SYC_BACLD Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|52001800|gb|AAU21742.1| cysteinyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52346452|gb|AAU39086.1| CysS [Bacillus licheniformis DSM 13] (467 aa)
Score = 715, Expect = 2.2e-73, Identities = 156/431 (36%), Positives = 254/431 (58%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL-------ENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNF-EELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           K +  V L++  +KMYVCGPTVYN++HIGN RP I FD + +     GY V ++ N TD+DDK++  A E       ++  +   YF+ + ++    ++   PRV++++ +I ++IQ +++  +AY  DGDVY+ T     YGK+S++ +DEL  G + +   KK +  DF LWK      ++WD  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  A+ W+H G++NI+N+KMSKSL NF+L  D++ E++   +R+F     Y +P+N++ E L N+KN          N+ + L    +    + ++ EK  E  K+    + ++FN  N +S + +  K+++  L+ KN  E + +    L   +  +LG  +    L D +  EL+ K N+ ++ ++F+ SD+ R  L    ++
  S:    12 KKEPFVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVFDTVRKYLEYKGYEVQYVSNFTDVDDKLIKAANELGEEVPVIAERFIKAYFEDVGSLGCTKADCH-PRVTENMDEIIDFIQTLIDKGYAYEADGDVYYKTRSFEGYGKLSHQSVDELRSGARIQVGEKKEDALDFTLWKAAKDNEISWDSPWGKGRPGWHIECSAMARKYLGDSIDIHAGGQDLAFPHHENEIAQSEALTGKPFAKYWLHNGYINIDNEKMSKSLGNFVLVHDIIKEHDPQVLRFFMLSVHYRHPINYSVELLENTKNAFGRLKTAYSNLQHRLKSSTNLTEGDSEWLEKIEEQRKAFQTAMDDDFNTANAISVLFDLAKHANYYLQEKNTAEHVIQAFIQLFDEICSVLGFSLKEQELLDKDIEELIEKRNEARRNRDFATSDQIRDQLKSMNII 452
>gi|28212192|ref|NP_783136.1| cysteinyl-tRNA synthetase [Clostridium tetani E88] >gi|61216342|sp|Q890M4|SYC_CLOTE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|28204636|gb|AAO37073.1| cysteinyl-tRNA synthetase [Clostridium tetani E88] (465 aa)
Score = 715, Expect = 2.5e-73, Identities = 160/439 (36%), Positives = 268/439 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNLNIFKSHLII------EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +++  +E + L    + MYVCGPTVYN  HIGN R  I FD + R     GY V F+ N TDIDDK++ +A +E I   EL   +  +Y+    ++NI  + +  PR ++ +++I  +++++V+  +AY +DGDVYF T + N+YGK+S + +++L  G +   + +K +  DFA+WK+   G   W+  +  GRPGWH ECSC+ +  LGD IDIH GG DL FPHHENE  Q+     K  A+ WMH   LNI+N+KMSKSL+NF  A+++L +Y+ + VR F     Y   LNF+ E L   +++  +L N IYNL    + +        E+KY +K  E+ +  + ++ ++FN  + ++ I + I+  +  +++ + +++ +   ++   L   LGI+  +     +DE  +L+++  K + EKN++ +D+ R  L E+ +L
  S:     1 MKLYNTLTRQKEEFIPLKTGEVNMYVCGPTVYNFFHIGNGRTFIVFDTVRRYLEYKGYKVKFVQNFTDIDDKMIKRANDEGITVKELGERFIGEYYKDADSLNIERATVN-PRATEFMEEIIQFVKELVDKGYAYEIDGDVYFHTKRFNEYGKLSGQNIEDLQAGARINVDERKKDAMDFAIWKKQKPGEPAWESPWGMGRPGWHIECSCMAHNLLGDTIDIHAGGHDLIFPHHENEIAQSECRTGKPFAKYWMHSAFLNIDNKKMSKSLNNFFTAREILEKYDADVVRLFMLSAHYRAQLNFSEELLQSAMSAVERLYNAIYNLENLANEVKRNDLNEEEKKYIKKLDEYREKYIEKMDDDFNTADAIAVIFDMIRDINSNVKSDSSKKIIEYALSIIRELGSPLGILQKSTEESVEDEIQQLIDRREKARTEKNWALADEIRDGLKERGIL 452
>gi|192813617|ref|ZP_03042277.1| cysteinyl-tRNA synthetase [Geobacillus sp. Y412MC10] >gi|192797592|gb|EDV74112.1| cysteinyl-tRNA synthetase [Geobacillus sp. Y412MC10] (468 aa)
Score = 714, Expect = 3.0e-73, Identities = 156/439 (35%), Positives = 264/439 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI---------ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLH-----FNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++IY+ +++  +  V+ +   +K+YVCGPTVY+++HIGN RP+I FDV+   F   G +V ++ N TD+DDK++ KA++      E++  +   Y++ L  + I  + +  PRV+D+++ I  +IQ++++  FAY   GDV++ T K + YGK+S + LDEL  G + E + +K NP+DF LWK    G + W   +  GRPGWH ECS +  +YLGD +DIHGGG DL+FPHHE E  Q+ A+  K LA  WMH G++ INN+KMSKSL N +L K+L  +Y    VR+F   T Y NPLN++ E +  ++N +E +       +  L       +  +  D ++ I         ++ ++FN P+ ++ + +    ++ LL+  +    + LH     FN    + +I+      L D+E   L+ +  + ++ KN++ +D+ R  L ++ ++
  S:     3 LQIYNTLTRMKETFVAQEPGKVKIYVCGPTVYDYIHIGNARPMIFFDVVRAYFENQGNDVNYVVNFTDVDDKMIRKAEQTGTTVPEVAEKFINAYYEDLDGLGIPRATLN-PRVTDNMESIIEFIQELIDRDFAYENGGDVFYRTRKFDDYGKLSQQNLDELQFGIRIEVDKRKENPEDFVLWKAAKPGEIYWSSPWGDGRPGWHIECSAMARRYLGDTLDIHGGGQDLQFPHHECEVAQSEALTGKPLANYWMHNGYIRINNEKMSKSLGNGVLVKELREQYTKEAVRYFMLSTHYRNPLNYSDEVMEQAQNSVERLANAAANVEHRLGTAIGSKDDQVSQDVADKISAVLVEFHEKMQDDFNTPDAITAMFQWASEANQLLKEASIPAAD-LHEVLRAFNEMNGVLRIVNNGTDELLDEEIEALIAERVEARKNKNWARADEIRDKLADEGIV 455
>gi|21911208|ref|NP_665476.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS315] >gi|28896585|ref|NP_802935.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes SSI-1] >gi|25009287|sp|Q8K5T7|SYC_STRP3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|21905420|gb|AAM80279.1| putative cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS315] >gi|28811839|dbj|BAC64768.1| putative cysteinyl-tRNA synthetase [Streptococcus pyogenes SSI-1] (447 aa)
Score = 714, Expect = 3.2e-73, Identities = 158/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TDIDDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDIDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|94991232|ref|YP_599332.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] >gi|94544740|gb|ABF34788.1| Cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] (447 aa)
Score = 713, Expect = 3.8e-73, Identities = 157/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYAADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADVIRDQL 428
>gi|16799348|ref|NP_469616.1| cysteinyl-tRNA synthetase [Listeria innocua Clip11262] >gi|21264012|sp|Q92F36|SYC_LISIN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|16412700|emb|CAC95504.1| cysteinyl-tRNA synthetase [Listeria innocua] (471 aa)
Score = 713, Expect = 4.3e-73, Identities = 166/424 (39%), Positives = 247/424 (58%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  + +  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK    G + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A+ WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L +K    +N L   LS   L  ++LG+       +  DD  +E L+ +  + + E+NF+ +D+ R +L EK ++
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKATVN-PRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFAKYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEETHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYL-SKETVSINVLREFLSMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKDII 458
>gi|50915009|ref|YP_060981.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] >gi|61216145|sp|Q5X9W5|SYC_STRP6 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|50904083|gb|AAT87798.1| Cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] (447 aa)
Score = 712, Expect = 5.3e-73, Identities = 156/433 (36%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F       K+L +  + +F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE------KMLAVFGI-VFEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|139474431|ref|YP_001129147.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] >gi|134272678|emb|CAM30949.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] (447 aa)
Score = 712, Expect = 5.4e-73, Identities = 158/433 (36%), Positives = 243/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE---DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG       +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + L +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRIDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKALHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARTNRDFATADAIRDQL 428
>gi|94995145|ref|YP_603243.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] >gi|94548653|gb|ABF38699.1| Cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] (447 aa)
Score = 712, Expect = 5.6e-73, Identities = 157/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLHKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|56808516|ref|ZP_00366253.1| COG0215: Cysteinyl-tRNA synthetase [Streptococcus pyogenes M49 591] (447 aa)
Score = 711, Expect = 6.9e-73, Identities = 156/433 (36%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F  +GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   ++L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYIGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHEMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|187932481|ref|YP_001884454.1| cysteinyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] >gi|187720634|gb|ACD21855.1| cysteinyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] (470 aa)
Score = 711, Expect = 7.0e-73, Identities = 171/439 (38%), Positives = 264/439 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG----DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNF----------TTENLINSKNQLENIIYNL---NIFK---SHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M+I++ +++  +E + +    +KMYVCGPTVYN  HIGN R  I FD + R     GY V F+ N TDIDDK++ KA EE     E+   Y  +Y++    + I  + +  PR +++I+DI +++ +++   +AY V+GDVYF+T K N YGK+S + +++L +G      S  + +KN+P DFA+WK    G   W   +  GRPGWH ECSC+  K LGD IDIH GG+DL FPHHENE  Q+ A+     A  WMH  ++NINNQKMSKSL+NF  A+D+L EY+++ VR+F     Y   +NF          + E L N+   LEN+I  +   NI +   ++L   +KY EK +E       ++ ++FN  + ++ + E  K ++  +   + +EL     NL   L   LG+   I     +DE   L+ +    ++ K+F+ SDK R  L ++ ++
  S:     1 MRIFNTLTRKKEEFIPITPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYLEYRGYEVKFVQNFTDIDDKMIKKANEEGTTVKEIGDKYIKEYYEDADKLQIERATVN-PRATEYIEDIIDFVAQLIEKGYAYEVEGDVYFNTKKFNDYGKLSGQSIEDLQMGASNRTSSIADERKNDPMDFAIWKAQKPGEPAWKCPWGMGRPGWHIECSCMAKKILGDTIDIHAGGMDLTFPHHENEVAQSEALTGMRFANYWMHSAYVNINNQKMSKSLNNFFTARDILKEYDSDVVRFFMMSAHYRLQINFSKDLLDSAKASVERLYNAIGNLENLIDEVSRENISEEEVNYLNSLKKYREKYIE-------KMDDDFNTADALTVLFELTKDTNTNINVNSSKELVNKALNLIRELGAPLGLLQKITKGSLEDEIESLIQQRQDARKNKDFALSDKIRDDLKDRGIV 456
>gi|39998454|ref|NP_954405.1| cysteinyl-tRNA synthetase [Geobacter sulfurreducens PCA] >gi|61216254|sp|Q747A2|SYC_GEOSL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|39985401|gb|AAR36755.1| cysteinyl-tRNA synthetase [Geobacter sulfurreducens PCA] (481 aa)
Score = 710, Expect = 7.5e-73, Identities = 134/319 (42%), Positives = 198/319 (62%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           +++Y+ +S T ++ V+L+   +KMYVCG TVY+H HIG+ R  + FD++ R     GY VT++ N TD+DDKI+N+A +E +    +S  +  ++   +  + +     + P+ ++HI ++   I+++V   FAY  DGDVYF     +QY K+S + L+E+  G + E   KK +P DFALWK +  G   WD  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ A N K  AR W+H G +NIN +KMSKSL NF   K++L  Y+   +R+F     Y +P++F+ +NL  +   LE  IYN
  S:     3 LRVYNTLSGTKEDFVTLEPGRVKMYVCGVTVYDHCHIGHARANVVFDMIYRYLRHAGYEVTYVRNYTDVDDKIINRANKEGVPFNVISERFIAEFDRDMAALGLDLPTYQ-PKATEHIAEMIQVIERLVAKGFAYAADGDVYFSVEAFDQYLKLSKRNLEEMQAGARIEVGEKKRHPMDFALWKGSKPGEPYWDSPWGQGRPGWHIECSAMSMKYLGETFDIHGGGKDLVFPHHENEIAQSEAANGKPFARYWIHNGFVNINAEKMSKSLGNFFTIKEVLESYDAEVLRFFLLSAHYRSPIDFSDQNLKEAAAGLER-IYN 321
>gi|168181842|ref|ZP_02616506.1| cysteinyl-tRNA synthetase [Clostridium botulinum Bf] >gi|182674897|gb|EDT86858.1| cysteinyl-tRNA synthetase [Clostridium botulinum Bf] (465 aa)
Score = 710, Expect = 7.8e-73, Identities = 163/439 (37%), Positives = 260/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWK-QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL---------IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E + L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ KA EE     EL   +  +Y+     +NI  +  K PR ++ +K+I  ++  ++   +AY +DGDVYF T K N YGK+S + L+EL +G +   + +K +P DFA+WK Q      W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L           E KY ++  ++ +  + ++ ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E   L+ +  K ++EK+++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFLPLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDTIRRYLEYRGYKVKFIQNFTDIDDKMIKKANEEGTTVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMKEIIKFVSDLIEKGYAYEIDGDVYFSTKKFNSYGKLSGQNLEELQLGARINVDERKKDPMDFAIWKSQKPEEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEGLRDEELKYRDELQKYKEKYIEKMDDDFNTADAISVIFDLIRDVNTNITIESSKELVKYALDLIRELGSPLGILQKSTKASLEEEIERLIQERQKARKEKDWALADKIRDDLKERGIV 452
>gi|157690877|ref|YP_001485339.1| cysteinyl-tRNA synthetase [Bacillus pumilus SAFR-032] >gi|187629792|sp|A8F962|SYC_BACP2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|157679635|gb|ABV60779.1| cysteine--tRNA ligase [Bacillus pumilus SAFR-032] (466 aa)
Score = 710, Expect = 8.7e-73, Identities = 161/433 (37%), Positives = 260/433 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQT-TIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLN--IFKSHLIIEQ--KYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNF-EELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +++  +E V L+   +KMYVCGPTVYN++HIGN RP I +D + +     GY+V F+ N TD+DDK++  A E       ++  +   YF+ +  +    +++  PRV++++ DI  +I+ ++   +AY  DGDVY+ T     YGK+S++ +DEL  G +     KK +  DFALWK      ++WD  +  GRPGWH ECS ++ KYLGD IDIH GG DL FPHHENE  Q+ A+  K  A+ WMH G++NI N+KMSKSL NF+L  D++ E + + +R+F     Y +P+N++ + L ++K   N+L+    NL+  +  S  I E   K+  K  E   + + E+ ++FN  N +S + E  K ++  + N +  EE+ K    L   +T +LG  +   +  + E   L+ + N+ ++ ++F+ SD+ R  L
  S:     3 INIYNTLTRKKEEFVPLEPGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRKYLEYSGYDVNFVSNFTDVDDKLIKAANELGEDVPTIADRFIQAYFEDVSALGCKKADLH-PRVTENMDDIIAFIETLIEKGYAYEADGDVYYSTRSFEGYGKLSHQSIDELKTGARIRVGEKKRDALDFALWKAAKNQEISWDSPWGEGRPGWHIECSAMVKKYLGDTIDIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWMHNGYINIENEKMSKSLGNFVLVHDIVKEQDPDVLRFFMLSVHYRHPINYSMDLLESTKSAFNRLKTSYANLHHRLESSTNITEDNAKWLAKVEEQRATFISEMNDDFNTANAISVLFELAKQANYYMENDHTSEEVIKAFIGLFQEITSVLGFSLEEKHTLEKEVEALIEQRNEARRNRDFALSDQIRDQL 446
>gi|166031083|ref|ZP_02233912.1| hypothetical protein DORFOR_00765 [Dorea formicigenerans ATCC 27755] >gi|166028930|gb|EDR47687.1| hypothetical protein DORFOR_00765 [Dorea formicigenerans ATCC 27755] (468 aa)
Score = 710, Expect = 8.8e-73, Identities = 170/439 (38%), Positives = 260/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS---EDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIY---NLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSSILL-RNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ +SK  +E + L++  ++MYVCGPTVYN +HIGN RP+I FD + R F   GY+V ++ N TD+DDKI+ KA EE +   E+S  Y  +    +  +N+  +    P  +  I  +   IQ +++  +AY  +G VY+ T +  +YGK+S+K LD+L  G++S       +K +P DF LWK    G   W   +S GRPGWHTECS +  KYLG+QIDIH GG DL FPHHENE  Q+ A N K  A  WMH   LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ E +  +K+ LE I+    NLN    +   E    E+   F +++         + ++FN  + V+ I E ++YS+      K  E L K+  +L   L  +LG+I      +  ++  +L+ +    ++ K+F+ +D  R  L+EK ++
  S:     1 MKIYNTMSKKKEEFIPLEEGKVRMYVCGPTVYNFIHIGNARPMIVFDTVRRYFEYKGYDVNYVSNFTDVDDKIIAKANEEGVTAEEISQRYIEECKKDMAGMNVKPATTN-PLATQEIDGMIQLIQTLMDKGYAYEKNGTVYYRTRQFKEYGKLSHKNLDDLRSGERSLLVSGADEKEDPLDFVLWKPKKEGEPFWKSPWSDGRPGWHTECSEMSKKYLGEQIDIHAGGEDLVFPHHENEIAQSEAANGKTFANYWMHNAFLNIDNRKMSKSLGNFRTVREISEQYDLQVLRFFMLSAHYRSPLNFSAELMEAAKSSLERIVNAVDNLNFLIKNAKDEPMTAEEAELFAQTDSFVKAFEDAMDDDFNTADAVAAIFELVRYSNTNADAEKTKEYLGKIK-DLIVKLADVLGLIVEKKEEILAEDIEKLIEERQAARKAKDFARADAIRDELLEKGII 455
>gi|71904305|ref|YP_281108.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] >gi|109894951|sp|Q48RA7|SYC_STRPM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|71803400|gb|AAX72753.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] (447 aa)
Score = 710, Expect = 9.3e-73, Identities = 157/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFAIADAIRDQL 428
>gi|12045107|ref|NP_072918.1| cysteinyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|1351147|sp|P47495|SYC_MYCGE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|3844851|gb|AAC71473.1| cysteinyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|166078699|gb|ABY79317.1| cysteinyl-tRNA synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (428 aa)
Score = 710, Expect = 9.6e-73, Identities = 164/432 (37%), Positives = 257/432 (59%)
  Q:     8 SKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKI--LGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           S + K  +L +K I +Y+CGPTVYN +H+GN RP+I FDVLNR+  +  Y V F+ NITDIDDKI+  A+++ + E  ++    T Y  +LK +NI    +K  ++++ I  I +YI ++VN   AY+    +VYF      QYG ++N+ +         E +  K N  DF LWK TT G+ W+ K+  GRPGWH EC+ LI+    +++ IHGGG+DLKFPHHENEN  ++A+ N+ + + WMH+GHL I NQKMSKSL NF+LA D L+ ++   +RW FYQ  Y +P++     +  + N ++ I   LN+ ++ L+  ++    + +        L +N N  N V+ I + IK  +  ++ K+F  L +    LS+L   I  LGI   ++     + L+ +W+ L ++K   ++D+ RK L++K LL
  S:     5 SVSQKPTTLVQKTINIYLCGPTVYNDLHLGNTRPLIVFDVLNRVLKKAKYTVNFVQNITDIDDKIIKIAQQQEVSESVVTKQQITAYKSLLKKLNILP--IKHIQITEKIDKIPDYIDQLVNQNHAYVSTQNNVYFAVNSLKQYGYLANRMVH------LEETDTDKKNKLDFVLWKITTAGIKWNSKWGLGRPGWHVECAFLIDYCFKNELTIHGGGVDLKFPHHENENALHMALYNQPITKHWMHIGHLMIENQKMSKSLQNFLLAVDFLNFHDFRVLRWIFYQKHYLHPIDLNQSLIEKANNDIQRIAKTLNVARTWLVYSEQSELISPKQYDPVFSALLDNLNFANAVAAIWKLIKKINTSIKTKDFSVLRE---QLSFLEWSIDLLGISFKSIHTKLNVRLIKEWSILHKQKAMDKADQIRKKLIKKMLL 428
>gi|16802285|ref|NP_463770.1| cysteinyl-tRNA synthetase [Listeria monocytogenes EGD-e] >gi|153172926|ref|ZP_01928861.1| hypothetical protein LMIG_01783 [Listeria monocytogenes FSL N3-165] >gi|21264004|sp|Q8YAB1|SYC_LISMO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|16409604|emb|CAD00766.1| cysteinyl-tRNA synthetase [Listeria monocytogenes] >gi|133731233|gb|EBA32931.1| hypothetical protein LMIG_01783 [Listeria monocytogenes FSL N3-165] (471 aa)
Score = 709, Expect = 1.0e-72, Identities = 166/424 (39%), Positives = 246/424 (58%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  +++  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK    G + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A  WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L  K    +N L   LS   L  ++LG+       +  DD  +E L+ +  + + E+NF+ +D+ R +L EK ++
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKASVN-PRVTENMDEIIQMISTLIEKGYAYESAGDVYFQTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEEAHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLA-KETVSINVLREFLSMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII 458
>gi|94989286|ref|YP_597387.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94993175|ref|YP_601274.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] >gi|94542794|gb|ABF32843.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94546683|gb|ABF36730.1| Cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] (447 aa)
Score = 709, Expect = 1.0e-72, Identities = 156/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++++KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDSEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|110803392|ref|YP_699686.1| cysteinyl-tRNA synthetase [Clostridium perfringens SM101] >gi|122956489|sp|Q0SQC1|SYC_CLOPS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|110683893|gb|ABG87263.1| cysteinyl-tRNA synthetase [Clostridium perfringens SM101] (466 aa)
Score = 709, Expect = 1.1e-72, Identities = 161/439 (36%), Positives = 259/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE----------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+Y+ ++K  +E + L    +KMYVCGPTVYN  HIGN R  I FD + R F   G+ V F+ N TDIDDK++ KA EE I   ++   Y  +Y+     +NI  + +  PR ++ I +I  +++ +V+  +AY VDGDVYF T K   YGK+S + +++L  G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LG+ IDIH GG DLKFPHHENE  Q+ A+  +  AR W+H   +N+NN+KMSKSL+NF  A+++L  Y+ + +R+      Y   LNF+ + L ++K  +E  IYN      +LI E    E N E          + +  + ++ ++FN  + ++ I + IK ++  +   + +EL +    L   L   LG+   +     ++E   L+ K  + +++++F+ +DK R  L ++ ++
  S:     2 IKVYNTLNKKKEEFIPLTPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYFEYRGFKVDFVQNFTDIDDKMIKKANEEGITVKKIGDTYIKEYYQDADALNIERATVN-PRATEFIGEIIKFVKGLVDKGYAYEVDGDVYFSTKKFEGYGKLSGQNIEDLQSGARISVDERKKDPMDFAIWKAQKPGEPAWNSPWGMGRPGWHIECSCMAKKLLGETIDIHAGGSDLKFPHHENEIAQSEALTGEPFARYWLHSAFVNVNNEKMSKSLNNFFTAREILERYDADVIRFLMLSAHYRQQLNFSEDLLESAKASVER-IYNAIGNLENLIDEVSREEMNEEEKAYLESLNKYKEKYIEKMDDDFNTADAITAIFDLIKDTNTNITIDSSKELAQKALELIRELGAPLGMFQKSTKGNLEEEIEALIAKRQQARKDRDFALADKIRDELKDRGIV 453
>gi|125718833|ref|YP_001035966.1| cysteinyl-tRNA synthetase [Streptococcus sanguinis SK36] >gi|125498750|gb|ABN45416.1| Cysteinyl-tRNA synthetase, putative [Streptococcus sanguinis SK36] (447 aa)
Score = 708, Expect = 1.4e-72, Identities = 156/433 (36%), Positives = 252/433 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ +E V +++  ++MYVCGPTVYN++H+GN R  + FD + R F   G+ V +I N TD+DDKI+++AKEE I   E++  Y   + + +  + +  +  + PRV D ++ I ++++ +V+  +AY  +GDVYF   KS+ Y K++NK L +L +G      E+  +K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   +  A  WMH G +NI++ KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + ++   L+   Y  N ++     + +  +     DK     +  +FN  N ++ + E  K+    + + N+    ++   L+ LL ++ GI+ V    D  IE L+ +    +  ++F+ +D+ R  L
  S:     2 IKIYDTMTRSLREFVPIEEGKVRMYVCGPTVYNYIHVGNARSTVAFDTVRRYFEYRGFEVNYISNFTDVDDKIIHRAKEEGITPKEVADKYIAAFREDVSALGVKPAT-QHPRVIDFMEAIIDFVRTLVDKGYAYESEGDVYFRVEKSHNYAKLANKTLADLELGASGRTDEETARKENPVDFALWKAAKPGEISWDSPWGAGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGQTFANYWMHNGFVNIDDVKMSKSLGNFITVHDALKTIDGQVLRFFFATQHYRKPINFTEKAVHDAATNLK---YLKNTYEQPFTGQAESAQLQAFLDKFT-AAMDEDFNAANGITVVFELAKW----INSGNYTA--EVKGALAELL-EVFGIVFVEEVLDADIERLIEERQAARANRDFATADRIRDEL 428
>gi|19746854|ref|NP_607990.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] >gi|24418689|sp|Q8NZD1|SYC_STRP8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|19749094|gb|AAL98489.1| putative cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] (447 aa)
Score = 708, Expect = 1.4e-72, Identities = 156/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   ++L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNMYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHEMLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|110834996|ref|YP_693855.1| cysteinyl-tRNA synthetase [Alcanivorax borkumensis SK2] >gi|123050340|sp|Q0VML5|SYC_ALCBS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|110648107|emb|CAL17583.1| Cysteinyl-tRNA synthetase [Alcanivorax borkumensis SK2] (460 aa)
Score = 708, Expect = 1.6e-72, Identities = 138/315 (43%), Positives = 190/315 (60%)
  Q:     6 FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
              K D  + LD   I +YVCGPTVYN VHIGN RP++ FDVL RL   L  NV +  NITDIDDKI+  A +       L+  +   + D + ++N  T ++  P+ +DHI ++   I  +V    AY  DG V F       YGK+S +KL+++L G + E    K +P DF LWK +T     WD  +  GRPGWH ECS +I+K+LGD IDIHGGG DL FPHHENE  Q    +  D  R W+H G++NI+ +KMSKSL NF L +DLL++Y+  T+R+    + Y +PLNF+ + L N++  L+ + Y L
  S:     9 LTGKKDDFIPLDPNRITLYVCGPTVYNFVHIGNARPVVVFDVLYRLLQRLYPNVVYARNITDIDDKIIKAAADNGEAISTLTERFTQAFADDMASLNAKTPSI-IPKATDHIPEMIQMIAILVEKGHAYEADGQVLFAVESMPDYGKLSGRKLEDMLAGARVEVADYKRHPGDFILWKPSTDEQPGWDSPWGRGRPGWHIECSAMIHKHLGDVIDIHGGGQDLIFPHHENEIAQGCCAHGTDYVRYWLHNGYINIDGEKMSKSLGNFRLVRDLLTQYHGETLRFALLSSHYRSPLNFSADVLDNAEKGLDTLYYAL 323
>gi|15675744|ref|NP_269918.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] >gi|71911468|ref|YP_283018.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] >gi|21264023|sp|Q99XZ9|SYC_STRP1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|13622964|gb|AAK34639.1| putative cysteinyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] >gi|71854250|gb|AAZ52273.1| cysteinyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] (447 aa)
Score = 707, Expect = 1.7e-72, Identities = 156/433 (36%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++  K V L +  + +YVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A +  +   ELS  +   + +  K + +  +    PRV D+I +I ++++ ++   FAY  DGDVYF   KS  Y K++NK L EL VG     + +   K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G + ++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++  L+ +   L    +    EQ+  +  + F  +    + ++FN  N ++ + +  K+    + + ++ E  K  F     +  + GII    F++E +E     L+ K  + +  ++F+ +D  R  L
  S:     2 IKIYDTMTRSLRKFVPLTENTVNIYVCGPTVYNYIHIGNARSAVAFDTIRRYFEYTGYQVNYISNFTDVDDKIIKAATQAGVSPKELSDRFIAAFIEDTKALGVKPATQN-PRVMDYIAEIISFVESLIEKDFAYEADGDVYFRVEKSEHYAKLANKTLSELEVGASGRTDAETALKENPLDFALWKSAKAGEVSWDSPWGFGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHDMLQTVDGQVLRFFLATQQYRKPINFTEKTIHDAEINLKYLKNTLQQPLTETADEQELKQFVIAFQDA----MDDDFNTANGITVVFDMAKW----INSGSYTEPVKSAFE---KMLAVFGII----FEEEVLEVDIEALIAKRQEARANRDFATADAIRDQL 428
>gi|168264876|ref|ZP_02686841.1| cysteinyl-tRNA synthetase [Listeria monocytogenes FSL J2-071] (476 aa)
Score = 707, Expect = 1.8e-72, Identities = 167/424 (39%), Positives = 244/424 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  + +  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK    G + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A  WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L  K    +N L   LS   L  ++LG+       +  DD  +E L+ +  + + E+NF+ +D+ R +L EK L 
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKATVN-PRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEEAHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLA-KETVSINVLREFLSMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKILF 458
>gi|46906472|ref|YP_012861.1| cysteinyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|47094540|ref|ZP_00232204.1| cysteinyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] >gi|47097639|ref|ZP_00235159.1| cysteinyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|153165269|ref|ZP_01926220.1| hypothetical protein LMHG_01118 [Listeria monocytogenes FSL N1-017] >gi|153186387|ref|ZP_01936705.1| hypothetical protein LMOG_02666 [Listeria monocytogenes J0161] >gi|153189494|ref|ZP_01937078.1| hypothetical protein LMPG_01662 [Listeria monocytogenes J2818] >gi|153200699|ref|ZP_01942780.1| hypothetical protein LMSG_01502 [Listeria monocytogenes HPB2262] >gi|61216246|sp|Q724H3|SYC_LISMF Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|46879736|gb|AAT03038.1| cysteinyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|47013983|gb|EAL04996.1| cysteinyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|47017086|gb|EAL07955.1| cysteinyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] >gi|126941155|gb|EBA19048.1| hypothetical protein LMOG_02666 [Listeria monocytogenes J0161] >gi|127766669|gb|EBA26999.1| hypothetical protein LMPG_01662 [Listeria monocytogenes J2818] >gi|133728302|gb|EBA30000.1| hypothetical protein LMHG_01118 [Listeria monocytogenes FSL N1-017] >gi|133736441|gb|EBA38139.1| hypothetical protein LMSG_01502 [Listeria monocytogenes HPB2262] (471 aa)
Score = 707, Expect = 1.9e-72, Identities = 166/424 (39%), Positives = 245/424 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  + +  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK    G + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A  WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L  K    +N L   LS   L  ++LG+       +  DD  +E L+ +  + + E+NF+ +D+ R +L EK ++
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKATVN-PRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEEAHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLA-KETVSINVLREFLSMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII 458
>gi|81429293|ref|YP_396294.1| cysteinyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] >gi|109894906|sp|Q38UZ6|SYC_LACSS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|78610936|emb|CAI55988.1| Cysteinyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] (468 aa)
Score = 706, Expect = 2.3e-72, Identities = 159/439 (36%), Positives = 250/439 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG----DKSEDNLKKNNPQDFALWK-QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNE---------KNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEE--LNKLHFNLSYLLTKILGIIHV--NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + +Y+ +++  +    L++  +KMYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TD+DDK++  A  ENI   EL+  Y T + +  K +NI  + +  PR +D+I++I  +IQ ++   +AY VDGDVY+   K   YG ++ + LD+L  G      +E+ L+K +P DFALWK +    + W+  +  GRPGWH ECS +  KYLGD IDIHGGG DL+FPHHENE  Q+ A   +     W+H G + +  ++QKMSKSL NF+   DL+ E N   +R+    T Y  P+ ++   L  ++  L+ +   L+    +L   Q   E         K  E + + +  + ++FN+ N ++ + E  K S+  L     +   L  L   L+ LL  I G++     L D E   L+ +    +  K+F++SD  R  L  + ++
  S:     2 LTVYNTLTRQKETFKPLEEGRVKMYVCGPTVYNYIHIGNARSAIAFDTIRRYLEYRGYQVDYVSNFTDVDDKMIKAANAENITVPELADRYITAFKEDTKALNIEPATLN-PRATDNIEEIVAFIQDLIAKDYAYAVDGDVYYRARKFKAYGHLAGQDLDQLEQGASEHTATEETLRKEDPIDFALWKAEKGNEIAWESPWGKGRPGWHIECSVMSTKYLGDTIDIHGGGQDLEFPHHENEIAQSEAKTGQTFVNYWLHNGFVTVGDDDQKMSKSLGNFVTVHDLIQEVNPQALRFLMSSTQYRRPIRYSQSLLAEAQTNLDRLKTTLD----NLAFRQPTAEPGEDQIVMDKAAELEAAFVTAMDDDFNVQNGLTQLYELAKLSNQYLEQPTVQSDTLTSLATRLTRLLA-IFGVVFKADQLLDTEVESLIEERQAARAAKDFAKSDAIRDQLKAQGII 455
>gi|139438524|ref|ZP_01772040.1| Hypothetical protein COLAER_01033 [Collinsella aerofaciens ATCC 25986] >gi|133776063|gb|EBA39883.1| Hypothetical protein COLAER_01033 [Collinsella aerofaciens ATCC 25986] (488 aa)
Score = 706, Expect = 2.5e-72, Identities = 127/316 (40%), Positives = 197/316 (62%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           M+IY+  +   +E   ++   ++MYVCGPTVY+++HIGN R  I+FDV+ R  +  GY VTF  N+TD+DDKI+ +A E+     E+++ +  ++  +++  N+   +++ PR +  I  +   I+ ++    AY  D GDVYF       YG++S + +D+L+VG + E+N  KN+P DFALWK    G  +W   +  GRPGWHTEC+ ++++YLG  IDIHGGG DL FPHHENE  Q     ++  +  WMH G L ++ +KMSKSL NF    ++L +++   +R    QTSY +PL+F+ E L  ++N L  I
  S:     1 MRIYNSATHKKEEFQPIESGKVRMYVCGPTVYDNIHIGNARTFISFDVIRRWLIASGYEVTFAQNLTDVDDKIIKRANEQGRTAAEVATEFSDKFIGVMRAANVLDPDVR-PRATKEIGPMIAMIKTLIEQGHAYAADNGDVYFAVRSDPNYGQVSGRNIDDLMVGARIEENEDKNDPLDFALWKAAKPGEPSWPSPWGEGRPGWHTECAAMVHRYLGTPIDIHGGGSDLAFPHHENECAQATCAWHQGFSNTWMHTGMLLVDGEKMSKSLGNFFTLAEVLEQHSAAALRLLMLQTSYRSPLDFSWERLEGAENSLTRI 318
>gi|153198267|ref|ZP_01942372.1| hypothetical protein LMRG_02667 [Listeria monocytogenes 10403S] >gi|127632098|gb|EBA21811.1| hypothetical protein LMRG_02667 [Listeria monocytogenes 10403S] (471 aa)
Score = 706, Expect = 2.7e-72, Identities = 166/424 (39%), Positives = 245/424 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  +++  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK    G + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A  WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L  K    +N L   LS   L  ++LG        +  DD  +E L+ +  + + E+NF+ +D+ R +L EK ++
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKASVN-PRVTENMDEIIQMISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEEAHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLA-KETVSINVLREFLSMMRLFAEVLGFKLENTQSDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII 458
>gi|157150688|ref|YP_001449668.1| cysteinyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075482|gb|ABV10165.1| cysteinyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] (447 aa)
Score = 705, Expect = 2.9e-72, Identities = 156/433 (36%), Positives = 248/433 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ +E V +++  ++MYVCGPTVYN++H+GN R  + FD + R F   G+ V +I N TD+DDKI+++AKEE I   E++  Y   + + +  + +  +  + PRV + + DI  +++ +V+  +AY  +GDVYF   KS+ Y K++NK L +L +G      E+  +K NP DFALWK    G ++WD  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   +  A  WMH G +NI++ KMSKSL NFI   D L   +   +R+FF    Y  P+NFT + + ++   L+   Y  N ++     +   ++     DK     +  +FN  N ++ + E  K+    + + N+    K  F     L ++ GI+ V    D  IE L+ +    +  ++F+ +D+ R  L
  S:     2 IKIYDTMTRSLREFVPIEEGKVRMYVCGPTVYNYIHVGNARSTVAFDTVRRYFEYRGFEVNYISNFTDVDDKIIHRAKEEGITPKEVADKYIAAFREDVSALGVKPAT-RHPRVVEFMADIIRFVEDLVDKGYAYESEGDVYFRVEKSHNYAKLANKTLADLELGASGRTDEETARKENPVDFALWKAAKPGEISWDSPWGAGRPGWHIECSVMSTEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTCQTFANYWMHNGFVNIDDVKMSKSLGNFITVHDALKTIDGQVLRFFFATQHYRKPINFTEKAVHDAATNLK---YLKNTYEQPFTGQADSDQLQDFLDKFT-AAMDEDFNAANGITVVFELAKW----INSGNYTAEVKTAFA---KLLEVFGIVFVEEVLDADIERLIEERQVARANRDFATADRIRDEL 428
>gi|70727478|ref|YP_254394.1| cysteinyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435] >gi|109894948|sp|Q4L3I9|SYC_STAHJ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|68448204|dbj|BAE05788.1| cysteinyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435] (466 aa)
Score = 705, Expect = 3.4e-72, Identities = 163/424 (38%), Positives = 263/424 (62%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE------------LTNNFNLPNIVS--FIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII----HVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GY V ++ N TD+DDK++N++KE N    +++  Y   +++ +  +N+   TSN   PRV +H+ +I ++I+++V+  +AY  DGDVYF T K   YGK+S++ LD+L VG + E   +K +  DF LWK+   G ++W+  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E +  +K+ LE       I  S+ +IE++        D+S  IE            + ++FN  N V+  +   K+    +L  N + + +++    +  + + +LG+       ++  DE IE L+ + N+ ++ K+F+ +D+ R +L E+ ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYKGYEVIYVSNFTDVDDKLINRSKELNESVPDIADRYIKAFYEDVGALNVKKATSN---PRVMNHMDEIIDFIKELVDEGYAYESDGDVYFRTRKFEGYGKLSHQSLDDLKVGARIEAGEQKEDALDFTLWKKAKPGEISWESPFGEGRPGWHIECSVMAFHELGKTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVNAAKSGLE------RIRNSYQLIEERETIATDIVDQSKYIEQIDAIIEQFETVMDDDFNTANAVTAWYDLSKLANKYVLENNTSTQVISRFK-EVYQIFSDVLGVPLKGNKSDMLLDEDIEKLIEERNEARKNKDFARADEIRDMLKEQNII 453
>gi|110799706|ref|YP_697116.1| cysteinyl-tRNA synthetase [Clostridium perfringens ATCC 13124] >gi|168211251|ref|ZP_02636876.1| cysteinyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] >gi|122958668|sp|Q0TMM4|SYC_CLOP1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|110674353|gb|ABG83340.1| cysteinyl-tRNA synthetase [Clostridium perfringens ATCC 13124] >gi|170710753|gb|EDT22935.1| cysteinyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] (466 aa)
Score = 704, Expect = 3.9e-72, Identities = 160/439 (36%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE----------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+Y+ ++K  +E + L    +KMYVCGPTVYN  HIGN R  I FD + R F   G+ V F+ N TDIDDK++ KA EE     ++   Y  +Y+     +NI  + +  PR ++ I +I  +++ +V+  +AY VDGDVYF T K   YGK+S + +++L  G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LG+ IDIH GG DLKFPHHENE  Q+ A+  +  AR W+H   +N+NN+KMSKSL+NF  A+++L  Y+ + +R+      Y   LNF+ + L ++K  +E  IYN      +LI E    E N E          + +  + ++ ++FN  + ++ I + IK ++  +   + +EL +    L   L   LG+   +     ++E   L+ K  + +++++F+ +DK R  L ++ ++
  S:     2 IKVYNTLNKKKEEFIPLTPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYFEYRGFKVDFVQNFTDIDDKMIKKANEEGTTVKKIGDTYIKEYYQDADALNIERATVN-PRATEFIGEIIKFVKGLVDKGYAYEVDGDVYFSTKKFEGYGKLSGQNIEDLQSGARISVDERKKDPMDFAIWKAQKPGEPAWNSPWGMGRPGWHIECSCMAKKLLGETIDIHAGGSDLKFPHHENEIAQSEALTGEPFARYWLHSAFVNVNNEKMSKSLNNFFTAREILERYDADVIRFLMLSAHYRQQLNFSEDLLESAKASVER-IYNAIGNLENLIDEVSREEMNEEEKAYLESLNKYKEKYIEKMDDDFNTADAITAIFDLIKDTNTNITIDSSKELAQKALELIRELGAPLGMFQKSTKGNLEEEIEALIAKRQQARKDRDFTLADKIRDELKDRGIV 453
>gi|169344133|ref|ZP_02865116.1| cysteinyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] >gi|169297744|gb|EDS79843.1| cysteinyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] (466 aa)
Score = 704, Expect = 4.2e-72, Identities = 160/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE----------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+Y+ ++K  +E + L    +KMYVCGPTVYN  HIGN R  I FD + R F   G+ V F+ N TDIDDK++ KA EE     ++   Y  +Y+     +NI  + +  PR ++ I +I  +++ +V+  +AY VDGDVYF T K   YGK+S + +++L  G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LG+ IDIH GG DLKFPHHENE  Q+ A+  +  AR W+H   +N+NN+KMSKSL+NF  A+++L  Y+ + +R+      Y   LNF+ + L ++K  +E  IYN      +LI E    E N E          + +  + ++ ++FN  + ++ I + IK ++  +   + +EL +    L   L   LG+   +      +E   L+ K  + +++++F+ +DK R  L ++ ++
  S:     2 IKVYNTLNKKKEEFIPLTPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYFEYRGFKVDFVQNFTDIDDKMIKKANEEGTTVKKIGDTYIKEYYQDADALNIERATVN-PRATEFIGEIIKFVKGLVDKGYAYEVDGDVYFSTKKFQGYGKLSGQNIEDLQSGARISVDERKKDPMDFAIWKAQKPGEPAWNSPWGMGRPGWHIECSCMAKKLLGETIDIHAGGSDLKFPHHENEIAQSEALTGEPFARYWLHSAFVNVNNEKMSKSLNNFFTAREILERYDADVIRFLMLSAHYRQQLNFSEDLLESAKASVER-IYNAIGNLENLIDEVSREEMNEEEKAYLESLNQYKEKYIEKMDDDFNTADAITAIFDLIKDTNTNITIDSSKELAQKALELIRELGAPLGMFQKSTKGNLAEEIEALIAKRQQARKDRDFALADKIRDELKDRGII 453
>gi|18311409|ref|NP_563343.1| cysteinyl-tRNA synthetase [Clostridium perfringens str. 13] >gi|168214716|ref|ZP_02640341.1| cysteinyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] >gi|168217920|ref|ZP_02643545.1| cysteinyl-tRNA synthetase [Clostridium perfringens NCTC 8239] >gi|182626995|ref|ZP_02954725.1| cysteinyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] >gi|21264002|sp|Q8XHQ5|SYC_CLOPE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|18146093|dbj|BAB82133.1| cysteine-tRNA ligase [Clostridium perfringens str. 13] >gi|170713805|gb|EDT25987.1| cysteinyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] >gi|177907665|gb|EDT70289.1| cysteinyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] >gi|182380037|gb|EDT77516.1| cysteinyl-tRNA synthetase [Clostridium perfringens NCTC 8239] (466 aa)
Score = 704, Expect = 4.3e-72, Identities = 160/439 (36%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE----------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+Y+ ++K  +E + L    +KMYVCGPTVYN  HIGN R  I FD + R F   G+ V F+ N TDIDDK++ KA EE     ++   Y  +Y+     +NI  + +  PR ++ I +I  +++ +V+  +AY VDGDVYF T K   YGK+S + +++L  G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LG+ IDIH GG DLKFPHHENE  Q+ A+  +  AR W+H   +N+NN+KMSKSL+NF  A+++L  Y+ + +R+      Y   LNF+ + L ++K  +E  IYN      +LI E    E N E          + +  + ++ ++FN  + ++ I + IK ++  +   + +EL +    L   L   LG+   +     ++E   L+ K  + +++++F+ +DK R  L ++ ++
  S:     2 IKVYNTLNKKKEEFIPLTPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYFEYRGFKVDFVQNFTDIDDKMIKKANEEGTTVKKIGDTYIKEYYQDADALNIERATVN-PRATEFIGEIIKFVKGLVDKGYAYEVDGDVYFSTKKFEGYGKLSGQNIEDLQSGARISVDERKKDPMDFAIWKAQKPGEPAWNSPWGMGRPGWHIECSCMAKKLLGETIDIHAGGSDLKFPHHENEIAQSEALTGEPFARYWLHSAFVNVNNEKMSKSLNNFFTAREILERYDADVIRFLMLSAHYRQQLNFSEDLLESAKASVER-IYNAIGNLENLIDEVSREEMNEEEKAYLESLNKYKEKYIEKMDDDFNTADAITAIFDLIKDTNTNITIDSSKELAQKALELIRELGAPLGMFQKSTKGNLEEEIEALIAKRQQARKDRDFALADKIRDELKDRGIV 453
>gi|168206821|ref|ZP_02632826.1| cysteinyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] >gi|170661739|gb|EDT14422.1| cysteinyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] (466 aa)
Score = 704, Expect = 4.4e-72, Identities = 160/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE----------FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+Y+ ++K  +E + L    +KMYVCGPTVYN  HIGN R  I FD + R F   G+ V F+ N TDIDDK++ KA EE     ++   Y  +Y+     +NI  + +  PR ++ I +I  +++ +V+  +AY VDGDVYF T K   YGK+S + +++L  G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+  K LG+ IDIH GG DLKFPHHENE  Q+ A+  +  AR W+H   +N+NN+KMSKSL+NF  A+++L  Y+ + +R+      Y   LNF+ + L ++K  +E  IYN      +LI E    E N E          + +  + ++ ++FN  + ++ I + IK ++  +   + +EL +    L   L   LG+   +      +E   L+ K  + +++++F+ +DK R  L ++ ++
  S:     2 IKVYNTLNKKKEEFIPLTPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYFEYRGFKVDFVQNFTDIDDKMIKKANEEGTTVKKIGDTYIKEYYQDADALNIERATVN-PRATEFIGEIIKFVKGLVDKGYAYEVDGDVYFSTKKFQGYGKLSGQNIEDLQSGARISVDERKKDPMDFAIWKAQKPGEPAWNSPWGMGRPGWHIECSCMAKKLLGETIDIHAGGSDLKFPHHENEIAQSEALTGEPFARYWLHSAFVNVNNEKMSKSLNNFFTAREILERYDADVIRFLMLSAHYRQQLNFSEDLLESAKASVER-IYNAIGNLENLIDEVSREEMNEEEKAYLESLNKYKEKYIEKMDDDFNTADAITAIFDLIKDTNTNITIDSSKELAQKALELIRELGAPLGMFQKSTKGNLAEEIEALIAKRQQARKDRDFALADKIRDELKDRGII 453
>gi|42779170|ref|NP_976417.1| cysteinyl-tRNA synthetase [Bacillus cereus ATCC 10987] >gi|61216251|sp|Q73FB7|SYC_BACC1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|42735085|gb|AAS39025.1| cysteinyl-tRNA synthetase [Bacillus cereus ATCC 10987] (465 aa)
Score = 703, Expect = 5.1e-72, Identities = 162/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +    L D+E   L+ K  + ++ ++F+ SD+ R  L ++ ++
  S:     3 IHIYNTLTRQKEEFIPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIQAYVKQLETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNII 452
>gi|196047745|ref|ZP_03114944.1| cysteinyl-tRNA synthetase [Bacillus cereus 03BB108] >gi|196021423|gb|EDX60131.1| cysteinyl-tRNA synthetase [Bacillus cereus 03BB108] (465 aa)
Score = 703, Expect = 5.6e-72, Identities = 162/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +    L D+E   L+ K  + ++ ++F+ SD+ R  L ++ ++
  S:     3 IHIYNTLTRQKEEFIPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQLETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNII 452
>gi|75760638|ref|ZP_00740667.1| Cysteinyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491881|gb|EAO55068.1| Cysteinyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] (339 aa)
Score = 703, Expect = 5.9e-72, Identities = 138/316 (43%), Positives = 201/316 (63%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ +++  +E V L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L  + N LE I
  S:     3 IHIYNTLTRQKEEFVPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFKTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQXTNNGLERI 319
>gi|169824112|ref|YP_001691723.1| cysteinyl-tRNA synthetase [Finegoldia magna ATCC 29328] >gi|167830917|dbj|BAG07833.1| cysteinyl-tRNA synthetase [Finegoldia magna ATCC 29328] (462 aa)
Score = 703, Expect = 5.9e-72, Identities = 166/434 (38%), Positives = 264/434 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN--WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI---IEQKYNEKNLE-FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEE---------LNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLM 434
           MK+Y+ +++  +E   + +KN+ +YVCGPTVYN++H+GN RPI+ FD L R F+  GYNV F+ N TDIDDKI+NKAK+ENI   E++  Y   Y D +  +N    +   P+ +++I ++  +++ + +   AY VDG+VYFD TK+  YGK+S K +D+L  G + + N +K NP DFALWK+        W+  +  GRPGWH ECS +    LGD IDIH GG DL+FPHHENE  Q+        A  W+H   + ++ +KMSKS +NF L KD+  E++   +R +     Y NP++F+ + L+ +KN L+  +Y    F + ++    E++  + N++ F +     + ++ N  + +S + + IKY      NKN++E           KL  ++SY+L  IL     +  D E  EL+ + N  ++EK+F ++D+ R  L+
  S:     1 MKLYNTLTRKKEEFKPIKEKNVGIYVCGPTVYNYIHVGNARPIVVFDTLRRYFIYKGYNVKFVSNFTDIDDKIINKAKDENIDFREITKKYIQAYLDNVSGLNFDEDDTIHPKATEYIDEMIKFVKTLEDKGAAYNVDGNVYFDITKAKDYGKLSKKNIDDLRAGARIDVNSEKKNPMDFALWKKRKEESEPAWESPWGMGRPGWHLECSVMSKTILGDTIDIHAGGEDLQFPHHENEIAQSETCTGAHFANYWLHNSMITVDKEKMSKSKNNFFLLKDIEKEFDLEVIRLWLLSVHYRNPIDFSHDTLVATKNSLDR-LYTAKKFLNRILENSSEKEEKDDNIKTFREKFEQAMDDDINTADAISVLFDFIKYI-----NKNYDENTSKNILLDAKKLMDDISYVL-GILFKEDDDDLDSEIEELIEQRNAARKEKDFKKADEIRDKLL 443
>gi|167769106|ref|ZP_02441159.1| hypothetical protein ANACOL_00429 [Anaerotruncus colihominis DSM 17241] >gi|167668746|gb|EDS12876.1| hypothetical protein ANACOL_00429 [Anaerotruncus colihominis DSM 17241] (462 aa)
Score = 703, Expect = 6.0e-72, Identities = 129/316 (40%), Positives = 196/316 (62%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           MKI++ +++  +E V ++   ++MY CGPTVYN++HIGN RPI  FD L R     GY+VTF+ N TDIDDK++NKA EE I   E++  Y  +Y    K + I  +++  PR +++I  I N ++ +    FAY  DG VYF + +  +YGK+S++ L+EL  G + + + KK +P DF LWK    G  +W   +  GRPGWH ECS +I ++LGD IDIH GG DL FPHHENE  Q+      +    WMH G++N++N+KMSKSL NF   +++  ++    +++   Q  Y +P+N++ E +   +  LE +
  S:     1 MKIFNTLTRQKEEFVPIEPGKVRMYACGPTVYNYIHIGNARPICVFDTLRRYLEYRGYDVTFVQNFTDIDDKLINKANEEGITVREVAERYIGEYMTDTKGLGIRPADIH-PRATENIDTIINMVKTLEEKGFAYERDGSVYFRSRRFEEYGKLSHQPLEELEAGARIDVSDKKEDPLDFVLWKAAKPGEPSWPSPWGEGRPGWHIECSAMIRRHLGDTIDIHCGGQDLIFPHHENEIAQSECCTGAEYVHYWMHNGYINVDNRKMSKSLGNFFTVREVAEKFGYEPIKFMMLQAHYRSPINYSLEVIEQCRAALERL 317
>gi|153813240|ref|ZP_01965908.1| hypothetical protein RUMOBE_03656 [Ruminococcus obeum ATCC 29174] >gi|149830653|gb|EDM85744.1| hypothetical protein RUMOBE_03656 [Ruminococcus obeum ATCC 29174] (469 aa)
Score = 703, Expect = 6.2e-72, Identities = 160/436 (36%), Positives = 258/436 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKS-----EDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFK----SHLIIEQKYNEKNLEFDKSNLI-----ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           MK+++ +S+  +E V L++  ++MYVCGPTVYN +HIGN RP+I FD + R     GY+V ++ N TD+DDKI+ KA EE +   E+S  Y  +    +  +N+  +    P  +  I  + + IQ +++ ++AY V DG VYF   K  +YGK+S+K LD+L  G +S     ED  +K +P DF LWK    G   W   +  GRPGWH ECS +  KYLG++IDIH GG DL FPHHENE  Q+   N    A+ WMH   LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ + + +SKN LE I       +    +  + E   +EK L  +++  +      + ++FN  + ++ + E +K+++  ++  + +E       +   L  +LG+       + D+E   L+ +    ++ K+F+ +D+ R LL++K
  S:     1 MKLFNTMSRRKEEFVPLEEGKVRMYVCGPTVYNLIHIGNARPMIIFDTVRRYLEYKGYDVNYVSNFTDVDDKIIKKAIEEGVSAEEISQRYIAECKKDMAGMNVKPATTH-PLATQEIDGMIDMIQTLIDKEYAYPVADGTVYFRVKKFKEYGKLSHKNLDDLQSGFRSLQVSGED--QKEDPLDFVLWKPKKEGEPFWKSPWCDGRPGWHIECSVMSKKYLGEEIDIHAGGEDLVFPHHENEIAQSECCNGVPFAKYWMHNAFLNIDNRKMSKSLGNFRTVREIGEQYDLQVLRFFMLNAHYRSPLNFSADLMESSKNALERITEAAARLRDRQAAATVQEATEDEKKLMQEEAAFVTKFEESMDDDFNTADALAAVFELVKFANTNVQEGSSKEFAGHTLEVMTKLCDVLGLTLEKKEEILDEEIENLIAERQAARKAKDFARADEIRGLLLDK 453
>gi|188590724|ref|YP_001919652.1| cysteinyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] >gi|188501005|gb|ACD54141.1| cysteinyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] (470 aa)
Score = 702, Expect = 6.4e-72, Identities = 169/439 (38%), Positives = 262/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG----DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNF----------TTENLINSKNQLENII-----YNLNIFK-SHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M+I++ +++  +E + +    +KMYVCGPTVYN  HIGN R  I FD + R     GY+V F+ N TDIDDK++ KA EE     E+   Y  +Y++    + I  + +  PR +++I+DI +++ +++   +AY V+GDVYF+T K N YGK+S + +++L +G      S  + +K +P DFA+WK    G   W   +  GRPGWH ECSC+  K LGD IDIH GG+DL FPHHENE  Q+ A+     A  WMH  ++NINNQKMSKSL+NF  A+D+L EY+++ VR+F     Y   +NF          + E L N+   LEN+I      N+N  +  +L    KY EK +E       ++ ++FN  + ++ + E  K ++  +   + +EL     +L   L   LG+   I     +DE   L+ +    ++ K+F+ SDK R  L ++ ++
  S:     1 MRIFNTLTRKKEEFIPITPGEVKMYVCGPTVYNFFHIGNGRTFIVFDTIRRYLEYRGYDVKFVQNFTDIDDKMIKKANEEGTTVKEIGDKYIKEYYEDADKLQIERATVN-PRATEYIEDIIDFVAQLIEKGYAYEVEGDVYFNTKKFNDYGKLSGQSIEDLQMGASNRTSSVADERKKDPMDFAIWKSQKPGEPAWKCPWGMGRPGWHIECSCMAKKILGDTIDIHAGGMDLTFPHHENEVAQSEALTGVQFANYWMHSAYVNINNQKMSKSLNNFFTARDILKEYDSDVVRFFMMSAHYRLQINFSKDLLDSAKASVERLYNAIGNLENLIDEVSRENMNEEEVRYLNSLNKYREKYIE-------KMDDDFNTADALTVLFELTKDTNTNINVNSSKELVNKALDLIRELGAPLGLLQKITKGSLEDEIESLIQQRQDARKNKDFALSDKIRDDLKDRGIV 456
>gi|184154737|ref|YP_001843077.1| cysteinyl-tRNA synthase [Lactobacillus fermentum IFO 3956] >gi|183226081|dbj|BAG26597.1| cysteinyl-tRNA synthase [Lactobacillus fermentum IFO 3956] (472 aa)
Score = 702, Expect = 6.7e-72, Identities = 156/439 (35%), Positives = 254/439 (57%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNI-KMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK----SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINS-------KNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL------FDDEAI-ELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +++  +E    +  I  MYVCGPTVYN++HIGN R ++ FD + R     GY V ++ N TD+DDK++  AKE+ I   EL+  Y   Y +    +N+  +    PR +++I  I ++I+ ++   +AY   GDVY+   K   YG++S + LD+L VG      +E+  KK +P DFALWK    G + WD  +  GRPGWH ECS +  KYLGD +DIH GG DL+FPHHENE  Q+ A         WMH G + I  +N+KMSKSL NF+   DL+ E +   +R+F   T Y  P+ ++ E+L+ +       KN  +N+ Y L    S    +     +  +F    +  + ++ N+ N ++ + E +++++  +  +  +    +   L  +L +++ +  V+L       +DE I EL+ K N  + EK+F+ SD+ R  L ++ ++
  S:     2 LKIYNTLTRQKEEFHPQQAGIVNMYVCGPTVYNYIHIGNARSVVAFDTVRRYLEFSGYQVNYVSNFTDVDDKMIKAAKEQGITVPELAYKYIQAYMEDTAALNVEPATTH-PRATENIDGIISFIEDLIEKGYAYQSGGDVYYRARKFAHYGQLSGQSLDDLEVGASEHVSTEEVAKKKDPLDFALWKAAKPGEIKWDSPWGAGRPGWHIECSVMSTKYLGDTLDIHAGGQDLEFPHHENEIAQSEAKTGHRFVNYWMHNGFVTIGRDNEKMSKSLGNFVTVHDLIKEVDPQVLRFFMSTTQYRRPIQYSQESLVEAQANLEHLKNTYDNLAYRLKDATSG--TDGGVQRQLADFRARFVAAMDDDINVQNGIAVVYELMRFANQYVEQRLVQREPIVAIQL--MLKRLVAVFGVDLAVSATEINDEKIKELIEKRNAARAEKDFALSDQIRDQLRDQGII 457
>gi|162447013|ref|YP_001620145.1| cysteinyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] >gi|187629784|sp|A9NEI9|SYC_ACHLI Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|161985120|gb|ABX80769.1| cysteinyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] (434 aa)
Score = 702, Expect = 7.8e-72, Identities = 160/439 (36%), Positives = 260/439 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD--DEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +S   +E   + +K + MYVCGPTVY+ +HIGN RP++ FDV+ R    L Y V +  NITD+DDKI+++A++ +I E EL++ Y   +F+I K I  +  ++  P  +++I+++  +I +++++ FAY     VYF   K   YG +SN+++ +L  G + +    K    DFALWK T  G+ +   +  GRPGWHTEC  + N+  G +IDIHGGG DLKFPHHENE  Q++A ++  LA+ WMHVG L++ N+KMSKSL N I  KDL+  YN N  R       Y  P+ F+ + +   +   + I Y LN +  H+I+    NE  L+ +     E  + ++F  P ++S I++ IK  +   + +N+  + ++   L          I+ N+ +  ++ I+  N W + + EKN+ ++D YRK L++K  +
  S:     2 LKIYNSLSNKIEEFKPIHEKKVNMYVCGPTVYDDIHIGNGRPVVFFDVVKRYLQYLDYGVKYASNITDVDDKIIDRAQKLHITEKELATTYTNNFFEIAKKIGGYNFDVT-PHATNYIEEMIKFIGELISDGFAYKTQSGVYFRVDKIKDYGILSNQQVKDLKTGVRIDLETDKEKDYDFALWKNTEEGIKYHAPWGDGRPGWHTECVVMTNEIFGGEIDIHGGGFDLKFPHHENEIAQSVAKHDHHLAKYWMHVGRLDLANEKMSKSLGNDIKLKDLVQVYNPNAYRLMLLAHHYRAPIQFSDDLIEQYQKAYDKISYTLNKWHFHMIL-NNINENGLDHESMEYFEGFMNDDFATPRVISLIDKLIKDLNKAFKVENYNTIIQILSTLG---------INPNILEVLEDDIQNYNNWQQARLEKNYEKADIYRKPLLDKGFI 434
>gi|169335260|ref|ZP_02862453.1| hypothetical protein ANASTE_01668 [Anaerofustis stercorihominis DSM 17244] >gi|169257998|gb|EDS71964.1| hypothetical protein ANASTE_01668 [Anaerofustis stercorihominis DSM 17244] (468 aa)
Score = 702, Expect = 7.9e-72, Identities = 173/439 (39%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT--IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE------------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII----HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ +++  +E V +++  + MYVCGPTVYN  HIGN RP I FD L R     GY V ++ N TDIDDKI+NKAKEE+     ++  Y  +YF   K + I  + +  PRVS+ I DI + I  +  N +AY VDG+VY+  +K   YGK+S K +DEL+ G + E N +K +P DFALWK+      + +D  +  GRPGWH ECS +  KYLG  IDIHGGG DL FPHHENE  Q+   N KD    ++H G++NINN+KMSKS  NF + +D+  +++   VR F     Y  P+NF+ + L  +++ L N +YN    ++ L +  K  +K+L+ D+   I             + ++ N  N VS I +  K  +  +   + +E+    + +   L  +LG++       + +DE IEL+ K    ++ K+F+ +DK R  L++K ++
  S:     1 MKLYNTLTRKKEEFVPINEGEVNMYVCGPTVYNFFHIGNARPFIIFDTLRRYLEYKGYKVNYVQNFTDIDDKIINKAKEEHTTSKAVADKYIKEYFTDAKGLGIKEATVH-PRVSECIGDIIDLISDLEKNGYAYNVDGNVYYRVSKFKDYGKLSKKPIDELISGARVEVNDEKESPLDFALWKKQKEDSEIAFDSPWGKGRPGWHIECSAMSRKYLGSTIDIHGGGEDLIFPHHENEIAQSEGANGKDFVHYFVHNGYININNEKMSKSKGNFFMVRDISKDFDLEVVRLFMLSAHYKTPVNFSFDILKQTQSGL-NRLYNTK--ENLLYLLDKAKDKDLKEDEKEFINSLPKYREEFKNAMEDDINTANAVSTIYDLSKDINSNVNENSSKEMIMKSYEMYMELNGVLGLLTKEKEDEILEDEIIELIEKRQNARKNKDFALADKIRDDLLDKGIV 454
>gi|163791190|ref|ZP_02185607.1| cysteinyl-tRNA synthetase [Carnobacterium sp. AT7] >gi|159873521|gb|EDP67608.1| cysteinyl-tRNA synthetase [Carnobacterium sp. AT7] (468 aa)
Score = 702, Expect = 7.9e-72, Identities = 159/439 (36%), Positives = 251/439 (57%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE-------FDKSNLIELTNNFNLPNIVSFIEEKIK----YSSILLRNKNFEELNKLHFNLSYLLTKILGII--HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ ++ K +  + +++  ++MYVCGPTVYN++HIGN R  + FD + R     GY+V ++ N TD+DDKI+  AKE N+   E++  +   Y +    + +  ++   PRV +++ DI ++I  ++  ++AY VDGDVY+ T K   YG++S+  +DEL VG      +++N KK +P DFALWK      +NW+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A      A  WMH G + ++N+KMSKSL NF+L  D++ + +   +R+F   T Y  P++++   +  ++  L  I    +     L       E + E       F ++ + E+ ++FN  N ++ I E  K    YS   + +K   E     F     L ++ GI      L D+   +L+ + N  +  KNF  SD  R  L E+ ++
  S:     2 LKIYNTLTRKKEAFIPIEEGKVRMYVCGPTVYNYIHIGNARSTVAFDTVRRYLEYRGYDVNYVSNFTDVDDKIIRTAKELNLTAPEVADKFIAAYHEDTHALGVEEAS-HHPRVMENMPDIIDFIAVLIEKEYAYEVDGDVYYRTRKFKNYGELSDISIDELEVGASNRLNAQENNKKEDPLDFALWKAAKEAEINWESPWGPGRPGWHIECSVMATKYLGDTIDIHAGGQDLAFPHHENEIAQSEAKTGHPFAHYWMHNGFVTMDNEKMSKSLGNFVLVHDIIKQVDPQILRFFMATTQYRRPISYSETTIEEARANLTKITMAFDNVTYRLKDAAAVGEDDQEQISQFKLFKENFVTEMDDDFNSANGITVIYEMAKAMNIYSERTVVSKVVLEAMLHQFQ---ELVQVFGITFGETELLDETIEQLIEERNAARAAKNFQRSDDIRDQLKEEGII 455
>gi|30260280|ref|NP_842657.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47525344|ref|YP_016693.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183123|ref|YP_026375.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|49481691|ref|YP_034442.1| cysteinyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145127|ref|YP_081701.1| cysteinyl-tRNA synthetase [Bacillus cereus E33L] >gi|65317550|ref|ZP_00390509.1| COG0215: Cysteinyl-tRNA synthetase [Bacillus anthracis str. A2012] >gi|165873141|ref|ZP_02217757.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|166996985|ref|ZP_02263444.1| cysteinyl-tRNA synthetase [Bacillus cereus AH820] >gi|167635089|ref|ZP_02393406.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|167641949|ref|ZP_02400184.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|170689572|ref|ZP_02880758.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|170707565|ref|ZP_02898018.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|177655593|ref|ZP_02936974.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|196041797|ref|ZP_03109087.1| cysteinyl-tRNA synthetase [Bacillus cereus NVH0597-99] >gi|33301677|sp|Q81VV1|SYC_BACAN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216160|sp|Q63HB0|SYC_BACCZ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216199|sp|Q6HPS8|SYC_BACHK Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|30253601|gb|AAP24143.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47500492|gb|AAT29168.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177050|gb|AAT52426.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|49333247|gb|AAT63893.1| cysteine--tRNA ligase (cysteinyl-tRNA synthetase) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978596|gb|AAU20146.1| cysteine--tRNA ligase (cysteinyl-tRNA synthetase) [Bacillus cereus E33L] >gi|164711121|gb|EDR16682.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|167510080|gb|EDR85491.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|167529563|gb|EDR92313.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|170127561|gb|EDS96435.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|170666485|gb|EDT17262.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|172080057|gb|EDT65155.1| cysteinyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|196027417|gb|EDX66034.1| cysteinyl-tRNA synthetase [Bacillus cereus NVH0597-99] (465 aa)
Score = 702, Expect = 8.0e-72, Identities = 162/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +    L D+E   L+ K  + ++ ++F+ SD+ R  L ++ ++
  S:     3 IHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQLETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNII 452
>gi|25010277|ref|NP_734672.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|77407940|ref|ZP_00784691.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae COH1] >gi|30316158|sp|Q8E7F2|SYC_STRA3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|23094629|emb|CAD45847.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|77173487|gb|EAO76605.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae COH1] (447 aa)
Score = 702, Expect = 8.0e-72, Identities = 160/436 (36%), Positives = 260/436 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE---DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE-FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD ++++ ++ + L++  + MYVCGPTVYN++HIGN R ++ FD + R F   GY V +I N TD+DDKI+  A E  +     S  + + + + +  + +  +  K PRV D++ +I ++++ +V+ +FAY  +GDVYF  +KS+ Y K++NK L++L +G       +   K NP DFALWK    G ++W+  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NFI   D+L   +   +R+F     Y  P+NFT + + +++    N+ Y  N F  +L I++  N++ LE F K+    + ++FN  N ++ I E  K+ +      +    +K+   L+ LL +I GI+      D  IE L+ +  + +  ++F+ +D+ R  L ++
  S:     2 IKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYCGYQVNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALGVKPAT-KNPRVIDYMDEIIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLEIGASGRVDGEGEIKENPLDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHDMLKSVDGQVIRFFLATQQYRKPVNFTEKAVHDAE---VNLKYLKNTF--NLPIQENANDEELEQFVKAFQEAMDDDFNTANGITVIFEMAKWIN------SGHYTSKVKETLAELL-EIFGIVFQEEVLDADIESLIEQRQEARANRDFATADRIRDELAKQ 431
>gi|163938097|ref|YP_001642981.1| cysteinyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] >gi|163860294|gb|ABY41353.1| cysteinyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] (465 aa)
Score = 701, Expect = 8.3e-72, Identities = 163/439 (37%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL-EFDKSNLI---ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ + L ++ N LE I       K  +        +NEK L E +K  +     + ++FN  N ++ +     +++  LL     + + + +      L  ILG  +    L D+E   L+ K  + +Q ++F+ SD+ R  L  + ++
  S:     3 IHIYNTLTRQKEEFMPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFKTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGKGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEDLLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLAEMEKFQVAFEEAMDDDFNTANAITELYNVANHANQYLLEEHTSKVVIEAYVKQLETLFSILGLELAQEELLDEEIEALIQKRIEARQNRDFALSDQIRDDLKGRNII 452
>gi|16077162|ref|NP_387975.1| cysteinyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] >gi|549024|sp|Q06752|SYC_BACSU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|289284|gb|AAA21798.1| cysteinyl-tRNA synthetase >gi|467482|dbj|BAA05328.1| cysteinyl-tRNA synthetase [Bacillus subtilis] >gi|499303|emb|CAA52167.1| cysteine--tRNA ligase [Bacillus subtilis] >gi|2632361|emb|CAB11870.1| cysteinyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] (466 aa)
Score = 701, Expect = 8.9e-72, Identities = 153/426 (35%), Positives = 250/426 (58%)
  Q:    14 VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL-------ENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILL-RNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           V L++  +KMYVCGPTVYN++HIGN RP I +D +       GY+V ++ N TD+DDK++  A E       +S  +   YF+ +  +    +++  PRV +++  I  ++ ++V   +AY  +GDVYF T     YGK+S + +DEL  G +     KK +  DFALWK    G ++WD  +  GRPGWH ECS ++ KYLGDQIDIH GG DL FPHHENE  Q+ A+  K  A+ W+H G++NI+N+KMSKSL NF+L  D++ +++   +R+F     Y +P+N++ E L N+K+          N+ + LN   +    + ++ EK  E  K+   E+ ++FN  N +S + +  K+++  L ++   + +      +   +  +LG  +    L D E  +L+ K N+ ++ ++F+ SD+ R  L    ++
  S:    17 VPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTISERFIKAYFEDVGALGCRKADLH-PRVMENMDAIIEFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDELRSGARIRVGEKKEDALDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQIDIHAGGQDLTFPHHENEIAQSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDIIKQHDPQLLRFFMLSVHYRHPINYSEELLENTKSAFSRLKTAYSNLQHRLNSSTNLTEDDDQWLEKVEEHRKAFEEEMDDDFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMFDRIVSVLGFSLGEQELLDQEIEDLIEKRNEARRNRDFALSDQIRDQLKSMNII 452
>gi|167013692|ref|ZP_02276225.1| cysteinyl-tRNA synthetase [Listeria monocytogenes FSL J1-194] (460 aa)
Score = 701, Expect = 9.4e-72, Identities = 165/423 (39%), Positives = 244/423 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKL 438
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  + +  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK    G + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A  WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L  +    +N L   LS   L  ++LG+       +  DD  +E L+ +  + + E+NF+ +D+ R +L EK +
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKATVN-PRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEEAHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLAKETV-SINVLREFLSMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNI 457
>gi|22536391|ref|NP_687242.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|77405339|ref|ZP_00782434.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae H36B] >gi|30316157|sp|Q8E1Z4|SYC_STRA5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|22533218|gb|AAM99114.1|AE014201_12 cysteinyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|77176017|gb|EAO78791.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae H36B] (447 aa)
Score = 701, Expect = 9.7e-72, Identities = 159/436 (36%), Positives = 258/436 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE---DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE-FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD ++++ ++ + L++  + MYVCGPTVYN++HIGN R ++ FD + R F   GY V +I N TD+DDKI+  A E  +     S  + + + + +  + +  +  K PRV D++ +I ++++ +V+ +FAY  +GDVYF  +KS+ Y K++NK L++L +G       +   K NP DFALWK    G ++W+  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NFI   D+L   +   +R+F     Y  P+NFT + + +++    N+ Y  N F  +L I++  N++ LE F K+    + ++FN  N ++ I E  K+    + + ++    K  F     L +I GI+      D  IE L+ +  + +  ++F+ +D+ R  L ++
  S:     2 IKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYCGYQVNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALGVKPAT-KNPRVIDYMDEIIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLEIGASGRVDGEGEIKENPLDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHDMLKSVDGQVIRFFLATQQYRKPVNFTEKAVHDAE---VNLKYLKNTF--NLPIQENANDEELEQFVKAFQGAMDDDFNTANGITVIFEMAKW----INSGHYTSRVKETFA---ELLEIFGIVFQEEVLDADIESLIEQRQEARANRDFATADRIRDELAKQ 431
>gi|166985488|ref|ZP_02256771.1| cysteinyl-tRNA synthetase [Bacillus cereus AH187] >gi|168164117|ref|ZP_02599350.1| cysteinyl-tRNA synthetase [Bacillus cereus H3081.97] (465 aa)
Score = 701, Expect = 1.0e-71, Identities = 161/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        ++EK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +    L D+E   L+ K  + ++ ++F+ SD+ R  L ++ ++
  S:     3 IHIYNTLTRQKEEFIPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLRSTNNGLERIKTAYGNLKHRMESSTDLTDHDEKWLADLKKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIQAYVKQLETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNII 452
>gi|190568970|ref|ZP_03021871.1| cysteinyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] >gi|190559894|gb|EDV13878.1| cysteinyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] (465 aa)
Score = 701, Expect = 1.0e-71, Identities = 162/439 (36%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       +++ +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +    L D+E   L+ K  + ++ ++F+ SD+ R  L ++ ++
  S:     3 IHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIANRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQLETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNII 452
>gi|116871622|ref|YP_848403.1| cysteinyl-tRNA synthetase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123460673|sp|A0AF38|SYC_LISW6 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116740500|emb|CAK19620.1| cysS [Listeria welshimeri serovar 6b str. SLCC5334] (471 aa)
Score = 700, Expect = 1.1e-71, Identities = 165/424 (38%), Positives = 245/424 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE-------NIIYNLNIFKSHLII---EQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY--LLTKILGI----IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L    +KMYVCGPTVYN++HIGN RPII FD + R F   GY+V F+ N TD+DDK++  A E  +   E++  +   YFD +  +N+  +++  PRV++++ +I   I  ++   +AY   GDVYF T K   YGK+S ++L EL  G + E N +K +  DF LWK      + W+  F  GRPGWH ECS L  KYLGD IDIH GG DL FPHHE+E  Q+ A   K  A  WMH   LNI+ +KMSKSL NFI   D+L + + N +R+F     Y  P+      L ++KN LE       NI + +       +    E ++ E+  E  ++   ++ ++FN  N ++   E  K ++I L  K    +N L   LS   L  ++LG+       +  DD  +E L+ +  + + E+NF+ +D+ R +L EK ++
  S:    19 LKDGEVKMYVCGPTVYNYIHIGNARPIIVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQLNVAKASVN-PRVTENMDEIIQLISTLIEKGYAYESAGDVYFRTKKFKDYGKLSGQELSELQHGARVEYNERKQDELDFTLWKAAKPDEIFWESPFGNGRPGWHIECSALAKKYLGDTIDIHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVLKDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEEAHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLA-KETVSINVLREFLSMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII 458
>gi|47569824|ref|ZP_00240494.1| cysteinyl-tRNA synthetase [Bacillus cereus G9241] >gi|47553517|gb|EAL11898.1| cysteinyl-tRNA synthetase [Bacillus cereus G9241] (465 aa)
Score = 700, Expect = 1.4e-71, Identities = 162/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +   +L D+E   L+ K  + ++ ++F+ SD+ R  L  + ++
  S:     3 IHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQLETLFDILGLELAQEDLLDEEIEALIQKRIEARKNRDFALSDQIRDDLKNRNII 452
>gi|78221284|ref|YP_383031.1| cysteinyl-tRNA synthetase [Geobacter metallireducens GS-15] >gi|109894903|sp|Q39ZL8|SYC_GEOMG Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|78192539|gb|ABB30306.1| cysteinyl-tRNA synthetase [Geobacter metallireducens GS-15] (485 aa)
Score = 699, Expect = 1.4e-71, Identities = 138/372 (37%), Positives = 222/372 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI---------IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILL 372
           +++Y+ +S T +E + L    + MYVCG TVY+H HIG+ R  + FD++ R     GY+VT++ N TD+DDKI+N+A +E +    +S  +  ++   +  + +     + P+ ++HI ++ + I +++   FAY  DGDVYF   K + Y K+S + LDE+  G + E   KK +P DFALWK +  G   W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ A N K  A  W+H G +NIN++KMSKSL NF   K++L +Y+   +R+F     Y +P++F+ +NL  ++  LE I   L     +L           +++  EK + F +     + ++FN    + F+ + ++ ++ +L
  S:     3 LRVYNTLSGTKEEFTPLVPGRVSMYVCGVTVYDHCHIGHARANVVFDMIYRYLRHAGYDVTYVRNYTDVDDKIINRANQEGVPYNAISERFIAEFDRDMAALGLDLPTHQ-PKATEHIAEMIDVISRLIEKGFAYAADGDVYFCVEKFDPYLKLSKRNLDEMQAGARIEVGEKKRHPMDFALWKGSKPGEPFWESPWGQGRPGWHIECSAMSMKYLGETFDIHGGGKDLVFPHHENEIAQSEAANGKPFAHYWIHNGFVNINSEKMSKSLGNFFTIKEVLEKYDAEVLRFFLLSAHYRSPIDFSDQNLREAEAGLERIYGTLAGIDENLTKGAEGTAEETDRELAEKAVTFPERFREAMDDDFNTAQALGFVFDLVRSANRVL 384
>gi|161508769|ref|YP_001574428.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|160367578|gb|ABX28549.1| cysteine--tRNA ligase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (476 aa)
Score = 699, Expect = 1.6e-71, Identities = 155/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++WD  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    28 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 463
>gi|57640379|ref|YP_182857.1| cysteinyl-tRNA synthetase [Thermococcus kodakarensis KOD1] >gi|68735029|sp|Q5JD45|SYC_PYRKO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|57158703|dbj|BAD84633.1| cysteinyl-tRNA synthetase [Thermococcus kodakarensis KOD1] (476 aa)
Score = 699, Expect = 1.7e-71, Identities = 140/339 (41%), Positives = 205/339 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNIFKSHLIIEQKYNEKNLE 339
           +KIY+ +++  +E   L +  ++MYVCGPTVY++ HIG+ R  I FDV+ R     GY V  + N TDIDDKI+ +A E      EL+  +   + + +K + +  +++ +PRV++HI+DI ++I+K+    +AY     VYF+  K   YGK+S  KL++L+ G + E    K NP+DFALWK+   G   W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q  A    +  R WMH G L +N +KMSKSL NF+  ++ L  Y+   +R F  Q  Y +PL++T E L ++KN LE   N + N+ +      I  K+ E+  E
  S:     3 IKIYNTLTRQKEEFKPLREGEVRMYVCGPTVYDYTHIGHARTYIAFDVIRRYLEHKGYTVLMVMNFTDIDDKIIKRANETGEDPKELAEKFLKYFLEDMKALKVKPADI-YPRVTEHIQDIIDFIRKLQEKGYAYEGSDGVYFEVRKFKDYGKLSKVKLEDLVKGARVEPGEGKKNPEDFALWKKAKPGEPKWESPWGEGRPGWHIECSTMSTKYLGESFDIHGGGSDLIFPHHENEIAQTEACTGHEWVRYWMHTGFLMVNGEKMSKSLGNFVTIREALERYDPEVIRLFVLQRHYRSPLDYTEEGLEHAKNNLERLYNTLENIRVAMERAEISFKWGEEEFE 345
>gi|160937871|ref|ZP_02085229.1| hypothetical protein CLOBOL_02763 [Clostridium bolteae ATCC BAA-613] >gi|158439097|gb|EDP16851.1| hypothetical protein CLOBOL_02763 [Clostridium bolteae ATCC BAA-613] (469 aa)
Score = 699, Expect = 1.8e-71, Identities = 164/435 (37%), Positives = 245/435 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVG---DKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFK---------SHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MKI++ +S+  +E V L    +KMYVCGPTVYN +HIGN RP+I FD + R F   GY+V ++ N TD+DDKI+ KA EE +    +S  Y  +    +  +N+  + +  P+ +  I  +   IQ +++   AY+  DG VYF T    +YGK+S+K LDEL  G    K      K +P DF LWK    G   W+  +  GRPGWH ECS +  +YLG+QIDIH GG DL FPHHENE  Q+   N+K+ A  WMH   LNI+N+KMSKSL NF   +++  +Y+   +R+F     Y +PLNF+ + +  SKN LE I+  +   +         S    EQ   E+  +        + ++FN  + +S I E +K ++         E       +   L  +LGII      + D E  E++    + +++KNF+ +D+ R  L++
  S:     1 MKIFNTLSRKKEEFVPLTPGEVKMYVCGPTVYNFIHIGNARPMIVFDTVRRYFEYKGYDVRYVSNFTDVDDKIIKKAIEEGVDADTVSRRYIEECKKDMAAMNVKPATVH-PQATQEICGMLEMIQTLIDKNHAYVAGDGTVYFRTGSFKEYGKLSHKNLDELQSGFREIKVTGEEGKEDPNDFVLWKPKKEGEPFWESPWCDGRPGWHIECSVMSKRYLGEQIDIHAGGEDLIFPHHENEIAQSECANDKNFATYWMHNAFLNIDNKKMSKSLGNFFTVREISEKYDLQVLRFFMLSAHYRSPLNFSADLMEASKNGLERILTCVEKLRDLEAKASDSSKTAGEQATMEEADKLRGKYEEAMDDDFNTADAISAIFELVKLANTTADESGTREFVSYMKTMIEELCDVLGIITEKKEEVLDSEIEEMIEARQQARKDKNFALADEIRGKLLD 452
>gi|77413794|ref|ZP_00789974.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae 515] >gi|77160156|gb|EAO71287.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae 515] (447 aa)
Score = 698, Expect = 1.9e-71, Identities = 160/436 (36%), Positives = 260/436 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE---DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE-FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD ++++ ++ + L++  + MYVCGPTVYN++HIGN R ++ FD + R F   GY V +I N TD+DDKI+  A E  +     S  + + + + +  + +  +  K PRV D++ +I ++++ +V+ +FAY  +GDVYF  +KS+ Y K++NK L++L +G       +   K NP DFALWK    G ++W+  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NFI   D+L   +   +R+F     Y  P+NFT + + +++    N+ Y  N F  +L I++  N++ LE F K+    + ++FN  N ++ I E  K+ +      +    +K+   L+ LL +I GI+      D  IE L+ +  + +  ++F+ +D+ R  L ++
  S:     2 IKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYCGYQVNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALGVKPAT-KNPRVIDYMDEIIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLEIGASGRVDGEGEIKENPLDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHDMLKIVDGQVIRFFLATQQYRKPVNFTEKAVHDAE---VNLKYLKNTF--NLPIQENANDEELEQFVKAFQEAMDDDFNTANGITVIFEMAKWIN------SGHYTSKVKETLAELL-EIFGIVFQEEVLDADIESLIEQRQEARANRDFATADRIRDELAKQ 431
>gi|118475860|ref|YP_893011.1| cysteinyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] >gi|187629790|sp|A0R8G1|SYC_BACAH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|118415085|gb|ABK83504.1| cysteinyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] (465 aa)
Score = 698, Expect = 2.3e-71, Identities = 161/439 (36%), Positives = 256/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE---QKYNEKNL----EFDKSNLIELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILG--IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E + L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +I ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I       K  +        +NEK L    +F  +    + ++FN  N ++ +     +++  LL       + + +      L  ILG  +    L D+E   L+ K  + ++ ++F+ SD+ R  L ++ ++
  S:     3 IHIYNTLTRQKEEFIPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIHELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHNEKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQLETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNII 452
>gi|196195725|gb|EDX90684.1| cysteinyl-tRNA synthetase [Alcanivorax sp. DG881] (460 aa)
Score = 697, Expect = 2.4e-71, Identities = 136/315 (43%), Positives = 189/315 (60%)
  Q:     6 FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
              K D  + LD   I +YVCGPTVYN VHIGN RP++ FDVL RL   L  NV +  NITDIDDKI+  A E       L+  +   + + + ++N  T N+  P+ +DHI ++   I  +V    AY  DG V F       YGK+S +KL+++L G + E    K +P DF LWK ++     W+  +  GRPGWH ECS +I+K+LGD IDIHGGG DL FPHHENE  Q    +  D  R W+H G++NI+ +KMSKSL NF L +DLL++Y+   +R+    + Y +PLNF+ + L N++  L+ + Y L
  S:     9 LTGKKDDFIPLDPDRITLYVCGPTVYNFVHIGNARPVVVFDVLYRLLQRLYPNVVYARNITDIDDKIIKAAAENGEDISVLTERFTAAFAEDMASLNAKTPNI-IPKATDHIPEMIQMIATLVEKGHAYEADGQVLFAVESMPDYGKLSGRKLEDMLAGARVEVADYKRHPGDFILWKPSSDEQPGWESPWGRGRPGWHIECSAMIHKHLGDVIDIHGGGQDLIFPHHENEIAQGCCAHGTDYVRYWLHNGYINIDGEKMSKSLGNFRLVRDLLTQYHGEILRFALLSSHYRSPLNFSADVLDNAEKGLDTLYYAL 323
>gi|76787565|ref|YP_328938.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae A909] >gi|77410936|ref|ZP_00787292.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae CJB111] >gi|109894950|sp|Q3K3G5|SYC_STRA1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|76562622|gb|ABA45206.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae A909] >gi|77162991|gb|EAO73946.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae CJB111] (447 aa)
Score = 697, Expect = 2.5e-71, Identities = 158/436 (36%), Positives = 257/436 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE---DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE-FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIYD ++++ ++ + L++  + MYVCGPTVYN++HIGN R ++ FD + R F   GY V +I N TD+DDKI+  A E  +     S  + + + + +  + +  +  K PRV D++ +I ++++ +V+ +FAY  +GDVYF  +KS+ Y K++NK L++L +G       +   K NP DFALWK    G ++W+  +  GRPGWH ECS +  +  GD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NFI   D+L   +   +R+F     Y  P+NFT + + +++    N+ Y  N F  +L I++  N++ LE F K+    + ++FN  N ++ I E  K+    + + ++    K  F     L +I GI+      D  IE L+ +  + +  ++F+ +D+ R  L ++
  S:     2 IKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYCGYQVNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALGVKPAT-KNPRVIDYMDEIIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLEIGASGRVDGEGEIKENPLDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEIFGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHDMLKSVDGQVIRFFLATQQYRKPVNFTEKAVHDAE---VNLKYLKNTF--NLPIQENANDEELEQFVKAFQGAMDDDFNTANGITVIFEMAKW----INSGHYTSRVKETFA---ELLEIFGIVFQEEVLDADIESLIEQRQEARANRDFATADRIRDELAKQ 431
>gi|27467210|ref|NP_763847.1| cysteinyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57866107|ref|YP_187766.1| cysteinyl-tRNA synthetase [Staphylococcus epidermidis RP62A] >gi|30316150|sp|Q8CTU1|SYC_STAES Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216111|sp|Q5HRM3|SYC_STAEQ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|27314752|gb|AAO03889.1|AE016744_292 cysteinyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57636765|gb|AAW53553.1| cysteinyl-tRNA synthetase [Staphylococcus epidermidis RP62A] (466 aa)
Score = 697, Expect = 2.5e-71, Identities = 156/424 (36%), Positives = 258/424 (60%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVS--FIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-----HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GY V ++ N TD+DDK++N++KE N    E++  Y   +++ +  +N+   TSN   PRV  H+ +I ++I+++V+  +AY  DGDVYF T + + YGK+S++ LD+L VG + E   +K +  DF LWK+   G ++W+  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E +  +++ LE I  +  + +    I     E++    + + I       + ++FN  N V+  +   K+    +L    + + LN+    +  + + +LG+         L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYKGYEVIYVSNFTDVDDKLINRSKELNESVPEIAEKYIKAFYEDVGALNVKKATSN---PRVMHHMGEIIDFIKELVDEGYAYESDGDVYFRTRQFDGYGKLSHQSLDDLKVGARIEAGEQKEDALDFTLWKKAKPGEISWNSPFGKGRPGWHIECSVMAYHELGSTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVGAARSGLERIRNSYKLIEEREQIASDLEEQSEYIQQIDKILNQFETVMDDDFNTANAVTAWYDLAKLANKYVLENTTSTKVLNRFK-EVYSIFSDVLGVPLKSKETEELLDEDIEQLIEERNEARKNKDFARADEIRDMLKARHII 453
>gi|57651406|ref|YP_185462.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87160084|ref|YP_493218.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300] >gi|88194292|ref|YP_499084.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220704|ref|YP_001331526.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|168728912|ref|ZP_02761189.1| cysteine--tRNA ligase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123291881|sp|Q2G2M6|SYC_STAA8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|172048774|sp|A6QEI2|SYC_STAAE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|187631648|sp|A8YZM7|SYC_STAAT Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216110|sp|Q5HIE5|SYC_STAAC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|109894946|sp|Q2FJB0|SYC_STAA3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|57285592|gb|AAW37686.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87126058|gb|ABD20572.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201850|gb|ABD29660.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373504|dbj|BAF66764.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] (466 aa)
Score = 697, Expect = 2.6e-71, Identities = 155/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++WD  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 453
>gi|21282214|ref|NP_645302.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49485394|ref|YP_042615.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|24418688|sp|Q8NXY7|SYC_STAAW Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56749395|sp|Q6GBV8|SYC_STAAS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|21203650|dbj|BAB94350.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49243837|emb|CAG42262.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] (466 aa)
Score = 697, Expect = 2.6e-71, Identities = 155/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++WD  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDRGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 453
>gi|15612674|ref|NP_240977.1| cysteinyl-tRNA synthetase [Bacillus halodurans C-125] >gi|11387138|sp|Q9KGF4|SYC_BACHD Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|10172723|dbj|BAB03830.1| cysteinyl-tRNA synthetase [Bacillus halodurans C-125] (466 aa)
Score = 697, Expect = 2.8e-71, Identities = 160/439 (36%), Positives = 254/439 (57%)
  Q:     1 MKIYDFVSKTDKE---VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYN------EKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHF-NLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M I  F S T K+   V L++  +KMYVCGPTVYN++HIGN RP I +D++ R     GY V F+ N TD+DDKI+  A E       +++ +   Y      + +  ++   PRV++ + +I ++I+ +    +AY   GDVYF T K  +YGK+S + +D+LL G + E + +K +P DF LWK    G ++WD  +  GRPGWH ECS ++ KYLGD IDIH GG DLKFPHHENE  Q+  +  K +A  W+H G +N++N+KMSKSL N +LA +++ +++   +R+F     Y +P+NF+ E L  +K  LE +   ++     L     +       E+  EF    + E+ ++FN  N ++ + +  K ++  LR +   +     F +L   L  +LG+       L D+E   L+ + N+ ++ KNF  +D  R  L  + ++
  S:     1 MAIQVFNSLTRKKEPFVPLEEGKVKMYVCGPTVYNYIHIGNARPPIVYDMIRRYLKYRGYEVLFVSNFTDVDDKIIRVANELGEDVFAVANRFIEAYKQDTSALGVLEAD-HHPRVTETMSEIISFIRVLEEKGYAYEQGGDVYFRTRKFKEYGKLSAQSIDDLLSGARIEVDERKEDPLDFVLWKAAKEGEVSWDSPWGKGRPGWHIECSAMVKKYLGDTIDIHAGGQDLKFPHHENEIAQSECMTGKPMANYWLHNGFINLDNEKMSKSLGNVVLANEMIRQHSAEVLRFFMLSAHYRSPINFSDELLEGAKRGLERLQTAVSSLVHRLQESADFGGTEPWLERIDEFRGRFIEEMDDDFNSANGIAVLFDLAKEANRYLREEQTSKAVLQSFIDLFNELGGVLGVTLNRQEELLDEEIERLIEERNEARKAKNFQRADDIRDQLKAEGII 452
>gi|49482759|ref|YP_039983.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749424|sp|Q6GJD9|SYC_STAAR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|49240888|emb|CAG39555.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] (466 aa)
Score = 697, Expect = 3.0e-71, Identities = 155/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++WD  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQTVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGATIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFVISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKKADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 453
>gi|167044639|gb|ABZ09311.1| putative tRNA synthetases class I (C) catalytic domain protein [uncultured marine crenarchaeote HF4000_APKG7F19] (463 aa)
Score = 696, Expect = 3.5e-71, Identities = 162/439 (36%), Positives = 253/439 (57%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNLNIFK---SHLIIEQKYNEKNLEFDKSNLIELTNNFNLP-NIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M+I+D +  T  E+    K +++Y+CG TVY+  HIG+ R II FDVL R        V F+ N TD+DDKI+ +A +E    LEL++ Y   YFD    +N+  + M +P+ ++HI+D++N I  +V+ K+AY+    VYF  +K  +YGK+S KK D+L+ G +   + +KNNP DFALWK +    +WD  +  GRPGWH ECS +  KYLG+  +IHGGG DL FPHHENE  Q+ +  +    +IWMHVG + IN +KMSKSL N      +L  +  N +R F    SYS P++++ + L   I    Q+E+  Y L + +      I E+   E   EFD +    L N+ N P  + +F +   + +S+    K  +   ++       ++ ILGI  + + D E  E   ++ K ++ + +KN+ ++D  R  + EK ++
  S:     2 MQIFDTLGNTKTELKFSDK-VRIYLCGVTVYDDAHIGHARTIIVFDVLRRFLESQKILVEFVQNFTDVDDKIIERALQEKTSPLELAAKYTKNYFDDFDRLNVKRATM-YPKATEHIEDMQNLISNLVDKKYAYITKNGVYFSVSKFTEYGKLSKKKTDDLISGARVAVDEEKNNPIDFALWKFSNSEPSWDSPWGKGRPGWHIECSAMSLKYLGENFEIHGGGRDLIFPHHENEIAQSESFMSNQFTKIWMHVGMITINGEKMSKSLGNVKSVNHVLENWGPNIIRLFCLSGSYSKPIDYSEKFLKENITKLRQIESCYYELRLAEGTDEETIAEKLVKECRDEFDSA----LNNDLNTPLALTAFYKLIREVNSLAAEEKITQTSAEIVLPEFERMSGILGIQILKVSDAEKNEINQMIKKRDEYRMQKNYEQADSIRAKIAEKNII 444
>gi|29374703|ref|NP_813855.1| cysteinyl-tRNA synthetase [Enterococcus faecalis V583] >gi|61216301|sp|Q839V5|SYC_ENTFA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|29342161|gb|AAO79927.1| cysteinyl-tRNA synthetase [Enterococcus faecalis V583] (470 aa)
Score = 696, Expect = 3.8e-71, Identities = 161/439 (36%), Positives = 259/439 (58%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINS-------KNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEE-----LNKLHFNLSYLLTKILGIIHVN--LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +++ +KEV   ++ + ++MYVCGPTVYN++HIGN R  I FD + R F   GY V ++ N TD+DDKI+  AKE  I   E++  +   + +  + +N+  + +  PRV DH+ DI  +I+ ++   FAY V GDVY+ T K   YGK+S++ +DEL VG      ++   K +P DFALWK      ++WD  +  GRPGWH ECS +  K+L + IDIHGGG DL+FPHHENE  Q+ A      A  WMH G++ I  +++KMSKSL NFI   +++ + +   +R+F   T Y  P+ ++   L  +       KN  EN+ +      + L  ++ Y  +  E ++  + E+ ++FN  N ++ + E  K  +         E     ++KL    S  L  I G+   N  L D +   L+ + N+ +++++F+ SD+ R LL E+ ++
  S:     2 IKIYNTLTR-EKEVFTPIEARKVRMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYRGYEVNYVSNFTDVDDKIIKAAKELKITAPEVAERFIKAFEEDTQALNVQPATLH-PRVMDHMPDILAFIEVLIEKGFAYEVAGDVYYRTRKFPNYGKLSHQSIDELEVGASQRTGVEQQLKEDPLDFALWKSAKEDEISWDSPWGKGRPGWHIECSVMATKHLEETIDIHGGGQDLEFPHHENEIAQSEAKTGHTFANYWMHNGYVTIGEDDEKMSKSLGNFITVHEMIQKVDPQILRFFMSTTQYRRPIRYSESTLKEAAANYQKLKNAFENLRFRQADAVASLPEDEHYLAQLNELEQRFITEMDDDFNAANGITVVYELAKMMNQYSEQATVSEPVLVAMDKL---FSGWLA-IFGLFFKNEELVDAQVDALIEERNQARKDRDFARSDEIRDLLKEQGIV 456
>gi|193083780|gb|ACF09463.1| cysteinyl-tRNA synthetase [uncultured bacterium KM3-47-D6] (462 aa)
Score = 695, Expect = 4.1e-71, Identities = 161/439 (36%), Positives = 255/439 (58%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNLNIFK---SHLIIEQKYNEKNLEFDKSNLIELTNNFNLP-NIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M+I+D +     E+    K + +Y+CG TVY+  HIG+ R II FDVL R     G  V F+ N TD+DDKI+++A +E I  LEL++ Y   YFD    +N+  + + +P+  +HI+D++N I  +V+ K+AY+    VYF  +K  +YGK+S KK+D+L+ G +   + +KNNP DFALWK +    +WD  +  GRPGWH ECS +  KYLG+  +IHGGG DL FPHHENE  Q+ +      A+IWMHVG + IN +KMSKSL N      +L  +  N +R F    SYS P++++ + L   I    Q+E+  Y L + +     +I E+   E   +FD +    L N+ N P  + +F +   + +S+    K  +   ++       +++ILG   + + D E  E   ++ K ++ + +KN+ ++D  R  + EK ++
  S:     1 MQIFDTLRNMKTELEFSDK-VGIYLCGVTVYDDAHIGHARTIIVFDVLRRFLESEGITVEFVQNFTDVDDKIIDRANQEKISPLELAAKYTKNYFDDFDGLNVKRATV-YPKAIEHIEDMQNLISSLVDKKYAYVTKNGVYFSVSKFTEYGKLSKKKIDDLISGARVSVDEEKNNPIDFALWKFSESEPSWDSPWGKGRPGWHIECSAMSLKYLGENFEIHGGGRDLIFPHHENEIAQSESFIPNQFAKIWMHVGMITINGEKMSKSLGNVKSVNHVLDNWGPNIIRLFCLSGSYSKPIDYSEKFLKENITKLRQIESCYYELRLAEGVGDEIIAEKLVKECREKFDSA----LNNDLNTPLALTTFYKLIREVNSLAAEEKITQTSAEIILQEFERMSEILGFQILKVSDAEKNEINQMIKKRDEYRMKKNYEQADNIRAEIAEKNVI 443
>gi|150402240|ref|YP_001329534.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis C7] >gi|166200151|sp|A6VG07|SYC_METM7 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|150033270|gb|ABR65383.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis C7] (476 aa)
Score = 694, Expect = 5.6e-71, Identities = 137/322 (42%), Positives = 215/322 (66%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNI 322
           +K+Y+ +++ ++E   L++  +KMYVCGPTVY+H H+G+ R  ++FD++ R    +GY V  + N TDIDDKI+ +++E+     ELS  +   + + + T+ +  +++ +P+V++HI +I  +I+K++   FAY  +  VYF+  K   YGK+SN  L++L+ G + E + +K NP+DFALWK    G   W+  F  GRPGWH ECS + +KYLG+Q DIHGGG DL FPHHENE  Q++A + KD    W+H G + +N +KMSKSL NFI  +D+  EY+   +R+FF Q  Y +P+++T E++ + KN LE   N+I N+ I
  S:     2 LKVYNTLTRKEEEFKPLNENEVKMYVCGPTVYDHTHLGHGRTYVSFDIIRRYLEHIGYTVNLVINFTDIDDKIIKRSQEKGKNPKELSETFVNVFLNDMATLKVKPADI-YPKVTEHIPEIIAFIEKLIEKGFAYKTENGVYFEVKKFENYGKLSNINLEDLISGARIEPSDEKKNPEDFALWKTAKPGEPKWESPFGEGRPGWHIECSAMSSKYLGEQFDIHGGGRDLSFPHHENEIAQSVAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFITIEDISKEYDPEILRFFFIQRHYRSPIDYTAESMSHVKNNLEKIYNVIENIRI 327
>gi|163816509|ref|ZP_02207873.1| hypothetical protein COPEUT_02698 [Coprococcus eutactus ATCC 27759] >gi|158448209|gb|EDP25204.1| hypothetical protein COPEUT_02698 [Coprococcus eutactus ATCC 27759] (463 aa)
Score = 694, Expect = 5.7e-71, Identities = 160/433 (36%), Positives = 249/433 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL-----KKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLE----FDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           MKI + +++  +E   +++  + +YVCGPTVY+++HIGN RP+I FD L R     GY V ++ N TD+DDKI+ +A  E +    +S  Y  +    +  +N+  +    P+ ++ I D+   ++ ++   +AY V+G VYF T K   YGK+S K +D+L  G++  D L     +K +P DF LWK    G  +W   +  GRPGWH ECS +  KY+GD IDIH GG DL FPHHENE  Q+ A N  + AR WMH G L INN+KMSKSL NF   +++  +Y    +R+F     Y +PLNF+ E +  SKN LE I+  ++  KS   I+   ++   +    F K     + ++ N  + +S I E +KY+++ +  ++ +   +L  N    L  ILGII      + D +   L+ +    ++ KNF+ +D+ R  L
  S:     1 MKILNTLTRRKEEFKPINEGKVGIYVCGPTVYDYIHIGNARPMIVFDTLRRYLEYKGYEVNYVSNFTDVDDKIIKRANAEGVDASVISERYIAEVKKDMAALNVREATTH-PKATEEIPDMIEMVKTLIEKDYAYEVNGTVYFRTRKFKDYGKLSKKNIDDLRSGNR--DLLVSGIDEKEDPLDFVLWKPKKEGEPSWPSPWGDGRPGWHLECSVMSKKYIGDVIDIHAGGEDLIFPHHENEIAQSEAANGTEFARYWMHNGFLKINNEKMSKSLGNFFTVREIAEKYPLQVIRFFMLSAHYRSPLNFSAELVEASKNGLERILTAVDRLKSINGIDGDVDKSVADEMDAFVKKYEDAMDDDLNTADAISVIFELVKYANVNVTEESSKATVELVLNTIEKLCDILGIITEKKEEILDSDIEALIEERQAARKAKNFARADEIRDQL 444
>gi|83591300|ref|YP_431309.1| cysteinyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] >gi|109894909|sp|Q2RFM3|SYC_MOOTA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|83574214|gb|ABC20766.1| cysteinyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] (476 aa)
Score = 693, Expect = 6.9e-71, Identities = 130/316 (41%), Positives = 189/316 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           M +Y+ ++   +E + ++   ++MYVCGPT YN++H+GN RP++ FD L R      Y+V ++ N TDIDDK++N+A+EE+   L ++  Y  ++F     +N+  + + +PRVS HI  I   I  +V   FAY+ DGDVYF+  K   YG++S +   E+  G + E N  K NP DFALWK    G  +W+  +  GRPGWH ECS +  KYLG   DIHGGG DL FPHHENE  Q  A      AR W+H G + +N +KMSKS  NF L +D+L  +    VR +   T Y +P++F    L+ ++  LE +
  S:     1 MYLYNTLTGRKEEFTPVEPGRVRMYVCGPTTYNYIHLGNARPMVVFDTLRRYLEYRNYDVLYVQNFTDIDDKVINRAREEHQAPLVIAERYIEEFFKDADALNVKRATL-YPRVSQHIDAIIAAIATLVERGFAYVADGDVYFEVEKFPAYGRLSKRTPGEMRAGARVEVNTSKRNPLDFALWKAACPGEPSWESPWGPGRPGWHIECSTMALKYLGPGFDIHGGGADLIFPHHENEIAQAEAQTGCTFARFWLHNGFITVNQEKMSKSKGNFFLVRDILKRFRPLAVRLYLLATHYRSPIDFDDAGLLAAERGLERL 317
>gi|154485049|ref|ZP_02027497.1| hypothetical protein EUBVEN_02770 [Eubacterium ventriosum ATCC 27560] >gi|149734002|gb|EDM50121.1| hypothetical protein EUBVEN_02770 [Eubacterium ventriosum ATCC 27560] (470 aa)
Score = 693, Expect = 7.5e-71, Identities = 169/439 (38%), Positives = 255/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD---KSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII----HVNLFDDEAI-ELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ ++K  +E V L++  +KMYVCGPTVYN +HIGN RP+I FD   R     GY+V ++ N TD+DDKI+ KA EE     E+S  Y  +    +  +NI  +    P  +  I  +   I+ +++  +AY  DG VY+ T K   YGK+S K +D+L  G    K      K +P DF LWK    G  +W   +S GRPGWH ECS +  KYLGD+IDIH GG DL FPHHENE  Q+ A N  + ++ WMH G LNINN+KMSKSL NF   +D+  +Y+   +R+F     Y +PLNF+ + + ++KN LE II +    +   II    + K  + +   L E           + ++ N  N +S + E +K+++  L   + +E     + +   L  +LGII       + D++ I E++ K  + K++++F+ +D+ R  L  K ++
  S:     1 MKIYNTLTKKKEEFVPLEEGKVKMYVCGPTVYNLIHIGNARPMIIFDTFRRYLEYKGYDVNYVSNFTDVDDKIIKKAIEEGTTAEEISQRYIKECKKDMHDLNIEPATTH-PLATQEIDGMIEMIKTLIDKGYAYDADGTVYYRTRKFKDYGKLSKKNIDDLEAGHRDIKVAGEESKEDPLDFVLWKPKKEGEPSWPSPWSDGRPGWHIECSVMSKKYLGDEIDIHAGGEDLIFPHHENEIAQSEAANGCEFSKYWMHNGFLNINNKKMSKSLGNFFTVRDISEKYDLQVLRFFMLSAHYRSPLNFSDDLMESAKNGLERIITSGAKIRD--IISNGKDGKVTDAEAKLLDEAKEYITKFEEAMDDDCNTANAISAVFELVKFANSNLNEGSTKEFAAGVYEILDKLCNVLGIILEKEEEKVGDEDYIEEMIAKRAQAKKDRDFAMADQIRDELAAKGIV 457
>gi|57634618|ref|NP_371054.2| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] (476 aa)
Score = 693, Expect = 8.8e-71, Identities = 154/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++W+  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    28 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWNSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 463
>gi|149183935|ref|ZP_01862320.1| cysteinyl-tRNA synthetase [Bacillus sp. SG-1] >gi|148848358|gb|EDL62623.1| cysteinyl-tRNA synthetase [Bacillus sp. SG-1] (465 aa)
Score = 693, Expect = 8.9e-71, Identities = 151/376 (40%), Positives = 232/376 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEF------DKSNLI-ELTNNFNLPNIVSFIEEKIKYSSILLRNKN 376
           +KI++ +++  +E   L++  +KMYVCGPTVYN++HIGN RP I FD ++R F   GY+V F+ N TD+DDK++  A E       I E  + +Y+E       +  ++H      PRV++ +  I ++I+ +++  +AY   GDVY+ T K   YGK+S++ +D+L VG + E   KK +P DF LWK    G + W+  +  GRPGWH ECS +  KYLG+ IDIH GG DL FPHHENE  Q+ A+N K  AR WMH G++NI+N+KMSKSL NF+L  D++ E +   +R+F     Y +P+N+  E L N+K+ L+ +  +    K    +  +  + N E+       K+  I E+ ++FN  N +S + E  + ++  L  KN
  S:     3 IKIFNTLTRKKEEFKPLEEGKVKMYVCGPTVYNYIHIGNARPAIVFDTVHRYFEYRGYDVNFVSNFTDVDDKLIKAANELGEDVPAIAERFIEAYHEDTEALGCQRADVH------PRVTESMDIIIDFIEALIDKGYAYESQGDVYYRTRKFEGYGKLSHQSIDDLKVGARIEAGDKKEDPLDFVLWKAAKEGEIFWESPWGQGRPGWHIECSAMAKKYLGETIDIHAGGQDLAFPHHENEIAQSEALNEKPFARYWMHNGYINIDNEKMSKSLGNFVLVHDIIKEQDPQVLRFFMLSVHYRHPINYNLELLENAKSGLDRLKTSYENLKHRREVSAELTDNNEEWLEKIASLKNQFIEEMDDDFNTANGISVLFELSRQANYYLMEKN 386
>gi|17228587|ref|NP_485135.1| cysteinyl-tRNA synthetase [Nostoc sp. PCC 7120] >gi|21264005|sp|Q8YXW5|SYC_ANASP Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|17130438|dbj|BAB73049.1| cysteinyl-tRNA synthetase [Nostoc sp. PCC 7120] (486 aa)
Score = 692, Expect = 9.1e-71, Identities = 166/433 (38%), Positives = 248/433 (57%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG-----DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLL--------SEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-ELTNNFN------------LPNIVSFIEEKIKYSSILLRNKNF----EELNKLHFNLSYLLTKILGI---------IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +++  + + +++   +KMY CG TVY++ H+G+ R  I +D + R  +  G+ V +I N TDIDDKI+N+AKE+ +   E+S+ +   YF  ++ +N+  ++ ++PRV++HI +I   IQ +     AY V GDVY+   +   YGK+S ++L+++  G     D  +   KK +P DFALWK    G   WD  +  GRPGWH ECS +I   LG  IDIHGGG DL FPHHENE  Q+ A  N+ LAR W H G + +N QKMSKSL NFI  ++LL           N   VR F  Q  Y  PL+FT E +  ++N  + +       K  L+   +Y EK     +S +I EL   F             L  +    +E  +  +IL+         +EL +  +N    L KILG+             L D +   L+ +    ++ KNFSESD+ R  L
  S:     3 LTIYNTLTRRQEPLETVEPGKVKMYCCGVTVYDYCHLGHARSYIVWDTIRRYLIWRGFGVKYIQNFTDIDDKILNRAKEQGLTMAEVSNRFIDAYFADIRRLNVLDAD-EYPRVTEHIPEIHQLIQILEEKGLAYAVGGDVYYRVERFPSYGKLSGRELEQMQAGASGRVDAEDSEPKKQHPFDFALWKAAKPGEPAWDSPWGAGRPGWHIECSAMIRSKLGATIDIHGGGGDLIFPHHENEIAQSEAAMNQPLARYWTHNGMVMVNGQKMSKSLGNFITIRELLDGVGSWKEDPVNPMAVRLFVLQAHYRKPLDFTEEAIATAENSWKTL-------KEGLLFGYQYGEKLGWGQESAIIPELATRFQELGDDDFNFSGGLAVLFELAKELRREGNILVHEGTTKTPSDELQR-QWNTLVTLAKILGLEAKLDDETQTQAGLSDTDIEALIEQRQAARKNKNFSESDRIRNEL 467
>gi|82750237|ref|YP_415978.1| cysteinyl-tRNA synthetase [Staphylococcus aureus RF122] >gi|109894947|sp|Q2YSD1|SYC_STAAB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|82655768|emb|CAI80168.1| cysteinyl-tRNA synthetase [Staphylococcus aureus RF122] (466 aa)
Score = 692, Expect = 9.9e-71, Identities = 154/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++WD  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   +  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQTVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFSNYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 453
>gi|159905981|ref|YP_001549643.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis C6] >gi|159887474|gb|ABX02411.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis C6] (476 aa)
Score = 692, Expect = 1.0e-70, Identities = 138/322 (42%), Positives = 212/322 (65%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNI 322
           +K+Y+ +++ ++E   L++K +KMYVCGPTVY+H H+G+ R  ++FD++ R    +GY V  + N TDIDDKI+ +A E      ELS  + T + + + T+ +  +++ +P+V++HI +I  +I+K++   FAY  +  VYF+  K   YGK+SN  L++L  G + E + +K NP+DFALWK    G   W   F  GRPGWH ECS + +KYLG+Q DIHGGG DL FPHHENE  Q++A + KD    W+H G + +N +KMSKSL NF+  + +  EY+   +R+FF Q  Y +P+++T E++ + KN LE   N+I N+ I
  S:     2 LKVYNTLTRKEEEFKPLNEKEVKMYVCGPTVYDHTHLGHGRTYVSFDIIRRYLEHIGYTVNLVINFTDIDDKIIKRANENGKNPKELSEQFITVFLNDMTTLKVKPADI-YPKVTEHIPEIIAFIEKLIEKGFAYETENGVYFEVKKFENYGKLSNINLEDLFSGVRIETSEEKKNPEDFALWKTAKPGEPKWKSPFVEGRPGWHIECSAMSSKYLGEQFDIHGGGRDLSFPHHENEIAQSVAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFVTIEGISKEYDPEILRFFFIQRHYRSPIDYTAESITHVKNNLEKIYNVIENIRI 327
>gi|55820186|ref|YP_138628.1| cysteinyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] >gi|55822074|ref|YP_140515.1| cysteinyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] >gi|61216120|sp|Q5M1W6|SYC_STRT1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216121|sp|Q5M6F6|SYC_STRT2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|55736171|gb|AAV59813.1| cysteinyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] >gi|55738059|gb|AAV61700.1| cysteinyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] (447 aa)
Score = 692, Expect = 1.1e-70, Identities = 159/433 (36%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL---KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ ++ V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A E  I   ELS  + T + +    + I  +    PRV +++ +I  ++  +++  FAY+ +GDVYF  TKSN Y K++NK L++L +G     +    +K +P DFALWK    G ++W+  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++    N+ Y  N     L  E    E     D      + ++FN  N V+ + +  K+    + + N++E  K  F     + ++ GI+      DE IE L+ +    +  K+F+ +D+ R  L
  S:     2 IKIYDTMTRSLRDFVPLTENTVNMYVCGPTVYNYIHIGNARSTVAFDTIRRYFEYRGYTVNYISNFTDVDDKIIKAANEVGISTKELSDKFITAFMEDTAQLGIKPATQN-PRVINYMDEIIAFVSILIDKGFAYVSEGDVYFRVTKSNNYAKLANKTLEDLEIGASGRTDAETDRKEDPLDFALWKAAKEGEISWESPWGPGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFVTVHDMLKTVDGQVLRFFLATQQYRKPINFTEKAIHDAE---VNLKYLKNTHSLPLTEEVSQAELQAYLDAFQ-AAMDDDFNTANGVTVLFDMAKW----INSGNYDETVKDAFE---KILQVFGIVFEEETLDEDIEKLIEERQAARANKDFATADRIRDEL 428
>gi|15926207|ref|NP_373740.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|148266989|ref|YP_001245932.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|150393036|ref|YP_001315711.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|156978858|ref|YP_001441117.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] >gi|171769940|sp|A7WYU7|SYC_STAA1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|189082076|sp|A6TZ06|SYC_STAA2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|189082077|sp|A5IQ83|SYC_STAA9 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|21264022|sp|Q99W73|SYC_STAAN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56749452|sp|Q932G0|SYC_STAAM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|13700420|dbj|BAB41718.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|46395518|dbj|BAB56692.2| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|147740058|gb|ABQ48356.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|149945488|gb|ABR51424.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|156720993|dbj|BAF77410.1| cysteinyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] (466 aa)
Score = 692, Expect = 1.2e-70, Identities = 154/424 (36%), Positives = 253/424 (59%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI------ELTNNFNLPNIVSFIEEKIKYSS-ILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GYNV ++ N TD+DDK++ +++E N    E++  Y   + + +  +N+   TSN   PRV DH+ DI  +I+ +V+  +AY   GDVYF T K   YGK+S++ +D+L VG + +    K +  DF LWK+   G ++W+  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NFIL  D++ E + + +R+F     Y +P+N+  E + ++++ LE I  +  + +    I      +    D+ + I       + ++FN  N ++   +  K ++  +L N    E+      +  + + +LG+   +     L D++  +L+ + N+ ++ K+F+ +D+ R +L  + ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALNVRKATSN---PRVMDHMDDIIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDFTLWKKAKPGEISWNSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNII 453
>gi|168144651|ref|ZP_02587880.1| cysteinyl-tRNA synthetase [Bacillus cereus G9842] (465 aa)
Score = 691, Expect = 1.3e-70, Identities = 138/316 (43%), Positives = 202/316 (63%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ +++  +E V L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I
  S:     3 IHIYNTLTRQKEEFVPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFKTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERI 319
>gi|172056119|ref|YP_001812579.1| cysteinyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] >gi|171988640|gb|ACB59562.1| cysteinyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] (465 aa)
Score = 691, Expect = 1.3e-70, Identities = 152/424 (35%), Positives = 240/424 (56%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL-------ENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILL-RNKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L++  +KMYVCGPTVYN++HIGN RP I FD + R F   GY+V ++ N TD+DDKI+  A E       L+  +   Y      +N+  +++  P V++ + DI  +I+ +V    AY   GDVYF T     YG++S + +DEL  G + E   KK +P DF LWK    G   W   +  GRPGWH ECS +  KYLGD IDIH GG DLKFPHHENE  Q+ A N++  A  WMH G LNI N+KMSKSL NF+   + +   +   +R+F     Y +P+N++ + +  + N L        N+ + L +        +K+  +  E  +  +  + ++FN  N V+ + +  K +++ L  ++  +E+ +    +   L+ +LG+   I   L D+E  +L+   +  ++E++F+ +D  R  L ++ +L
  S:    18 LEEGKVKMYVCGPTVYNYIHIGNARPAIVFDTVRRYFTYRGYDVKYVSNFTDVDDKIIRTANELGEDYHALTKRFIEAYHADTGALNVQKADIH-PLVTETMDDIIAFIEVLVKKGNAYASSGDVYFRTRSFKDYGQLSQQSIDELRSGARIEVGEKKEDPLDFVLWKAAKPGEPAWTSPWGEGRPGWHIECSAMAKKYLGDTIDIHAGGQDLKFPHHENEIAQSEACNSQKFANYWMHNGFLNIENEKMSKSLGNFLTVHEAIQAVDPMVLRFFMLSVQYRHPINYSRDLIDQAANGLARIRESVANVEHRLTMTADLGTATEKWLNRIEEIKQHFVTSMDDDFNTANAVTDLFDLSKEANLYLGEDQVAKEVLERFLAVFQELSTVLGVTLTIEKGLLDEEVEQLIRDRDTARKERDFARADAIRDQLRDQGIL 452
>gi|73663535|ref|YP_302316.1| cysteinyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|109894949|sp|Q49V39|SYC_STAS1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|72496050|dbj|BAE19371.1| cysteinyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (466 aa)
Score = 690, Expect = 1.6e-70, Identities = 160/424 (37%), Positives = 256/424 (60%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIH--TSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN------------------IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVS-FIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   +KMYVCGPTVYN++HIGN RP I +DV+ R F   GY V F+ N TD+DDK++ ++KE +     ++  Y   +++ +  +N+   TSN   PRV +H+ DI N+I+ +V+  +AY   GDVYF T K   YGK+S++ L++L VG + E   +K +  DF LWKQ   G ++W+  F  GRPGWH ECS +    LG  IDIH GG DL+FPHHENE  Q+ A N+   A  WMH G +NI+N+KMSKSL NF+L  D++ + + + +R+F     Y +P+N+  E +  +K+ LE +  +                    I +   I+EQ     N +F+ +N I  T  ++L  + + ++ E    + +L R   F+E+ ++  ++  L   + G     L D+E   L+ + N  +++K+F+ +D+ R  L E+ ++
  S:    18 IEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYEVVFVSNFTDVDDKLIKRSKELDESVETIADRYIDAFYEDVGALNVKKATSN---PRVMNHMDDIINFIKDLVDEGYAYESGGDVYFRTRKFQDYGKLSHQSLNDLKVGARIEQGEQKEDALDFTLWKQAKPGEISWESPFGEGRPGWHIECSVMAYHELGATIDIHAGGTDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFVLVHDIIKQIDPDVLRFFMISVHYRSPINYNMELVEAAKSGLERVRNSYQAIEEREAIATDIEAQSDYIAEIDKILEQFETVMNDDFNTANAI--TAWYDLAKLANKYVLENTTSTKVLGR---FKEVYQIFSDV--LGVPLKGKDSDELLDEEVEALIEERNNARKDKDFARADEIRDQLKEQNII 453
>gi|116627043|ref|YP_819662.1| cysteinyl-tRNA synthetase [Streptococcus thermophilus LMD-9] >gi|116100320|gb|ABJ65466.1| cysteinyl-tRNA synthetase [Streptococcus thermophilus LMD-9] (447 aa)
Score = 690, Expect = 1.7e-70, Identities = 159/433 (36%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL---KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ ++ V L +  + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  A E  I   ELS  + T + +    + I  +    PRV +++ +I  ++  +++  FAY+ +GDVYF  TKSN Y K++NK L++L +G     +    +K +P DFALWK    G ++W+  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + +++    N+ Y  N     L  E    E     D      + ++FN  N V+ + +  K+    + + N++E  K  F     + ++ GI+      DE IE L+ +    +  K+F+ +D+ R  L
  S:     2 IKIYDTMTRSLRDFVPLTENTVNMYVCGPTVYNYIHIGNARSTVAFDTIRRYFEYRGYTVNYISNFTDVDDKIIKAANEVGISTKELSDKFITAFMEDTAQLGIKPATQN-PRVINYMDEIIAFVSILIDKGFAYVSEGDVYFRVTKSNNYAKLANKTLEDLEIGASGRTDAETDRKEDPLDFALWKAAKEGEISWESPWGPGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFVTVHDMLKTVDGQVLRFFLATQQYRKPINFTEKAIHDAE---VNLKYLKNTHSLPLTEEVSQAELQAYLDAFQ-AAMDDDFNTANGVTVLFDMAKW----INSGNYDETVKNAFE---KILQVFGIVFEEETLDEDIEKLIEERQAARANKDFATADRIRDEL 428
>gi|30018360|ref|NP_829991.1| cysteinyl-tRNA synthetase [Bacillus cereus ATCC 14579] >gi|168138635|ref|ZP_02581864.1| cysteinyl-tRNA synthetase [Bacillus cereus B4264] >gi|33301673|sp|Q81J59|SYC_BACCR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|29893900|gb|AAP07192.1| Cysteinyl-tRNA synthetase [Bacillus cereus ATCC 14579] (465 aa)
Score = 690, Expect = 1.9e-70, Identities = 138/316 (43%), Positives = 202/316 (63%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ +++  +E V L++  +KMYVCGPTVYN++HIGN RP + FD + R     GY+V ++ N TD+DDK++  A E       ++  +   YF+ +  +    + +  PRV++++  I  +IQ++VN  +AY  +GDVYF T +   YGK+S++ + +L  G + E   KK +P DFALWK    G + W+  +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ A+  K  AR WMH G++NINN+KMSKSL NFIL  D++ +Y+   +R+F     Y +P+NF+ E L ++ N LE I
  S:     3 IHIYNTLTRQKEEFVPLEENKVKMYVCGPTVYNYIHIGNARPPMVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTALGCKHATVH-PRVTENMDIIIEFIQELVNKGYAYESEGDVYFKTKEFEGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERI 319
>gi|187776555|ref|ZP_02993028.1| hypothetical protein CLOSPO_00067 [Clostridium sporogenes ATCC 15579] >gi|187775214|gb|EDU39016.1| hypothetical protein CLOSPO_00067 [Clostridium sporogenes ATCC 15579] (465 aa)
Score = 690, Expect = 2.0e-70, Identities = 165/439 (37%), Positives = 262/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFD------KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E V+L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ KA EE I   EL   +  +Y+     +NI  +  K PR ++ + +I  ++  ++   +AY +DGDVYF T +   YGK+S + L+EL +G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L  +  ++  ++ LE+       K   IE + ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E  +L+ +  K ++EKN++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFVTLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDSIRRYLEYRGYKVKFIQNFTDIDDKMIKKANEEGITVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMDEIIRFVSDLIEKGYAYEIDGDVYFSTKRFGDYGKLSGQNLEELQLGSRINVDERKKDPMDFAIWKSQKPGEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEELRDEELEYKNELQKYKEKYIEKMDDDFNTADAISVIFDLIRDVNTNVTIESSKELVKYTLDLIRELGNPLGILQESTKASLEEEIEKLIEERQKARKEKNWALADKIRDNLKERGIV 452
>gi|147918862|ref|YP_687412.1| cysteinyl-tRNA synthetase [uncultured methanogenic archaeon RC-I] >gi|110622808|emb|CAJ38086.1| cysteinyl-tRNA synthetase [uncultured methanogenic archaeon RC-I] (473 aa)
Score = 689, Expect = 2.3e-70, Identities = 164/435 (37%), Positives = 258/435 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKS-NQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG--LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNK-DLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI---------ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI-----IHVNLFDDEAIEL-LNKWNKLKQEKNFSESDKYRKLLME 435
           ++ Y+ +++T ++   LD + +KMYVCGPTVY++ H+G+ R  I FDV+ R  L  GY+VT++ N TD+DDKI+ +AKE N+   ELS  +   YF+ +  +N+  ++  +PRV++ +  I   I+ +V+  +AY   G VYF   +  ++ G +S++  D L VG + E + +K NP DF LWK    G  L+WD  +  GRPGWH EC+ +  K LG+QIDIHGGG+DL FPHHE+E +Q+ A   K   A+ W+H G L +N +KMSKSL NF L +D+L +Y+  TVR+F   T+Y  PL+F+   L  +K  L  I   ++          K ++K  + D S LI          + NNF+    ++ I E  +  + LLR     +  K    L    + ILGI        ++  DE ++L ++    ++++K++  SD  R  L +
  S:     6 LRFYNTLTQTVEDFQPLDDRKVKMYVCGPTVYDYCHMGHARSYIVFDVIRRHLLYRGYDVTYVQNFTDVDDKILKRAKELNVDPTELSRKFIAAYFEDIDRLNVMRAD-HYPRVTEFMDPIIGIIKALVDKGYAYESMGSVYFSIDRMVSEVGVLSHQTYDSLKVGARIEVDERKRNPMDFVLWKAAKPGESLSWDSPWGKGRPGWHIECTAMSVKLLGEQIDIHGGGMDLIFPHHESEILQSEAYTGKVPFAKYWIHNGFLLVNKEKMSKSLGNFFLIRDILQKYSPETVRFFILNTNYQGPLDFSDAGLEEAKKSLARIQNTVSDITDR---AGKTDQKGSDQDISALIAESKARFDEHMDNNFSTREAIAEIFEFTRTVNRLLRGSFSADEAKQIAGLYDHFSNILGIRWETEQKEDMLADELMKLIIDIRAAVRKKKDYETSDLIRSRLKD 456
>gi|150019973|ref|YP_001305327.1| cysteinyl-tRNA synthetase [Thermosipho melanesiensis BI429] >gi|187631644|sp|A6LJ41|SYC_THEM4 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|149792494|gb|ABR29942.1| cysteinyl-tRNA synthetase [Thermosipho melanesiensis BI429] (469 aa)
Score = 689, Expect = 2.3e-70, Identities = 155/426 (36%), Positives = 243/426 (57%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSH----LIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL----FDDEAI--ELLNKWNKLKQEKNFSESDKYRKLLM 434
           K +K V      +KMYVCGPTVYN++HIGN RP + FD   R     GY V  + N TDIDDKI+N+A    +   +++  +  +Y+   + + I  +N   PR +D++K+I   ++K++   +AY+ D GDVYF   +   YGK+S KKL++L+ G + E +  K NP DFALWK    G  +WD  +  GRPGWH ECS +  + LGD  DIH GG DL FPHHE+E  Q+ A+  K  A+ WMH G +     KMSKS+ N  L ++ +  Y  + V+ F     Y  P+ F+ E + N+K     I+  LN F+      L+ ++     ++E   +  +E L ++FN P +++ I E  K  +  +     EE  K +  ++ +   +LGI    L     +++ I  E+L+   +L++EK+++ +DK R  L+
  S:    12 KKEKLVPNTPGVVKMYVCGPTVYNYIHIGNARPAVVFDAFRRFLEYRGYKVVMVQNFTDIDDKIINEANAWGVNFKDVADTFIAEYWKDAENLGIRAANFH-PRTTDYVKEIVEAVEKLIAKNYAYVADNGDVYFSVKEFKDYGKLSGKKLEDLVAGARVEVSELKKNPLDFALWKAVKPGEPSWDSPWGNGRPGWHIECSVMSQRLLGDSFDIHAGGEDLIFPHHEDEKAQSEALTGKPFAKYWMHNGMIITRGDKMSKSIGNVFLVREAVKRYGKDAVKLFLLSKHYRTPIEFSHEIMFNTKKAALRILNTLNRFEEKYPYPLVPKRDTFMNDME---ARFVEALEDDFNTPRVIALIFELSKDLNKAMDEGKEEEALKRYHLITRVFGSVLGIFERGLKVVETNNQKIIEEILSVRQELRKEKDYNVADKIRDALL 446
>gi|170760749|ref|YP_001788843.1| cysteinyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] >gi|169407738|gb|ACA56149.1| cysteinyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] (465 aa)
Score = 688, Expect = 2.7e-70, Identities = 165/439 (37%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFD------KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E V+L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ +A EE     EL   +  +Y+     +NI  +  K PR ++ +++I  ++  ++   +AY +DGDVYF T K N YGK+S + L+EL +G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L  +  ++  ++ LE+       K   IE + ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E  +L+ +  K ++EKN++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFVTLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDTIRRYLEYRGYKVKFIQNFTDIDDKMIKRANEEGSTVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMEEIIKFVSDLIEKGYAYEIDGDVYFSTKKFNSYGKLSGQNLEELQLGSRINVDERKKDPMDFAIWKNQKPGEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEELRDEELEYKNELQKYKEKYIEKMDDDFNTADAISVIFDLIRDVNTNVTIESSKELVKYTLDLIRELGNPLGILQESTKASLEEEIEKLIEERQKARKEKNWALADKIRDDLKERGIV 452
>gi|148381443|ref|YP_001255984.1| cysteinyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153933894|ref|YP_001385818.1| cysteinyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153937063|ref|YP_001389225.1| cysteinyl-tRNA synthetase [Clostridium botulinum A str. Hall] >gi|187629799|sp|A7FZ91|SYC_CLOB1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|187629801|sp|A5I7M8|SYC_CLOBH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|148290927|emb|CAL85063.1| cysteinyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|152929938|gb|ABS35438.1| cysteinyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152932977|gb|ABS38476.1| cysteinyl-tRNA synthetase [Clostridium botulinum A str. Hall] (465 aa)
Score = 688, Expect = 2.9e-70, Identities = 164/439 (37%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFD------KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E ++L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ +A EE     EL   +  +Y+     +NI  +  K PR ++ +++I  ++  ++   +AY +DGDVYF T K N YGK+S + L+EL +G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L  +  ++  ++ LE+       K   IE + ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E  +L+ +  K ++EKN++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFLTLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDTIRRYLEYRGYKVKFIQNFTDIDDKMIKRANEEGSTVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMEEIIKFVSDLIEKGYAYEIDGDVYFSTKKFNSYGKLSGQNLEELQLGARINVDERKKDPMDFAIWKSQKPGEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEELRDEELEYKNELQKYKEKYIEKMDDDFNTADAISIIFDLIRDVNTNVTIESSKELVKYTLDLIRELGSPLGILQESTKASLEEEIEKLIEERQKARKEKNWALADKIRDNLKERGIV 452
>gi|134045577|ref|YP_001097063.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis C5] >gi|132663202|gb|ABO34848.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis C5] (476 aa)
Score = 687, Expect = 3.5e-70, Identities = 138/322 (42%), Positives = 210/322 (65%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI-GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNI 322
           +K+Y+ +++ ++E   L +K +KMYVCGPTVY+H H G+ R  ++FD++ R    +GY V  + N TDIDDKI+ +A E+     ELS  +   + + + T+ +  +++ +P+V++HI +I  +I+K++   FAY  +  VYF+  K   YGK+SN  L++L  G + E + KK NP+DFALWK        W+  F  GRPGWH ECS + +KYLG Q DIHGGG DL FPHHENE  Q++A + KD    W+H G + +N +KMSKSL NF+  +D+  EY+   +R+FF Q  Y +P+++T E++ + KN LE   N+I N+ I
  S:     2 LKVYNTLTRKEEEFKPLTEKEVKMYVCGPTVYDHTHFGHGRTYVSFDIIRRYLEHIGYTVNLVINFTDIDDKIIKRANEKGKNPQELSEQFINVFLNDMATLKVKPADI-YPKVTEHIPEIIAFIEKLIEKGFAYKTENGVYFEVKKFENYGKLSNINLEDLYSGVRIETSEKKKNPEDFALWKTAKPREPKWESPFGEGRPGWHIECSAMSSKYLGKQFDIHGGGRDLSFPHHENEIAQSVAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFVTIEDISKEYDPEILRFFFIQRHYRSPIDYTAESMTHVKNNLEKIYNVIENIRI 327
>gi|168178810|ref|ZP_02613474.1| cysteinyl-tRNA synthetase [Clostridium botulinum NCTC 2916] >gi|182669931|gb|EDT81907.1| cysteinyl-tRNA synthetase [Clostridium botulinum NCTC 2916] (465 aa)
Score = 687, Expect = 4.4e-70, Identities = 164/439 (37%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFD------KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E ++L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ +A EE     EL   +  +Y+     +NI  +  K PR ++ +++I  ++  ++   +AY +DGDVYF T K N YGK+S + L+EL +G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L  +  ++  ++ LE+       K   IE + ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E  +L+ +  K ++EKN++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFLTLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDTIRRYLEYRGYKVKFIQNFTDIDDKMIKRANEEGSTVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMEEIIKFVSDLIEKGYAYEIDGDVYFSTKKFNSYGKLSGQNLEELQLGARINVDERKKDPMDFAIWKSQKPGEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEELRDEELEYKNELQKYKEKYIEKMDDDFNTADAISVIFDLIRDVNTNVTIESSKELVKYTLDLIRELGSPLGILQESTKASLEEEIEKLIEERQKARKEKNWALADKIRDNLKERGIV 452
>gi|195978850|ref|YP_002124094.1| cysteinyl-tRNA synthetase CysS [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975555|gb|ACG63081.1| cysteinyl-tRNA synthetase CysS [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (448 aa)
Score = 686, Expect = 4.5e-70, Identities = 151/433 (34%), Positives = 242/433 (55%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL---IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ +E V +  K + MYVCGPTVYN++HIGN R  + FD + R F   GY V +I N TD+DDKI+  AKE  +   +L+  +   + +  K + +  +  K PRV D++ +I  +I  ++   +AY   GDVYF   K++ Y +++NK + +L  G     + +   K NP DFALWK    G ++W   +S GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A  +K  A  WMH G +N++N+KMSKSL NF+   DLL   +  T+R+F     Y  P+NFT + + +++        NL   K+ L    +    + +   F  +    + ++FN  N ++ + +  K+    + +  + E  K  F     +  + GI+      D E  +L+ +  + +  ++F+++D  R  L
  S:     3 IKIYDTMTRSLREFVPITDKVVNMYVCGPTVYNYIHIGNARSAVAFDTVRRYFEYAGYTVNYISNFTDVDDKIIKAAKEAGLSPKQLADQFIAAFMEDTKALGVKPAT-KNPRVMDYMDEIIAFIAALIKKGYAYESAGDVYFRVAKASNYARLANKTIADLEAGASGRTDTETALKENPLDFALWKSAKPGEVSWTSPWSAGRPGWHIECSVMATELLGDTIDIHGGGADLEFPHHTNEIAQSEAKTSKTFANYWMHNGFVNVDNEKMSKSLGNFVTVHDLLKTVDGQTLRFFLATQHYRKPINFTEKAIHDAE-------VNLKYLKNTLQQPTVATADSSQLAAFVTAFKAAMNDDFNTANGITVLFDMAKW----INSGAYSEAVKSAFE---EMLAVFGIVFEAESLDTEIEQLIAERQEARANRDFAKADAIRDQL 429
>gi|171778429|ref|ZP_02919587.1| hypothetical protein STRINF_00438 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282830|gb|EDT48254.1| hypothetical protein STRINF_00438 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (448 aa)
Score = 686, Expect = 4.6e-70, Identities = 155/433 (35%), Positives = 249/433 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNL-IELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ ++ V + +  + MYVCGPTVYN++HIGN R ++ FD + R F   GY V +I N TD+DDKI+  A    +     S  +   + + +K + +  +  K PRV D++ +I  +++ +V+  FAY  +GDVYF   KS  Y K++NK L++L VG     + +   K NP DFALWK    G ++W   +  GRPGWH ECS +    LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NF+   D+L   +   +R+F     Y  P+NFT + + ++     N+ Y  N F   L + +  +   LE  K++    + ++FN  N ++ + +  K+    + + N++++ K  F       KIL +  V +F++E ++     L+ K  + +  ++F+ +D  R  L
  S:     3 IKIYDTMTRSLRDFVPITENTVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYRGYKVNYISNFTDVDDKIIKGAAAAGMDTKAFSDKFIAAFMEDVKELGVEPAT-KNPRVIDYMDEIIAFVKDLVDKGFAYEANGDVYFRVAKSKNYAKLANKTLEDLEVGASGRVDGEGDIKENPLDFALWKAAKPGEVSWKSPWGQGRPGWHIECSVMATSILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFVTVHDMLKTVDGQVLRFFLATQQYRKPVNFTEKAVHDAS---VNLKYLKNTFT--LPLGEAVDSAELEKFKADFEAAMDDDFNTANGITVVFDMAKW----INSGNYDQVTKDTF------AKILAVFGV-VFEEEVLDADIEALVEKRQEARANRDFATADAIRDQL 429
>gi|154249366|ref|YP_001410191.1| cysteinyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] >gi|171769335|sp|A7HKV1|SYC_FERNB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|154153302|gb|ABS60534.1| cysteinyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] (470 aa)
Score = 686, Expect = 4.8e-70, Identities = 158/436 (36%), Positives = 243/436 (55%)
  Q:     3 IYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF--KSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE----------LLNKWNKLKQEKNFSESDKYRKLLMEKKL 438
           I D +SK+   + +L+   +KMYVCGPTVYN++HIGN RP++ FD L R    +GY V  + N TDIDDKI+N+AKE N+    ++  +  +YF   + + +  +N   PR +D +KDI   I+ ++   FAY  + GDVYF   K   YGK+S K LD+L  G + + N  K +P DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIHGGG DL FPHHE+E  Q+ A+  K  A+ WMH G + +   KMSKSL N  + ++ +  Y  + V+ F     Y +P+ F+ E L ++    + +   LN F  K    +  K +E+   F    +  L+++FN P  +S + + +K  +  +   N E   K++  +  +   +LG+    +   + +           ++N  N+ ++ K F  +DK R  L+  K+
  S:     6 ITDTLSKSKVPLETLEPGVVKMYVCGPTVYNYIHIGNARPMVVFDALRRFLEFVGYRVIMVQNFTDIDDKIINEAKEWNVDWKTVADTFIAEYFHDAQLLGVRAANYH-PRTTDFVKDIVEAIETMIKKDFAYPAENGDVYFSVRKLRDYGKLSGKNLDDLRAGARVDVNELKKDPLDFVLWKSAKPGEPTWDSPWCNGRPGWHIECSVMSQKLLGDMFDIHGGGEDLIFPHHEDEIAQSEALTGKPPAKYWMHNGMIIVRGDKMSKSLGNTFMVREAVRRYTKDGVKLFLLSKHYRSPMEFSDEILQDNMRAAQRVHNALNRFTEKYPYPLVPKIDEEMENFIDRFVEALSDDFNTPVALSILFDTVKELNKSMDEGNDERALKMYHLVKRIYGPVLGVFDSEIQKQQQVNSEQLDQLIQGIINLRNEYRKNKQFEIADKLRDALLNAKI 455
>gi|89893193|ref|YP_516680.1| hypothetical protein DSY0447 [Desulfitobacterium hafniense Y51] >gi|109647493|ref|ZP_01371396.1| cysteinyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] >gi|89332641|dbj|BAE82236.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109640583|gb|EAT50138.1| cysteinyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] (477 aa)
Score = 686, Expect = 5.0e-70, Identities = 132/316 (41%), Positives = 191/316 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIA-VNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +++++ +S   +E    ++  + MY CGPTVYN+ H+GN R ++ FD++ R  L  GY+VTF+ N TDIDDKI+ + +EE    LEL+  Y  +YF     +N+  +++  P+ +DHI ++   I+ +     AY VDGDVYF   K   YGK+S + L+++  G + E   +K NP DFALWK    G   W+  +  GRPGWH ECS +  KYLG   DIHGGG DL FPHHENE  Q    ++ +  AR WMH   L IN QKMSKSL NF   +++L  +    +R++   T Y +PL+F  ENL  ++  LE +
  S:     3 LRLFNTMSHQKEEFKPREEGKVGMYTCGPTVYNYFHVGNGRMLVVFDMIRRYLLYKGYDVTFVQNFTDIDDKIIKRGQEEGRDPLELAQDYIGEYFKDAAALNLMPASIH-PKATDHIPEMIEIIKGLEEQGLAYAVDGDVYFAVDKLPAYGKLSGRTLEDMQAGARVEVGERKQNPMDFALWKNAKPGEPFWESPWGKGRPGWHIECSAMSLKYLGSGFDIHGGGGDLVFPHHENEIAQAEGYLHGETFARYWMHNAFLTINQQKMSKSLGNFFTVREILEHFPGEVIRFYLLGTHYRSPLDFDDENLQMAQKGLERL 320
>gi|169830402|ref|YP_001716384.1| cysteinyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] >gi|169637246|gb|ACA58752.1| cysteinyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] (478 aa)
Score = 686, Expect = 5.7e-70, Identities = 129/311 (41%), Positives = 180/311 (57%)
  Q:    17 DKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNW-DLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL 327
           D   + +YVCGPT YN +H+GN R ++ FD + R FL  GY V +I N TD+DDKI+N+++EE I    L++ Y  +YF     +N+  +++  P+VSDHI +I   I  I++   AY+  GDVYF   K   YG++S + LD+LL G + E   +K +P DFALWK    G  W +  +  GRPGWH ECS +  KYLG   DIHGGG DL FPHHENE  Q+     +  AR W+H G + I  +KMSKSL N  L ++L   Y    +R F     Y NPL++  E +  S   +  +   L + +  L
  S:    18 DPGRVSIYVCGPTTYNFIHLGNARALVVFDTIRRYFLYKGYRVLYIQNFTDVDDKIINRSREEGIDPQTLAAKYVDEYFVDADALNVRRADVH-PKVSDHIPEIIALITMIIDRGLAYVAGGDVYFAVRKFGGYGRLSKRSLDDLLAGARVEVGEQKRDPLDFALWKAAKPGEPWWESPWGRGRPGWHIECSAMALKYLGTGFDIHGGGADLIFPHHENEIAQSEGATGEPFARYWIHNGFITIREEKMSKSLGNVFLVRELTRLYPPEALRLFLLSNHYRNPLDYDPEAMEASVRAVNRLKTCLGLLRESL 328
>gi|119485660|ref|ZP_01619935.1| Cysteinyl-tRNA synthetase, class Ia [Lyngbya sp. PCC 8106] >gi|119456985|gb|EAW38112.1| Cysteinyl-tRNA synthetase, class Ia [Lyngbya sp. PCC 8106] (481 aa)
Score = 685, Expect = 6.1e-70, Identities = 160/435 (36%), Positives = 252/435 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNL-------------IELTNNFNLPNIVSFIEEKIK----YSSILLRNKNFE----ELNKLHFNLSYLLTKILGI----------IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+  ++T +  + L+ +++KMY CG TVY++ H+G+ R  I +DV+ R    LGY V ++ N TDIDDKI+N+AK+EN     +S  +   Y++ L+ +NI  ++  +PR +D+I +I   IQ++    +AY   GDV++   K  +YGK+S +K D+L  G     S    +K +  DFALWK +  G   W   +  GRPGWH ECS ++ + LG  IDIHGGG DL FPHHENE  Q+ A N + LAR WMH G + +  +KMSKSL NF   + LL   +   +R F +Q  Y  PL+FT + + +++N         N     L+ + ++ EK    DK++L             I + ++FN P  ++ + E  K      +IL      E    ++ +  + L   L ++LG+              L D E  +L+ +    ++ KN++E D+ R  L E
  S:     3 LKIYNTQTRTKETFIPLEPQHVKMYCCGVTVYDYCHLGHARSYIFWDVVRRYLEWLGYTVQYVQNFTDIDDKILNRAKKENSSMEAVSERFIEAYYEDLRRLNIRDAD-AYPRATDNISEIYQLIQQLEKKGYAYASKGDVFYSVEKFPEYGKLSGRKQDQLQAGASGRVSGAEGEKKHSSDFALWKASKPGEPAWKSPWGEGRPGWHIECSAMVRQLLGATIDIHGGGGDLIFPHHENEIAQSEAANCEPLARFWMHNGFVTVGGEKMSKSLGNFTTIRQLLETVDPMVIRLFVFQAHYRKPLDFTPDAITSAEN-------GWNTLCEGLLFKSQHGEKLGWLDKNDLPPALHSEAVERFQIAMDDDFNTPGGLAVLFELAKELRTEGNILTHEGKTETPLPQIQQTWWTLVQ-LAEVLGLEVKPEDTSIPTASGLSDQEIEDLIQQRLAARKAKNYAEGDQIRDRLKE 464
>gi|153940395|ref|YP_001392856.1| cysteinyl-tRNA synthetase [Clostridium botulinum F str. Langeland] >gi|187629802|sp|A7GJ96|SYC_CLOBL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|152936291|gb|ABS41789.1| cysteinyl-tRNA synthetase [Clostridium botulinum F str. Langeland] (465 aa)
Score = 685, Expect = 6.3e-70, Identities = 164/439 (37%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFD------KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E ++L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ +A EE     EL   +  +Y+     +NI  +  K PR ++ +++I  ++  ++   +AY +DGDVYF T K N YGK+S + L+EL +G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L  +  ++  ++ LE+       K   IE + ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E  +L+ +  K ++EKN++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFLTLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDTIRRYLEYRGYKVKFIQNFTDIDDKMIKRANEEGSTVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMEEIIKFVSDLIEKGYAYEIDGDVYFSTKKFNSYGKLSGQNLEELQLGARINIDERKKDPMDFAIWKSQKPGEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEELRDEELEYKNELQKYKEKYIEKMDDDFNTADAISVIFDLIRDVNTNVTIESSKELVKYTLDLIRELGNPLGILQESTKASLEEEIEKLIEERQKARKEKNWALADKIRDNLKERGIV 452
>gi|75909922|ref|YP_324218.1| cysteinyl-tRNA synthetase [Anabaena variabilis ATCC 29413] >gi|109894882|sp|Q3M6R3|SYC_ANAVT Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|75703647|gb|ABA23323.1| cysteinyl-tRNA synthetase [Anabaena variabilis ATCC 29413] (486 aa)
Score = 685, Expect = 6.4e-70, Identities = 166/433 (38%), Positives = 248/433 (57%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG-----DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLL--------SEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-ELTNNFN------------LPNIVSFIEEKIKYSSILLRNKNF----EELNKLHFNLSYLLTKILG---------IIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +++  + + +++   +KMY CG TVY++ H+G+ R  I +D + R  +  G+ V +I N TDIDDKI+N+AKE+     E+S+ +   YF  ++ +N+  ++ ++PRV++HI +I   IQ +     AY V GDVY+   +   YGK+S ++L+++  G     D  +   KK +P DFALWK    G   WD  +  GRPGWH ECS +I   LG  IDIHGGG DL FPHHENE  Q+ A  N+ LAR W H G + +N QKMSKSL NFI  ++LL           N   VR F  Q  Y  PL+FT E + N++N  + +       K  L+   +Y EK     +S +I EL   F             L  +    +E  +  +IL+         +EL +  +N    L K+LG         +    L D +   L+ +    ++ KNFSESD+ R  L
  S:     3 LTIYNTLTRRQEPLETVEPGKVKMYCCGVTVYDYCHLGHARSYIVWDTIRRYLIWRGFEVKYIQNFTDIDDKILNRAKEQGSTMAEVSNRFIDAYFADIRRLNVLDAD-EYPRVTEHIPEIHQLIQILEEKGLAYAVGGDVYYRVERFPSYGKLSGRELEQMQAGASGRVDVEDSEPKKQHPFDFALWKAAKPGEPAWDSPWGQGRPGWHIECSAMIRSKLGATIDIHGGGGDLIFPHHENEIAQSEAAMNQPLARYWTHNGMVMVNGQKMSKSLGNFITIRELLDGVGSWKGDPVNPMAVRLFVLQAHYRKPLDFTEEAIANAENSWKTL-------KEGLLFGYQYGEKLGWGQESAIIPELATRFQELGDDDFNFSGGLAVLFELAKELRREGNILVHEGTTKTPSDELQR-QWNTLVTLGKVLGLEATPDDETLTQPGLSDTDIEALIEQRQAARKNKNFSESDRIRNEL 467
>gi|170754736|ref|YP_001783143.1| cysteinyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] >gi|169119948|gb|ACA43784.1| cysteinyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] (465 aa)
Score = 685, Expect = 6.5e-70, Identities = 164/439 (37%), Positives = 263/439 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFD------KSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL---FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+Y+ ++   +E ++L    +KMYVCGPTVYN  HIGN R  + FD + R     GY V FI N TDIDDK++ +A EE     EL   +  +Y+     +NI  +  K PR ++ +++I  ++  ++   +AY +DGDVYF T K N YGK+S + L+EL +G +   + +K +P DFA+WK    G   W+  +  GRPGWH ECSC+    LG+ IDIH GG DL FPHHENE  Q+ A   K  A+ W+H   +N+NNQKMSKSL+NF  A+++L +Y+ + +R F     Y   +NF+ E L ++K  L+ +  ++N  ++ L  +  ++  ++ LE+       K   IE + ++FN  + +S I + I+  +  +  ++ +EL K   +L   L   LGI+  +     ++E  +L+ +  K ++EKN++ +DK R  L E+ ++
  S:     1 MKVYNTLTNKKEEFLTLVPGEVKMYVCGPTVYNFFHIGNARTFVVFDTIRRYLEYRGYKVKFIQNFTDIDDKMIKRANEEGSTVKELGDRFIKEYYKDADDLNIERAT-KNPRATEFMEEIIKFVSDLIEKGYAYEIDGDVYFSTKKFNSYGKLSGQNLEELQLGARINVDERKKDPMDFAIWKSQKPGEPAWESPWGMGRPGWHIECSCMAYNLLGETIDIHAGGSDLSFPHHENEIAQSEARTGKQFAKYWLHSAFVNVNNQKMSKSLNNFFTAREILEKYDADVLRMFMLSGHYRTQINFSMELLDSTKAALDRLYNSINNLENLLDEVKNEELRDEELEYKNELQKYKEKYIEKMDDDFNTADAISVIFDLIRDVNTNVTIESSKELVKYTLDLIRELGNPLGILQESTKASLEEEIEKLIEERQKARKEKNWALADKIRDNLKERGIV 452
>gi|167729705|emb|CAO80617.1| cysteinyl-tRNA synthetase [Candidatus Cloacamonas acidaminovorans] (469 aa)
Score = 685, Expect = 6.7e-70, Identities = 136/320 (42%), Positives = 195/320 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           M +Y+  ++  +E   +    + +Y CGPTVYN+ HIGN R  I FDV+ R F   GY VT++ NITDIDDKI+ +A EENI    ++  Y   + D    + I     + P+ ++ + DI  +I ++    +AY V+GDVYF T     YG +S KK +E L G +  +N  K +P DF LWK+   G   W+  +  GRPGWHTEC  +  KYLG+  DIH GGIDL FPHHENE  Q +A + K LA  WMH G LN++ +KMSKSL NF  A+D+L+EY+  ++R+FF    Y +P++F+ E +  S+  + N+  +L
  S:     1 MLLYNTQTRKKEEFQPITPGKVGIYACGPTVYNYFHIGNARAFIFFDVVRRYFTYRGYEVTYVQNITDIDDKIIAQANEENISFTLVAEKYTRAFLDDTSALGIKPPTYQ-PKATEVMDDIIAFIAELEKKGYAYEVEGDVYFATENLPSYGCLSGKKTEEQLAGARVMENYNKRHPADFTLWKKGKPGEPVWESPWGKGRPGWHTECVVMSQKYLGETFDIHCGGIDLIFPHHENELAQAMAYSGKPLANYWMHNGFLNVDGEKMSKSLKNFFTARDILAEYDAESIRFFFLSKHYRSPIDFSRELMEESQRAVANLYSSL 321
>gi|167745717|ref|ZP_02417844.1| hypothetical protein ANACAC_00410 [Anaerostipes caccae DSM 14662] >gi|167655029|gb|EDR99158.1| hypothetical protein ANACAC_00410 [Anaerostipes caccae DSM 14662] (466 aa)
Score = 684, Expect = 7.6e-70, Identities = 162/439 (36%), Positives = 256/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD---KSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL----IIEQKYNEKNLEFDKSNLI-----ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ +++  +E V +    + +YVCGPTVYN++HIGN RP+I FD + R F   GY+V ++ N TD+DDKI+ KA EE +   E++  Y  +    ++ +N+  +  + P+ ++ I  +   I  ++    AY V+G VYF T   + YGK+S K +D+L  G    K      K +P DF LWK    G + W   +  GRPGWH ECS +  KY+GD IDIH GG DL FPHHENE  Q+ A N++  A  WMH G LNI+NQKMSKS  NF   +++  +Y    +R+F     Y NPLNF+   + ++KN L+ I+  +++ +           K  E NLE +   L+      + ++FN  + VS I E +K ++  ++  + +   KL   +   L  +LGI      ++ D+E   ++ +  + ++EK+F+ +D+ R  L+EK ++
  S:     1 MKIYNTLTRKKEEFVPVHPGKVGIYVCGPTVYNYIHIGNARPMIIFDTVRRYFEYKGYDVNYVSNFTDVDDKIIKKANEEGVSATEIAERYIEECKKDMEGLNVKPATHQ-PKATEEIDGMIRMIGTLIEKGHAYEVNGTVYFKTRSFDGYGKLSKKNIDDLEAGHRDIKVRGEEGKQDPLDFVLWKPKKEGEIAWPSPWGEGRPGWHIECSEMSKKYIGDTIDIHAGGEDLIFPHHENEIAQSEACNDECFANYWMHNGFLNIDNQKMSKSAGNFFTVREISEKYPLQVIRFFMLSAHYRNPLNFSDTLVESAKNGLDRILTAIDLVRDQADKPETAAGKEEEANLE-EARKLVGKFEEAMEDDFNTADAVSAIFELVKLANTTVKESSSDYAAKL-LEIMETLCGVLGIETKQEEDILDEEIERMIEERQQARKEKDFARADEIRDELLEKGII 453
>gi|167765721|ref|ZP_02437774.1| hypothetical protein CLOSS21_00209 [Clostridium sp. SS2/1] >gi|167712594|gb|EDS23173.1| hypothetical protein CLOSS21_00209 [Clostridium sp. SS2/1] (467 aa)
Score = 683, Expect = 1.1e-69, Identities = 163/439 (37%), Positives = 252/439 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD---KSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE---------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKIY+ +++  +E V +    + MYVCGPTVYN++HIGN RP+I FD + R F   GY V ++ N TD+DDKI+ KA EE +   E++  Y  +    ++ +NI  +  + PR ++ I  +   IQ ++    AY VDG VYF T     YGK+S K +D+L  G    K      K +P DF LWK    G + WD  +  GRPGWH ECS +  KY+GD IDIH GG DL FPHHENE  Q+ A N +  A  WMH G LNINN+KMSKS  NF   +++  +Y    +R+F     Y  PLNF+   + ++K  L+ I+  +++ +     E+  +    E +    IE         + ++FN  + VS I E ++ S+  +++ + +   K+   L  L + +LGI       + D+E  +L+ +    ++ K+F+ +D+ R  L+E+ ++
  S:     1 MKIYNTLTRQKEEFVPVHPGKVGMYVCGPTVYNYIHIGNARPMIIFDTVRRYFEYKGYEVNYVSNFTDVDDKIIKKANEEGVTATEIAERYIKECKQDMEALNIKPATHQ-PRATEEIGGMIKMIQTLIKKGHAYEVDGTVYFKTRSFKDYGKLSKKNIDDLEAGHREIKVTGEEGKEDPLDFVLWKPKKEGEIAWDSPWGEGRPGWHIECSEMSKKYIGDTIDIHAGGEDLIFPHHENEIAQSEACNGEKFANYWMHNGFLNINNKKMSKSAGNFFTVREIGEKYPLQVIRFFMLSAHYRTPLNFSDTLVESAKTGLDRILTAIDLCREMSAKEETGSLSKEETEHFANIEVLVKKFEDAMEDDFNTADAVSAIFEIVRESNSTVKDFSADYAKKILKVLEDLCS-VLGIETTKEEEILDEEIEKLIEERQAARKNKDFARADEIRDQLLEQGIV 454
>gi|148322313|gb|EDK87563.1| cysteine--tRNA ligase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (473 aa)
Score = 681, Expect = 1.8e-69, Identities = 164/435 (37%), Positives = 253/435 (58%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--------------EFDKSNLIELTNNFNLPNIVSFIEEKIK-----YSSILLRNKNFEELNKLHFNLSYLLTKILGI-----IHVNLFDDEAIELLNKWNK-LKQEKNFSESDKYRKLLME 435
           +KIY+ ++   D+   L +  + MYVCGPTVYN++HIGN RP I FD + R     GY VT++ N TD+DDK++NKA  EN+   E++  Y   YF+    IN+    M  P+ +++I ++   I+ +V+  +AY  +GDVYF+  K  + YG++S + +++L  G + + N  K +  DFALWK +     +WD  +  GRPGWH ECS +  KYLGD  DIHGGG+DL FPHHENE  Q+        AR WMH G++NIN QKMSKS  +FIL +D+L  +    +R F   + Y  P+ F+   L  +K+ LE I   L   K       + + +NL              E +   +  +  +FN    +  I E +K        + +  K  E +N+++  L  ++  +LG+     + VN    + IEL+ +  +  ++EKN++ SDK R  L+E
  S:     2 IKIYNTLTGHLDEFKPLKENEVSMYVCGPTVYNYIHIGNARPAIFFDTVRRYLEYRGYKVTYVQNFTDVDDKMINKANIENVSIKEIAERYIKAYFEDTSKINLKEDGMIRPKATENINEMIEIIKSLVDKGYAYESNGDVYFEVKKYRDGYGELSKQNIEDLESGARIDVNEIKRDALDFALWKASKPNEPSWDSPWGKGRPGWHIECSAMSRKYLGDSFDIHGGGLDLIFPHHENEMAQSKCGCGGTFARYWMHNGYININGQKMSKSSGSFILLRDILKHFEGRVIRLFVLGSHYRKPMEFSDTELNQTKSSLERIENTLKRIK-------ELDRENLKGTDDCQDLLATKKEMEAKFIEAMDEDFNTAQALGHIFELVKAVNKTLDEVNISEKGLEVINEVYSYLVMIIQDVLGVQLKLEVEVNNISADLIELILELRRNAREEKNWALSDKIRDRLLE 457
>gi|81176849|ref|ZP_00875826.1| Cysteinyl-tRNA synthetase, class Ia [Streptococcus suis 89/1591] >gi|80976397|gb|EAP40009.1| Cysteinyl-tRNA synthetase, class Ia [Streptococcus suis 89/1591] (447 aa)
Score = 681, Expect = 2.0e-69, Identities = 152/433 (35%), Positives = 251/433 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNL-IELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ ++ V L++  +KMYVCGPTVYN++HIGN R ++ FD + R F   GY+VT+I N TD+DDKI+  A E  +   ELS  +   + + +  + +  +  K PRV D++ +I +++Q +++  +AY   GDVYF   K+  Y +++NK L +L  G     + E  LK++ P DFALWK    G ++W+  +  GRPGWH ECS +  + LG  IDIHGGG DL+FPHH NE  Q+     +  A  WMH   LNIN++KMSKSL NF+ A D+L + +   +R+F     Y  PLN+T + + +++  L+   Y  N +     ++   ++  LE   +     + ++FN  N ++ I +  K+    + + N++E  K  F     + ++ GI+    + D E   L+ +    +  ++F+ +D+ R  L
  S:     2 IKIYDTMTRSLRDFVPLEEGKVKMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYRGYDVTYISNFTDVDDKIIKAANEAGMTTKELSDKFIAAFREDVAKLGVKPAT-KNPRVIDYMDEIIDFVQVLIDKGYAYEASGDVYFRVEKAENYARLANKTLSDLEAGASGRVEGEGQLKEH-PFDFALWKTAKPGEVSWESPWGAGRPGWHIECSVMATEILGATIDIHGGGADLEFPHHTNEIAQSECKTGQTFANYWMHNAMLNINDEKMSKSLGNFLTAHDMLEQIDGQVLRFFLSTQHYRRPLNYTEKAISDAEINLK---YLKNTYTQP--VQNSVDKSALELHLAAFEAAMDDDFNAANGITAIFDFAKW----INSGNYDETVKEAFG---KMLEVFGIVFEEEVLDSEIEALIAERQAARANRDFATADRIRDEL 428
>gi|47458983|ref|YP_015845.1| cysteinyl-tRNA synthetase [Mycoplasma mobile 163K] >gi|61216201|sp|Q6KIE2|SYC_MYCMO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|47458311|gb|AAT27634.1| cysteinyl-tRNA synthetase [Mycoplasma mobile 163K] (413 aa)
Score = 679, Expect = 3.3e-69, Identities = 184/417 (44%), Positives = 248/417 (59%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINK-YLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQ---KYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIK-YSSIL---LRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +YVCGPTVYN VHIGN++PI+TFD+  R    +     F+HN+TDIDDKI+ KA +EN  ELE+S  Y   Y  +L   NI+  +    +V+D+I  I  YI  +V     Y+  G VYFDTTK  +YG ISN  L++ L GD    N +KNNP DF LWK+T +G+ W   +S GRPGWHTECS LIN  +  DQIDIHGGGIDL FPH+ENENIQNIA++   LA+ W+HVGH+   N+KMSKSL+NFILA D + +Y  +T R     TS+S P++   E ++ S  ++ N  Y +   +++L+I Q   + NE   +     + +L  NF    I   I  +IK ++S++     NK  E    L F  S                 + ++L  KW   K  KNF  SDK    L EKKL+
  S:     4 IYVCGPTVYNKVHIGNMKPIMTFDLFLRGANFIEKQYLFLHNLTDIDDKIIEKASKENKTELEISELYSDFYLKMLDEYNINKPDY-IEKVTDNINMIIEYIGLLVKKGSGYIKKGSVYFDTTKYPEYGSISNLNLNKTLDGDDDFKN-EKNNPHDFVLWKKTKVGITWKSPWSEGRPGWHTECSALINHIFKKDQIDIHGGGIDLIFPHNENENIQNIALHGLSLAKKWLHVGHIKWENEKMSKSLNNFILADDFIEKYGNDTFRTLILNTSFSTPISI-NEEILESNKKISN-KYQVTFNQANLLIMQSKKRQNEVETQKYLEKIAKLLENFEFSKINFEINLQIKLFNSVVDLDAANKLVECFKLLGFKFS-----------SQNVSQKDLDLFLKWKIEKTNKNFKISDKLFLELKEKKLV 413
>gi|45358623|ref|NP_988180.1| cysteinyl-tRNA synthetase [Methanococcus maripaludis S2] >gi|61216204|sp|Q6LYD1|SYC_METMP Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|45047489|emb|CAF30616.1| Cysteinyl-tRNA synthetase [Methanococcus maripaludis S2] (476 aa)
Score = 679, Expect = 3.6e-69, Identities = 137/322 (42%), Positives = 214/322 (66%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNI 322
           +K+Y+ +++ ++E  +L++K +KMYVCGPTVY++ H+G+ R  ++FD++ R    +GY V  + N TDIDDKI+ +A E+     E+S  +   + D + T+ +  +++ +P+V++HI +I  +I+K++   FAY  +  VYF+  K   YGK+SN  L++L+ G + E + KK N +DFALWK    G   W+  F +GRPGWH ECS + +KYLG+Q DIHGGG DL FPHHENE  Q+ A + KD    W+H G + +N +KMSKSL NF+   D+  EY+   +R+FF Q  Y +P+++T E++ + KN LE   N+I N+ I
  S:     2 LKVYNTLTRCEEEFKTLNEKEVKMYVCGPTVYDNTHLGHGRTYVSFDIIRRYLEHMGYTVNLVINFTDIDDKIIKRAYEKEKDPKEISEQFIKVFLDDMATLKVKPADI-YPKVTEHISEIIAFIEKLIEKGFAYKTEDGVYFEVKKFKNYGKLSNINLEDLVSGARIETSEKKKNQKDFALWKTAKPGEPKWESPFGSGRPGWHIECSAMSSKYLGEQFDIHGGGRDLSFPHHENEIAQSSAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFVTIGDISKEYSPEILRFFFIQRHYRSPIDYTAESMNHVKNNLEKIYNVIENIRI 327
>gi|34762389|ref|ZP_00143391.1| Cysteinyl-tRNA synthetase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887971|gb|EAA25037.1| Cysteinyl-tRNA synthetase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (473 aa)
Score = 679, Expect = 3.8e-69, Identities = 160/435 (36%), Positives = 252/435 (57%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS-------HLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIK-----YSSILLRNKNFEELNKLHFNLSYLLTKILGI-----IHVNLFDDEAIELLNKWNK-LKQEKNFSESDKYRKLLME 435
           +KIY+ ++   D+   L +  + MYVCGPTVYN++HIGN RP I FD + R     GY VT++ N TD+DDK++NKA  EN+   E++  Y   YF+    +N+    M  P+ +++I ++   I+ +V+  +AY  +GDVYF+  K  + YG++S + +++L  G +   N  K +P DFALWK +     +WD  +  GRPGWH ECS +  KYLGD  DIHGGG+DL FPHHENE  Q+        AR WMH G++NIN +KMSKS  +F+L +D+L  +    +R F   + Y  P+ F+   L  +K+ LE I   L   K         +   Q+      E +   +  +  +FN    + +I E +K        + +  K  E +++++  L  ++  +LG+     + VN    + IEL+ +  +  ++EKN++ SDK R  L+E
  S:     2 IKIYNTLTGHLDEFKPLKENEVSMYVCGPTVYNYIHIGNARPAIFFDTVRRYLEYRGYKVTYVQNFTDVDDKMINKANIENVSIKEIAERYIKAYFEDTSKLNLKEDGMIRPKATENINEMIEIIKSLVDKGYAYESNGDVYFEVNKYKDGYGELSKQNIEDLESGARINVNEVKKDPLDFALWKASKPNEPSWDSPWGKGRPGWHIECSAMSKKYLGDSFDIHGGGLDLIFPHHENERAQSKCGCGGTFARYWMHNGYININGEKMSKSSGSFVLLRDILKYFEGRVIRLFVLGSHYRKPMEFSDAELNQTKSSLERIENTLKRIKELDRENIKGIDDCQELLATKKEIEAKFIEAMDEDFNTAQALGYIFELVKAVNKTLDEVNISKKGLEVIDEVYSYLVMIIQDVLGVKLKLEVEVNNISADLIELILELRRNAREEKNWALSDKIRDRLLE 457
>gi|188584813|ref|YP_001916358.1| cysteinyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349500|gb|ACB83770.1| cysteinyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] (469 aa)
Score = 678, Expect = 4.3e-69, Identities = 156/439 (35%), Positives = 255/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE------------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELN-KLHFNLSYLLTKILGIIHVN--LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+++ + K  +E V   +  + MYVCGPTVY++ H+GN R  + FDV+ R     GY VT++ NITDI+DK++N+A E+ I   EL+  Y ++YFD  + I I  ++   P+ ++HI +I   IQ +++  +AY   GDVYFDT   + YGK+  +  +EL+ G +   + +K NP DF LWK    G   WD  F  GRPGWH ECS +  KYL   +DIH GG DL FPHHENE  Q+ A   +D  + WMHVG+L I+N+KMSKS+ NF+  +D   +Y+   +R F     Y +PLNFT E +  +K+ L+ +    N  K +L   +K  E+ L   + +++E            + ++FN  + ++ I    K  +  + N     L  K  ++L     +++G++     +  +E  + + +  + +++K+F  +D  R  L ++ ++
  S:     5 IKLFNTMKKKKEEFVPKQEGKVDMYVCGPTVYDYFHVGNARAFLIFDVVRRYLDYKGYQVTYVQNITDIEDKMINRANEDGITVAELAEKYTSEYFDDARAIGIKDAD-HHPKATEHIAEIIEIIQDLLDKGYAYRQGGDVYFDTAAFDDYGKLCRQDPEELVSGARVAVDDRKKNPADFVLWKSKKEGEPAWDSPFGQGRPGWHIECSAMSMKYLDTPLDIHAGGSDLVFPHHENEVAQSEAATGQDFCKYWMHVGYLEIDNRKMSKSMGNFLTVRDFRQKYDPRVLRLFLMSAHYRSPLNFTDELIEQAKSSLDRLDNFYNNLKFYL---EKSREQELTDKEQDIMEYLKQARTEFEAAMDDDFNTASALAVIFSLAKEINSYIGNGGENALVFKNTYDLLLEFDQVMGLLPETDEILPEEIEQKIQEREQARKQKDFQRADAIRDELRDRGII 456
>gi|24378673|ref|NP_720628.1| cysteinyl-tRNA synthetase [Streptococcus mutans UA159] >gi|30316156|sp|Q8DWA9|SYC_STRMU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|24376535|gb|AAN57934.1|AE014867_6 putative cysteinyl-tRNA synthetase [Streptococcus mutans UA159] (447 aa)
Score = 677, Expect = 5.1e-69, Identities = 154/430 (35%), Positives = 246/430 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK---KNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL--IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-HVNLFDDEAIELLNKWNKLKQEKNFSESDKYR 430
           +KIYD ++++ +E V + +  + MYVCGPTVYN++H+GN R  I FD + R F   GY V +I N TD+DDKI+  A +  +    LS  +   + + +  + +  +    PRV D+++DI +++Q +V+  FAY   GDVYF   KS+ Y  ++NK L+EL +G     + +   K +P DFALWK    G + WD  +  GRPGWH ECS +    LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +NI+N+KMSKSL NFI   D L   +   +R+FF    Y  P NFT + + +++  L+   Y  N ++      +++    + LE  ++ + E   +FN  N ++ + E  K+    + + ++++  K  F     + +I G++    + D E  +L+ +  K +  ++F+++D  R
  S:     2 IKIYDTLTRSLREFVPIHENTVNMYVCGPTVYNYIHVGNGRSAIAFDTIRRYFEYRGYTVNYISNFTDVDDKIIKAAAKAGMTTKALSDKFIAAFKEDVAALGVKPATEN-PRVIDYMQDIIDFVQILVDKGFAYESSGDVYFRVRKSDNYAALANKTLEELEIGASGRVDAESDCKEDPLDFALWKAAKEGEIAWDSPWGAGRPGWHIECSVMATTILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKKFANYWMHNGFVNIDNEKMSKSLGNFITVHDALKTMDGQVLRFFFATQHYRKPFNFTEKAIRDAEINLK---YLKNTYEQPFTATVDEAVFARFLEKFQAAMDE---DFNTANGITVVFELAKW----INSGHYDQTVKDKFA---EILQIFGVVFKEEVLDAEIEKLIEERQKARAARDFTKADAIR 425
>gi|146319578|ref|YP_001199290.1| cysteinyl-tRNA synthetase [Streptococcus suis 05ZYH33] >gi|146321776|ref|YP_001201487.1| cysteinyl-tRNA synthetase [Streptococcus suis 98HAH33] >gi|145690384|gb|ABP90890.1| Cysteinyl-tRNA synthetase [Streptococcus suis 05ZYH33] >gi|145692582|gb|ABP93087.1| Cysteinyl-tRNA synthetase [Streptococcus suis 98HAH33] (447 aa)
Score = 676, Expect = 7.2e-69, Identities = 153/433 (35%), Positives = 249/433 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNL-IELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++++ ++ V L++  +KMYVCGPTVYN++HIGN R ++ FD + R F   GY+VT+I N TD+DDKI+  A E  +   ELS  +   + + +  + +  +  K PRV D++ +I +++Q +++  +AY   GDVYF   K   Y +++NK L +L VG     + E  LK++ P DFALWK    G ++W   +  GRPGWH ECS +  + LG  IDIHGGG DL+FPHH NE  Q+     +  A  WMH   LNIN++KMSKSL NF+ A D+L + +   +R+F     Y  PLN+T + + +++  L+   Y  N +     ++   ++  LE   +     + ++FN  N ++ I +  K+    + + N++E  K  F     +  + GI+    + D E   L+ +    +  ++F+ +D+ R  L
  S:     2 IKIYDTMTRSLRDFVPLEEGKVKMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYRGYDVTYISNFTDVDDKIIKAANEAGMTTKELSDKFIAAFKEDVTKLGVKPAT-KNPRVIDYMDEIIDFVQVLIDKGYAYEAAGDVYFRVEKVENYARLANKTLSDLEVGASGRVEGEGQLKEH-PFDFALWKTAKSGEVSWGSPWGAGRPGWHIECSVMATEILGATIDIHGGGADLEFPHHTNEIAQSECKTGQTFANYWMHNAMLNINDEKMSKSLGNFLTAHDMLEQIDGQVLRFFLATQHYRRPLNYTEKAISDAEINLK---YLKNTYTQP--VQNSVDKSALELHLAAFEAAMDDDFNAANGITAIFDFAKW----INSGNYDETVKEAFG---KMLAVFGIVFEEEVLDSEIEALIAERQAARANRDFATADRIRDEL 428
>gi|14521604|ref|NP_127080.1| cysteinyl-tRNA synthetase [Pyrococcus abyssi GE5] >gi|13878786|sp|Q9UYV2|SYC_PYRAB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|5458823|emb|CAB50310.1| cysS cysteinyl-tRNA synthetase [Pyrococcus abyssi GE5] (477 aa)
Score = 676, Expect = 7.4e-69, Identities = 162/433 (37%), Positives = 254/433 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNIFKSHLIIEQKYNEKNL-------EFDKSNLIELTNNFNLPNIVSFIEEKI----KYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD-----------EAIELLNKWNK-LKQEKNFSESDKYRKLL 433
           +K+Y+ +++  +E+  L    ++MYVCGPTVY++ H+G+ R  I FDV+ R     G+ V  + N TDIDDKI+ +A+E      +L+  +   + + +  + +  +++ +PRV++HI DI  +I+K+    +AY     VYF+  K   YGK+S  K++EL  G + E    K NP+DFALWK+   G   WD  +  GRPGWH ECS + +KYLG+  DIHGGG DL FPHHENE  Q+ A    +  R W+H G + +  +KMSKSL NF+  ++LL  Y+   +R F  Q  Y +PL++T E L ++KN LE   N + N+ I   +  +  K++EK+        E  K     + ++FN    +  + E      KY  IL  +K  E + +       +++++ GI     F+D           + IELL +  K L++EK F  +DK R+ L
  S:     3 IKVYNTLTRKKEELKPLRDGEVRMYVCGPTVYDYPHLGHARTYIAFDVIRRYLEHRGFTVLMVMNFTDIDDKIIKRAQETGEDPGKLAERFIKVFLEDMNALKVKPADI-YPRVTEHIDDIIEFIKKLKEKGYAYEGSDGVYFEVQKFKDYGKLSGVKIEELRKGARVEPGEGKKNPEDFALWKKAKPGEPKWDSPWGEGRPGWHIECSVMSSKYLGESFDIHGGGNDLIFPHHENEIAQSEACFGHEWVRYWLHTGFVMVKGEKMSKSLGNFVTVRELLQRYSPEVIRLFVLQKHYRSPLDYTEEGLQHAKNNLERLYNTLENIRIAMRNAELSYKWSEKDFEAYEAIREARKKFYDAMDDDFNTAEALKAVFEVSNAINKY--ILEVDKPKESILRKALEFFKVVSEVFGI-----FEDYFKEEKKGEEEKLIELLVEVRKQLRKEKRFDLADKIREEL 455
>gi|167629446|ref|YP_001679945.1| cysteinyl-tRNA synthetase [Heliobacterium modesticaldum Ice1] >gi|167592186|gb|ABZ83934.1| cysteinyl-tRNA synthetase [Heliobacterium modesticaldum Ice1] (481 aa)
Score = 676, Expect = 7.8e-69, Identities = 125/316 (39%), Positives = 194/316 (61%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKD-LARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +++Y+ +S+ +KE  +  K   + MYVCGPT Y+++H+GN RP++ FD + R    +GY V +I N TDIDDKI+++AKE     + +++ +  +Y+   K +N+  + +  P+VS H+ +I   I  +V    AY + GDVYF       YGK+S + L++L  G + + N +K +P DFALWK    G  +WD  +  GRPGWH ECS +  KYLGD  DIHGGG DL FPHHENE  Q+ A      +AR W+H G + +N +KMSKSL NF   +++L  +  + +R++   T Y +P++F    L  ++  L+ +
  S:     3 LRVYNTLSR-EKETFVPHKAGRVGMYVCGPTTYDYIHLGNARPLVVFDTIRRYLEHVGYEVVYIQNFTDIDDKIIHRAKEIGEDPIAMAARFVEEYYRDAKALNVRPATIH-PKVSAHMAEIIAMIGVLVEKGHAYELGGDVYFSIPSFKDYGKLSGRSLEDLQAGARVDVNERKRHPMDFALWKGAKPGEPSWDSPWGKGRPGWHIECSAMSRKYLGDAFDIHGGGQDLIFPHHENEIAQSEACTGTSPMARYWLHNGFITVNQEKMSKSLGNFFTLREILKRFPGDVIRFYLLSTHYRSPIDFDDSKLEAAQKGLQRL 320
>gi|161528475|ref|YP_001582301.1| cysteinyl-tRNA synthetase [Nitrosopumilus maritimus SCM1] >gi|160339776|gb|ABX12863.1| cysteinyl-tRNA synthetase [Nitrosopumilus maritimus SCM1] (462 aa)
Score = 675, Expect = 1.0e-68, Identities = 166/435 (38%), Positives = 248/435 (57%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINI-HTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNL------NIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD---DEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MK+ D +S  ++E+   KK +K+Y+CG TVY+  HIG+ R II FDVL R   + G  + FI N TD+DDKI+N+A+ EN     +S+ Y   YF     +N+ H +N  +P+ ++HI+DI  +I+K++  + AY+    VYF  +K  +YGK+S KK+DEL  G + E +  KNNP DFA+WK + +   WD  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ +      A+IWMHVG + I+ +KMSKS+ N    K +L  +  N +R F     YS P++++ E L   +    Q E   Y L      N  K   I+E+  +    EFDK+   ++  +  L      ++E  + ++     K   ++ K  F     + KILG+    + +    E   ++    K +QEK F E+D+ R  L E
  S:     1 MKLQDTLSNAEQELDTSKK-VKIYLCGVTVYDESHIGHARTIIVFDVLRRYLEDKGIEIEFIQNFTDVDDKIINRAQAENTSAEAISTKYIENYFKDFDGLNVKHATN--YPKATEHIEDIIKFIEKLIEKEIAYVSKNGVYFAVSKFPEYGKLSKKKIDELESGARIEVDEAKNNPLDFAVWKFSDVEPLWDSPWGKGRPGWHIECSAMSTKYLGENFDIHGGGRDLIFPHHENEIAQSESFTGNQFAKIWMHVGMVTIDGEKMSKSIGNIKSIKHVLENWGPNIIRLFCLSGHYSKPIDYSEELLKENLTKWRQAETCYYELIHANSENSEKVGSIVEKLGS----EFDKALEDDVNTHLALSAFFQLVKEANRLAAEEKLGKEDAKIIKTEF---LRMLKILGLNIPEMTEGMKQEIDTMIENREKFRQEKQFQEADQIRDKLNE 438
>gi|194468084|ref|ZP_03074070.1| cysteinyl-tRNA synthetase [Lactobacillus reuteri 100-23] >gi|194452937|gb|EDX41835.1| cysteinyl-tRNA synthetase [Lactobacillus reuteri 100-23] (470 aa)
Score = 674, Expect = 1.3e-68, Identities = 161/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNL-KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--------EFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLR--NKNFEELNKLHFNLSYLLTKILGI---IHVNLFDDEAI-ELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E   L    + MYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TD+DDK++  A E+ I   +L+  Y   + +    INI  + +  PR +++I +I  ++Q ++   +AY  DGDVY+   K N YG++S + LD+L VG     S D + KK +P DFALWK    G ++WD  +  GRPGWH ECS +  KYLG  IDIH GG DL+FPHHENE  Q+ A   +   R WMH G + I  +N+KMSKSL NFI   +++ E +   +R+F   T Y  P+ ++  NL  ++N L +I      F +    EQ  +E ++        +F    +  + ++ N+ N ++ + E +KY+++  +  N N   +  +   L  L++ I G+      N  +DE I +L+ + N  ++ K+F+ SD+ R  L ++ ++
  S:     2 LTIYNTLTRKKEEFKPLHPGVVNMYVCGPTVYNYIHIGNARSAIAFDTVRRYLEFKGYKVNYVSNFTDVDDKMIKAAAEQGITVPQLAEKYINAFMEDTAAINIEPATLH-PRATENITEIIKFVQGLIEKGYAYPKDGDVYYRARKFNHYGQLSGQSLDDLEVGASEHVSADEVNKKEDPLDFALWKAAKPGEISWDSPWGKGRPGWHIECSVMSTKYLGKTIDIHAGGQDLEFPHHENEIAQSEAETGQKFVRYWMHNGFVTIGKDNEKMSKSLHNFITVHEIIKEVDPQVLRFFMATTQYRRPIQYSQANLTAAQNNLNHI---QTAFDNLTYREQDADEGDVQGVTDRLEQFHHQFITAMDDDINVQNGIATVYELVKYANVYAQQDNVNLGAIQAIKKELVELMS-IFGVKLEASDNQINDEKIKQLIEERNVARKNKDFARSDEIRDNLKKQGII 457
>gi|108764055|ref|YP_630849.1| cysteinyl-tRNA synthetase [Myxococcus xanthus DK 1622] >gi|108467935|gb|ABF93120.1| cysteinyl-tRNA synthetase [Myxococcus xanthus DK 1622] (504 aa)
Score = 672, Expect = 2.4e-68, Identities = 123/294 (41%), Positives = 180/294 (61%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE 314
           + +YVCGPTVY+++HIGN R   +FDV+ R     G  V ++ N TD+DDKI+  A E     +EL++ Y   + +  + +++   +   PRVSDH+ +I   IQK+V+   AY   GDVYF  +    Y K+S + LDEL VG++ +   +K  P DFALWK    G   W+  +  GRPGWH ECS +  KYLG+  DIHGG +DL FPHHENE  Q+ + N    AR WMH G L++   KMSKSL N +  +D L++ +   +R+FF  T Y +PL+F+ + L +++ ++E
  S:    42 VGVYVCGPTVYSYIHIGNARTFTSFDVVVRYLRHRGLKVRYVRNFTDVDDKIIKAAAETGEAPVELAARYVEIFREDTRALHLLEPDFS-PRVSDHLPEIIAIIQKLVDKGHAYASQGDVYFSVSSDEDYAKLSKRNLDELCVGERVQPGEQKREPLDFALWKAAKPGEPAWESPWGPGRPGWHIECSAMSAKYLGETFDIHGGALDLIFPHHENEIAQSESANGVTFARYWMHCGFLDLEGAKMSKSLGNVVRLRDALTKVDPEALRFFFLATHYRHPLSFSDKALADAETRME 335
>gi|148543540|ref|YP_001270910.1| cysteinyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|184152946|ref|YP_001841287.1| cysteinyl-tRNA synthase [Lactobacillus reuteri F275] >gi|189082068|sp|A5VI99|SYC_LACRF Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|148530574|gb|ABQ82573.1| cysteinyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|183224290|dbj|BAG24807.1| cysteinyl-tRNA synthase [Lactobacillus reuteri F275] (470 aa)
Score = 671, Expect = 2.7e-68, Identities = 160/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNL-KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--------EFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFE--ELNKLHFNLSYLLTKILGI---IHVNLFDDEAI-ELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E   L    + MYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TD+DDK++  A E+ I   +L+  Y   + +    INI  + +  PR +++I +I  ++Q ++   +AY  DGDVY+   K N YG++S + LD+L VG     S D + KK +P DFALWK    G ++WD  +  GRPGWH ECS +  KYLG  IDIH GG DL+FPHHENE  Q+ A   +   R WMH G + I  +N+KMSKSL NFI   +++ E +   +R+F   T Y  P+ ++  NL +++N L +I      F +    EQ  +E ++        +F    +  + ++ N+ N ++ + E +KY+++  +  N     +  +   L  L++ I G+      N  +DE I +L+ + N  ++ K+F+ SD+ R  L ++ ++
  S:     2 LTIYNTLTRKKEEFKPLHPGVVNMYVCGPTVYNYIHIGNARSAIAFDTVRRYLEFKGYKVNYVSNFTDVDDKMIKAAAEQGITVPQLAEKYINAFMEDTAAINIEPATLH-PRATENITEIIKFVQGLIEKGYAYPKDGDVYYRARKFNHYGQLSGQSLDDLEVGASEHVSADEVNKKEDPLDFALWKAAKPGEISWDSPWGKGRPGWHIECSVMSTKYLGKTIDIHAGGQDLEFPHHENEIAQSEAETGQKFVRYWMHNGFVTIGKDNEKMSKSLHNFITVHEIIKEVDPQVLRFFMATTQYRRPIQYSQANLTDAQNNLNHI---QTAFDNLTYREQDADEGDVQEVTDRLEQFHHQFITAMDDDINVQNGIATVYELVKYANVYAQQDNVSLGAIQAIKKELVELMS-IFGVKLEASDNQINDEKIKQLIEERNIARKNKDFARSDEIRDNLKKQGII 457
>gi|51894254|ref|YP_076945.1| cysteinyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] >gi|61216176|sp|Q67JP9|SYC_SYMTH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|51857943|dbj|BAD42101.1| cysteinyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] (471 aa)
Score = 671, Expect = 3.0e-68, Identities = 157/433 (36%), Positives = 238/433 (54%)
  Q:     1 MKIY-DFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDG-DVYFDTTKSNQYGKISNKKLDELLVG--DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELT-----------NNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL----FDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           ++IY D   K +  V L+   ++ Y CGPTVY++ HIGN R  + FD + R     GY VTF+ N TDIDD+++ +A+E  I   EL+      YF     + +  +++  PR +  I +    IQ++++   AY+V+G DVYF  T S  YGK+S+K L+EL+ G  ++ + + +K +P DFALWK    G   W   +  GRPGWH ECS +  KYLGD IDIH GG DL FPHHENE  Q+ AV  K  AR WMH  HL I+  KMSKS+ NF   +D+L  Y+   VR F     Y   L+F+ + + +++  LE  +YN      HL       E   E +++ L EL+           ++FN    ++ I +  +  +  ++        +    L   L  +LG++         D E   L+    + ++ +NF+E+D+ R  L
  S:     3 IRIYNDLTRKKEDFVPLEPGKVRFYNCGPTVYDYFHIGNARNFVVFDTVRRYLEYRGYQVTFVQNFTDIDDRMIKRARERGITVSELAEEMIQAYFADAGALGVRPADVH-PRATALIDEQIAMIQQLIDKGHAYVVEGGDVYFRVTTSPDYGKLSHKNLEELVAGASERVDPDDRKEHPFDFALWKGQKPGEPAWPAPWGPGRPGWHIECSAMARKYLGDTIDIHAGGEDLTFPHHENEIAQSEAVTGKPFARYWMHNAHLMIDGAKMSKSVGNFFTVRDILKRYDGEVVRMFLLSAHYRTQLSFSDQLMEDTRRALER-LYNTVANLEHLAKTAPRAEMTAE-EQAVLAELSQARERFVAAMDDDFNTAEGLAVIFDLSRELNSRVKPGASAAFAEGGLALLRELAGVLGLLERKAQPQELDAEIEALIAARQEARKARNFAEADRIRDQL 452
>gi|158521678|ref|YP_001529548.1| cysteinyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] >gi|158510504|gb|ABW67471.1| cysteinyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] (479 aa)
Score = 670, Expect = 3.3e-68, Identities = 123/316 (38%), Positives = 194/316 (61%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ ++ K +  V ++   + MYVCGPTVY   HIG+ R ++ FDV+ R     GY+VT++ N TD+DDKI+++A EE     +++  Y  +++  +  + +  + ++ P+ ++HI DI   IQ +VN   AY   GDV+F       YGK+S +KLD++  G + E + +K NP DF LWK    G  +W+  +  GRPGWH EC+ + ++YLG   DIHGGG DL FPHHENE  Q+ A   ++ AR W+H G + IN +KMSKSL+NF +  ++L  Y+  TVR F   + Y +P++F+  ++  +   L+ +
  S:     3 LSIYNVLTGKKELFVPVNPGKVGMYVCGPTVYGPCHIGHARSVVVFDVIARYLRVAGYDVTYVRNFTDVDDKIIHRAAEEGKTSEQIAEKYIAEFYRDMDALFVQRATVE-PKATEHIDDILAVIQILVNKGVAYEAGGDVFFSVEAFPGYGKLSGRKLDQMEAGARIEVDKRKRNPFDFVLWKAEKPGEPSWESPWGRGRPGWHIECTAMSSRYLGQTFDIHGGGKDLIFPHHENEIAQSEAAFGREFARFWVHNGFVQINQEKMSKSLNNFKMINEILEAYHPETVRLFLLSSHYRSPIDFSDTSMAEAGAGLDKL 319
>gi|77745319|gb|ABB02560.1| cysteinyl-tRNA synthetase [Lactobacillus reuteri] (470 aa)
Score = 670, Expect = 3.4e-68, Identities = 161/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNL-KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL--------EFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFE--ELNKLHFNLSYLLTKILGI---IHVNLFDDEAI-ELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +E   L    + MYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TD+DDK++  A E+ I   +L+  Y   + +    INI  + +  PR +++I +I  ++Q +V   +AY  DGDVY+ + K N YG++S + LD+L VG     S D + KK +P DFALWK    G ++WD  +  GRPGWH ECS +  KYLG  IDIH GG DL+FPHHENE  Q+ A   +   R WMH G + I  +N+KMSKSL NFI   +++ E +   +R+F   T Y  P+ ++  NL +++N L +I      F +    EQ  +E ++        +F    +  + ++ N+ N ++ + E +KY+++     N     +  +   L  L++ I G+      N  +DE I +L+ + N  ++ K+F+ SD+ R  L ++ ++
  S:     2 LTIYNTLTRKKEEFKPLHPGVVNMYVCGPTVYNYIHIGNARSAIAFDTVRRYLEFKGYKVNYVSNFTDVDDKMIKAAAEQGITVPQLAEKYINAFMEDTAAINIEPATLH-PRATENITEIIKFVQGLVEKGYAYPKDGDVYYRSRKFNHYGQLSGQSLDDLEVGASEHVSADEVNKKEDPLDFALWKAAKPGEISWDSPWGKGRPGWHIECSVMSTKYLGKTIDIHAGGQDLEFPHHENEIAQSEAETGQKFVRYWMHNGFVTIGKDNEKMSKSLHNFITVHEIIKEVDPQVLRFFMATTQYRRPIQYSQANLTDAQNNLNHIQI---AFDNLTYREQDADEGDVQEVTDRLEQFHHQFITAMDDDINVQNGIATVYELVKYANVYAHQDNVSLGAIQAIKKELVELMS-IFGVKLEASDNQINDEKIKQLIEERNIARKNKDFARSDEIRHNLKKQGII 457
>gi|154684612|ref|YP_001419773.1| cysteinyl-tRNA synthetase [Bacillus amyloliquefaciens FZB42] >gi|187629789|sp|A7Z0L6|SYC_BACA2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|154350463|gb|ABS72542.1| CysS [Bacillus amyloliquefaciens FZB42] (466 aa)
Score = 670, Expect = 3.6e-68, Identities = 155/431 (35%), Positives = 253/431 (58%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLN---IFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNF-EELNKLHFNLSYLLTKILGII--HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           K +  V L++  +KMYVCGPTVYN++HIGN RP I +D +       GY+V ++ N TD+DDK++  A E       +S  +   YF+ +  +    +++  PRV +++  I  ++ +++   +AY  +GDVYF T     YGK+S + +DEL  G +     KK +  DFALWK    G ++WD  +  GRPGWH ECS ++ KYLGD+IDIH GG DL FPHHENE  Q+ A+  K  A+ W+H G++NI+N+KMSKSL NF+L  D++ +Y+   +R+F     Y +P+N++ E L  +K   N+L+    NLN   I  ++L    +     +E  ++   E + ++FN  N +S   +  K ++  ++  N  + + K   ++   +  +LG+      L D+E  EL+ K N+ ++ ++F+ SD+ R  L    ++
  S:    12 KKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTVSERFIKAYFEDVGALGCRKADLH-PRVMENMDAIIEFVSELIKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDELRSGARIRVGEKKEDALDFALWKAAKDGEISWDSPWGKGRPGWHIECSAMVKKYLGDEIDIHAGGQDLTFPHHENEIAQSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDIIKQYDPQLLRFFMLSVHYRHPINYSEELLEKTKNAFNRLKTAYSNLNHRLISSTNLTDNDEEWLAKIEEHRTAFEEAMDDDFNTANAISVWFDLAKVANYYMQEDNTADHVIKAFISMFDRIGSVLGLTLGEEELVDEEIEELIEKRNEARRNRDFALSDQIRDQLKSMNII 452
>gi|14590527|ref|NP_142595.1| cysteinyl-tRNA synthetase [Pyrococcus horikoshii OT3] >gi|6831682|sp|O58370|SYC_PYRHO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|3257043|dbj|BAA29726.1| 476aa long hypothetical cysteinyl-tRNA synthetase [Pyrococcus horikoshii OT3] (476 aa)
Score = 670, Expect = 3.6e-68, Identities = 132/339 (38%), Positives = 210/339 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNIFKSHLIIEQKYNEKNLE 339
           ++IY+ ++K  +E   +++  ++MYVCGPTVY++ H+G+ R  I FDV+ R     GY+V  + N TDIDDKI+ +AKE      +L+  +   + + +K + +  +++ +PRV++HI+DI  +I+++    +AY     VYF+  K  +YGK+S  KL+EL  G + E    K NP+DFALWK+   G   W+  +  GRPGWH ECS + +KYLG+  DIHGGG DL FPHHENE  Q+ A    +    W+H G + +  +KMSKSL NF+  ++LL  Y+   +R+F  Q  Y +PL+++ E L ++KN LE   N + N+ I   +  +   ++E + +
  S:     3 LRIYNTLTKQKEEFKPINEGEVRMYVCGPTVYDYPHLGHARTYIAFDVIRRYLEHKGYSVLMVMNFTDIDDKIIRRAKETGEDPAKLAEKFIKVFLEDMKALKVKPADI-YPRVTEHIEDIIQFIERLKEKGYAYEGSDGVYFEVQKFKEYGKLSGVKLEELRKGARVEPGEGKKNPEDFALWKKAKPGEPKWESPWGEGRPGWHIECSVMSSKYLGESFDIHGGGNDLIFPHHENEIAQSEACFGHEWVHYWLHTGFVMVKGEKMSKSLGNFVTVRELLQRYSPEVIRFFVLQKHYRSPLDYSEEGLQHAKNNLERLYNTLENIRIAMENAELAYTWDENDFK 345
>gi|76799247|ref|ZP_00781419.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae 18RS21] >gi|76585400|gb|EAO61986.1| cysteinyl-tRNA synthetase [Streptococcus agalactiae 18RS21] (320 aa)
Score = 670, Expect = 4.0e-68, Identities = 129/313 (41%), Positives = 198/313 (63%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE---DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL 313
           +KIYD ++++ ++ + L++  + MYVCGPTVYN++HIGN R ++ FD + R F   GY V +I N TD+DDKI+  A E  +     S  + + + + +  + +  +  K PRV D++ +I ++++ +V+ +FAY  +GDVYF  +KS+ Y K++NK L++L +G       +   K NP DFALWK    G ++W+  +  GRPGWH ECS +  + LGD IDIHGGG DL+FPHH NE  Q+ A   K  A  WMH G +N++N+KMSKSL NFI   D+L   +   +R+F     Y  P+NFT + + +++  L
  S:     2 IKIYDTMTRSLQDFIPLNEGKVNMYVCGPTVYNYIHIGNARSVVAFDTIRRYFEYCGYQVNYISNFTDVDDKIIKGAAEAGMDTKSFSDKFISAFMEDVAALGVKPAT-KNPRVIDYMDEIIDFVKVLVDKEFAYEANGDVYFRVSKSHHYAKLANKTLEDLEIGASGRVDGEGEIKENPLDFALWKSAKSGEVSWESPWGKGRPGWHIECSVMATEILGDTIDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVNVDNEKMSKSLGNFITVHDMLKSVDGQVIRFFLATQQYRKPVNFTEKAVHDAEVNL 318
>gi|28377486|ref|NP_784378.1| cysteine--tRNA ligase [Lactobacillus plantarum WCFS1] >gi|38258341|sp|Q88YX9|SYC_LACPL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|28270318|emb|CAD63219.1| cysteine--tRNA ligase [Lactobacillus plantarum WCFS1] (470 aa)
Score = 669, Expect = 4.8e-68, Identities = 145/410 (35%), Positives = 240/410 (58%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS----EDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTN-------NFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL-LTKILGII----HVNLFDDEAIELLNKWNKLKQEKNFSESDKYR 430
           +KMYVCGPTVYN++HIGN R  I FD + R F   GY+V ++ N TD+DDK++ +A E++     ++  +   + +    +NI  + +  PR S++I +I  ++Q ++   +AY   GDVY+   K  +YG++S++++D+L VG       E+  +K +P DFALWK    G ++W+  +  GRPGWH ECS +  KYLGD  DIHGGG DL+FPHHENE  Q+ A   K  A  W+H G + +  +N+KMSKSL NF+   D++   +   +R+F   T Y  P+ +T  NL    N+ ++L N   NL  F+    ++   N  +    +     +TN       +FN+ N V+ + E  K +++       ++   +    + + LT + G+     +  L DD    L+++    ++ K+F+++D+ R
  S:    23 VKMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYCGYHVDYVSNFTDVDDKLIKRAAEDHTTVPAVADRFIKAFMEDTTAVNIEPATVH-PRASENIPEIIAFVQALIEKGYAYESAGDVYYRARKFKKYGQLSDQRIDDLEVGASQHTADEETDRKEDPIDFALWKAAKPGEISWESPWGAGRPGWHIECSVMSTKYLGDTFDIHGGGQDLEFPHHENEIAQSEAKTGKTFANYWLHNGFVTVGDDNEKMSKSLGNFVTVHDIIKTVDPQVLRFFMATTQYRRPIQYTQANLDEAANNLDKLRNAYRNLT-FR----LQDATNGTDTAVAEQLQTLITNFGTAMDDDFNVQNGVAAVYELAKLANVYAAKATVQKETLIALQKALVQLTGVFGVTFETANATLADDAIQALIDEREAARKAKDFAKADQIR 448
>gi|118578479|ref|YP_899729.1| cysteinyl-tRNA synthetase [Pelobacter propionicus DSM 2379] >gi|171704442|sp|A1AK01|SYC_PELPD Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|118501189|gb|ABK97671.1| cysteinyl-tRNA synthetase [Pelobacter propionicus DSM 2379] (493 aa)
Score = 668, Expect = 5.7e-68, Identities = 127/316 (40%), Positives = 192/316 (60%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ ++ + D  V L      MYVCG TVY++ HIG+ R  + FDV+ R     GY VT++ N TDIDDKI+N+A +E +    +S  Y   +   +  + +    ++ P+ +DH+  I + I+ ++    AY  DGDVY+       Y ++S + L+++L G + E + +K NP DFALWK +  G  +WD  +  GRPGWH ECS +  +YLG   DIHGGG DL FPHHENE  Q+ A N     R WMH G +NIN++KMSKSL NF   +++L +Y+  T+R+F     Y +P++F+ +NL +++  LE I
  S:     3 LRIYNTLTGEKDTFVPLHPGKAGMYVCGVTVYDYCHIGHARANVVFDVIYRYLGYSGYAVTYVRNFTDIDDKIINRANQEGVDYTTISERYIEAFNQDMARLGLAKPTVE-PKATDHMGGIISVIETLIAKGHAYESDGDVYYAVESFPSYLRLSGRNLEDMLAGARVEVDDRKRNPMDFALWKGSKPGEPSWDSPWGAGRPGWHIECSAMSMEYLGKTFDIHGGGKDLVFPHHENEIAQSEAANGCQFVRYWMHNGFVNINSEKMSKSLGNFFTIREVLEQYDPETLRFFILSAHYRSPIDFSDQNLNDAQAGLERI 319
>gi|187605165|ref|ZP_02991366.1| cysteinyl-tRNA synthetase [Exiguobacterium sp. AT1b] >gi|187482734|gb|EDU20737.1| cysteinyl-tRNA synthetase [Exiguobacterium sp. AT1b] (465 aa)
Score = 668, Expect = 6.0e-68, Identities = 160/438 (36%), Positives = 252/438 (57%)
  Q:     1 MKIYD-FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKN-------QLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL--LTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKL 438
           +++Y+   +K +  V +    + MYVCGPTVYN++H+GN RP I FD + R     GY V ++ N TD+DDKI+  A E       L++ Y   Y      +N+  +++  PRV+D +++I  +I+++    FAY  +GDVYF T K   YGK+S + +++L  G + +   KK +P DF LWK       +WD  +  GRPGWH ECS +  K+LG  IDIH GG DLKFPHHENE  Q+ A N+   A  W+H G +NI N+KMSKSL NF+L  + L E +   +R+F     Y +P+N++ E +  + N         +NI Y L++  + L    +  E+ LE  K++ IE + ++ N  N V+ + +  + ++I  +  +  +   L   LS    LT +LG+       L D E  +L+ + N  +  +NF+ +D+ R LL E+ +
  S:     2 IQLYNSLTNKKEPFVPIVPGKVSMYVCGPTVYNYIHVGNARPAIAFDTVRRYLTYRGYEVKYVLNFTDVDDKIIRTANELGEDTETLTNRYIEAYLADTGALNVQPADVH-PRVTDTMEEIIEFIRQLETEGFAYESEGDVYFRTKKFETYGKLSQQSIEDLRAGSRVDVGEKKEDPLDFVLWKAAKPDEPSWDSPWGKGRPGWHIECSAMAKKHLGTTIDIHAGGHDLKFPHHENEIAQSEACNHAKFANYWLHNGFINIENEKMSKSLGNFLLVHEALKEVDPMVLRFFMLSVHYRHPINYSRELIEQAANGWSRIKEAYQNIEYRLSV-TAGLGEASESMERKLESIKASFIESMDDDINTANAVTVLFDLAREANIYAKADHVAKAT-LEQVLSLFDELTGVLGLTLAEEKELLDAEIDQLIQERNDARAARNFARADEIRDLLKEQNI 451
>gi|18977396|ref|NP_578753.1| cysteinyl-tRNA synthetase [Pyrococcus furiosus DSM 3638] >gi|18893083|gb|AAL81148.1| cysteinyl-tRNA synthetase [Pyrococcus furiosus DSM 3638] (483 aa)
Score = 667, Expect = 7.8e-68, Identities = 138/346 (39%), Positives = 205/346 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL-NIFKSHLIIEQKYNEKNLEFDKSNLI 346
           +K+Y+ ++K  +E   L +  +KMYVCGPTVY++ H+G+ R  I FDV+ R     GY V  + N TDIDDKI+ +A+E      EL+  +   + + ++ + +  +++ +PRV+DHI DI  +I K+    +AY     +YF+  K  +YGK+S  K+++L  G + E    K NP+DFALWK+   G   WD  +  GRPGWH ECS + +KYLG+  DIHGGG DL FPHHENE  Q+ A    +  + W+H G + +  +KMSKSL NF+  ++LL  Y    +R+F  Q  Y +PL +T E L ++KN L+ +   L NI  +    E  Y    LEF    +I
  S:     8 LKVYNTLTKQKEEFKPLREGEVKMYVCGPTVYDYPHLGHARTYIAFDVIRRYLEHKGYTVLMVMNFTDIDDKIIKRARETGEDPKELAERFIKIFLEDMEALKVKPADI-YPRVTDHIDDIIEFIGKLKEKGYAYEGSDGIYFEVKKFPEYGKLSGVKIEDLQKGARVEPGEGKKNPEDFALWKKAKPGEPKWDSPWGEGRPGWHIECSVMSSKYLGESFDIHGGGNDLIFPHHENEIAQSEACFGHEWVKYWLHTGFVMVKGEKMSKSLGNFVTIRELLKRYEPEVIRFFVLQKHYRSPLEYTEEGLQHAKNNLQRLYNTLENIRVALRNAEISYTWGELEFKTYEII 355
>gi|30316338|sp|Q8U227|SYC_PYRFU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (477 aa)
Score = 667, Expect = 9.3e-68, Identities = 138/346 (39%), Positives = 205/346 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL-NIFKSHLIIEQKYNEKNLEFDKSNLI 346
           +K+Y+ ++K  +E   L +  +KMYVCGPTVY++ H+G+ R  I FDV+ R     GY V  + N TDIDDKI+ +A+E      EL+  +   + + ++ + +  +++ +PRV+DHI DI  +I K+    +AY     +YF+  K  +YGK+S  K+++L  G + E    K NP+DFALWK+   G   WD  +  GRPGWH ECS + +KYLG+  DIHGGG DL FPHHENE  Q+ A    +  + W+H G + +  +KMSKSL NF+  ++LL  Y    +R+F  Q  Y +PL +T E L ++KN L+ +   L NI  +    E  Y    LEF    +I
  S:     2 LKVYNTLTKQKEEFKPLREGEVKMYVCGPTVYDYPHLGHARTYIAFDVIRRYLEHKGYTVLMVMNFTDIDDKIIKRARETGEDPKELAERFIKIFLEDMEALKVKPADI-YPRVTDHIDDIIEFIGKLKEKGYAYEGSDGIYFEVKKFPEYGKLSGVKIEDLQKGARVEPGEGKKNPEDFALWKKAKPGEPKWDSPWGEGRPGWHIECSVMSSKYLGESFDIHGGGNDLIFPHHENEIAQSEACFGHEWVKYWLHTGFVMVKGEKMSKSLGNFVTIRELLKRYEPEVIRFFVLQKHYRSPLEYTEEGLQHAKNNLQRLYNTLENIRVALRNAEISYTWGELEFKTYEII 349
>gi|170079458|ref|YP_001736096.1| cysteinyl-tRNA synthetase [Synechococcus sp. PCC 7002] >gi|169887127|gb|ACB00841.1| cysteinyl-tRNA synthetase [Synechococcus sp. PCC 7002] (472 aa)
Score = 666, Expect = 1.1e-67, Identities = 153/424 (36%), Positives = 234/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG-----DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFN--LPNIVSFIEEKIKYSSILLRNKNFEE----LNKLHFNLSYLLTKILGII------HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           L+   ++MY CG TVY++ H+G+ R  + +DV+ R     GY V +I N TDIDDKI+N+A+ E      ++  +   YF+ ++ ++I  ++ ++PR +  +  I+  I  +    FAY   GDVY+   K + YGK+S +KLD++  G     ++  D  KK++P DFALWK    G   WD  +  GRPGWH ECS ++   LG+ IDIH GG DL FPHHENE  Q+ A   + LA+ W+H G + +  +KMSKSL NFI  ++LL +Y+   VR F  Q  Y+ PL+FT E L  +    E +   L     HL       +K +      +++   NF+  L  +    +E  K  +IL+     ++    L  L   L   L  ILG +         L D E  +L+ +    +  KN++E D+ R LL EK ++
  S:    19 LEANLVRMYCCGITVYDYCHLGHARTCLIWDVVRRYLQWSGYEVHYIQNFTDIDDKILNRARAEKSSMGAIAEKFIEAYFEDMEALHIQPAD-EYPRATHSLDGIQKLIHDLEQRGFAYASQGDVYYAVRKFDGYGKLSGRKLDDMQAGASGRVNEDPDAPKKHDPFDFALWKAAKAGEPAWDSPWGAGRPGWHIECSAMVRDRLGETIDIHVGGSDLIFPHHENEIAQSEAATGQPLAKYWLHNGMVKVEGEKMSKSLGNFITIRELLKKYDPMAVRLFILQAHYTKPLDFTDEALTAATKGWETLNDALLFGAEHLDTNNITADKGILAKFKAIVDNDLNFSGGLAILFELAKELKKEKNILVHEGKLQQNPQILASLWLTLKE-LADILGFVPETKQQAAGLTDAEIEDLIQQRKDARANKNYAEGDRLRDLLAEKGIV 458
>gi|42523767|ref|NP_969147.1| hypothetical protein Bd2317 [Bdellovibrio bacteriovorus HD100] >gi|61216207|sp|Q6MKR7|SYC_BDEBA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|39575974|emb|CAE80140.1| cysS [Bdellovibrio bacteriovorus HD100] (482 aa)
Score = 666, Expect = 1.2e-67, Identities = 131/330 (39%), Positives = 188/330 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIE 330
           +KI++  SK  ++ + L    +KMYVCGPTVYN +H+GN R  + F+++      LGY VT+  N TD+DDKI+N+A E  +   ELS  Y  +Y     ++ +   +M  P+V++H+ DI + ++ +V+ K AY   GDV +       YGK+S +  D+LL G + E + KK NP DFALWK    G ++W   +  GRPGWH ECS +I    GDQIDIHGGG+DL FPHHENE  Q+     K   + WMH   LN   QKMSKSL N +  ++ L  YN    +W      Y    +F  E +  +   L  +   L++ +S+L  E
  S:     2 LKIHNSQSKQLEDFTPLTPGQVKMYVCGPTVYNFLHVGNFRGPVVFNMVRNWLEHLGYKVTYALNFTDVDDKIINRANELGMSPTELSEKYIAEYKKDFASLGLRPHDMN-PKVTEHMDDIRSMVESLVSQKKAYEAQGDVLYSIESFKDYGKLSGRNTDDLLAGARVEVDEKKRNPMDFALWKAAKPGEVSWPSPWGPGRPGWHIECSAMIKNLFGDQIDIHGGGMDLIFPHHENEIAQSEGCTGKAFVKYWMHNNMLNFGGQKMSKSLGNIVTMREFLEMYNAEIYKWMILSAHYRTLSDFGDEAVERAVGGLSRVYSALSMAESYLTPE 332
>gi|160933144|ref|ZP_02080533.1| hypothetical protein CLOLEP_01987 [Clostridium leptum DSM 753] >gi|156868218|gb|EDO61590.1| hypothetical protein CLOLEP_01987 [Clostridium leptum DSM 753] (470 aa)
Score = 665, Expect = 1.3e-67, Identities = 157/439 (35%), Positives = 248/439 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTT----------ENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIK--YSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-----NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MKI++ +++  +E V +     K+Y CGPTVYN +HIGN RP+  FD+L R     G  VTF+ N TDIDDKI+ KA EE    L ++  Y  +Y    + +NI  + +  PR ++ ++ I   I  +V   +AY  + GDVYF T K + YGK+S++ L+EL  G +      K +P DFALWK    G   WD  +  GRPGWH ECS +   YLGD IDIH GG DL FPHHENE  Q+   N    A  WMH G++N++N+KMSKSL+NF   +++  E+    +R+    + Y +P+N++           E L   +  LE ++ N    +     E K   K LE  ++   E + ++ N  + ++ + E  K   +++       +E+ +    L   L  +LG+++V     +  D+E   L+ +  + ++ KN++E+D+ R  L  + ++
  S:     1 MKIFNTLTRQKEEFVPIAPGEAKIYACGPTVYNFIHIGNARPMCVFDILRRYLEYRGMKVTFVQNFTDIDDKIIRKANEEKTDYLTVAERYIQEYKTDARGLNIREATVH-PRATETMEQIIEIISDLVKKGYAYPAENGDVYFRTLKFSGYGKLSHQPLEELEAGARIGVGESKEDPMDFALWKAAKPGEPYWDSPWGKGRPGWHIECSAMARTYLGDTIDIHCGGQDLIFPHHENEIAQSECCNGVPFAHYWMHNGYINVDNRKMSKSLNNFFTVREVAKEFGYEPIRYLMVASHYRSPINYSVDLLKQCTAALERLYTCRENLEFVVSNAKPGREARDEEIK---KRLEEYQNRFCEAMDDDLNTADAIAVLFELAKDINTNLSTATNPHKEIAEEALTLFNSLADVLGLLYVKKDTKDSLDEEIENLIQRRVEARKNKNWAEADRIRDELSARHVV 456
>gi|157329892|emb|CAO42791.1| unnamed protein product [Vitis vinifera] (513 aa)
Score = 665, Expect = 1.3e-67, Identities = 131/306 (42%), Positives = 188/306 (61%)
  Q:     1 MKIYDFVSKTDKEV---SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL 306
           +++Y+ +++  KE+    +D K + MYVCG T Y+  H+G+ R  + FDVL R    LGY VT++ N TD+DDKI+ +A E     L LSS +  +Y D +  +   T   + PRVSDH+  I++ I +I+NN  AY++DGDVYF   KS  YG++S +KL++   G++   + +K NP DFALWK       +WD  +  GRPGWH ECS +   YL  + DIHGGGIDL FPHHENE  Q+ A   +     WMH GH+  NN+KMSKSL NF   + +   Y+   +R+F   T Y +P+N++   L
  S:     7 LRVYNTMTQ-QKEIFKPVVDGK-VSMYVCGVTAYDLSHLGHARAAVCFDVLYRYLQHLGYEVTYVRNFTDVDDKIIRRANELGENPLTLSSRFCQEYLDDMTDLQCLTPTQQ-PRVSDHMDQIKDMITQIINNDCAYIIDGDVYFAVDKSPNYGRLSGRKLEDNRAGERVAVDSRKRNPADFALWKAAKPDEPSWDSPWGPGRPGWHIECSAMSAHYLTFKFDIHGGGIDLIFPHHENEIAQSCAACQESNVSYWMHNGHVTNNNEKMSKSLGNFFTIRQITDLYHPLALRYFLLGTHYRSPVNYSIAQL 313
>gi|77459860|ref|YP_349367.1| cysteinyl-tRNA synthetase [Pseudomonas fluorescens PfO-1] >gi|109894924|sp|Q3KA28|SYC_PSEPF Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|77383863|gb|ABA75376.1| cysteinyl-tRNA synthetase [Pseudomonas fluorescens PfO-1] (460 aa)
Score = 665, Expect = 1.5e-67, Identities = 132/320 (41%), Positives = 202/320 (63%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           + IY+ ++K+ KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R     GY++T++ NITDIDDKI+N+A E     E + E  +++ +E +       +NI   +M+ PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ +NL ++K  LE   + L
  S:     2 LTIYNTLTKS-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRFSGYDLTYVRNITDIDDKIINRANENGESFEALTERMIAAMHEDE-----ARLNIKKPDME-PRATDHIPGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFMGYGKLSRKKIEDLRIGARIEVDEAKEDPLDFVLWKGVKPGEPSWESPWGAGRPGWHIECSVMSTCCLGETFDIHGGGSDLEFPHHENEIAQSEAATGKTYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLDKYHPEVVRYLLVSSHYRSAINYSEDNLKDAKGALERFYHAL 323
>gi|110599237|ref|ZP_01387477.1| cysteinyl-tRNA synthetase [Geobacter sp. FRC-32] >gi|110549992|gb|EAT63178.1| cysteinyl-tRNA synthetase [Geobacter sp. FRC-32] (494 aa)
Score = 665, Expect = 1.5e-67, Identities = 126/316 (39%), Positives = 194/316 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +++Y+ +S   +E V ++   +KMYVCG TVY+H HIG+ R  + FDV+ R F  LG +VT++ N TDIDDKI+N+A  E +    +S  +  ++   ++ + +     + P+ ++HI +I + +Q +++  FAY   GDV F   K + Y K+S + L+++  G + E + +K +P DFALWK+   G   W+  +  GRPGWH ECS +  KYLG   DIHGGG DL FPHHENE  Q+ A   K     W+H G +NIN++KMSKSL NF   K++L  Y+   +R+F     Y +P++F+ +NL  ++  LE I
  S:     3 LRVYNTLSGNKEEFVPVEPGKVKMYVCGVTVYDHCHIGHARANVVFDVIYRYFCHLGLDVTYVRNYTDIDDKIINRANREGVTYDLISERFIKEFDRDMERLGLKLPTCQ-PKATEHIDEIISLVQTLIDKDFAYQAGGDVNFCVEKFDSYLKLSGRTLEDMQAGARIEVDERKRHPMDFALWKEAKPGEPFWESPWGKGRPGWHIECSAMSMKYLGTTFDIHGGGKDLIFPHHENEIAQSEAATGKPFVNYWLHNGFVNINSEKMSKSLGNFFTIKEVLDRYDNEVLRFFLLSAHYRSPIDFSDQNLTEAEAGLERI 319
>gi|19704900|ref|NP_602395.1| cysteinyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22257049|sp|Q8RIK9|SYC_FUSNN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|19712793|gb|AAL93694.1| Cysteinyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (473 aa)
Score = 665, Expect = 1.5e-67, Identities = 165/435 (37%), Positives = 253/435 (58%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTK-SNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL---------NIFKSHLIIEQKYNEKNLEFDKSNLIELTN-NFNLPNIVSFIEEKIKYSSILL-----RNKNFEELNKLHFNLSYLLTKILGI-----IHVNLFDDEAIELLNKWNK-LKQEKNFSESDKYRKLLME 435
           +KIY+ ++   D+   L +  + MYVCGPTVYN++HIGN RP I FD + R     GY V ++ N TD+DDK++NKA  EN+   E++  Y   YF+    IN+    M  P+ +++I ++   IQ +V+  +AY  +GDVYF+  K  + YG++S + +++L  G + + N  K +  DFALWK +     +WD  +  GRPGWH ECS +  KYLGD  DIHGGG+DL FPHHENE  Q+        A+ WMH G++NIN +KMSKS  +F+L +D+L  +    +R F   + Y  P+ F+   L  +K+ LE I   L         NI       E    +K +E   +  IE  N +FN    +  I E +K  +  L       K  E +++++  L  ++  +LG+     + VN    + IEL+ +  +  ++EKN++ SDK R  L+E
  S:     2 IKIYNTLTGHLDEFKPLKENEVSMYVCGPTVYNYIHIGNARPAIFFDTVRRYLEYRGYKVNYVQNFTDVDDKMINKANIENVSIKEIAERYIKAYFEDTSKINLKEEGMIRPKATENINEMIEIIQSLVDKGYAYESNGDVYFEVKKYRDGYGELSKQNIEDLESGARIDVNEIKRDALDFALWKASKPNEPSWDSPWGKGRPGWHIECSAMSRKYLGDSFDIHGGGLDLIFPHHENEMAQSKCGCGGTFAKYWMHNGYININGEKMSKSSGSFVLLRDILKYFEGRVIRLFVLGSHYRKPMEFSDTELNQTKSSLERIENTLKRIKELDRENIKGIDDCQELLATKKEME---AKFIEAMNEDFNTAQALGHIFELVKAVNKTLDEANISKKGLEVIDEVYSYLVMIIQDVLGVQLKLEVEVNNISADLIELILELRRNAREEKNWALSDKIRDRLLE 457
>gi|6599476|gb|AAF18750.1|AF163997_1 cysteinyl-tRNA synthetase [Methanococcus maripaludis] (476 aa)
Score = 665, Expect = 1.5e-67, Identities = 135/322 (41%), Positives = 209/322 (64%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE---NIIYNLNI 322
           +K+Y+ +++ ++E  +L+K  +KMYVCGP VY+  H+G+ R  ++ D++ R    +GY V  + N TDIDDKI+ +A E+     E+S  +   + D + T+ +  +++ +P+V++HI +I  +I++++   FAY  +  VYF+  K   YGK+SN  L++L+ G + E + KK N +DFALWK    G   W+  F  GRPGWH ECS + +KYLG+Q DIHGGG DL FPHHENE  Q+ A + KD    W+H G + +N +KMSKSL NFI   D+  EY+   +R+FF Q  Y +P+++T E++ + KN LE   N+I N+ I
  S:     2 LKVYNTLTRKEEEFKTLNKNEVKMYVCGPPVYDTTHLGHGRTYVSLDIIRRYLEHIGYTVNLVINFTDIDDKIIKRAYEKGKDPKEISEQFIKVFLDDMATLKVKPADI-YPKVTEHISEIIAFIERLIEKGFAYKTEDGVYFEVKKFKNYGKLSNINLEDLVSGARVETSEKKKNQKDFALWKTAKPGEPKWESPFGKGRPGWHIECSAMSSKYLGEQFDIHGGGRDLSFPHHENEIAQSSAYSGKDWVNYWIHTGFVMVNGEKMSKSLGNFITIGDISKEYSPEILRFFFIQRHYRSPIDYTAESMNHVKNNLEKIYNVIENIRI 327
>gi|70731271|ref|YP_261012.1| cysteinyl-tRNA synthetase [Pseudomonas fluorescens Pf-5] >gi|109894922|sp|Q4K9S1|SYC_PSEF5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|68345570|gb|AAY93176.1| cysteinyl-tRNA synthetase [Pseudomonas fluorescens Pf-5] (460 aa)
Score = 664, Expect = 1.8e-67, Identities = 132/320 (41%), Positives = 201/320 (62%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           + IY+ ++K+ KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R     GY++T++ NITDIDDKI+N+A E     E + E  +++ +E +       +NI   +M+ PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W   +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ +NL ++K  LE   + L
  S:     2 LTIYNTLTKS-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLITRWLRFSGYDLTYVRNITDIDDKIINRANENGEAFEALTERMIAAMHEDE-----ARLNIKKPDME-PRATDHIPGMHTMIQTLIDKGYAYAPGNGDVYYRVGKFMGYGKLSRKKIEDLRIGARIEVDESKQDPLDFVLWKAAKPGEPSWPSPWGDGRPGWHIECSVMSTCCLGETFDIHGGGSDLEFPHHENEIAQSEAATGKTYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLDKYHPEVVRYLLVASHYRSAINYSEDNLKDAKGALERFYHAL 323
>gi|163724364|ref|ZP_02131894.1| cysteinyl-tRNA synthetase [Desulfatibacillum alkenivorans AK-01] >gi|161402203|gb|EDQ26441.1| cysteinyl-tRNA synthetase [Desulfatibacillum alkenivorans AK-01] (474 aa)
Score = 663, Expect = 2.1e-67, Identities = 122/301 (40%), Positives = 184/301 (61%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           L   ++ MYVCGPTVY+  HIG+ R  + FD++ R   E GY VT++ N TD+DDKI+N+A E ++    LS  Y  ++   +  + +    ++ PR ++ IK+I     K+V    AY+VDGDVYFD      YGK+S +KL+++  G + + + +K +P DFALWK    G   W+  +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A   +   R WMH G +NI+++KMSKSL+NF+  K++L +++   VR F     Y +P++FT + +  + + L+ +
  S:    19 LKPGHVSMYVCGPTVYDSSHIGHARSAVVFDIVFRYLQESGYEVTYVRNFTDVDDKIINRANERDMDCQALSEIYIDEFHRDMDALAVLRPTLE-PRATEFIKEIIEVTSKLVEKGHAYVVDGDVYFDVRSFESYGKLSGRKLEDMEAGARVKVDSRKKDPFDFALWKAKKPGEPAWESPWGEGRPGWHIECSAMSWSRLGETFDIHGGGQDLIFPHHENEVAQSEAAFGQQFVRYWMHNGFVNIDSEKMSKSLNNFLTVKEILDQFHPEAVRLFLLSKHYRSPVDFTEQAMKEAASGLDRV 319
>gi|104781222|ref|YP_607720.1| cysteinyl-tRNA synthetase [Pseudomonas entomophila L48] >gi|123079208|sp|Q1IBP9|SYC_PSEE4 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|95110209|emb|CAK14916.1| cysteinyl-tRNA synthetase [Pseudomonas entomophila L48] (460 aa)
Score = 663, Expect = 2.3e-67, Identities = 151/430 (35%), Positives = 243/430 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL-----------FDDEAIE-LLNKWNKLKQEKNFSESDKYR 430
           + IY+ +SKT +    LD  N++MYVCG TVY++ H+G+ R ++ FD++ R   + GY +T++ NITDIDDKI+N+A E       L++       +  + ++I   +++ PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E    K +P DF LWK    G   WD  +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L +SK  LE   + L        +  K  E    F +   + + ++F  P   + + + ++  +  LR  + E    L   L   L  +LG++ ++             D   +E L+    + + +KN++ESD+ R
  S:     2 LTIYNTLSKTKETFKPLDGNNVRMYVCGMTVYDYCHLGHGRSMVAFDLITRWLRKSGYALTYVRNITDIDDKIINRANENGESFDALTARMIDAMHEDERRLSILKPDLE-PRATDHIPGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFAGYGKLSRKKIEDLRIGARIEVGESKQDPLDFVLWKGAKPGEPFWDSPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIAQSEAATGKPYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLDKYHPEVVRYLLVASHYRSAINYSEDSLRDSKGALERFYHALRGLPR---VAAKGGEA---FVERFTVAMNDDFGTPEACAVLFDLVREIN-RLRESDVEAAAGLAGRLRE-LGDVLGVLQLDADEFLRAGAEGKVDAAQVEALIQARLQARADKNWAESDRIR 437
>gi|189423475|ref|YP_001950652.1| cysteinyl-tRNA synthetase [Geobacter lovleyi SZ] >gi|189419734|gb|ACD94132.1| cysteinyl-tRNA synthetase [Geobacter lovleyi SZ] (487 aa)
Score = 663, Expect = 2.4e-67, Identities = 123/296 (41%), Positives = 184/296 (62%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNW-DLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + MYVCG TVY+  HIG+ R  I FD++ R     GY+VT+I N TDIDDKI+N+A +E      ++  Y   + + +  + +    ++ P+ +DHI+DI + IQ++++N  AY VDGDVYF       Y K+S + LD++L G + + + +K NP DFALWK +  G  W +  +  GRPGWH ECS +  ++LG   DIHGGG DL FPHHENE  Q+   N     + W+H G +NIN++KMSKSL NF   +++L  ++  T+R+F  Q  Y +PL+++ +NL  ++  L  I
  S:    24 VGMYVCGVTVYDFCHIGHARAGIVFDMIYRYLRFSGYDVTYIRNYTDIDDKIINRANQEGTDYRTIADRYIATFDEDMDRLGMLRPTIE-PKATDHIEDIISIIQRLIDNGHAYAVDGDVYFAVETFPAYLKLSGRNLDDMLAGARVDVDERKRNPMDFALWKGSKPGEPWWESPWGKGRPGWHIECSAMSMRFLGPSFDIHGGGKDLVFPHHENEIAQSEGANGCQFVKYWLHNGFVNINSEKMSKSLGNFFTIREVLELFDPETLRFFILQAHYRSPLDYSDQNLREAQAGLSRI 319
>gi|67922209|ref|ZP_00515723.1| Cysteinyl-tRNA synthetase, class Ia [Crocosphaera watsonii WH 8501] >gi|67855912|gb|EAM51157.1| Cysteinyl-tRNA synthetase, class Ia [Crocosphaera watsonii WH 8501] (482 aa)
Score = 661, Expect = 3.6e-67, Identities = 164/435 (37%), Positives = 252/435 (57%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE------DNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYN-----EKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNF-----------EELNKLHFNLSYLLTKILGI--------IHVNLFDD-EAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+  ++  +  V+L    + MY CG TVY++ H+G+ R  I +D++ R     GY VT++ N TDIDDKI+ +A+E+ +   ++S  +   YF+ ++ +N+  ++ ++PRV+D+I  I+  I+ ++   +AY  DGDVYF      QYGK+S +    +  G           N  K +P DFALWK        WD  +  GRPGWH ECS ++   LG+ IDIHGGG DL FPHHENE  Q+ A N K LA+ W+H G + +N +KMSKSL NF   ++LL+       +R F  Q  Y  PL+FT E + ++ N  + +       +  L+  +KY      EKN E D S +IE     + ++FN P  ++ + E  K    L R  N            E+L +    L + L  ILG+           N FD  E  +L+ + N  ++ K+++ESD+ R+ L E
  S:     3 LKIYNTQTRRLEPFVTLLPGRVTMYCCGVTVYDYCHLGHARSYIIWDMVRRYLKWRGYEVTYVQNFTDIDDKILRRAQEQGVSMADISERFIEAYFEDIRPLNVMDAD-EYPRVTDNISGIQQLIEVLLEKNYAYAADGDVYFHVEAFEQYGKLSGRSQSMMQAGASGRVAVSDPTNSHKKHPSDFALWKSAKPEEPAWDSPWGEGRPGWHIECSAMVRGLLGETIDIHGGGGDLVFPHHENEIAQSEAANGKPLAKYWVHNGMVTVNGEKMSKSLGNFTTIRELLNRPLEPMVIRLFVLQAHYRKPLDFTEEAISSATNGWQTL-------QQGLLFGEKYGNRLGWEKNQELD-SAVIEQFKATVDDDFNSPGGLAVLFELAKN---LRREGNLLTHEGKITTDGEDLQRQWQTLVH-LAGILGLEAKSEVGSEDTNNFDQAEITKLIQQRNAARKVKDYAESDRIREQLQE 463
>gi|148548000|ref|YP_001268102.1| cysteinyl-tRNA synthetase [Pseudomonas putida F1] >gi|187629852|sp|A5W458|SYC_PSEP1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|148512058|gb|ABQ78918.1| cysteinyl-tRNA synthetase [Pseudomonas putida F1] (460 aa)
Score = 661, Expect = 4.0e-67, Identities = 153/433 (35%), Positives = 246/433 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD------------DEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +SKT KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R   + GY +T++ NITDIDDKI+N+A E       L++       +  + +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +  + LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L ++K  LE   + L        +  K  E    F +   + + ++F  P   + + + ++  +  LR+ + E    L   L   L  +LG++ +   D             E   L+    + + +KN++ESD+ R  L
  S:     2 LTIYNTLSKT-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYELTYVRNITDIDDKIINRANENGETFDALTARMIDAMHEDERRLNILPPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKKIEDLRIGARIEVDEAKQDPLDFVLWKGVKPGEPSWESPWGPGRPGWHIECSVMSTRCLGESFDIHGGGSDLEFPHHENEIAQSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVASHYRSAINYSEDSLRDAKGALERFYHALRGLPR---VAAKGGEA---FVERFSVAMNDDFGTPEACAVLFDLVREIN-RLRDSDPEAAAGLAGRLRE-LGDVLGVLQLEADDFLRAGAEGKVDAAEVEGLIQARLQARADKNWAESDRIRDQL 440
>gi|116629010|ref|YP_814182.1| cysteinyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] >gi|122273992|sp|Q045X8|SYC_LACGA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116094592|gb|ABJ59744.1| cysteinyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] (472 aa)
Score = 660, Expect = 5.6e-67, Identities = 159/439 (36%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNE-----KNLEFDKSNLIE-LTNNFNLPNIVSFIEE-KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+++ +++  +E   L    + MYVCGPTVYN++HIGN R +I FD + R F   GY+V ++ N TD+DDK++N+A++E+    EL+  Y   + +  + +NI  + +  PR +  I++I +++Q +++  FAY VDGDVY+   K   YG++S++ + EL  G       E+  KK +P DFALWK  +    + WD  +  GRPGWH ECS +  KYLGD IDIHGGG DL+FPHHENE  Q+ A   K     WMH G + +    +KMSKSL NF+   D+L + +   +R++     Y  P+N++ + L  ++  L+     L    + L+ EQ+  E      NL   K+  IE + ++FN+ N +S + +     ++ L +N+  +   K    L     +I G+         DDE   ++ K ++ ++ KN++ESD+ R  L  K ++
  S:     3 MKVFNTLTRQKEEFKPLVAGKVSMYVCGPTVYNYIHIGNARSVIAFDTIRRYFEYRGYDVKYVSNFTDVDDKMINEARKEHTTVGELADRYIKAFMEDTEALNIEPATLH-PRATHEIQEIIDFVQDLIDKGFAYEVDGDVYYRAKKFPNYGQLSDQNIAELEEGASEHINEEEQSKKEDPIDFALWKAQKDDDEIAWDSPWGKGRPGWHIECSVMSTKYLGDTIDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWMHNGFVTVGKKQEKMSKSLHNFVTVHDILKQIDPQVLRFYMSSVQYRRPINYSEDGLKQAETVLKRYQNTLRNLDARLMDEQETLEDSILRDNLTQAKAEFIEAMDDDFNVQNALSIMYDLTSNLNTHLQKNQVDKPALKKAKKLLLAWLEIFGVSFNEKQTENDDEIEVMVAKRDEARKNKNWAESDRLRDELQAKGIV 459
>gi|26989624|ref|NP_745049.1| cysteinyl-tRNA synthetase [Pseudomonas putida KT2440] >gi|37999406|sp|Q88IU4|SYC_PSEPK Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|24984507|gb|AAN68513.1|AE016483_4 cysteinyl-tRNA synthetase [Pseudomonas putida KT2440] (460 aa)
Score = 659, Expect = 6.3e-67, Identities = 153/433 (35%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD------------DEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +SKT KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R   + GY +T++ NITDIDDKI+N+A E       L++       +  + +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S K++++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L ++K  LE   + L        +  K  E    F +   + + ++F  P   + + + ++  +  LR+ + E    L   L   L  +LG++ +   D             E   L+    K + +KN++ESD+ R  L
  S:     2 LTIYNTLSKT-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYELTYVRNITDIDDKIINRANENGETFDALTARMIDAMHEDERRLNILPPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKRIEDLRIGARIEVDEAKQDPLDFVLWKGVKPGEPSWESPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIAQSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVASHYRSAINYSEDSLRDAKGALERFYHALRGLPR---VAAKGGEA---FVERFSVAMNDDFGTPEACAVLFDLVREIN-RLRDSDVEAAAGLAGRLRE-LGDVLGVLQLEADDFLRAGAEGKVDAAEVEGLIQARLKARADKNWAESDRIRDQL 440
>gi|95929121|ref|ZP_01311866.1| cysteinyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] >gi|95135022|gb|EAT16676.1| cysteinyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] (481 aa)
Score = 658, Expect = 7.9e-67, Identities = 148/419 (35%), Positives = 239/419 (57%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELT--------NNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL------LTKILGII-----------------HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + MYVCG TVY++ HIG+ R  I FD++ R      Y+VT++ N TD+DDKI+N+A E  I   +LS  +   + + +  + +    ++ P+ ++HI  I   +++++ N  AY  DGDVYF     + Y K+S + LDE+  G +     KK NP DFALWK    G  +W+  +  GRPGWH ECS +  +YLG+  DIHGGG DL FPHHENE  Q+ A   +   + W+H G +N+N +KMSKSL NF   +D+L  Y+   VR+F     Y +P++F+ +NL  ++  L      L    + ++ E   +    + + ++  ELT        ++FN    + ++ E I+  + L+  K F +   L  ++  L      L K+LG+                   +++  +E   L+ +  + +Q+K+F+ SD  R  L EK +L
  S:    24 VGMYVCGVTVYDYCHIGHARANIVFDIVYRYLKYSDYDVTYVRNYTDVDDKIINRANERGITSQQLSEEFIQAFDEDMARLGLDLPTVQ-PKATEHIDHIIALVERLIANGKAYASDGDVYFAVESFDSYLKLSKRNLDEMQAGARIAPGEKKRNPMDFALWKAAKPGEPSWESPWGKGRPGWHIECSAMGMEYLGESFDIHGGGKDLVFPHHENEIAQSEAATGQPFVKYWLHNGFVNVNQEKMSKSLGNFFTIRDILKTYDPEVVRFFILSAHYRSPIDFSDQNLKEARLGLSRFYEGLQA-AAEVLAECPPS----DVEATDGAELTAKFREAMDDDFNTAQAIGYLFEGIRTMNRLMATKKFRKKADLVASVRSLYDTFLELGKVLGMFGSEPKAWLNQQRLSALADLDITVEEIDALIAERLQARQDKDFARSDAIRDELAEKGIL 468
>gi|116333230|ref|YP_794757.1| cysteinyl-tRNA synthetase [Lactobacillus brevis ATCC 367] >gi|122270082|sp|Q03SU6|SYC_LACBA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116098577|gb|ABJ63726.1| cysteinyl-tRNA synthetase [Lactobacillus brevis ATCC 367] (470 aa)
Score = 658, Expect = 8.4e-67, Identities = 149/419 (35%), Positives = 240/419 (57%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG----DKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-----ELTNNFNLPNIVSFIEEKIKYSSILL-RNKNFE-ELNKLHFNLSYLLTKILGI---IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + MYVCGPTVYN++HIGN R  I FD + R F   GY V ++ N TD+DDK++N+A +E I   EL   +   + +    +NI  + +  PR ++HI +I  ++Q +++  +AY VDGDVY+   K + YG++++  LD+L  G       E+  +K +P DFALWK    G ++W   +  GRPGWH ECS +   YLG+  DIHGGG DL FPHH+NE  Q+ A   K     W+H G + I  +N+KMSKSL NF+   D+L   +  T+R+F   T Y  P+ +T +NL  ++  LE +    +     L   +  N+  +E +   ++      + ++FN+ N ++ + E  +  ++   R   F   L+ +   LS LL+ + GI       L DD    L+++    ++ ++F  SD+ R+ L  + ++
  S:    23 VNMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYRGYQVKYVSNFTDVDDKMINEANKEGITVPELGDRFIAAFKEDTAALNIEPATVN-PRATEHINEIIEFVQDLIDKDYAYPVDGDVYYRAHKFSHYGELAHLNLDDLEEGASQHTNDEETARKEDPVDFALWKGAKPGEISWPSPWGAGRPGWHIECSVMSTHYLGETFDIHGGGEDLIFPHHQNEIAQSEAKTGKTFVHYWLHNGFVTIGDDNEKMSKSLGNFVTVHDILKTVDPQTLRFFMSTTQYRRPIQYTQQNLDTAERNLERLQTAYDNMGYRLKDAEAGNDPKVEQETRQIVADYIDAMDDDFNVQNGIAKVHELARLGNVYAERPVVFAGTLDFIRQTLSDLLS-VFGIKFAAAATLDDDRIQALIDERLAARKSRDFLRSDEIREQLKSQGII 456
>gi|160943774|ref|ZP_02091005.1| hypothetical protein FAEPRAM212_01272 [Faecalibacterium prausnitzii M21/2] >gi|158444948|gb|EDP21951.1| hypothetical protein FAEPRAM212_01272 [Faecalibacterium prausnitzii M21/2] (465 aa)
Score = 658, Expect = 8.8e-67, Identities = 137/366 (37%), Positives = 215/366 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKS-----EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENII-----YNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIK 366
           M+I++ +++  +E V       ++YVCGPTVYN++HIGN RP+I FD L R     G  V ++ NITDIDDK++ K +EE     E++  +E +Y      +N     ++ PR ++HI  I + ++ ++++  AY+  +GDVYF       YGK+S+  LD+L  G++      ED+LK++ P DFA+WK    G   W+  +  GRPGWH ECS +   +LG  ID+H GG DL FPHHENE  Q+   N  + AR WMH G +N++NQKMSKSL NF   +D+ + Y    +R+F     Y  PLN+T + + + KN LE +       +  + K+    ++   EK  E        + ++ N P+ ++ + + +K
  S:     1 MQIFNTLTRQKEEFVPQVPGEYRIYVCGPTVYNYIHIGNARPLIVFDTLRRYLEYRGNKVIYVSNITDIDDKLIKKGQEEGTSMKEVAQRFEAEYLKDAAGLNCEKPTVQ-PRATEHIPQILDIVKDLIDSGHAYVAKNGDVYFRVKSDPGYGKLSHLNLDDLESGNRELRSRMEDDLKED-PADFAVWKAAKPGEPAWESPYGMGRPGWHIECSAMSRTHLGKTIDLHCGGQDLIFPHHENEIAQSECANGCEFARYWMHNGFINVDNQKMSKSLHNFFTVRDVANLYGYEPIRYFMLTAGYRMPLNYTVDLIESCKNSLERLYTCRENLDFALSKTDFGTDETLKEKAAEARTKFCTAMDDDLNTPDALAAVFDLVK 377
>gi|170721588|ref|YP_001749276.1| cysteinyl-tRNA synthetase [Pseudomonas putida W619] >gi|169759591|gb|ACA72907.1| cysteinyl-tRNA synthetase [Pseudomonas putida W619] (460 aa)
Score = 658, Expect = 9.3e-67, Identities = 154/433 (35%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD------------DEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +SKT KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R   + GY +T++ NITDIDDKI+N+A E       L++       +  + +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G   WD  +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L  Y+   VR+    + Y + +N++ ++L ++K  LE   + L        +  K  E   EF +   + + ++F  P   + + + ++  +  LR+ + +    L   L   L  +LG++ +   D             E   L+    + + +KN++ESD+ R  L
  S:     2 LTIYNTLSKT-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYELTYVRNITDIDDKIINRANENGETFDALTARMIDAMHEDERRLNILKPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKKIEDLRIGARIEVDEAKQDPLDFVLWKGVKPGEPYWDSPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIAQSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLDVYHPEVVRYLLVASHYRSAINYSEDSLRDAKGALERFYHALRGLPR---VAAKGGE---EFVERFSVAMNDDFGTPEACAVLFDLVREIN-RLRDSDPDAAAGLAGRLRE-LGDVLGVLQLEADDFLRAGAEGKVDAAEVEALIQARLQARADKNWAESDRIRDQL 440
>gi|171853871|emb|CAM11833.1| Cysteinyl-tRNA synthetase [Candidatus Phytoplasma australiense] (439 aa)
Score = 658, Expect = 9.4e-67, Identities = 155/439 (35%), Positives = 257/439 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQK-YNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEA--IELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ ++   ++ + L   ++ MYVCGPTVYNH+H+GN RP+I F+ + +    +G+ V ++ NITDIDDKI+  + ++   E  L+  Y + +  +LK +NI T N   P+ +++I  +  YI+ +++  FAY  D  +YF+ +K + YG++ N+ L +L    +   +  K  P DF LWK+T+ G+ +   +  GRPGWHTEC  +I +     +DIHGGG DLKFPHH+NE  Q  A  N +LA  +MHV  L+  NQKMSKSL N +  KDLL  ++++ +++F   T Y  P+NF+   +  S+ + + I+  L     +L I++K   +   +   S    + ++F+   ++  IE  IK +    + ++ + L K+H +L ++L  +LG I    F  E    E   KW + +Q K+F ++D  RK L++K LL
  S:     2 LKIYNSLTNQKEDFIPLSPPDVNMYVCGPTVYNHLHLGNARPLIFFNTVKKYLETIGFKVFYVVNITDIDDKIIKSSLQKQTKEEVLAKEYISSFLQLLKDLNIETIN-SHPKATNYIPSMIEYIKVLLDKGFAYFTDQGIYFEISKISDYGQLKNQDLTQLKKNARKTLDPNKKKPGDFVLWKKTSQGVQYQSPWFCGRPGWHTECVTMIEQIFKTSLDIHGGGADLKFPHHQNEIAQAKAYKNNNLANFFMHVARLDFENQKMSKSLGNIVWCKDLLKRFSSSVIKFFILSTHYRKPINFSENLIKQSQKKYDKIMLFLIKNDFYLQIKKKPIVDLEPKIIDSFHRLMKDDFSTNKVIDLIEINIKEA--YQKQQDLDFLAKIHKSLLWIL-DVLG-IEPQFFRAEKKDFETYVKWQEARQNKDFKQADFLRKELIDKNLL 439
>gi|158340032|ref|YP_001521202.1| cysteinyl-tRNA synthetase [Acaryochloris marina MBIC11017] >gi|158310273|gb|ABW31888.1| cysteinyl-tRNA synthetase [Acaryochloris marina MBIC11017] (496 aa)
Score = 658, Expect = 9.4e-67, Identities = 132/303 (43%), Positives = 191/303 (63%)
  Q:    14 VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG------DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLL----SEY----NTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +S+  + + MY CG TVY++ H+G+ R  + +DVL R     GY V ++ N TDIDDKI+++A  E I   E+S  Y   YF  ++ +NI  ++  +PRV++HI  I   IQ +    +AY +DGDVY+   + ++YGK+S +KL++L VG      D ++D  KK +P DFALWK    G   W+  +  GRPGWH ECS +I   LG+ IDIHGGG DL FPHHENE  Q+  +  + LAR W+H G + +N +KMSKSL NF   +DLL    ++Y    +   VR F  Q  Y  PL+FT + ++ S N  + +
  S:    17 ISVHPERVVMYCCGVTVYDNCHLGHARSYMAWDVLRRYLKWCGYTVRYVQNFTDIDDKILHRAIVEGITMQEVSDRYINAYFRDIRRLNILDAD-DYPRVTEHIPAIHQLIQALEQQGYAYAIDGDVYYSVRQFSEYGKLSGRKLEQLKVGAGGRVADDTQDQ-KKRDPFDFALWKSAKPGEPAWESPWGLGRPGWHIECSAMIRARLGETIDIHGGGGDLVFPHHENEIAQSEVLTGQPLARYWLHNGMVTVNGEKMSKSLGNFTTIRDLLDGGWADYPEPVDPMAVRLFVLQGHYRKPLDFTKDAIVASINSWQTL 332
>gi|189485695|ref|YP_001956636.1| cysteinyl-tRNA synthetase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287654|dbj|BAG14175.1| cysteinyl-tRNA synthetase [uncultured Termite group 1 bacterium phylotype Rs-D17] (465 aa)
Score = 658, Expect = 1.0e-66, Identities = 160/437 (36%), Positives = 249/437 (56%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN-IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN-LNIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII--HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKK 437
           +KI++ +S   +E    + N + MYVCG T Y+ VH+G+ R  + FD++ R  L  GY V  I N TD+DDKIV +++E+N+   EL+  Y   YF     +NI  +  K+P V+  I +I N+I+++VN   AY + GD+YF   K   YGK+S + L +L  G +      KN+  DFALWK+T       + W+  +  GRPGWH ECS + ++ LGD IDIHGGG DL FPHHENE  Q+ A   K   + W+H G + IN +KMSKSL+NF   K +  +YN   VR++     YS+PL+F+   + +++N L+ +    L +  S    + +  +K+L   + N +  L ++FN    +S++ E     S  L     E L++L           LGI+       D+    LL + N  ++ KN++ESD+ RKL+++++
  S:     3 IKIHNTLSNKKEEFYPQRGNFVSMYVCGITPYDEVHLGHARVYVVFDIVKRHLLRRGYIVKHIQNFTDVDDKIVKRSQEKNMKPSELAQIYIEDYFVQAGRLNILKAE-KYPCVTQMIPEIVNFIKELVNKGLAYEIGGDIYFSVEKFKDYGKLSKRNLKDLRAGARVGVCNGKNSAFDFALWKKTKENEPREVTWESPWGKGRPGWHIECSAMSSELLGDTIDIHGGGQDLIFPHHENEIAQSEAKTGKKFVKYWIHNGFVTINKEKMSKSLNNFFTLKAIFEKYNPRVVRYYLLTQHYSSPLDFSDAGIESARNTLQGMDGTYLRLISSVKESDVEITDKDLSDLQGNFLSALDDDFNSEKALSYLHELKGLISKGLLTAGRERLSQLKKLFEDFAGTSLGILLPEEQNADESLQNLLKERNDARKNKNWAESDRVRKLIIDER 447
>gi|56752435|ref|YP_173136.1| cysteinyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81300471|ref|YP_400679.1| cysteinyl-tRNA synthetase [Synechococcus elongatus PCC 7942] >gi|61216122|sp|Q5MZA4|SYC_SYNP6 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|109894954|sp|Q31MM7|SYC_SYNP7 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56687394|dbj|BAD80616.1| cysteinyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81169352|gb|ABB57692.1| cysteinyl-tRNA synthetase [Synechococcus elongatus PCC 7942] (478 aa)
Score = 657, Expect = 1.2e-66, Identities = 156/435 (35%), Positives = 249/435 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG-----DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTN--TVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEK-NLEFDKSNLIELT--NNFNLPNIVSFIEEKIK----YSSILLRNKNFE-ELNKLHFNLSYL--LTKILG------IIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLME 435
           + +Y+ +++  +    L   ++ +Y CG TVY++ H+G+ R  I +D L R  L LGY V ++ N TDIDDKI+ ++++E      ++  Y   YF+ +  +NI  ++  +PR +  +  I+  I ++ +  FAY  DGDVYF   +   YGK+S +KL++L  G     + +E++LK ++P DFALWK        WD  +  GRPGWH ECS ++   LGD IDIH GG DL FPHHENE  Q+ AV    LAR W+H G +N+  +KMSKSL NF   + LL E   +   +R F  Q +Y  P++FT E L   +N  E +   L+ F  H      + E   ++ D S+   +   ++ N P  ++ + E  K      ++L+   + + +  +LH +   L  L  +LG      +   N  D+ AIE  + K +  +Q K+F+E+D+ R  L +
  S:     3 LSLYNTLTRQKQRFEPLQAGSVSLYCCGVTVYDYCHLGHARSYIVWDTLRRYLLWLGYRVRYVQNFTDIDDKILRRSRQEGTTMQAIADRYTQAYFEDMARLNILEAD-DYPRATHTLDGIQRLIAELEDKGFAYAADGDVYFSVRRFQDYGKLSGRKLEDLKAGASGRVESAEESLK-HDPFDFALWKAAKPEEPAWDSPWGPGRPGWHIECSAMVRDRLGDSIDIHVGGADLVFPHHENEIAQSEAVTGHPLARYWLHNGMVNVGGEKMSKSLGNFTTIRQLLDEGGISPMVLRLFVLQANYRKPIDFTDEALQACQNGWETLQEGLH-FGEHWGDRLGWTESVTVDPDLSDRFRMAMDDDLNTPAALAVLFELAKELRRQQNLLIHEGHLDGDAQQLHQHWVTLVQLAGVLGLEAEPELAETNELDEAAIEDWIAKRHAARQAKDFAEADRIRHYLAD 460
>gi|195953483|ref|YP_002121773.1| cysteinyl-tRNA synthetase [Hydrogenobaculum sp. Y04AAS1] >gi|195933095|gb|ACG57795.1| cysteinyl-tRNA synthetase [Hydrogenobaculum sp. Y04AAS1] (488 aa)
Score = 656, Expect = 1.4e-66, Identities = 133/314 (42%), Positives = 200/314 (63%)
  Q:     3 IYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQT-TIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +Y+ +S   +E V ++   + +Y CG TVY+  H+G+ R +I FDV  R   +LGY V F+ N TDIDDKI+NKA EEN   + +++ Y  +Y+  ++ IN+  +N++ PRV++H+++I + I K++    AY  DGD+YF       YGK+S +  +EL  G + E +LKK NP DFALWK + +    W+  +S GRPGWHTEC  +I K+LG+ IDIH GGIDL FPHHENE  Q  ++  K  AR WMH G + +  +KMSKSL NF+  K++ ++Y+ + +R     T Y +PL+F+ E +  +K   E +
  S:     5 LYNTLSAELEEFVPINPPQVNIYTCGVTVYDDSHVGHGRSLIVFDVFRRYLEKLGYRVKFVRNFTDIDDKIINKANEENKDFMSIANRYIARYYLDMEAINVKPANVE-PRVTEHMEEIISLISKLIELGKAYESDGDIYFSIDSFKDYGKLSKRSPEELEAGARIEPSLKKRNPLDFALWKASKSHEPGWESPWSYGRPGWHTECVAMIFKHLGETIDIHAGGIDLVFPHHENEIAQAESITGKPFARYWMHNGLVTVGGKKMSKSLGNFVTLKEIYTKYHPDVLRLLVLFTHYRSPLDFSFEKMEETKKAYERL 319
>gi|54297226|ref|YP_123595.1| cysteine tRNA synthetase [Legionella pneumophila str. Paris] >gi|61216143|sp|Q5X5P9|SYC_LEGPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|53751011|emb|CAH12422.1| cysteine tRNA synthetase [Legionella pneumophila str. Paris] (456 aa)
Score = 656, Expect = 1.4e-66, Identities = 153/428 (35%), Positives = 246/428 (57%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS-HLIIEQKYNEKNLEFDKSNLIELTN-NFNLPNIVSFI----EEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI---ELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           K +  VSL    I MYVCG TVY+H H+G+ R ++ FDV+ R     G++VT++ NITDIDDKI+ +A E  +   EL++ Y     +    +NI   + + PR + HI+ I   IQ+++    AY+ D GDV ++     +YGK+S+K ++ L+ G + E   +K +P DF LWK+   G  +W   +  GRPGWH ECS +    LG+Q DIHGGG+DL+FPHHENE  Q+ A   K  A  W+HVG L +N +KM+KS+ NF    D+L E++   +R+F   + Y +PLN++ ENL+N+K  L      + ++++   +  Q  + K  E+ +    +  N +FN P  +S +     E  K +S  L +     L  L   L +L       +   L ++E +   +L+ +  + + E+N++++D+ R  L+ K
  S:    11 KKEPFVSLRPGKIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLRSQGFDVTYVRNITDIDDKIIARASERGVSIDELTAQYIDAMNNDTHALNILPPDHE-PRATGHIETIIRLIQRLLEKGNAYVSDNGDVCYEVDTFPEYGKLSHKDIEGLVSGSRVEIVKEKRSPLDFVLWKKAKPGEPSWPSPWGEGRPGWHIECSAMAMHELGEQFDIHGGGLDLQFPHHENEIAQSEAATGKPFANYWLHVGMLQVNGEKMAKSIGNFYTIADVLKEHHPEVIRYFLLSSHYRSPLNYSEENLLNAKKAL------IRLYQAVKDVPPQTADSKLDEYWQEQFNQAMNDDFNTPVALSVLFQLAHEVNKSNSPALAHT----LKNLAGILGFLQKDPESFLQSGLAEEEKLVIEQLIAERLQARAERNWAKADQIRADLLSK 438
>gi|191639246|ref|YP_001988412.1| Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) [Lactobacillus casei] >gi|187631657|sp|Q035S0|SYC_LACC3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|190713548|emb|CAQ67554.1| Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) [Lactobacillus casei BL23] (468 aa)
Score = 656, Expect = 1.4e-66, Identities = 133/316 (42%), Positives = 193/316 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNL-KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + +Y+ +S+  +  + L    I+MYVCGPTVYN++HIGN R  I FD + R F   GY VT++ N TD+DDKI+N A +     L+L+  +   + +    + I  +    PR S  I DI  ++Q +++ ++AY VDGDVY+   K   YG++S++ +DEL  G     ++D L KK +P DFALWK    G ++W+  +  GRPGWH ECS +  K LGD  DIHGGG DL+FPHHENE  Q+ A  +K   R WMH G + I  +++KMSKSL NFI   D+    +   +R+F   T Y  P+ ++  NL N+ N L  +
  S:     2 LTLYNTMSRKKETFTPLHPGEIRMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYRGYKVTYVSNFTDVDDKIINAAHKTGEAPLDLAQRFIDAFMEDTTALGIEPATAH-PRASQMIPDIIEFVQDLIDKEYAYAVDGDVYYRARKFKHYGELSHQNVDELEEGASQHITQDELAKKEDPIDFALWKAAKPGEISWESPWGKGRPGWHIECSVMSTKLLGDTFDIHGGGQDLEFPHHENEIAQSEAKTDKQFVRYWMHNGFVTIGEDDEKMSKSLGNFITVHDIRKTVDPQVLRFFMAGTQYRMPIRYSETNLKNAANSLNRL 324
>gi|186901074|ref|ZP_02974028.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 7424] >gi|186691881|gb|EDU16503.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 7424] (486 aa)
Score = 656, Expect = 1.5e-66, Identities = 156/436 (35%), Positives = 252/436 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL------KKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL---NIFKSHLIIEQKYNEKNLEFDKSNLIE----LTNNFN----LPNIVSFIEEKIKYSSILLRNKNFE---ELNKLHFNLSYLLTKILGI------IHVNLFD---DEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           + IY+ +++  +    L+   ++MY CG TVY++ H+G+ R  + +DV+ R     GY V +I N TDIDDKI+N+A++E     ++S  +   YF+ +  ++I  ++  +PR +  +  I+  + ++    +AY  DGDVY+     + YGK+S +KL++L  G     +L      KK +P DFALWK    G  +W+  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   K LAR WMH G + +  +KMSKSL NF   +DLL++++   VR F  QT Y NPL+FT + L  + N  + +   L    +F   L  +Q  +  ++  D   + +    + ++FN    L  +    ++  K  +IL+  +  E   E  K  +     L+++LG+      +H    D   D  IE L+ +  + ++ KNF+E D+ R  L  K
  S:     3 LTIYNTLTRQKEPFEPLEPGKVRMYCCGITVYDYCHLGHARTCLVWDVVRRYLQWRGYQVQYIQNFTDIDDKILNRARKEGTSMEDVSERFIKAYFEDMDRLHIQKAD-AYPRATHTLDGIKRLVYELEQKGYAYPADGDVYYSVRSFSDYGKLSGRKLEDLQAGASGRVDLEDSESQKKKDPFDFALWKAAKPGEPSWESPWGLGRPGWHIECSAMVRERLGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLARYWMHNGMVKVGGEKMSKSLGNFTTIRDLLAQFDPMAVRLFILQTHYRNPLDFTPKALEAATNGWQTLQEGLLFGYLFGEKLGWDQLSSNSSVREDNPLVQQFQDAVDDDFNFAGGLAVLFEIAKDLRKEGNILVHQEKTETSPEKLKEQWQTLVQLSQVLGLEAHPPQVHRETTDGLTDAEIETLIEQRTQARKAKNFAEGDRIRDDLKAK 469
>gi|172035425|ref|YP_001801926.1| cysteinyl-tRNA synthetase [Cyanothece sp. ATCC 51142] >gi|171696879|gb|ACB49860.1| cysteinyl-tRNA synthetase [Cyanothece sp. ATCC 51142] (482 aa)
Score = 655, Expect = 1.8e-66, Identities = 153/439 (34%), Positives = 253/439 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD------KSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF----KSHLIIEQKYNEKNLEFDKSNLIELTNNFN----LPNIVSFIEEKIKYSSILLRNKNFE---ELNKLHFNLSYLLTKILGI---------IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + +Y+ +++  +   ++++  +KMY CG TVY++ H+G+ R  I +DV+ R     GY+VT+I N TDIDDKI+N+A++E      +S  +   YF+ ++ +N+  ++  +PR +  +  I+  + ++    +AY  +GDVY++  +   YGK+S +KL++L  G       +  +  KK +P DFA+WK    G   WD  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   K LAR W+H G + +  +KMSKSL NF   ++LL +++   VR F  Q  Y  P++FT E L  +    + +   L +F     S L  ++  +E   EF +     + ++FN    L  +    +E  K  ++L+     E   EL +  +     L  +LG+            +  DD AIE  + K  + ++ KNF+ESD+ R  L E+ ++
  S:     3 LTVYNTLTRNKEPFTTIEEGKVKMYCCGITVYDYCHLGHARTCIVWDVVRRYLQWRGYDVTYIQNFTDIDDKILNRARQEKTTMEAVSERFIEAYFEDMECLNVAKAD-AYPRATHTLNGIQRLVSELEAKGYAYASEGDVYYNVHQFKPYGKLSGRKLEDLQAGASGRVAVEDAEASKKKDPADFAVWKSAKPGEPAWDSPWGKGRPGWHIECSAMVRERLGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLARYWLHNGMVKVGGEKMSKSLGNFTTIRELLEKFDPMAVRLFILQAHYRKPVDFTDEALEAATKGWQTLSEGL-LFGFQQGSKLGFKENRSELLPEFIQRFQDTVDDDFNFAGGLAVLFEIAKELRKEGNLLVHQGKTETPSELLQKQWQTLIALATVLGLEADSNPVNSEKSDGLDDAAIEAFIEKRKEARKNKNFAESDRIRDELKEQGVI 468
>gi|54294205|ref|YP_126620.1| cysteine tRNA synthetase [Legionella pneumophila str. Lens] >gi|61216142|sp|Q5WX29|SYC_LEGPL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|53754037|emb|CAH15510.1| cysteine tRNA synthetase [Legionella pneumophila str. Lens] (456 aa)
Score = 655, Expect = 2.0e-66, Identities = 153/428 (35%), Positives = 247/428 (57%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS-HLIIEQKYNEKNLEFDKSNLIELTN-NFNLPNIVSFI----EEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI---ELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           K +  VSL    I MYVCG TVY+H H+G+ R ++ FDV+ R     G++VT++ NITDIDDKI+ +A E ++   EL++ Y     +    +NI   + + PR + HI+ I   IQ+++    AY+ + GDV ++     +YGK+S+K ++ L+ G + E   +K +P DF LWK+   G  +W   +  GRPGWH ECS +    LG+Q DIHGGG+DL+FPHHENE  Q+ A   K  A  W+HVG L +N +KM+KS+ NF    D+L E++   +R+F   + Y +PLN++ ENL+N+K  L      + ++++   +  Q  + K  E+ +    +  N +FN P  +S +     E  K +S  L +     L  L   L +L       +   L ++E +   +L+ +  K + E+N++++D+ R  L+ K
  S:    11 KKEPFVSLRPGKIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLRSQGFDVTYVRNITDIDDKIIARASERDVSIDELTAQYIDAMNNDTHALNILPPDHE-PRATGHIETIIRLIQRLLEKGNAYVSENGDVCYEVDTFPEYGKLSHKDIEGLVSGSRVEIVKEKRSPLDFVLWKKAKPGEPSWPSPWGEGRPGWHIECSAMAMHELGEQFDIHGGGLDLQFPHHENEIAQSEAATGKPFANYWLHVGMLQVNGEKMAKSIGNFYTIADVLKEHHPEVIRYFLLSSHYRSPLNYSEENLLNAKKAL------IRLYQAVKDVPPQTADSKLDEYWQEQFNQAMNDDFNTPVALSVLFQLAHEVNKSNSPALAHT----LKNLAGILGFLQKDPESFLQSGLAEEEKLVIEQLIAERLKARAERNWTKADQIRADLLSK 438
>gi|28870897|ref|NP_793516.1| cysteinyl-tRNA synthetase [Pseudomonas syringae pv. tomato str. DC3000] >gi|37999386|sp|Q87YQ2|SYC_PSESM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|28854146|gb|AAO57211.1| cysteinyl-tRNA synthetase [Pseudomonas syringae pv. tomato str. DC3000] (460 aa)
Score = 655, Expect = 2.2e-66, Identities = 129/320 (40%), Positives = 197/320 (61%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           + IY+ ++K+ KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R     GY++T++ NITDIDDKI+N+A++       L++       +    +NI   +M+ PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A  W+H G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L  SK  LE   + L
  S:     2 LSIYNTLTKS-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRFSGYDLTYVRNITDIDDKIINRARDNGESFDALTARMIDAMHEDEARLNILKPDME-PRATDHIPGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFQGYGKLSRKKIEDLRIGARIEVDESKQDPLDFVLWKGVKPGEPSWESPWGAGRPGWHIECSVMSTCCLGDTFDIHGGGSDLEFPHHENEIAQSEAATGKPYANAWLHCGMIRINGEKMSKSLNNFFTLRDVLEKYHPEVVRYLLVSSHYRSAINYSEDSLRESKAALERFYHAL 323
>gi|90962221|ref|YP_536137.1| cysteinyl-tRNA synthetase [Lactobacillus salivarius UCC118] >gi|123269889|sp|Q1WSS5|SYC_LACS1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|90821415|gb|ABE00054.1| Cysteinyl-tRNA synthetase [Lactobacillus salivarius UCC118] (470 aa)
Score = 654, Expect = 2.4e-66, Identities = 162/439 (36%), Positives = 255/439 (58%)
  Q:     1 MKIYD-FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE----DNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNF--EELNKLHFNLSYLLTKILGII---HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++Y+   ++ +K   L+   + MYVCGPTVYN++HIGN R  + FD + R     G+ V ++ N TD+DDKI+  ++E N+   E++  +   +++    +N+  + +  PRV D++ DI  +I+ +V   +AY   GDVY+ T K   YGK+S + +D+L  G  S     D  KK +P DFALWK+   G ++W+  +  GRPGWH ECS +  KYLGD IDIH GG DL+FPHHENE  Q+ A   K  AR W+H G + I   +QKMSKSL NF+   DLL + N   +R+F   T Y  P+ +++ NL  +K  L  +          L    + N+K +E + +NL +     + ++FN+ N +S + E  K  ++    +    + +N L  N    + +I GI       L DD   +L+ + N+ ++ KNF  SD+ R LL E+ ++
  S:     2 LQLYNTLTNQKEKFEPLNPGKVTMYVCGPTVYNYIHIGNARSAVAFDTIRRYLEYRGFEVNYVSNFTDVDDKIIKASQEMNLSVKEITEKFINAFYEDTSALNVKKATLN-PRVMDNMDDIIKFIEVLVQKGYAYESAGDVYYKTRKFKDYGKLSGQLIDDLEQGASSRVDDIDQDKKQDPLDFALWKKVKQGEISWNSPWGQGRPGWHIECSVMSTKYLGDTIDIHAGGQDLEFPHHENEIAQSEAKTGKKFARYWLHNGFVTIGEEDQKMSKSLGNFVTVHDLLKKVNPQVIRFFMSTTQYRRPIRYSSANLNEAKVNLNKLQTAYENLSYRLKDSVEGNDKEVEVNFANLEKDFVKVMDDDFNVQNGISVVYEMAKQLNVYSEKEKVYTDTINNL-INTYKKVVEIFGISFSEEKELLDDTIEQLIQERNEARKNKNFKRSDEIRDLLKEQGII 456
>gi|15673833|ref|NP_268008.1| cysteinyl-tRNA synthetase [Lactococcus lactis subsp. lactis Il1403] >gi|24418700|sp|Q9CEJ0|SYC_LACLA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|12724882|gb|AAK05949.1|AE006415_4 cysteinyl-tRNA synthetase (EC 6.1.1.16) [Lactococcus lactis subsp. lactis Il1403] (448 aa)
Score = 654, Expect = 2.5e-66, Identities = 127/316 (40%), Positives = 193/316 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           MKIY+  S+  ++   ++   +KMYVCGPTVYN++H+GN R ++ FD++ +     G+ V +I N TD+DDKI+N AK  N+   + S  Y   +++    +N+  ++   P+ ++ I+ +  +IQ++V+ +FAY+  GDVYF  +KS  Y K++NK L +LL G      E+   K +P DFALWK      ++W   +  GRPGWH ECS +    LG+ IDIHGGG DL+FPHH NE  Q+ A   +     WMH G +N++ +KMSKSL NF    +LL   N   +R+F   T Y  P+NFT + L  ++N ++ I
  S:     1 MKIYNTYSRQLEDFQPIEPGKVKMYVCGPTVYNYIHVGNARSVVAFDLVRKYLEFRGFEVQYISNFTDVDDKIINGAKAANMTTTDFSERYIAAFYEDTDALNVKRASQN-PKATEFIEAMIEFIQELVDKEFAYVSQGDVYFRVSKSKDYAKLANKNLADLLAGASGRTDEETKLKESPADFALWKSAKADEVSWQAPWGAGRPGWHIECSVMSTSLLGETIDIHGGGADLEFPHHTNEIAQSEAKTGQKFVNYWMHNGFVNVDGEKMSKSLGNFTTVHELLQVVNPQILRFFLATTHYRRPVNFTDDALTEAENNIKKI 320
>gi|172054928|ref|YP_001806255.1| cysteinyl-tRNA synthetase [Cyanothece sp. ATCC 51142] >gi|171701209|gb|ACB54189.1| cysteinyl-tRNA synthetase [Cyanothece sp. ATCC 51142] (486 aa)
Score = 654, Expect = 2.7e-66, Identities = 161/436 (36%), Positives = 256/436 (58%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE------DNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYN-EKNLEFDKSNLIE-----LTNNFNLPNIVSFIEE---KIKYSSILL--RNKNFEELNKLHFNLSYL--LTKILGI---IHVNLFDD------EAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIY+  ++  +  V+L    + MY CG TVY++ H+G+ R  I +D++ R     GY VT++ N TDIDDKI+ +A++E +   ++S  +   YF  ++ +N+  ++ ++PRV+D+I  I+  IQ +++  +AY VDGDVYF      +YGK+S +    +  G          +  KK +P DFALWK        W   +  GRPGWH ECS ++   LG+ IDIHGGG DL FPHHENE  Q+ A N K LA+ W+H G + +N +KMSKSL NF   ++LL+   +   +R F  Q  Y  PL+FT E + ++ N  + +   L   + +   E +   +KN E D S +IE     + ++FN P  ++ + E    ++    LL    KN  + + L      L  L  ILG+      NL D+      E  +L+ + N+ ++ K++++SD+ R+ L EK
  S:     7 LKIYNSQTRRLEPFVTLLPGRVTMYCCGVTVYDYCHLGHARSYIIWDMVRRYLQWWGYEVTYVQNFTDIDDKILRRAQQEGVSMADISQRFIEAYFTDIRPLNVMDAD-QYPRVTDNISGIQQLIQVLLDKNYAYAVDGDVYFHVEAFGEYGKLSGRSQSMMQAGASGRVAVNDLEKTKKKHPSDFALWKSAKPEEPAWHSPWGEGRPGWHIECSAMVRALLGETIDIHGGGGDLVFPHHENEIAQSEAANGKPLAKYWLHNGMVTVNGEKMSKSLGNFTTIRELLNRPLDPMVIRLFVLQAHYRKPLDFTEEAISSATNGWQTLQQGLRFGEKY---EDRLGWQKNQELD-SAVIEQFKAAMDDDFNSPGGLAVLFELAKNLRREGNLLTHEGKNPTDSDNLQRQWQTLVHLAGILGLEAKSEANLEDNQNFDEAEITKLIQQRNEARKVKDYAQSDRLREQLQEK 468
>gi|148358849|ref|YP_001250056.1| cysteinyl-tRNA synthetase [Legionella pneumophila str. Corby] >gi|187629845|sp|A5IBG0|SYC_LEGPC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|148280622|gb|ABQ54710.1| cysteinyl-tRNA synthetase [Legionella pneumophila str. Corby] (456 aa)
Score = 654, Expect = 2.7e-66, Identities = 152/428 (35%), Positives = 247/428 (57%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS-HLIIEQKYNEKNLEFDKSNLIELTN-NFNLPNIVSFI----EEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI---ELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           K +  VSL    I MYVCG TVY+H H+G+ R ++ FDV+ R     G++VT++ NITDIDDKI+ +A E ++   EL++ Y     +    +NI   + + PR + HI+ I   IQ+++    AY+ + GDV ++     +YGK+S+K ++ L+ G + E   +K +P DF LWK+   G  +W   +  GRPGWH ECS +    LG+Q DIHGGG+DL+FPHHENE  Q+ A   K  A  W+HVG L +N +KM+KS+ NF    D+L E++   +R+F   + Y +PLN++ ENL+N+K  L      + ++++   +  Q  + K  E+ +    +  N +FN P  +S +     E  K +S  L +     L  L   L +L       +   L ++E +   +L+ +  + + E+N++++D+ R  L+ K
  S:    11 KKEPFVSLRPGKIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLRSQGFDVTYVRNITDIDDKIIARASERDVSIDELTAQYIDAMNNDTHALNILPPDHE-PRATGHIETIIRLIQRLLEKGSAYVSENGDVCYEVDTFPEYGKLSHKDIEGLVSGSRVEIVKEKRSPLDFVLWKKAKPGEPSWPSPWGEGRPGWHIECSAMAMHELGEQFDIHGGGLDLQFPHHENEIAQSEAATGKPFANYWLHVGMLQVNGEKMAKSIGNFYTIADVLKEHHPEVIRYFLLSSHYRSPLNYSEENLLNAKKAL------IRLYQAVKDVPPQTADSKLDEYWQEQFNQAMNDDFNTPVALSVLFQLAHEVNKSNSPALAHT----LKNLAGILGFLQKDPESFLQSGLAEEEKLVIEQLIAERLQARAERNWAKADQIRTDLLSK 438
>gi|85858183|ref|YP_460385.1| cysteinyl-tRNA synthetase [Syntrophus aciditrophicus SB] >gi|85721274|gb|ABC76217.1| cysteinyl-tRNA synthetase [Syntrophus aciditrophicus SB] (550 aa)
Score = 654, Expect = 2.8e-66, Identities = 127/332 (38%), Positives = 197/332 (59%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQK 332
           +K+Y+ ++   KEV   + +  + +YVCG TVY+  H+G+ R  + FDVL R     GY VT+I N TD+DDKI+ +A  E +   E+++ Y   +   +  + +    +  PR ++HI ++   I K+     AY VDG+VY+   +   YGK+S +KL++++ G + + N  KNNP DFALWK +      WD  +  GRPGWH ECS +  KYLGD  DIHGGG DL FPHHENE  Q+  V  K LA IW+H G + IN++KMSKSL N    +++L+ Y+   +R F  Q+ Y + ++F+ E+L  ++  ++     L   +  L + ++
  S:    59 LKLYNTLN-NKKEVFTPIREGRVGLYVCGITVYDVCHVGHARSAVVFDVLKRYLEYRGYEVTYIKNFTDVDDKIIARANAEGVSISEIANRYIASHDKDMDRLGVLRPTVT-PRATEHIGEMIELISKLQKRGLAYAVDGNVYYAVERFPGYGKLSGRKLEDMMAGARIDVNEHKNNPMDFALWKASKPNEPAWDSPWGPGRPGWHIECSVMSQKYLGDTFDIHGGGEDLVFPHHENEIAQSEGVTGKPLANIWIHNGFVKINSEKMSKSLGNVFTIQEMLTRYHAEVIRLFMLQSHYRSAVDFSEESLSEARQGMDRFYGTLKAIQEVLAVAEE 391
>gi|83644974|ref|YP_433409.1| cysteinyl-tRNA synthetase [Hahella chejuensis KCTC 2396] >gi|109894904|sp|Q2SK40|SYC_HAHCH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|83633017|gb|ABC28984.1| cysteinyl-tRNA synthetase [Hahella chejuensis KCTC 2396] (467 aa)
Score = 654, Expect = 2.8e-66, Identities = 145/439 (33%), Positives = 247/439 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL----IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LFDDEAIEL-----------LNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY  +S+  +E   +    + +YVCG TVY++ H+G+ R ++ FD++ R     GY+V ++ NITD+DDKI+N+A++       L++ +     +  + + + +   + PR + HI +I   IQ++++  +AY   +GDVY+   +   YGK+S +KLDE+  G + E + +K +P DF LWK    G L+WD  +  GRPGWH ECS +  + LGD  DIHGGG DLKFPHHENE  Q+ A         WMH G + +N +KMSKSL NF   +++L +Y    VR+F   + Y + ++++   L  +++ LE +  ++      L    + E    E    F ++    + ++FN  + V+ + +  K  ++  +      L+     +   L ++LG++  +   L   E  E+           + + N  +  K+F+ESD+ R LL EK +L
  S:     2 LKIYSSLSQQKEEFKPIQAGKVGIYVCGMTVYDYCHLGHARVLVCFDIITRYLRAKGYDVNYVRNITDVDDKILNRARDNGESVDALTARFIDAMHEDERALGVLSPTSE-PRATGHIDEIIAMIQRLMDKGYAYHASNGDVYYSVEQFADYGKLSKQKLDEIRAGARIEVDAEKRSPADFVLWKAAKPGELSWDSPWGEGRPGWHIECSAMSTRCLGDTFDIHGGGPDLKFPHHENEIAQSEAATGCKYVNYWMHAGAVRVNKEKMSKSLGNFFTIREILDKYPAEVVRYFLASSHYRSAIDYSDVALEEARSGLERLYNSIRELYGELGAVSMDEPLVGEYRERFHQA----MDDDFNTSSAVAVLFDMAKAVNVAKKEDRTRALSLAKGMVD--LAEVLGLLQADPESLMQGEGEEVGGLSVAEIEDFIAQRNAARANKDFAESDRIRDLLKEKGVL 454
>gi|114330220|ref|YP_746442.1| cysteinyl-tRNA synthetase [Nitrosomonas eutropha C91] >gi|122314719|sp|Q0AJJ4|SYC_NITEC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|114307234|gb|ABI58477.1| cysteinyl-tRNA synthetase [Nitrosomonas eutropha C91] (467 aa)
Score = 654, Expect = 2.8e-66, Identities = 150/439 (34%), Positives = 252/439 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSH--------LIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-----------LFDDEAIE----LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIYD ++++ +E + L    +KMYVCG TVY+H H+G+ R ++ FD + R    L Y VT++ NITDIDDKI+ +A E +     L++ Y     +    + I + + + PR ++ I+ +   I+ +++   AY+ + GDV++D  +   YGK+S K LD+L  G++ E +  K +P DF LWK       +WD  +  GRPGWH ECS +   YLG++ DIHGGG DL+FPHHENE  Q+  V+       WMH G + ++N+KMSKSL NF   +++L+ Y    VR+F  +  Y +PLN++  +L +++N LE +   L   K+H               +  N  + +  +  + ++FN P  V+ + +        L ++     N  + +L   L  ILG++  +             D  +IE    ++ +  + ++EKNF+++D  R+ L E  ++
  S:     2 LKIYDTLTRSRREFIPLTPGKVKMYVCGMTVYDHCHLGHARVLVVFDSVVRWLQTLDYEVTYVRNITDIDDKIIRRALENHEPFGALTARYIQAMEEDAAALGIISPSFE-PRATECIESMVTMIESLLSKGLAYVANNGDVFYDVRRFPGYGKLSGKSLDDLRAGERVEIDTNKRDPLDFVLWKAAKPDEPSWDSPWGKGRPGWHIECSAMSGHYLGERFDIHGGGQDLQFPHHENEIAQSEGVHGHPHVNYWMHNGFVRVDNEKMSKSLGNFFTVREVLARYQPEVVRFFIVRAHYRSPLNYSDAHLNDARNALERLYTAL---KNHAPSQAQAAEEATATIDWVNDGYAQRFMAAMNDDFNTPEAVAVLFD--------LASEANRTGNSHYASLLKALGGILGLLQQSPRQYLQHPAHPQNDHHSIEEIERMIQQRLQARKEKNFAQADALRQQLAEAGII 454
>gi|71736729|ref|YP_273919.1| cysteinyl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|109894921|sp|Q48L06|SYC_PSE14 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|71557282|gb|AAZ36493.1| cysteinyl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola 1448A] (460 aa)
Score = 654, Expect = 2.9e-66, Identities = 129/320 (40%), Positives = 196/320 (61%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           + IY+ ++K+ KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R     GY +T++ NITDIDDKI+N+A++       L++       +    +NI   +M+ PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A  W+H G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L  SK  LE   + L
  S:     2 LSIYNTLTKS-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRFSGYELTYVRNITDIDDKIINRARDNGESFDALTARMIDAMHEDEARLNILKPDME-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFQGYGKLSRKKIEDLRIGARIEVDESKEDPLDFVLWKGVKPGEPSWESPWGAGRPGWHIECSVMSTCCLGDTFDIHGGGSDLEFPHHENEIAQSEAATGKTYANAWLHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVSSHYRSAINYSEDSLRESKAALERFYHAL 323
>gi|125624812|ref|YP_001033295.1| cysteinyl-tRNA synthetase [Lactococcus lactis subsp. cremoris MG1363] >gi|187629844|sp|A2RMS1|SYC_LACLM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|124493620|emb|CAL98607.1| CysS protein [Lactococcus lactis subsp. cremoris MG1363] (448 aa)
Score = 654, Expect = 3.0e-66, Identities = 154/433 (35%), Positives = 250/433 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG----DKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI-IHVNLFDDEAIELLNKWNKLKQE-KNFSESDKYRKLL 433
           MKIY+  S+  ++   ++   +KMYVCGPTVYN++H+GN R ++ FD++ +     G+ V +I N TD+DDKI+  A  ENI   ELS  Y   +++    +N+  ++   P+ ++ I+ + ++IQ++++  +AY+ +GDVYF   KS  Y K++NK L +LL G       E NLK++ P DFALWK      ++W   +  GRPGWH ECS +    LG+ IDIHGGG DL+FPHH NE  Q+ A   +     WMH G +N++ +KMSKSL NF    +LL   +   +R+F   T Y  PLNFT + L  ++N ++ I    N ++ HL  + + N   L   +++ +  +  +FN+ N ++   + + +    +   N     K  F+    + +ILGI   +    D  IE + +  +L +E ++F++SD+ R  L
  S:     1 MKIYNTYSRQLEDFQPIEPGKVKMYVCGPTVYNYIHVGNARSVVAFDLVRKYLEFRGFEVEYISNFTDVDDKIIKAAASENISTKELSERYIAAFYEDTDLLNVKRASQN-PKATEFIEAMIDFIQELLDKDYAYISEGDVYFRVAKSKDYAKLANKNLADLLAGASGRTDEETNLKES-PADFALWKSVKADEVSWQAPWGAGRPGWHIECSVMSTSLLGETIDIHGGGADLEFPHHTNEIAQSEAKTGQKFVNYWMHNGFVNVDGEKMSKSLGNFTTVHELLQVVDPQILRFFLTTTHYRRPLNFTDDALTEAENNIKKI---ENAYR-HLDDQAESNLSALTTFRNDFVAAMDEDFNIANGMTVFYDFVSW----VNKGNGGAEVKAFFD---QVLEILGIKFEIEQSLDSEIEAMIEERQLAREVRDFAKSDEIRDAL 429
>gi|152996132|ref|YP_001340967.1| cysteinyl-tRNA synthetase [Marinomonas sp. MWYL1] >gi|189082069|sp|A6VX53|SYC_MARMS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|150837056|gb|ABR71032.1| cysteinyl-tRNA synthetase [Marinomonas sp. MWYL1] (460 aa)
Score = 653, Expect = 3.0e-66, Identities = 154/436 (35%), Positives = 256/436 (58%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSS-YYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL--LTKILGIIHVNL------------FDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIY+ +S   KE+   +++  + MYVCG TVY+  HIG+ R +I+FDV++R    LGY + ++ NITD+DDKI+ +A+E N     L+      Q  D L+  N      + P+ ++ +++I + +Q +++  FAY    GDVY+  TK   YGK++N+KL+++L G + +  + K +P DF LWKQ   G ++W   +  GRPGWH ECS +    LG   DIHGGG DLKFPHHENE  Q+ A   K+    WMH G + +NN+KMSKSL NF   +D+L+++N   VR+    + Y + ++++ ++L+ +K  LE +   L         +Q+  E    F+ +   E     + ++FN    VS + E ++     L     E+ NK     + L  L ++LG+++ +               + AI+ L+++  + +++KNF+ SD+ R  L  +
  S:     2 LKIYNTLSGK-KEIFKPIEEGKVGMYVCGNTVYDFCHIGHARAMISFDVISRFIRHLGYELNYVRNITDVDDKIIKRAEENNESTQSLTERMIAAQREDELRLGNKMPD--REPKATEFMQEIIDMVQVLIDKGFAYQGTSGDVYYRATKFKDYGKLNNRKLEDMLAGARIDVEVAKEHPADFVLWKQAKAGEVSWSSPWGEGRPGWHIECSAMSTNCLGSHFDIHGGGPDLKFPHHENEIAQSEAATGKEYVNYWMHCGAVRVNNEKMSKSLGNFFTVRDVLAKFNPEVVRYLMVSSQYRSAIDYSDQSLLEAKVALERLYTALR--------QQQVAE---SFEPTVFTERFEEAMKDDFNTAVAVSVLFELVRE----LNKAKTEDANKASLLAAELRSLAELLGLLYQDPEYFLQNSTVSEGLGEVAIQALIDERTQARKDKNFARSDEIRDELASQ 444
>gi|187924487|ref|YP_001896129.1| cysteinyl-tRNA synthetase [Burkholderia phytofirmans PsJN] >gi|187715681|gb|ACD16905.1| cysteinyl-tRNA synthetase [Burkholderia phytofirmans PsJN] (465 aa)
Score = 653, Expect = 3.0e-66, Identities = 134/363 (36%), Positives = 214/363 (58%)
  Q:     1 MKIYDFVSKTDKE--VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT----IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE 363
           ++IY+ +++ DK+  V L +  ++MYVCG TVY++ H+G+ R ++ FD++ R    LGY+VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +D I  +   I+++  N +AY   DGDV +   K   YGK+S K L++L  G++   N  K +P DF LWKQ          WD K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   +     WMH G++ I+N+KMSKSL+NF   +++L++Y+   VR+F  +  Y +PLN++  ++ +++N L  +   L         E  +NE + +  ++    + ++FN P  VS + E
  S:     4 LRIYNTLAR-DKQTFVPLQEGVVRMYVCGMTVYDYCHVGHARVMVVFDIVQRWLRTLGYDVTYVRNITDIDDKIIRRAVENGETIKALTDRFIDALHEDADALGIQRPDLE-PRATDFIPQMLGMIEQLEANGYAYQASDGDVNYAVRKFANYGKLSGKSLEDLRAGERVAANDAKQDPLDFVLWKQAKPDEPADTGWDSKYGRGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEAATGQTFVNFWMHNGYVQIDNEKMSKSLNNFFTIREVLAQYDAEVVRFFIARAHYRSPLNYSDVHIDDARNALARLYTALKDVTPD-AAELDWNEAHAQRFQA---AMNDDFNTPVAVSVLFE 367
>gi|191162221|ref|ZP_03024102.1| cysteinyl-tRNA synthetase [Geobacter sp. M21] >gi|190997011|gb|EDV72458.1| cysteinyl-tRNA synthetase [Geobacter sp. M21] (527 aa)
Score = 653, Expect = 3.6e-66, Identities = 148/439 (33%), Positives = 250/439 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLII---------EQKYNEKNLEFDKSNLIELTNNFN-------LPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-----------------HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++Y+ ++ + +E V ++   + MYVCG TVY+H HIG+ R  + FD++ R  L  G  VT++ N TDIDDKI+N+A  + +   E+S  +  ++ + +  + +     + P+ ++HI +I N +QK+++  FAY    DV++   +   Y K+S + L+++  G + + + +K +P DFALWK    G   W+  +  GRPGWH ECS +  K+LG+ +DIHGGG DL FPHHENE  Q+ A + K   + W+H G +NIN++KMSKSL NF   K++L  Y+   +R+F     Y +P++F+ +NL  ++  LE I   L      L             ++ EK   F       + ++FN       L ++V  I  ++  +S  L  K   E+ K        +  +LGI                   + +  +E   L+ +  + ++ KNF   D+ R LL+EK ++
  S:    50 LRVYNTLTGSKEEFVPINPGKVGMYVCGVTVYDHCHIGHARANVVFDMIYRHLLSKGLEVTYVRNYTDIDDKIINRANRDGVAYNEISERFIKEFDNDMARLMLQLPTFQ-PKATEHIPEIINLVQKLIDKGFAYQSGSDVFYRVDRFEGYLKLSKRNLEDMQAGARIDVDERKEHPMDFALWKGAKPGEPYWESPWGQGRPGWHIECSAMSTKFLGETLDIHGGGKDLIFPHHENEIAQSEAASGKPFVKYWLHNGFVNINSEKMSKSLGNFFTIKEILESYDAEVLRFFLLSAHYRSPIDFSDQNLKEAELGLERIYKALAGIDERLASGAHTPADADNTEFAEKVAGFAGRFGDAMDDDFNTALALGHLFDLVRVINRELPTASTGLLEKVKAEVAK--------MAAVLGICDSVPAAFLQRMKDRKTSDMEMSAEEIETLIAERAEARKAKNFKRGDEIRDLLLEKNIV 514
>gi|89256953|ref|YP_514315.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica] >gi|115315315|ref|YP_764038.1| cysteine--tRNA ligase [Francisella tularensis subsp. holarctica OSU18] >gi|134301406|ref|YP_001121374.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. tularensis WY96-3418] >gi|156503147|ref|YP_001429212.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010049|ref|ZP_02274980.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica FSC200] >gi|122324692|sp|Q0BKI3|SYC_FRATO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|187629822|sp|A7NE53|SYC_FRATF Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|187629824|sp|A4IWF2|SYC_FRATW Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|109894902|sp|Q2A1T7|SYC_FRATH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|89144784|emb|CAJ80122.1| Cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica LVS] >gi|115130214|gb|ABI83401.1| cysteine--tRNA ligase [Francisella tularensis subsp. holarctica OSU18] >gi|134049183|gb|ABO46254.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. tularensis WY96-3418] >gi|134254025|gb|EBA53119.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica 257] >gi|151570011|gb|EDN35665.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. novicida GA99-3549] >gi|156253750|gb|ABU62256.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica FTNF002-00] (464 aa)
Score = 653, Expect = 3.8e-66, Identities = 153/424 (36%), Positives = 236/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNLFD----------DEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NITDIDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   +GDV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++ +           E  +L+ +  + K++KN++ +D+ R  L ++ ++
  S:    22 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIKAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGII 451
>gi|66044980|ref|YP_234821.1| cysteinyl-tRNA synthetase [Pseudomonas syringae pv. syringae B728a] >gi|75502675|sp|Q4ZVN9|SYC_PSEU2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|63255687|gb|AAY36783.1| Cysteinyl-tRNA synthetase, class Ia [Pseudomonas syringae pv. syringae B728a] (460 aa)
Score = 653, Expect = 3.9e-66, Identities = 129/320 (40%), Positives = 196/320 (61%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           + IY+ ++K+ KEV   LD   ++MYVCG TVY++ H+G+ R ++ FD++ R     GY +T++ NITDIDDKI+N+A+E       L++       +    +NI   +M+ PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  W+H G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L  SK  LE   + L
  S:     2 LSIYNTLTKS-KEVFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRFSGYELTYVRNITDIDDKIINRARENGESFDALTARMIEAMHEDEARLNILKPDME-PRATDHIPGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFQGYGKLSRKKIEDLRIGARIEVDESKEDPLDFVLWKGVKPGEPSWESPWGAGRPGWHIECSVMSTCCLGETFDIHGGGSDLEFPHHENEIAQSEAATGKTYANAWLHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVSSHYRSAINYSEDSLRESKAALERFYHAL 323
>gi|152992414|ref|YP_001358135.1| cysteinyl-tRNA synthetase [Sulfurovum sp. NBC37-1] >gi|166225309|sp|A6Q8G9|SYC_SULNB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|151424275|dbj|BAF71778.1| cysteinyl-tRNA synthetase [Sulfurovum sp. NBC37-1] (465 aa)
Score = 652, Expect = 4.0e-66, Identities = 162/435 (37%), Positives = 249/435 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ----IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILL----RNKNFEELNKLHFNLSYLLTKILGIIHVNLFD---DEAIE-----LLNKWNKLKQEKNFSESDKYRKLLME 435
           M+I+D V KT      + +    +YVCGPTVY+  H+G+ R  + FD+L+R    LGY V    N TDIDDKI+ K +E      E++SYY  +Y D ++ + +  ++++ P+ ++ +  IE  IQ +++  FAY+V +GDVYFDT+K + YG IS+K  D+     + E N +K NP+DFALWK  +    + +   FS+GRPGWH ECS +I KY        IDIHGGG DL FPHHENE  Q+      +LA+ WMH G + IN +KMSKSL N    KD L  Y    +R++     Y N  NF  E+L  +K +L+  +Y L       ++  K +  N  F ++ L  ++++ N+   ++ I+E I  ++  L    +NK  ++    +      L    G    + F    DEA++     LL +  + K+ K+F+ SD  R  L++
  S:     1 MQIFDSVQKTKVTFEPIREGEASIYVCGPTVYDDAHLGHARSSLAFDLLSRTLKALGYKVIMAKNFTDIDDKIIKKVEETGKSMQEITSYYIQRYLDEMEQLGVQRADIE-PKATESLDAIEQMIQTLIDKDFAYVVSNGDVYFDTSKDSHYGDISHKVSDDD-TQSRVEHNSEKRNPRDFALWKACKGEEDICFGAPFSSGRPGWHIECSAMIEKYFKGNGQYSIDIHGGGADLLFPHHENEAAQSRCATGHELAKYWMHNGFVQINGEKMSKSLGNSFFLKDALEVYGGEVLRYYLNSVHYRNDFNFNEEDLQTAKKRLDK-LYRLK----KRVLPGKASTVNKAFKQALLNAMSDDLNISIALAVIDEMIAETNEKLDTDPKNKALKKETIANIEFIDTLLGFGGKEPFSYFQIGVDEALKEKIEILLQERTEAKKAKDFATSDAIRNELID 448
>gi|167033877|ref|YP_001669108.1| cysteinyl-tRNA synthetase [Pseudomonas putida GB-1] >gi|187629853|sp|B0KUU0|SYC_PSEPG Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|166860365|gb|ABY98772.1| cysteinyl-tRNA synthetase [Pseudomonas putida GB-1] (460 aa)
Score = 652, Expect = 4.0e-66, Identities = 149/433 (34%), Positives = 243/433 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD------------DEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +SK  +    LD   ++MYVCG TVY++ H+G+ R ++ FD++ R   + GY++T++ NITDIDDKI+N+A E       L++       +  + +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S KK+++L +G + E +  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   K  A  WMH G + IN +KMSKSL+NF   +D+L +Y+   VR+    + Y + +N++ ++L ++K  LE   + L        +  K  E    F +   + + ++F  P   + + + ++  +  LR+ + E    L   L   L  +LG++ +   D             E   L+    + + +KN++ESD+ R  L
  S:     2 LTIYNTLSKAKETFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYDLTYVRNITDIDDKIINRANENGETFDALTARMIDAMHEDERRLNILPPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKKIEDLRIGARIEVDEAKQDPLDFVLWKGVKPGEPSWESPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIAQSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVASHYRSAINYSEDSLRDAKGALERFYHALRGLPR---VAAKGGEA---FVERFSMAMNDDFGTPEACAVLFDLVREIN-RLRDSDLEAAAGLAGRLRE-LGDVLGVLQLEADDFLRAGAEGKVDAAEVEGLIQARLQARTDKNWAESDRIRDQL 440
>gi|116512729|ref|YP_811636.1| cysteinyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] >gi|123125354|sp|Q02WZ9|SYC_LACLS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116108383|gb|ABJ73523.1| cysteinyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] (448 aa)
Score = 652, Expect = 4.1e-66, Identities = 154/433 (35%), Positives = 250/433 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG----DKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI-IHVNLFDDEAIELLNKWNKLKQE-KNFSESDKYRKLL 433
           MKIY+  S+  ++   ++   +KMYVCGPTVYN++H+GN R ++ FD++ +     G+ V +I N TD+DDKI+  A  ENI   ELS  Y   +++    +N+  ++   P+ ++ I+ + ++IQ++++  +AY+ +GDVYF   KS  Y K++NK L +LL G       E NLK++ P DFALWK      ++W   +  GRPGWH ECS +    LG+ IDIHGGG DL+FPHH NE  Q+ A   +     WMH G +N++ +KMSKSL NF    +LL   +   +R+F   T Y  PLNFT + L  ++N ++ I    N ++ HL  + + N   L   +++ +  +  +FN+ N ++   + + +    +   N     K  F+    + +ILGI   +    D  IE + +  +L +E ++F++SD+ R  L
  S:     1 MKIYNTYSRQLEDFQPIEPGKVKMYVCGPTVYNYIHVGNARSVVAFDLVRKYLEFRGFEVEYISNFTDVDDKIIKAAVSENISTKELSERYIAAFYEDTDLLNVKRASQN-PKATEFIEAMIDFIQELLDKDYAYISEGDVYFRVAKSKNYAKLANKNLADLLAGASGRTDEETNLKES-PADFALWKSVKADEVSWQAPWGAGRPGWHIECSVMSTSLLGETIDIHGGGADLEFPHHTNEIAQSEAKTGQKFVNYWMHNGFVNVDGEKMSKSLGNFTTVHELLQVVDPQILRFFLATTHYRRPLNFTDDALTEAENNIKKI---ENAYR-HLDDQAESNLSALTTFRNDFVAAMDEDFNIANGMTVFYDFVSW----VNKGNGGAEVKAFFD---QVLEILGIKFEIEQSLDSEIEAMIEARQLAREVRDFAKSDEIRDAL 429
>gi|148266184|ref|YP_001232890.1| cysteinyl-tRNA synthetase [Geobacter uraniireducens Rf4] >gi|189082065|sp|A5G949|SYC_GEOUR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|146399684|gb|ABQ28317.1| cysteinyl-tRNA synthetase [Geobacter uraniireducens Rf4] (494 aa)
Score = 652, Expect = 4.2e-66, Identities = 122/316 (38%), Positives = 195/316 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +++Y+ ++ T ++ V ++   +KMYVCG TVY+H HIG+ R  + FDV+ R    LG  V ++ N TDIDDKI+N+A  E +    +S  +  ++   +  + +     + P+ ++HI +I   +Q +++  FAY + GDV F   K + Y K+S + L+++  G + E + +K +P DF LWK+   G   W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ A + K   + W+H G +NIN++KMSKSL NF   K++L +Y++  +R+F     Y +PL+F+ +NL  ++  +E I
  S:     3 LRVYNTLTGTKEDFVPIEPGKVKMYVCGVTVYDHCHIGHARANVVFDVIYRYLRSLGLEVNYVRNYTDIDDKIINRANREGVAYDAISERFIKEFDRDMAQLGLLLPTSQ-PKATEHIPEIITLVQTLIDKGFAYQMGGDVNFCVEKFDPYLKLSKRNLEDMQAGARIEVDERKRHPMDFVLWKEAKPGEPFWESPWGKGRPGWHIECSAMSMKYLGETFDIHGGGKDLVFPHHENEIAQSEAASGKPFVKYWLHNGFVNINSEKMSKSLGNFFTIKEVLDKYDSEVLRFFLLSAHYRSPLDFSDQNLTEAETGMERI 319
>gi|194324147|ref|ZP_03057921.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. novicida FTE] >gi|194321594|gb|EDX19078.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. novicida FTE] (464 aa)
Score = 652, Expect = 4.2e-66, Identities = 155/424 (36%), Positives = 236/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNL---------FDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NITDIDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   +GDV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++          D   IE L+ +  + K++KN++ +D+ R  L ++ ++
  S:    22 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIKAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGVDASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGII 451
>gi|91784175|ref|YP_559381.1| cysteinyl-tRNA synthetase [Burkholderia xenovorans LB400] >gi|123358667|sp|Q13X60|SYC_BURXL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|91688129|gb|ABE31329.1| cysteinyl-tRNA synthetase [Burkholderia xenovorans LB400] (465 aa)
Score = 652, Expect = 4.2e-66, Identities = 135/363 (37%), Positives = 211/363 (58%)
  Q:     1 MKIYDFVSKTDKE--VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT----IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE 363
           ++IY+ +++ DK+  V L    ++MYVCG TVY++ H+G+ R ++ FD++ R    LGYNVT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +D I  +   I+++  N +AY   DGDV +   K   YGK+S K L++L  G++   N  K +P DF LWKQ          WD K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+ A   +     WMH G++ I+N+KMSKSL+NF   +++L++Y+   VR+F  +  Y +PLN++  ++ +++N L  +   L         E  +NE    + +     + ++FN P  VS + E
  S:     4 LRIYNTLAR-DKQTFVPLQDGVVRMYVCGMTVYDYCHVGHARVMVVFDIVQRWLRTLGYNVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIKALHEDADALGIQRPDIE-PRATDFIPQMLGMIERLEANGYAYQASDGDVNYAVRKFANYGKLSGKSLEDLRAGERVAANDAKQDPLDFVLWKQAKPQEPADTGWDSKYGRGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEAATGQTFVNFWMHNGYVQIDNEKMSKSLNNFFTIREVLAQYDAEVVRFFIARAHYRSPLNYSDVHIDDARNALTRLYTALKDVTPDG-AELDWNEA---YAQRFQAAMNDDFNTPVAVSVLFE 367
>gi|160903262|ref|YP_001568843.1| cysteinyl-tRNA synthetase [Petrotoga mobilis SJ95] >gi|187629839|sp|A9BGT9|SYC_PETMO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|160360906|gb|ABX32520.1| cysteinyl-tRNA synthetase [Petrotoga mobilis SJ95] (469 aa)
Score = 652, Expect = 4.2e-66, Identities = 159/430 (36%), Positives = 255/430 (59%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN----IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-LFDDEAIEL-------LNKWNKLKQEKNFSESDKYR 430
           +KIYD +S +    V + +  IK+Y+CGPTVYN +HIGN RPII FD   R    +GY VT + N TDIDDKI+ +AK+EN+   E+   Y  +Y+  +  +     N   P+ ++++ +I +YI+++    +AY  + GDVYF+  K ++YG++S++K+++L VG + E +  K NP DFALWK +  G   W+  +  GRPGWH ECS + ++ LGD  DIH GG DL FPHHENE  Q IA + KD A+ WMH G + +   KMSKSL N    +DLL +++++ ++ F     Y  P++ + E L N +  +  +  +LN     F   +   QK N    E ++  +  L+N+F+ P++V+ I E  +  +  L +++ E +   ++ +  +   +LG+   N       +EL       LN  + L++EK ++ SD  R
  S:     7 IKIYDTLSGQVVDLVPVKEGEIKIYLCGPTVYNLLHIGNARPIIIFDAFRRFLEYIGYKVTLVQNFTDIDDKIIEQAKKENLPFEEVGKRYIIEYWRDMTALKARAFNFH-PKTTNYVDEIISYIKELEEKGYAYKAENGDVYFEVEKFSRYGELSHRKVEDLKVGVRVEVSEYKKNPLDFALWKASKEGEPFWESPWGKGRPGWHIECSVMSSEILGDTFDIHAGGNDLIFPHHENERAQAIAKSGKDFAKYWMHNGMIRMAQDKMSKSLGNVWYLRDLLKKFDSDVLKIFILSKHYRIPIDVSEELLRNQEVSVNRVKESLNEAETFFNGKVPCPQKMNYFK-EQEEYLISSLSNDFDTPSVVARIFELSRDLNKALNSRDEETIKNNYYIIRNIYGSVLGVFETNEQIQKNNVELNQLMEIILNVRSALREEKLYNLSDYIR 449
>gi|52841538|ref|YP_095337.1| cysteinyl-tRNA synthetase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|61216153|sp|Q5ZVY1|SYC_LEGPH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|52628649|gb|AAU27390.1| cysteinyl-tRNA synthetase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (456 aa)
Score = 652, Expect = 4.2e-66, Identities = 149/428 (34%), Positives = 243/428 (56%)
  Q:     9 KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFI----EEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI---ELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           K +  VSL    I MYVCG TVY+H H+G+ R ++ FDV+ R     G++VT++ NITDIDDKI+ +A E  +   EL++ Y     +    +NI   + + PR + HI+ I   IQ+++    AY+ + GDV ++     +YGK+S+K ++ L+ G + E   +K +P DF LWK+   G  +W   +  GRPGWH ECS +    LG+Q DIHGGG+DL+FPHHENE  Q+ A   K  A  W+HVG L +N +KM+KS+ NF    D+L E++   +R+F   + Y +PLN++ ENL+N+K  L  +   +          +      ++F+++    + ++FN P  +S +     E  K +S  L +     L  L   L +L       +   L ++E +   +L+ +  + + E+N++++D+ R  L+ K
  S:    11 KKEPFVSLKPGTIGMYVCGITVYDHCHLGHARSMVAFDVMVRYLRSQGFDVTYVRNITDIDDKIIARASERGVSIDELTAQYIDAMNNDTHALNILPPDHE-PRATGHIETIIRLIQRLLEKGNAYVSENGDVCYEVDTFPEYGKLSHKDIEGLVSGSRVEIVKEKRSPLDFVLWKKAKPGEPSWPSPWGEGRPGWHIECSAMAMHELGEQFDIHGGGLDLQFPHHENEIAQSEAATGKPFANYWLHVGMLQVNGEKMAKSIGNFYTIADVLKEHHPEVIRYFLLSSHYRSPLNYSEENLLNAKKALIRLYQAVKDVPPQTEDSKLDEYWQVQFNQA----MNDDFNTPVALSVLFQLAHEVNKSNSPALAHT----LKNLAGILGFLQKDPESFLQSGLAEEEKLVIEQLIAERLQARAERNWAKADQIRADLLSK 438
>gi|114320961|ref|YP_742644.1| cysteinyl-tRNA synthetase [Alkalilimnicola ehrlichei MLHE-1] >gi|114227355|gb|ABI57154.1| cysteinyl-tRNA synthetase [Alkalilimnicola ehrlichei MLHE-1] (485 aa)
Score = 652, Expect = 4.3e-66, Identities = 145/420 (34%), Positives = 234/420 (55%)
  Q:    20 NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL------------FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++MYVCG TVY++ H+G+ R ++ FD++ R    LGY VTF+ NITDIDDKI+ +A E  E +G +    +    + D  + + +   + + PR + HI DI   I+++V    AY+ D GDVYF  +   +YGK+S ++ ++L  G + E +  K +P DFALWK    G   W   +  GRPGWH ECS +  + LGD  DIHGGG+DLKFPHHENE  Q+           WMH GH+ IN++KM+KSL NF   +++LSE+    VR F   + Y +PLN++ + L  ++  LE +   L       + E         F  +    + ++FN P  ++ + E  +  +  LR  + +        L  +L  +LG++  +              D E   L+ +  + ++ ++F+E+D+ R  L E+ ++
  S:    45 HVRMYVCGMTVYDYCHLGHARALVVFDMVARYLRHLGYRVTFVRNITDIDDKIIRRAAELGEPMGAVT-ERFIRAMHEDA-EALGVLPPDHE-PRATGHIDDIIAMIERLVERGHAYVADDGDVYFAVSSYPEYGKLSGERQEDLRAGARVEVDEGKRDPVDFALWKAARPGEPAWPSPWGEGRPGWHIECSAMSTQVLGDHFDIHGGGLDLKFPHHENEIAQSECATGHPFVNYWMHNGHVRINDEKMAKSLGNFFTVREVLSEHRAEAVRLFLLSSHYRSPLNYSLDGLRQAQGALERLYLALRGLPEAPVPEADPQGFRARFHAA----MDDDFNTPEALAVLFELAREVN-RLRQGDDDAGAAAPGALLRVLGGVLGLLQDDPERFLRGGDAGGDEDAEIDALVARRTEARKNRDFAEADRIRDELAERGII 472
>gi|187631658|sp|Q0A7N3|SYC_ALHEH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (462 aa)
Score = 652, Expect = 4.3e-66, Identities = 145/420 (34%), Positives = 234/420 (55%)
  Q:    20 NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL------------FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++MYVCG TVY++ H+G+ R ++ FD++ R    LGY VTF+ NITDIDDKI+ +A E  E +G +    +    + D  + + +   + + PR + HI DI   I+++V    AY+ D GDVYF  +   +YGK+S ++ ++L  G + E +  K +P DFALWK    G   W   +  GRPGWH ECS +  + LGD  DIHGGG+DLKFPHHENE  Q+           WMH GH+ IN++KM+KSL NF   +++LSE+    VR F   + Y +PLN++ + L  ++  LE +   L       + E         F  +    + ++FN P  ++ + E  +  +  LR  + +        L  +L  +LG++  +              D E   L+ +  + ++ ++F+E+D+ R  L E+ ++
  S:    22 HVRMYVCGMTVYDYCHLGHARALVVFDMVARYLRHLGYRVTFVRNITDIDDKIIRRAAELGEPMGAVT-ERFIRAMHEDA-EALGVLPPDHE-PRATGHIDDIIAMIERLVERGHAYVADDGDVYFAVSSYPEYGKLSGERQEDLRAGARVEVDEGKRDPVDFALWKAARPGEPAWPSPWGEGRPGWHIECSAMSTQVLGDHFDIHGGGLDLKFPHHENEIAQSECATGHPFVNYWMHNGHVRINDEKMAKSLGNFFTVREVLSEHRAEAVRLFLLSSHYRSPLNYSLDGLRQAQGALERLYLALRGLPEAPVPEADPQGFRARFHAA----MDDDFNTPEALAVLFELAREVN-RLRQGDDDAGAAAPGALLRVLGGVLGLLQDDPERFLRGGDAGGDEDAEIDALVARRTEARKNRDFAEADRIRDELAERGII 449
>gi|116049743|ref|YP_791450.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14] >gi|122258854|sp|Q02KT6|SYC_PSEAB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|115584964|gb|ABJ10979.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14] (460 aa)
Score = 652, Expect = 4.3e-66, Identities = 131/319 (41%), Positives = 199/319 (62%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN-----IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           ++IY+ +SKT KEV   L    ++MYVCG TVY++ H+G+ R ++ FDV+ R     GY++T++ NITDIDDKI+N+A E +     + E  +++ +E +       +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S +++++L +G + E    K +P DF LWK    G  +W   +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A+ W+H G + IN +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ENL  +K  L+   YN
  S:     2 LQIYNTLSKT-KEVFTPLVGNQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLRHRGYDLTYVRNITDIDDKIINRANENDEPFDVLTERMIAAMHEDE-----ARLNILKPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFAGYGKLSRRRVEDLRIGARIEPGEAKEDPLDFVLWKGAKPGEPSWSSPWGEGRPGWHIECSVMSTCCLGDSFDIHGGGNDLEFPHHENEIAQSEAATGKPYAKSWLHCGMITINGEKMSKSLGNFFTIREVLEKYHPEVVRYLLIASHYRSPINYSEENLREAKAALDR-FYN 321
>gi|148657145|ref|YP_001277350.1| cysteinyl-tRNA synthetase [Roseiflexus sp. RS-1] >gi|148569255|gb|ABQ91400.1| cysteinyl-tRNA synthetase [Roseiflexus sp. RS-1] (478 aa)
Score = 652, Expect = 4.3e-66, Identities = 126/313 (40%), Positives = 194/313 (61%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINN---------QKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL 313
           ++IY+ +++T +   +L+   +KMYVCG TVY+  HIG+    I FDV+ R     GY V  + N TD+DDKI+N+A+E      EL+  Y  ++ + L+ +N+  +++ +PR ++ + +I+ +I +++    AY+VDGDVYF       YGK+S + LD+++ G++   + +K NP DFALWK    G   WD  +  GRPGWH ECS +   +LG+QIDIHGGG DL FPHHENE  Q  ++  K  AR WMH G L I           +KMSKSL N +  ++ L++Y+ + +R     +SY +PL F  E   + + +L
  S:     3 IRIYNTLTRTLEPFETLEPGVVKMYVCGVTVYDRAHIGHAMSAIVFDVVRRYLEYRGYAVQHVVNFTDVDDKIINRAREIGRDPKELAESYIAEFLEDLEALNVKRAHI-YPRATETMPEIQQFITRLIETGHAYVVDGDVYFRIATVPDYGKLSRRSLDDMIAGNRISVDERKENPADFALWKAAKPGEPFWDSPWGPGRPGWHIECSAMNLAHLGEQIDIHGGGADLIFPHHENEIAQTESLTGKPFARYWMHNGMLQIQTRLADGTYKLEKMSKSLGNVVTIREFLAQYHPDVLRLTVLSSSYRSPLAFGEEIAADQERKL 325
>gi|157122772|gb|EDO66901.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. holarctica FSC022] (464 aa)
Score = 652, Expect = 5.0e-66, Identities = 153/424 (36%), Positives = 236/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNLFD----------DEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NITDIDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   +GDV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++ +           E  +L+ +  + K++KN++ +D+ R  L ++ ++
  S:    22 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIRAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDNASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGII 451
>gi|118496920|ref|YP_897970.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. novicida U112] >gi|187629823|sp|A0Q4Q1|SYC_FRATN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|118422826|gb|ABK89216.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. novicida U112] (459 aa)
Score = 651, Expect = 5.4e-66, Identities = 155/424 (36%), Positives = 236/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNL---------FDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NITDIDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   +GDV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++          D   IE L+ +  + K++KN++ +D+ R  L ++ ++
  S:    17 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIKAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGVDASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGII 446
>gi|30248074|ref|NP_840144.1| cysteinyl-tRNA synthetase [Nitrosomonas europaea ATCC 19718] >gi|61216300|sp|Q82Y45|SYC_NITEU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|30179959|emb|CAD83954.1| Cysteinyl-tRNA synthetase [Nitrosomonas europaea ATCC 19718] (465 aa)
Score = 651, Expect = 6.4e-66, Identities = 128/361 (35%), Positives = 216/361 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL------IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFI 361
           +KIYD ++++ +E + L    ++MYVCG TVY++ H+G+ R ++ FD + R    LGY V ++ NITD+DDKI+ +A E +     L++ Y     +    + + + + + PR ++++  +   I+ ++N + AY+  +GDV++D  +   YGK+S K LD+L  G++ E +  K +P DF LWK       +WD  +  GRPGWH ECS +   YLGDQ DIHGGG DL+FPHHENE  Q+  V+       WMH G + ++N+KMSKSL NF   +++L+ Y    VR+F  +  Y +PLN++  +L ++++ LE +     + K+H       +     + +N  + +  +  + ++FN P  V+ +
  S:     2 LKIYDTLTRSRREFIPLTPGEVRMYVCGMTVYDYCHLGHARVLVVFDSVVRWLQTLGYKVIYVRNITDVDDKIIRRALENHEPFSALTARYIQAMEEDAMALGVISPSFE-PRATEYVDSMIAMIESLLNRELAYVASNGDVFYDVRRFPGYGKLSGKSLDDLRAGERVEIDTNKRDPLDFVLWKAAKPDEPSWDSPWGKGRPGWHIECSAMSEHYLGDQFDIHGGGQDLQFPHHENEIAQSEGVHGHSHVNYWMHNGFVRVDNEKMSKSLGNFFTVREVLTRYQPEVVRFFIVRAHYRSPLNYSDAHLNDARSALERL---YTVLKNHAPSQDSEVATAVIDWENNVYARRFMSAMNDDFNTPEAVAVL 367
>gi|151571482|gb|EDN37136.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. novicida GA99-3548] (459 aa)
Score = 650, Expect = 6.8e-66, Identities = 153/424 (36%), Positives = 236/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNLFD----------DEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NITDIDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   +GDV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++ +           E  +L+ +  + K++KN++ +D+ R  L ++ ++
  S:    17 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIKAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGII 446
>gi|194539051|ref|YP_002074112.1| cysteinyl-tRNA synthetase [Vibrio sp. Ex25] >gi|151937606|gb|EDN56460.1| cysteinyl-tRNA synthetase [Vibrio sp. Ex25] (460 aa)
Score = 650, Expect = 6.9e-66, Identities = 151/435 (34%), Positives = 241/435 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF-------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR +  I +I   +QK++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE +  +L     +            E+       + ++FN P   S + +  +  +  L+ +N E+ ++L   L   L  ++GI+H +   F       DDE  E   L+   N  +  K+++ +D  R  L E
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGESCDSLTERLIGEMHADFDALNMKRPDIE-PRATQFIPEIIELVQKLIERGFAYVADNGDVMFEVRKFDEYGKLSKQDLDQLQAGARVDVETAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGDHFDIHGGGSDLQFPHHENEIAQSCCAHDTKYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSLRGLDLN-----AAPAGGEEYVSRFTAAMNDDFNTPEAYSVLFDMAREVN-RLKTENLEKASELG-ALMRELADVIGILHQDPEAFLKGDAGNDDEVAEIEALIKLRNDSRAAKDWANADMARDKLTE 443
>gi|146304825|ref|YP_001192141.1| cysteinyl-tRNA synthetase [Metallosphaera sedula DSM 5348] >gi|187631639|sp|A4YIG5|SYC_METS5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|145703075|gb|ABP96217.1| cysteinyl-tRNA synthetase [Metallosphaera sedula DSM 5348] (465 aa)
Score = 650, Expect = 6.9e-66, Identities = 158/433 (36%), Positives = 252/433 (58%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN-IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK-KNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFK-------SHLIIEQ--KYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE-------KIKYSS----ILLRNKNFEELNK----LHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           M++++ + K  +     + N +KMYVCGPTVY+ VHIG+ R  + FD ++R     GYNV  + NITDIDDKI+NKA+E      E+S YY   Y + +  + +       P+V+ HIK+I +++Q+++++  AY+ +G VYFD      YG++SN K +E    D+ E+ +K K +P DFALWK    G   W+  +  GRPGWH ECS +  +YLG +IDIHGGG+DL FPHHENE  Q  ++      + WMHV  L I  +KMSKS  N +  K+ LS+Y  +T+R++F  + Y NP+ ++ E L  S   L+ +   +++ +       +H   E+  K  E+ +         + N+F+  N ++ I E       K++YS      L+    F + N+    +    S  L ++  +I      D  IE+    N L++++ +  SD+ R +L
  S:     1 MQVFNTLGKRLQSFEPHEPNTVKMYVCGPTVYDEVHIGHGRTFVAFDAMSRYLRVKGYNVVRVQNITDIDDKIINKARELGKSWNEVSEYYSKSYLEHIGALKVKID--MHPKVTTHIKEIIDFVQRLIDSGHAYVANGSVYFDVDTYPGYGELSNVKKEEW---DQGEEIVKEKRHPYDFALWKAYKPGEPYWESPWGKGRPGWHIECSTMSTRYLGTKIDIHGGGMDLVFPHHENERAQTESLTGSTWVKYWMHVAFLTIRKEKMSKSKGNIVPLKEALSKYGPSTLRYWFLSSQYRNPIEYSEEILEQSSRSLQRLKDAISVLRKIIQKGPAHYAKEEDVKVQEEIVRAISRFDEHMENDFDTSNALTSIHEIASIVFSKLQYSEDVFGALIALDGFRKFNEVFAVMDEEFSAELDRLTKVI------DAVIEVR---NYLRKKQMYDLSDQIRDIL 446
>gi|194545874|ref|YP_002080902.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa C3719] >gi|126166820|gb|EAZ52331.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa C3719] (460 aa)
Score = 650, Expect = 7.0e-66, Identities = 131/319 (41%), Positives = 198/319 (62%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN-----IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           ++IY+ +SKT KEV   L    ++MYVCG TVY++ H+G+ R ++ FDV+ R     GY++T++ NITDIDDKI+N+A E       + E  +++ +E +       +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S +++++L +G + E    K +P DF LWK    G  +W   +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A+ W+H G + IN +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ENL  +K  L+   YN
  S:     2 LQIYNTLSKT-KEVFTPLVGNQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLRHRGYDLTYVRNITDIDDKIINRANENGEPFDVLTERMIAAMHEDE-----ARLNILKPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFAGYGKLSRRRVEDLRIGARIEPGEAKEDPLDFVLWKGAKPGEPSWSSPWGEGRPGWHIECSVMSTCCLGDSFDIHGGGNDLEFPHHENEIAQSEAATGKPYAKSWLHCGMITINGEKMSKSLGNFFTIREVLEKYHPEVVRYLLIASHYRSPINYSEENLREAKAALDR-FYN 321
>gi|15596992|ref|NP_250486.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa PAO1] >gi|194551121|ref|YP_002086148.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa 2192] >gi|21264027|sp|Q9I2U7|SYC_PSEAE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|9947777|gb|AAG05184.1|AE004605_6 cysteinyl-tRNA synthetase [Pseudomonas aeruginosa PAO1] >gi|126193514|gb|EAZ57577.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa 2192] (460 aa)
Score = 650, Expect = 7.0e-66, Identities = 131/319 (41%), Positives = 198/319 (62%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN-----IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           ++IY+ +SKT KEV   L    ++MYVCG TVY++ H+G+ R ++ FDV+ R     GY++T++ NITDIDDKI+N+A E       + E  +++ +E +       +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S +++++L +G + E    K +P DF LWK    G  +W   +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A+ W+H G + IN +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ENL  +K  L+   YN
  S:     2 LQIYNTLSKT-KEVFTPLVGNQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLRHRGYDLTYVRNITDIDDKIINRANENGEPFDVLTERMIAAMHEDE-----ARLNILKPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGKFAGYGKLSRRRVEDLRIGARIEPGEAKEDPLDFVLWKGAKPGEPSWSSPWGEGRPGWHIECSVMSTCCLGDSFDIHGGGNDLEFPHHENEIAQSEAATGKPYAKSWLHCGMITINGEKMSKSLGNFFTIREVLEKYHPEVVRYLLIASHYRSPINYSEENLREAKAALDR-FYN 321
>gi|29654778|ref|NP_820470.1| cysteinyl-tRNA synthetase [Coxiella burnetii RSA 493] >gi|153209422|ref|ZP_01947398.1| cysteinyl-tRNA synthetase [Coxiella burnetii 'MSU Goat Q177'] >gi|154707364|ref|YP_001423944.1| cysteinyl-tRNA synthetase [Coxiella burnetii Dugway 5J108-111] >gi|165919402|ref|ZP_02219468.1| cysteinyl-tRNA synthetase [Coxiella burnetii RSA 334] >gi|187629807|sp|A9KBJ2|SYC_COXBN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216302|sp|Q83BL7|SYC_COXBU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|29542046|gb|AAO90984.1| cysteinyl-tRNA synthetase [Coxiella burnetii RSA 493] >gi|120575359|gb|EAX31983.1| cysteinyl-tRNA synthetase [Coxiella burnetii 'MSU Goat Q177'] >gi|154356650|gb|ABS78112.1| cysteinyl-tRNA synthetase [Coxiella burnetii Dugway 5J108-111] >gi|165916918|gb|EDR35522.1| cysteinyl-tRNA synthetase [Coxiella burnetii RSA 334] (458 aa)
Score = 650, Expect = 7.3e-66, Identities = 154/435 (35%), Positives = 245/435 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD-----------DEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MKI++ ++K  KE+   ++   +K+YVCG TVY+++HIG+ R  I FD++ R     GY VTF+ NITDIDDKI+ +A E       L+  +     +  K + + + + + PR + ++ +I   IQK+++N++AY   +GDV+FD  +   YGK+S++ LDEL  G + E +  K +P DF LWK+   G   WD  +  GRPGWH ECS + +  LG   DIHGGG+DLKFPHHENE  Q+ A   K   ++WMH G L IN +KMSKSL N I  ++ L E +   +R+F     Y NPL+++ ENL N +  LE     L   +   ++    +EK   +       + ++FN P   + + E ++  +    N   E+   L   L   L  I G++  +               E  +L+++ N+ + +K++  +D+ R  L +
  S:     1 MKIFNSLTK-QKEIFKPIESGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVVRYLRMRGYEVTFVRNITDIDDKIIKRAGENKESPAALAERFIQILHEDEKALRVLSPDQE-PRATQYVPEIIKLIQKLLDNQYAYTGQNGDVFFDVRRFKDYGKLSHRHLDELQAGARVEVSDSKRDPLDFVLWKKAKPGEPKWDSPWGEGRPGWHIECSAMSSSILGQPFDIHGGGLDLKFPHHENEIAQSEAGEEKPFVKLWMHAGLLEINKEKMSKSLGNIISIREALKESDVEVLRYFLLSGHYRNPLSYSKENLENGRLALERFYLAL---RGLPVVN---HEKTSSYTDRFYEAMDDDFNTPIAFALLFEMVREINRFRDNNQIEKAAVLAAELK-CLGNIFGLLQYSPEQFLQGAKKEADVQEIKKLIDQRNEARAKKDWKTADQIRDQLTD 441
>gi|93005831|ref|YP_580268.1| cysteinyl-tRNA synthetase [Psychrobacter cryohalolentis K5] >gi|109894926|sp|Q1QC19|SYC_PSYCK Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|92393509|gb|ABE74784.1| cysteinyl-tRNA synthetase [Psychrobacter cryohalolentis K5] (488 aa)
Score = 650, Expect = 7.4e-66, Identities = 159/433 (36%), Positives = 240/433 (55%)
  Q:     3 IYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSH----LIIEQKY--------------NEKNLEFDKSNLIE----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLME 435
           IYD ++   +    L    + MYVCG TVY++ HIG+ R ++ FD+  R   +LGY+V ++ NITDIDDKI+ +A E  E IG L  +  + T   +    +   + + + PR +DHI +++  I+ +V+N +AY  D GDVY+       YGK+S + LD++  G + E    K NP DF LWK        W   +  GRPGWH ECS +  K LG+  DIHGGG DL+FPHHENE  Q+ A    + AR WMHVG +N++ +KMSKSL NF   +D++++Y   TVR+F   + Y + +NF+   L  S N L  +   L + +      LII++                   N +F+ S  I     L  + N  +    +E   + +  L      + LN L   +   L  ++G +  +   DEAI+ L+ +    K  KNF+ +D+ R  L E
  S:    16 IYDSLTGRKQAFKPLATGKVGMYVCGMTVYDYCHIGHARVMVGFDMAVRWLAQLGYDVNYVRNITDIDDKIITRAAENGEEIGTL--TQRFITAMHEDATALGCLSPDAE-PRATDHIDEMQQMIETLVSNDYAYAGDNGDVYYAVDSFADYGKLSKRNLDDMQAGSRVEVENDKRNPFDFVLWKAAKPDEPQWASAWGQGRPGWHIECSAMSTKCLGNTFDIHGGGHDLQFPHHENEIAQSEAATGCEYARNWMHVGFINVDGEKMSKSLGNFFTIRDVMAKYLPETVRFFLLSSHYRSQVNFSDSALDESHNSLSRLYQALKVAEQQKGKVLIIDEALINNAYASAVGQDFIKAMNDDFNSSTAISVLFGLARDINKASKAQDVETAWQLAQHL--KALAQTLNILQQPVQQFLQAVIGEVAEDSLTDEAIDGLIIERADAKTNKNFARADEIRVQLKE 471
>gi|116514575|ref|YP_813481.1| cysteinyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274693|sp|Q048S9|SYC_LACDB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116093890|gb|ABJ59043.1| cysteinyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (474 aa)
Score = 649, Expect = 1.1e-65, Identities = 159/435 (36%), Positives = 248/435 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS----EDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINS-------KNQLENIIYNLNIFKSHLI---IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKI-------------KYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI--ELLNKWNKLKQEKNFSESDKYRKLLME 435
           MK+++ +++  +E   L    + MYVCGPTVYN++HIGN R  I FD + R F   GY V ++ N TD+DDK++N+A  E     EL+  Y   + +  + +NI  + +  PR +  I  I ++IQ +++  +AY  DGDVY+   K   YG +S++ +D+L  G       E+  +K +P DFALWK  +    + WD  +  GRPGWH ECS +  KYLGD +DIHGGG DL+FPHHENE  Q+ A   K     W+H G + +  + +KMSKSL NF+   D+L   +   +R+F     Y + +N++ ENL  +       KN LE I Y L      L    + +   E   +F+ +    + ++FN+ N ++ I E +             K S  L   K    L+    ++  LL K  G       DD+A+  EL+ +  + ++ K++++SD+ R  L E
  S:     1 MKLFNTLTRQKEEFKPLVPGQVSMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYKGYKVNYVSNFTDVDDKMINEAGAEGTTVPELAERYIQAFLEDTRALNIEEATLH-PRATHEIPAIIDFIQTLIDKGYAYEADGDVYYRAKKFADYGHLSDQNIDQLEEGASQHVNDEEQGRKEDPIDFALWKGQKAADEIAWDSPWGKGRPGWHIECSVMSTKYLGDTLDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWLHNGFVTVGKDEEKMSKSLHNFVTVYDILKNVDPQVLRFFMASVQYRSQINYSEENLEQAANILGRFKNTLEGINYRLADATEGLPDPDLAKLVTETTAKFEAA----MDDDFNVQNALTAIYEALPAVNSNANAEKADKESLRLFAKKLAAWLSVFGLDVDKLLAKEAG-------DDDAVIEELVAQRTEARKNKDWAKSDELRDQLKE 457
>gi|85713337|ref|ZP_01044354.1| cysteinyl-tRNA synthetase [Idiomarina baltica OS145] >gi|85692839|gb|EAQ30820.1| cysteinyl-tRNA synthetase [Idiomarina baltica OS145] (460 aa)
Score = 649, Expect = 1.1e-65, Identities = 150/415 (36%), Positives = 232/415 (55%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL-------FDDEA--IE-LLNKWNKLKQEKNFSESDKYRKLLME 435
           + MYVCG T Y+  HIG+ R  + FDV+ R   ++GY+VT++ NITD+DDKI+ +A E       L+  Y  +       +N+   +++ PRV+ H+ DI   I+ +V   +AY  D GDV FD +  + YG++S + L++L  G + +    K +P DF LWK+   G  +WD  +  GRPGWH ECS +   +LG+  DIHGGG DL FPHHENE  Q+   N  +    WMH G + +++ KMSKSL NF   +D+L+ Y+  TVR+F   + Y + LN+T +NL  +   LE +   L      L  EQ      L +       + ++FN P  +S + E ++  +   R+ + E   +L   L   L  +LG++  +         DDE   IE L+ + NK + EK+++ +D+ R  L E
  S:    24 VGMYVCGVTTYDLCHIGHARTYVAFDVVVRYLRKIGYDVTYVRNITDLDDKIIKRAAENGEPFDALTQRYIDEMHRDFAALNLLEPDVE-PRVTQHMDDIIRMIESLVTQGYAYQADNGDVLFDVSTFDDYGRLSRQNLEQLQAGARVDVEASKLDPLDFVLWKKAKAGEPSWDSPWGEGRPGWHIECSAMNKAHLGETFDIHGGGSDLTFPHHENEIAQSCCANQTNYVNYWMHSGMVQVDDVKMSKSLGNFFTIRDVLNAYDAETVRYFLLSSHYRSQLNYTQDNLEQAHAALERLYTALR----GLTPEQPDENLRLPYWNQFTDAMNDDFNAPEAMSVLFELVREIN-KARDNDAERAAQLAHVLVE-LADVLGLLQQSPESFLQGGADDEVALIEALIAQRNKARAEKDWAAADEARDRLTE 443
>gi|107101226|ref|ZP_01365144.1| hypothetical protein PaerPA_01002258 [Pseudomonas aeruginosa PACS2] (460 aa)
Score = 648, Expect = 1.3e-65, Identities = 131/319 (41%), Positives = 198/319 (62%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN-----IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           ++IY+ +SKT KEV   L    ++MYVCG TVY++ H+G+ R ++ FDV+ R     GY++T++ NITDIDDKI+N+A E       + E  +++ +E +       +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   K   YGK+S +++++L +G + E    K +P DF LWK    G  +W   +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A+ W+H G + IN +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ENL  +K  L+   YN
  S:     2 LQIYNTLSKT-KEVFTPLVGNQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLRHRGYDLTYVRNITDIDDKIINRANENGEPFDVLTERMIAAMHEDE-----ARLNILKPDQE-PRATDHIAGMHAMIQILIDKGYAYAPGNGDVYYRVGKFAGYGKLSRRRVEDLRIGARIEPGEAKEDPLDFVLWKGAKPGEPSWSSPWGEGRPGWHIECSVMSTCCLGDSFDIHGGGNDLEFPHHENEIAQSEAATGKPYAKSWLHCGMITINGEKMSKSLGNFFTIREVLEKYHPEVVRYLLIASHYRSPINYSEENLREAKAALDR-FYN 321
>gi|116749069|ref|YP_845756.1| cysteinyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB] >gi|171460796|sp|A0LIR9|SYC_SYNFM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|116698133|gb|ABK17321.1| cysteinyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB] (493 aa)
Score = 648, Expect = 1.3e-65, Identities = 146/436 (33%), Positives = 248/436 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI--IEQKYNEKNLEFDKSNLIE------------LTNNFN----LPNIVS-----------FIEEKIKYSSILLRNKNFEELNKLHFNLSYLL---------TKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           + +Y+ ++K+ +E + L+   +K YVCG TVY+  HIG+ R  I FDV+ R    LG+ VT++ N TD+DDKI+ +A +       ++  Y   +++ +  + +   +++ P  ++++  +   I+ +++   AY    DV+F+  K   YGK+S ++++++L G + E + +K NP DF LWK +  G  +WD  +  GRPGWH ECS + +++LG   DIHGGG DL FPHHENE  Q+ A       R W+H G +NINN+KMSKSL NF+  +D+L + +  TVR+F     Y +P++F+ E +  ++  LE +   L   K      +E+ + EK L      L +            + N+FN    L N+ S           F  +++K  +  L     + +      L  L           + L I    L + E    +    + +Q+KNF+E+D+ R+ + +K
  S:     3 LHVYNTLTKSKEEFIPLEPGKVKFYVCGVTVYDLSHIGHARSAIVFDVIYRYLRFLGFEVTYVRNFTDVDDKIIRRANDAGTDCRSIAQRYIAAFYEDMDALGVLRPDLE-PLATENVPGMIEIIRVLMDKGIAYQAGADVFFEIEKFPGYGKLSGRQIEDMLAGARVEVDARKRNPLDFVLWKGSKPGEPSWDSPWGPGRPGWHIECSAMGSRFLGKTFDIHGGGKDLIFPHHENEIAQSEAAFGMPFVRYWLHNGFVNINNEKMSKSLGNFLTIRDVLQKVHPETVRFFVLSKHYRSPVDFSDETIGEAEKGLERLYGTLGAVKERAAAGVEEAFQEKALRGQDPELFDQIAALSGAFREAMDNDFNTAQALGNLFSLQRHLQRFLDKFGRKQLKGPASALARAGADAIRDHALVLGLLTREPEAFQAEQRSLKIKSTGLTEAEVERCIELRRQARQDKNFAEADRLREEIEKK 477
>gi|15383990|gb|AAK96068.1|AF393466_2 cysteinyl-tRNA synthetase [uncultured crenarchaeote 74A4] (462 aa)
Score = 648, Expect = 1.4e-65, Identities = 157/433 (36%), Positives = 246/433 (56%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL---INSKNQLENIIYNL--NIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD---EAIELLNKWNKLKQEKNFSESDKYRKLL 433
           M + D ++  ++E+ + KK IK+Y+CG TVY+  HIG+ R II FDVL +        V F+ N TD+DDKI+N+A +EN+   E+SS Y   YF   + +N+  +   +P+ ++HI+DI  +I+K+++ + AY+    VYF  +K ++YGK+S KK+DEL  G + + +  K +P DFA+WK + I   W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+ A  N   A+IWMHVG + I+ +KMSKSL N    K +L  +  N +R F     YS  ++++ + L   +    Q+E   + L     K+   + +   +  +EFDKS   +   +  L      ++E  + ++     K    + K  F     ++ ILG+    +  +   E  EL+    K ++EK F ++DK R  L
  S:     1 MNLQDTLTTVEQELDITKK-IKIYLCGVTVYDESHIGHARTIIVFDVLRKYLESKKVEVDFVQNFTDVDDKIINRATKENVTAEEISSKYIENYFRDFEELNVKRAT-NYPKATEHIEDIIEFIKKLIDKEIAYVTKNGVYFAVSKFSEYGKLSKKKIDELQSGSRIQIDETKKDPADFAVWKFSDINPTWESPWGKGRPGWHIECSVMSLKYLGENFDIHGGGRDLIFPHHENEIAQSEACTNLPFAKIWMHVGMVTISGEKMSKSLGNTKSIKQVLENWGPNIIRLFCLSGHYSKVIDYSEDMLKENLTKWRQVETCYFELIHANNKNQENVSENVQKIGIEFDKSLEDDFNTHLALSAFFQLVKETNRLAAAEKLGKENGAIIKKEFK---RISAILGLTIPEMSQNKIQEIDELILNREKFREEKQFDKADKIRDEL 436
>gi|152989578|ref|YP_001348862.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa PA7] >gi|187629850|sp|A6V727|SYC_PSEA7 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|150964736|gb|ABR86761.1| cysteinyl-tRNA synthetase [Pseudomonas aeruginosa PA7] (460 aa)
Score = 648, Expect = 1.4e-65, Identities = 130/319 (40%), Positives = 198/319 (62%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN-----IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           ++IY+ +SKT KEV   L    ++MYVCG TVY++ H+G+ R ++ FDV+ R     GY++T++ NITDIDDKI+N+A E       + E  +++ +E +       +NI   + + PR +DHI  +   IQ +++  +AY   +GDVY+   +   YGK+S +++++L +G + E    K +P DF LWK    G  +W   +  GRPGWH ECS +    LGD  DIHGGG DL+FPHHENE  Q+ A   K  A+ W+H G + IN +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ENL  +K  L+   YN
  S:     2 LQIYNTLSKT-KEVFTPLVGNQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLRHRGYDLTYVRNITDIDDKIINRANENGEPFDVLTERMIAAMHEDE-----ARLNILKPDQE-PRATDHIAGMHAMIQTLIDKGYAYAPGNGDVYYRVGRFAGYGKLSRRRVEDLRIGARIEPGEAKEDPLDFVLWKGAKPGEPSWSSPWGEGRPGWHIECSVMSTCCLGDSFDIHGGGNDLEFPHHENEIAQSEAATGKPYAKSWLHCGMITINGEKMSKSLGNFFTIREVLEKYHPEVVRYLLIASHYRSPINYSEENLREAKAALDR-FYN 321
>gi|152990845|ref|YP_001356567.1| cysteinyl-tRNA synthetase [Nitratiruptor sp. SB155-2] >gi|166225301|sp|A6Q401|SYC_NITSB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|151422706|dbj|BAF70210.1| cysteinyl-tRNA synthetase [Nitratiruptor sp. SB155-2] (465 aa)
Score = 647, Expect = 1.6e-65, Identities = 165/433 (38%), Positives = 254/433 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI--GLNWDLKFSTGRPGWHTECSCLINKYLGD-----QIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN--IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHF--NLSYLLTKILGI--------IHVNLFDDEAI---ELLNKWNKLKQEKNFSESDKYRKLL 433
           M IYD   K    +  L  ++IK+YVCGPTVY+  H+G+ R  I FD+L R    LGY  TF+ N TDIDDKI+ K  E      E++SYY  +Y + ++ + +  ++++ P+ + ++  + + I++++  + AY   +GD+YFDT+K  +Y  +S+K  +E +   + E N  K NP DFALWK+      + +D  F  GRPGWH ECS +I+K+L       QIDIH GG DL FPHHENE  Q     N++LA+ WMH G + I+ +KMSKSL N    KD L  Y+   +R++   T Y + LNF  E+L+ SK +L+  +Y L   ++       QK      EF    L  L+ + N+   ++ I++ I Y++  L N   ++  K     N+ Y ++K+LGI         H+ + ++E     EL+ K    K+EKNF  +D  R+ L
  S:     1 MVIYDSSKKEYCSLEPLKNRHIKVYVCGPTVYDDAHLGHARSAIAFDLLRRTLNALGYKTTFMKNFTDIDDKIIKKMNETGKSLQEITSYYIQRYLEDMEALGVQRADIE-PKATQNLDAMIDMIERLLQKECAYQTPNGDIYFDTSKDEKYCTLSHKCDEESM--SRIEPNPDKKNPADFALWKRCKGEGDVCFDSPFGKGRPGWHIECSAMIDKHLAYHDTPFQIDIHAGGADLLFPHHENEAAQTRCACNQELAKYWMHNGFVTISGEKMSKSLGNSFFIKDALKVYDGEILRFYLLSTHYRSDLNFNEEDLLASKKRLDK-LYRLKKRVYGVQASTPQK------EFVDELLQALSQDLNISKTLAAIDQFIAYANEHLDNNPKDKAFKKQIVANIEY-ISKLLGIGHKDAYSYFHLGISEEEKQKIEELIEKRTTAKKEKNFQLADSIREEL 446
>gi|118587321|ref|ZP_01544748.1| cysteinyl-tRNA synthetase [Oenococcus oeni ATCC BAA-1163] >gi|118432310|gb|EAV39049.1| cysteinyl-tRNA synthetase [Oenococcus oeni ATCC BAA-1163] (467 aa)
Score = 647, Expect = 1.6e-65, Identities = 148/410 (36%), Positives = 242/410 (59%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDN----LKKNNPQDFALWK-QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTN-TVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI-------IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD------EAIE-LLNKWNKLKQEKNFSESDKYR 430
           I MYVCGPTVYN++H+GN R  I FD + R  L  GY+V F+ N TD+DDKI+N+A+EE + E  ++S Y   +++  K +NI  +  +  R ++ I DI  ++  +++  +AY   GDVYF   K+  YG ++++ L++L VG     +      K +P DFALWK +    + WD  +  GRPGWH ECS +  KYLGD IDIHGGGIDL FPHH +E  Q+ A   K     W+H G +N+NN+KMSKSL NF    +LLS Y+    +R+    T Y  P+N+++  L  ++ +L+ I       K+          I+Q  +++   F ++    + ++FN+ N ++ I E ++ ++  + + + ++  K    +   + +++G+  ++  +       + IE LL K    +  KN+ +SD+ R
  S:    23 ITMYVCGPTVYNYIHVGNARSSIAFDTIRRYLLYRGYDVNFVSNFTDVDDKIINRAQEEGVSENAIASKYIKAFYEDTKPLNIIPATTR-TRATEVIPDIIEFVSDLIDKGYAYESRGDVYFRVRKAGNYGLLAHENLEDLEVGASGRLDDGALALKEDPLDFALWKNEPRQVIKWDSPWGQGRPGWHIECSVMSTKYLGDTIDIHGGGIDLAFPHHTDEMAQSEAHTGKQFVHYWLHNGFVNVNNEKMSKSLGNFTTVHELLSSYDDPMAIRFLMTATHYRRPINYSSSELERARVELDRIRTAYRRLKNADFKIGDDPQIDQLVSKQTAAFVEA----MDDDFNVANALAAIFELVRLANSYVDSGDVKD--KSAQEILRQIAELIGVFGISGLETKKESLPKKIELLLKKRETARINKNWQQSDQLR 445
>gi|88860441|ref|ZP_01135079.1| cysteinyl-tRNA synthetase [Pseudoalteromonas tunicata D2] >gi|88817639|gb|EAR27456.1| cysteinyl-tRNA synthetase [Pseudoalteromonas tunicata D2] (459 aa)
Score = 647, Expect = 1.7e-65, Identities = 146/433 (33%), Positives = 254/433 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           ++IY+ +++  ++   +    I MYVCG T+Y++ H+G+ R  ++FDV+NR F  LGY+VT++ NITD+DDKI+ +A E N    +L+        +    +N+  ++++ P V+ HI +I   +++++    AY+  +GDV FD +    YG +S + L  L  G + E ++ K++P DF LWK+      +W   +  GRPGWH ECS + +K+LGD  DIHGGG DL+FPHHENE  Q+   + +     W+H G + +N +KMSKSL+NF   +++L +Y+  TVR+F     Y + LN++ ENL  +++ LE I   L    +   ++   NE   +F ++    + ++FN P  +  + E  K  +  +++ +  +  +L F L   +T++LGI        +  N  +DE  +   L+ + N+ + +KN++ +D  R  L
  S:     2 VQIYNTLTRQKEQFKPMVAGKISMYVCGITIYDYCHVGHARTYVSFDVMNRYFRHLGYDVTYVRNITDVDDKIIKRAHENNEEINDLTVRMTKAMHEDFNALNMLPADIE-PTVTGHIPEIITMVERLIEKGHAYIAGNGDVLFDVSTFAAYGALSQQDLSMLQAGARVEVDMGKDDPLDFVLWKKAKPEEPSWGSPWGAGRPGWHIECSAMSSKHLGDHFDIHGGGSDLQFPHHENEIAQSCCASGQKYVNTWIHTGMVQVNKEKMSKSLNNFFTVREVLKQYDRETVRFFLINGHYRSQLNYSQENLDQARSSLERIYTALRGV-TPTPVDLAANEYVAKFRQA----MNDDFNTPEALPVVFELAKEIN-RVKDSDSSKAAELAFVLK-AITEVLGIAQQEPESFLQGNQDEDEVAQIEALIAQRNQARADKNWALADDARDKL 440
>gi|149194602|ref|ZP_01871698.1| cysteinyl-tRNA synthetase [Caminibacter mediatlanticus TB-2] >gi|149135346|gb|EDM23826.1| cysteinyl-tRNA synthetase [Caminibacter mediatlanticus TB-2] (464 aa)
Score = 647, Expect = 1.8e-65, Identities = 167/435 (38%), Positives = 263/435 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGD----QIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEEL--NKLHFNLSYLLTKILGIIHVNLFD------DEAI-----ELLNKWNKLKQEKNFSESDKYRKLLME 435
           MKIYD   K   E + + +K +++YVCGPTVY+  H+G+ R  I+FD+L R    LGY VTF+ N TDIDDKI+ K  E      E++ YY  +Y + +  +N+  ++++ P+ +  ++ +   IQ +++  +AY L +GD+YFD +K  +Y K+SNK  D+ +V     +   K NP DFALWK  +    + +D  F  GRPGWH ECS +I K++      +IDIHGGG DL FPHHENE  Q+       LA+ WMH G + IN +KMSKSL N    KD L  Y+   +R++   T Y  PLNF+ E+LI SK +L+  +Y L   K    + +K  +K+  F+++ L  ++++ N+   ++ ++E IK ++  L     +++   K+  N+ + + K+LG+   + ++      DE       EL+ K ++ K+EKNF  +DK R  L E
  S:     1 MKIYDSHLKEKVEFIPIKEKEVRIYVCGPTVYDDAHLGHARSSISFDLLRRTLECLGYKVTFVKNFTDIDDKIIKKMNETKKSLKEITEYYIKRYLEDMDALNVKRADIE-PKATQSLEAMFEIIQILLDKGYAYKLPNGDIYFDVSKDEEYCKLSNKCQDDEVVHRVEIEG--KKNPADFALWKACKGESDVCFDSPFGKGRPGWHIECSAMIKKHIAYDGEYEIDIHGGGADLFFPHHENEEAQSHCAYGGHLAKYWMHNGFVQINGEKMSKSLGNSFFIKDALKHYSGEVLRFYLMSTHYRAPLNFSEEDLIASKKRLDK-LYRLK--KRIYGVSKKQQDKS--FEENLLNAMSDDLNISKALAVVDEFIKDANENLDKNPKDKILKQKIVSNIEF-INKLLGVGGSDAYEYFQAGIDEETKKKIEELIAKRSEAKKEKNFELADKIRDELKE 447
>gi|116495760|ref|YP_807494.1| cysteinyl-tRNA synthetase [Lactobacillus casei ATCC 334] >gi|116105910|gb|ABJ71052.1| cysteinyl-tRNA synthetase [Lactobacillus casei ATCC 334] (444 aa)
Score = 647, Expect = 1.8e-65, Identities = 129/294 (43%), Positives = 181/294 (61%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK---SEDNL-KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           MYVCGPTVYN++HIGN R  I FD + R F   GY VT++ N TD+DDKI+N A +     L+L+  +   + +    + I  +    PR S  I DI  ++Q +++ ++AY VDGDVY+   K   YG++S++ +DEL  G     ++D L KK +P DFALWK    G ++W+  +  GRPGWH ECS +  K LGD  DIHGGG DL+FPHHENE  Q+ A  +K   R WMH G + I  +++KMSKSL NFI   D+    +   +R+F   T Y  P+ ++  NL N+ N L  +
  S:     1 MYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYRGYKVTYVSNFTDVDDKIINAAHKTGEAPLDLAQRFIDAFMEDTTALGIEPATAH-PRASQMIPDIIEFVQDLIDKEYAYAVDGDVYYRARKFKHYGELSHQNVDELEEGASQHITQDELAKKEDPIDFALWKAAKPGEISWESPWGKGRPGWHIECSVMSTKLLGDTFDIHGGGQDLEFPHHENEIAQSEAKTDKQFVRYWMHNGFVTIGEDDEKMSKSLGNFITVHDIRKTVDPQVLRFFMAGTQYRMPIRYSETNLKNAANSLNRL 300
>gi|42518493|ref|NP_964423.1| cysteinyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] >gi|61216256|sp|Q74L26|SYC_LACJO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|41582778|gb|AAS08389.1| cysteinyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] (470 aa)
Score = 647, Expect = 1.8e-65, Identities = 157/439 (35%), Positives = 258/439 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKN-----LEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLS-YLLTKILGIIHVNL------FDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MK+++ +++  +E   L    + MYVCGPTVYN++HIGN R +I FD + R F   GY+V ++ N TD+DDK++N+A++E+    +L+  Y   + +  + +NI  + +  PR +  IK+I +++Q +++   AY VDGDVY+   K   YG++S++ + EL  G       E+  KK +P DFALWK  +    + WD  +  GRPGWH ECS +  KYLGD IDIHGGG DL+FPHHENE  Q+ A   K     WMH G + +    +KMSKSL NF+   D+L + +   +R++     Y  P+N++ + L  ++  L+     L    + L  E +  E N     L   K+  IE + ++FN+ N +S + +    ++ L  +   ++++K     +  LL   L I  V+        DDE  +L+ + ++ ++ K+++ESD+ R  L  K ++
  S:     1 MKVFNTLTRKKEEFKPLVAGKVSMYVCGPTVYNYIHIGNARSVIAFDTIRRYFEYRGYDVNYVSNFTDVDDKMINEARKEHTTVEKLAERYIKAFMEDTEALNIEPATLH-PRATHEIKEIIDFVQDLIDKGVAYEVDGDVYYRARKFPNYGQLSDQNIAELEEGASEHINEEEQSKKEDPIDFALWKAQKEEDEIAWDSPWGKGRPGWHIECSVMSTKYLGDTIDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWMHNGFVTVGKKQEKMSKSLHNFVTVHDILKQIDPQVLRFYMSSVQYRRPINYSEDGLKQAETVLKRYQNTLRNLDARLNDENETLEDNGLRDDLTQAKAEFIEAMDDDFNVQNALSIMYD---LATTLNNHLQKDQVDKPALKRAKKLLIAWLEIFGVSFKEEQAENDDEIEKLIAQRDEARKNKDWAESDRLRDELQAKGIV 457
>gi|104774470|ref|YP_619450.1| cysteinyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|123077205|sp|Q1G8Z0|SYC_LACDA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|103423551|emb|CAI98469.1| Cysteinyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (474 aa)
Score = 646, Expect = 2.0e-65, Identities = 159/435 (36%), Positives = 248/435 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS----EDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINS-------KNQLENIIYNLNIFKSHLI---IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKI-------------KYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI--ELLNKWNKLKQEKNFSESDKYRKLLME 435
           MK+++ +++  +E   L    + MYVCGPTVYN++HIGN R  I FD + R F   GY V ++ N TD+DDK++N+A  E     EL+  Y   + +  + +NI  + +  PR +  I  I ++IQ +++  +AY  DGDVY+ T K   YG +S++ +D+L  G       E+  +K +P DFALWK  +    + WD  +  GRPGWH ECS +  KYLGD +DIHGGG DL+FPHHENE  Q+ A   K     W+H G + +  + +KMSKSL N +   D+L   +   +R+F     Y + +N++ ENL  +       KN LE I Y L      L    + +   E   +F+ +    + ++FN+ N ++ I E +             K S  L   K    L+    ++  LL K  G       DD+A+  EL+ +  + ++ K++++SD+ R  L E
  S:     1 MKLFNTLTRQKEEFKPLVPGQVSMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYKGYKVNYVSNFTDVDDKMINEAGAEGTTVPELAERYIQAFLEDTRALNIEEATLH-PRATHEIPAIIDFIQTLIDKGYAYEADGDVYYRTKKFADYGHLSDQNIDQLEEGASQHVNDEEQGRKEDPIDFALWKGQKAADEIAWDSPWGKGRPGWHIECSVMSTKYLGDTLDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWLHNGFVTVGKDEEKMSKSLHNCVTVHDILKNVDPQVLRFFMASVQYRSQINYSEENLEQAANILGRFKNTLEGINYRLADATEGLPDPDLAKLVTETTAKFEAA----MDDDFNVQNALTAIYEALPAVNSNANAEKADKESLRLFAKKLAAWLSVFGLDVDKLLAKEAG-------DDDAVIEELVAQRTEARKNKDWAKSDELRDQLKE 457
>gi|161830739|ref|YP_001597327.1| cysteinyl-tRNA synthetase [Coxiella burnetii RSA 331] >gi|187629808|sp|A9N924|SYC_COXBR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|161762606|gb|ABX78248.1| cysteinyl-tRNA synthetase [Coxiella burnetii RSA 331] (458 aa)
Score = 646, Expect = 2.4e-65, Identities = 153/435 (35%), Positives = 245/435 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFD-----------DEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           MKI++ ++K  KE+   ++   +K+YVCG TVY+++HIG+ R  I FD++ R     GY VTF+ NITDIDDKI+ +A E       L+  +     +  K + + + + + PR + ++ +I   IQK+++N++AY   +GDV+FD  +   YGK+S++ LD+L  G + E +  K +P DF LWK+   G   WD  +  GRPGWH ECS + +  LG   DIHGGG+DLKFPHHENE  Q+ A   K   ++WMH G L IN +KMSKSL N I  ++ L E +   +R+F     Y NPL+++ ENL N +  LE     L   +   ++    +EK   +       + ++FN P   + + E ++  +    N   E+   L   L   L  I G++  +               E  +L+++ N+ + +K++  +D+ R  L +
  S:     1 MKIFNSLTK-QKEIFKPIESGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVVRYLRMRGYEVTFVRNITDIDDKIIKRAGENKESPAALAERFIQILHEDEKALRVLSPDQE-PRATQYVPEIIKLIQKLLDNQYAYTGQNGDVFFDVRRFKDYGKLSHRHLDKLQAGARVEVSDSKRDPLDFVLWKKAKPGEPKWDSPWGEGRPGWHIECSAMSSSILGQPFDIHGGGLDLKFPHHENEIAQSEAGEEKPFVKLWMHAGLLEINKEKMSKSLGNIISIREALKESDVEVLRYFLLSGHYRNPLSYSKENLENGRLALERFYLAL---RGLPVVN---HEKTSSYTDRFYEAMDDDFNTPIAFALLFEMVREINRFRDNNQIEKAAVLAAELK-CLGNIFGLLQYSPEQFLQGAKKEADVQEIKKLIDQRNEARAKKDWKTADQIRDQLTD 441
>gi|156742112|ref|YP_001432241.1| cysteinyl-tRNA synthetase [Roseiflexus castenholzii DSM 13941] >gi|156233440|gb|ABU58223.1| cysteinyl-tRNA synthetase [Roseiflexus castenholzii DSM 13941] (478 aa)
Score = 646, Expect = 2.4e-65, Identities = 125/316 (39%), Positives = 194/316 (61%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINN---------QKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++T +   +L+   +KMYVCG TVY+  HIG+    I FDV+ R     GY V  + N TD+DDKI+N+A        EL+  Y  ++ + L+ +N+  +++ +PR ++ + +I+ +I +++    AY+VDGDVYF  + +  YGK+S + LD+++ G++   + +K NP DFALWK    G   WD  +  GRPGWH ECS +   +LG+QIDIHGGG DL FPHHENE  Q  ++  K  AR WMH G L I           +KMSKSL N +  ++ L+ Y+ + +R     +SY +PL F  E   + + +L  +
  S:     3 IRIYNTLTRTLEPFETLEPGVVKMYVCGVTVYDRAHIGHAMSAIVFDVVRRYLEYRGYAVQHVVNFTDVDDKIINRAHALGRDPKELAESYIAEFLEDLEALNVKRAHI-YPRATETMPEIQRFISRLIETGHAYVVDGDVYFRVSTAPDYGKLSRRSLDDMIAGNRIGIDERKENPADFALWKAAKPGEPFWDSPWGPGRPGWHIECSAMNLAHLGEQIDIHGGGTDLIFPHHENEIAQTESLTGKTFARYWMHNGMLQIQTRLADGTYKLEKMSKSLGNVVTIREFLARYHPDVLRLTVLSSSYRSPLAFGEEIAADQERKLARL 328
>gi|126658705|ref|ZP_01729850.1| cysteinyl-tRNA synthetase [Cyanothece sp. CCY0110] >gi|126619967|gb|EAZ90691.1| cysteinyl-tRNA synthetase [Cyanothece sp. CCY0110] (482 aa)
Score = 645, Expect = 2.9e-65, Identities = 161/436 (36%), Positives = 254/436 (58%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE------DNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYN-----EKNLEFDKSNLIE-----LTNNFNLPNIVSFIEE---KIKYSSILL--RNKNFEELNKLHFNLSYL--LTKILGI---IHVNLFD----DEA--IELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIY+  ++  +  ++L    + MY CG TVY++ H+G+ R  I +D++ R     GY VT++ N TDIDDKI+ +A++E +  +++S  +   YF  ++ +N+  ++ ++PRV+D+I  I+  IQ ++   +AY VDGDVYF      +YGK+S +    +  G           N  K +P DFALWK        W+  +  GRPGWH ECS ++   LG+ IDIHGGG DL FPHHENE  Q+ A N K LA+ W+H G + +N +KMSKSL NF   ++LL+   +   +R F  Q  Y  PL+FT E + ++ N  + +       +  L   +KY      +KN E D S +IE     + ++FN P  ++ + E    ++    LL    K   + + L      L  L  ILG+      NL D    DEA    L+ + N  ++ K++++SD+ R+ L +K
  S:     3 LKIYNTQTRRLEPFITLLPGRVTMYCCGVTVYDYCHLGHARSYIIWDMVRRYLQWRGYEVTYVQNFTDIDDKILRRAQQEGVSMVDISERFIEAYFTDIRPLNVMDAD-EYPRVTDNISGIQQLIQVLLEKNYAYAVDGDVYFHVEAFGEYGKLSGRSQSMMQAGASGRVAMSDPANSHKKHPSDFALWKSAKPEEPAWNSPWGEGRPGWHIECSAMVRGLLGETIDIHGGGGDLVFPHHENEIAQSEAANGKPLAKYWVHNGMVTVNGEKMSKSLGNFTTIRELLNRPLDPMVIRLFVLQAHYRKPLDFTEEAISSATNGWQTL-------QQGLRFGEKYGNRLGWQKNQELD-SAVIEQFNAAMDDDFNSPGGLAVLFELAKNLRREGNLLTHEGKTPTDSDNLQRQWQTLVHLAGILGLEAKPKANLEDTQNFDEAKITRLIQQRNAARKVKDYAQSDRIREQLQQK 464
>gi|118047029|ref|ZP_01515672.1| cysteinyl-tRNA synthetase [Chloroflexus aggregans DSM 9485] >gi|117996489|gb|EAV10687.1| cysteinyl-tRNA synthetase [Chloroflexus aggregans DSM 9485] (472 aa)
Score = 644, Expect = 4.2e-65, Identities = 125/300 (41%), Positives = 179/300 (59%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINN------QKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           ++MYVCG T Y+  HIG+    I FD++ R     GY V  I N TDIDDK++ +A+      L LS  Y  ++   L+ +N+  +   +PRVS  +  I  ++Q ++   +AY+VDGDVYF   +   YGK+S + LDE+L G + E + +K +P DFALWK    G   WD  +  GRPGWH ECS +  +YLG QIDIHGGG DL FPHHENE  Q+ ++  +  AR W+H G L + N      +KMSKSL N +   D LS Y+ +  R     +SY +PL +  E   +++ +LE ++  L
  S:    24 VRMYVCGVTPYDEAHIGHAMSAIVFDMIRRYLEFRGYQVRHIVNFTDIDDKVIARAQAMGQDPLALSGQYAAEFLTQLQAMNVLPAT-AYPRVSTTMPGIIAFVQGLIERGYAYVVDGDVYFRVKRDEDYGKLSGRSLDEMLSGTRFEVDPRKESPADFALWKAARPGEPAWDSPWGPGRPGWHIECSAMAMEYLGPQIDIHGGGTDLIFPHHENEIAQSESLTGQPFARYWVHNGMLQLVNPQTRQVEKMSKSLGNVVTIADFLSRYDPDVFRLIVLSSSYRSPLTYNDEIAADNQRKLERLLSAL 329
>gi|116617314|ref|YP_817685.1| cysteinyl-tRNA synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096161|gb|ABJ61312.1| cysteinyl-tRNA synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (468 aa)
Score = 644, Expect = 4.3e-65, Identities = 159/433 (36%), Positives = 248/433 (57%)
  Q:     3 IYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWKQTTIG--LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTV-RWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE---------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFN-LSYLLTKILGIIHV----NLFDDEAI-----ELLNKWNKLKQEKNFSESDKYRKLLME 435
           +Y+ +S+ +KEV   +    I MYVCGPTVYN++HIGN R  I FD + R F   GY V ++ N TD+DDKI+N+A+EE I ELE+++ Y   + +    +NI  + ++  R ++ I +I  +++ +++  +AY  +GDVYF   K   YG ++++ L E+          E+ ++K +P DFA+WK       ++W   +  GRPGWH ECS +  KYL + IDIHGGGIDL FPHH NE  Q+ A   +     WMH G +N+NN+KMSKSL NF    D+L+ Y+   V R+    T Y  P+N+    L  ++ +LE I         +L+   + +E   + D   LIE         + ++FN PN ++ I E +   +       + E N +  + + +LL  I  ++ V     L  +E +     ELL+K    ++  +F  SD  R  L E
  S:     4 VYNTLSR-EKEVFKPITAGKINMYVCGPTVYNYIHIGNARSAIAFDTVRRYFEYRGYEVNYVSNFTDVDDKIINRAQEEGISELEVANKYADAFDEDTLPLNIKPATVR-SRATEVIPEIIEFVKDLIDKGYAYESEGDVYFRAKKFKGYGILAHQDLAEMEANAAGRLNDEETIRKEDPIDFAVWKNEPREGVISWSSPWGNGRPGWHIECSVMAQKYLSNTIDIHGGGIDLAFPHHTNEIAQSEARTGQKFVNYWMHNGFVNVNNEKMSKSLGNFTTLHDMLATYDDPMVIRYLLTTTQYRRPINYEASTLEQARLELERI----RTAYRNLMFRAETSEPGGDEDVETLIEVQKKAFDQAMDDDFNTPNALAAIFELVSIGN------TYTERNTVKVDTVQHLLGTIADLLSVFGIEGLDGNEELTTKQRELLDKRVLARESHDFERSDLLRNQLKE 452
>gi|146307594|ref|YP_001188059.1| cysteinyl-tRNA synthetase [Pseudomonas mendocina ymp] >gi|187629851|sp|A4XVG1|SYC_PSEMY Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|145575795|gb|ABP85327.1| cysteinyl-tRNA synthetase [Pseudomonas mendocina ymp] (461 aa)
Score = 643, Expect = 4.4e-65, Identities = 129/319 (40%), Positives = 196/319 (61%)
  Q:     1 MKIYDFVSKT-DKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           + IY+ ++KT D    L    ++MYVCG TVY+  HIG+ R ++ FDV+ R   + GY+VT++ NITDIDDKI+ +A E     E + E  +++ +E +       +++   +++ PR + HI  +   IQ +++  +AY   +GDVY+  T+   YGK+S +K+DEL +G + E +  K +P DF LWK    G  +WD  +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A   K  A  WMH G + ++ +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ E+L  +K  LE   YN
  S:     3 LSIYNTLTKTKDVFQPLVGNQVRMYVCGMTVYDFCHIGHARVMVAFDVVTRWLRQRGYDVTYVRNITDIDDKIIKRANENGEPFEALVERMIAAMHEDE-----ARLSVLRPDIE-PRATGHIAGMHQMIQTLIDKGYAYAPGNGDVYYRVTRFETYGKLSRRKIDELKIGARIEVDEIKEDPLDFVLWKGAKPGEPSWDSPWGKGRPGWHIECSVMSTCCLGETFDIHGGGPDLVFPHHENEIAQSEAATGKQYANAWMHAGAVRVDGEKMSKSLGNFFTIREVLEKYHPEVVRYLLVSSHYRSPINYSEESLKEAKGALER-FYN 322
>gi|119505713|ref|ZP_01627782.1| cysteinyl-tRNA synthetase [marine gamma proteobacterium HTCC2080] >gi|119458423|gb|EAW39529.1| cysteinyl-tRNA synthetase [marine gamma proteobacterium HTCC2080] (458 aa)
Score = 643, Expect = 4.8e-65, Identities = 135/350 (38%), Positives = 194/350 (55%)
  Q:    17 DKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIK 366
           D   I +YVCGPTVYN  HIGN RP++TFD+L R+   L   V +  NITDIDDKI+  A+E N G   ++  +  +Y + +  +N  + +++ PR +++IK + + I +++    AY  +G V FD T    YG +S + L+++L G + E    K +P DF LWK +      WD  +  GRPGWH ECS +I  +LGD IDIHGGG DL FPHHENE  Q+      D  R W+H  +++++ +KMSKSL N    +DLL  Y    +R+    T Y +PLNF+ E L N+K  L N  Y      S +  E    E  L F       L ++ N P  ++ +    K
  S:    21 DPNRITLYVCGPTVYNLAHIGNARPVVTFDMLYRVLRALYPTVVYARNITDIDDKIIAAARERNEGIDAVTKEFTDKYREDMAQLNALSPDLE-PRATENIKPMCDLITQLIARGHAYAAEGHVLFDVTSMPSYGALSGRNLEDMLAGARVEVADYKRSPGDFVLWKPSAEDEPGWDSPWGWGRPGWHLECSAMIRAHLGDAIDIHGGGRDLIFPHHENERAQSCCGYGGDFVRYWLHNAYVDMDGEKMSKSLGNVRTVRDLLGLYPGEVLRFALLSTHYRSPLNFSGEVLDNAKLTL-NSFYQALRNTSDICPEDVRPEDTLAF-----TALLDDLNTPKAIAALHASCK 364
>gi|89093601|ref|ZP_01166548.1| Cysteinyl-tRNA synthetase, class Ia [Oceanospirillum sp. MED92] >gi|89081997|gb|EAR61222.1| Cysteinyl-tRNA synthetase, class Ia [Oceanospirillum sp. MED92] (461 aa)
Score = 643, Expect = 4.8e-65, Identities = 149/439 (33%), Positives = 242/439 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++IY+ ++K     + +++  IKMYVCG TVY+  HIG+ R ++ FDV+ R     G++V ++ NITD+DDKI+ +A E      EL+        +    +++     + PR + HI DI + ++ ++   FAY   +GDVY+   K   YGK++NK +DEL  G + E    K +P DF LWK    G ++WD  +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A N       WMH G + +N++KMSKSL NF   +D+L +YN   VR+F  +  Y   ++++ ++L  ++  LE        +++   ++        +F++  +  + ++FN P  VS + E +   +   R +   E   L   L   L  +LG++  N             L ++E  +L+    + K+ KNF+E+DK R  L  + ++
  S:     2 LQIYNTLTKEKSPFTPIEEGKIKMYVCGVTVYDLCHIGHARVMVAFDVITRFMRSQGWDVDYVRNITDVDDKIIKRAAENGEEPHELTERMIAAMHEDEARLSVLRPTQE-PRATAHIGDIISLVETLIEKGFAYPAANGDVYYRVEKFADYGKLTNKNVDELKTGARIEVEEAKESPLDFVLWKSAKEGEVSWDSPWGKGRPGWHIECSAMSKCCLGNTFDIHGGGPDLPFPHHENEIAQSEAANGCTYVNTWMHAGPVRVNSEKMSKSLGNFFTIRDVLEKYNAEVVRFFLARVHYRTYIDYSEDSLKEARVMLE------RFYQALRGVDAVEGPLENDFEERFIAAMNDDFNTPKAVSVMFELVNELNKATR-EGASEAPALAAQLRK-LGGMLGLLQQNADEFLQGESEEGGLSNEEIEQLIVDRAEAKKAKNFAEADKIRDDLASQGII 447
>gi|126660010|ref|ZP_01731132.1| cysteinyl-tRNA synthetase [Cyanothece sp. CCY0110] >gi|126618688|gb|EAZ89435.1| cysteinyl-tRNA synthetase [Cyanothece sp. CCY0110] (482 aa)
Score = 642, Expect = 6.2e-65, Identities = 152/439 (34%), Positives = 249/439 (56%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL------KKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSH---LIIEQKYNEKNLEFDKSNLIELTNNFN----LPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL------------FDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + +Y+ ++ K +   ++++  +KMY CG TVY++ H+G+ R  I +DV+ R     GYNVT+I N TDIDDKI+N+A++E      +S  +   YF+ ++ + +  ++  +PR +  +  I+  + ++    +AY  +GDVY++  +   YGK+S +KL++L  G     NL      KK +P DFA+WK    G   WD  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   + LAR W+H G + +  +KMSKSL NF   ++LL + +   VR F  Q  Y  P++FT E L  + N  + +   L     H   L  +    E   +F K     + ++FN    L  +    +E  K  ++L+   N E  +++     Y L  +  ++ +               +D AIE L+ +  + ++ KNF+ESD+ R  L E+ ++
  S:     3 LTVYNTLTRKKEPFTTIEEGKVKMYCCGITVYDYCHLGHARTCIIWDVVRRYLQWHGYNVTYIQNFTDIDDKILNRARKEKTTMEAVSERFIEAYFEDMERLGVQKAD-AYPRATHTLNGIQRLVSELEAKGYAYASNGDVYYNVHQFKPYGKLSGRKLEDLQAGASGRVNLEDSEASKKKDPADFAVWKSAKPGEPAWDSPWGKGRPGWHIECSAMVRERLGETIDIHVGGSDLIFPHHENEIAQSEAATGQPLARYWLHNGMVKVGGEKMSKSLGNFTTIRELLEKIDPMAVRLFILQAHYRKPVDFTDEALAAATNGWQTLSEGLLFGFQHGTTLGFKGDMLELLPKFVKRFNNAVDDDFNFAGGLAVLFEIAKELRKEGNLLVHQGNTETNSEILEKQWYTLRTLASVLGLEADRNQLQSEPSDGLNDTAIETLIEQRKEARKNKNFAESDRIRDELKEQGII 468
>gi|115378641|ref|ZP_01465792.1| cysteinyl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1] >gi|115364353|gb|EAU63437.1| cysteinyl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1] (458 aa)
Score = 642, Expect = 7.0e-65, Identities = 119/290 (41%), Positives = 177/290 (61%)
  Q:    25 VCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE 314
           +CGPTVY+++HIGN R   +FDV+ R     GY V ++ N TD+DDKI+  A E     + L+  +   + D  + +++   ++  P+VS+H+ +I   I+ +V    AY   GDVYF  +   +Y K+S +KLD+L  G++ +   +K  P DFALWK    G  +WD  +  GRPGWH ECS +  KYLG+  DIHGG +DL FPHHENE  Q+ A + K  A+ WMH G L+I   KMSKSL N +  +D L+  +   +R+FF  T Y +PL+F+ + + +S+ +LE
  S:     1 MCGPTVYSYIHIGNARTFTSFDVVVRYLRYRGYRVHYVRNYTDVDDKIIKAAHETGEEPVALAGRFVKIFQDDTRALHLVEPDVA-PKVSEHLPEILRIIETLVAKGVAYESQGDVYFSVSSYPEYAKLSKRKLDDLCAGERVQPGEQKREPLDFALWKAAKPGEPSWDSPWGKGRPGWHIECSAMSAKYLGESFDIHGGALDLIFPHHENEIAQSEAASGKPFAKYWMHCGFLDIEGAKMSKSLGNVVRLRDALTRVDAEALRFFFLSTHYRHPLHFSDKAIADSEYRLE 290
>gi|113477437|ref|YP_723498.1| cysteinyl-tRNA synthetase [Trichodesmium erythraeum IMS101] >gi|123160290|sp|Q10XJ9|SYC_TRIEI Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|110168485|gb|ABG53025.1| cysteinyl-tRNA synthetase [Trichodesmium erythraeum IMS101] (489 aa)
Score = 642, Expect = 7.0e-65, Identities = 162/436 (37%), Positives = 250/436 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK----SED--NLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEK-NLEFDKSNLIELT---------------NNFNLPNIVSFIEEKIK----YSSILLR----NKNFEELNKLHFNLSYLLTKILGI----------IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +K+Y+ +++ ++    L+   IKMYVCG TVY++ H+G+ R  I +D + R  +  GY V ++ N TDIDDKI+ +A+E       ++  +   YF+ +K +N+  ++ ++PR + +I  I+N I  +    FAY   GDVY+   + +QYGK+S ++L+E+  G      SED    KK +P DFALWK    G   WD  +  GRPGWH ECS ++   LG+ IDIH GG DL FPHHENE  Q+ A   K LAR W+H G + IN +KMSKSL NF   +DLL +  +   +R F     Y  P++FT E + ++KN         N  K  ++   +Y  K   E    NL + T               ++ N P  ++ + E  K      ++L+       + EEL K    L   L+++LG+          I   L + E   L+ +  + K+ KN+SE+D+ R  L  +
  S:     3 LKLYNSLTRQEETFEPLEPNIIKMYVCGVTVYDYCHLGHARSYIAWDTMRRYLIWQGYQVRYVQNFTDIDDKILKRARETGSSMDSVAKRFTEAYFEDMKRLNVLEAD-EYPRATQNIDRIQNLIHDLEKKGFAYSSGGDVYYQVREFSQYGKLSGRRLEEMQAGASGRVDSEDLETAKKKDPFDFALWKAAKTGEPAWDSPWGKGRPGWHIECSAMVQDCLGETIDIHAGGADLIFPHHENEIAQSEASTGKILARYWLHNGFVTINGEKMSKSLGNFTTIRDLLDQPVDPMALRMFVLTAQYRKPIDFTEEAIASAKN-------GWNTIKEGILFPYQYGPKLGWEMPAKNLSDQTLLLTSYLEKFQKAMDDDINTPAALAILFELAKDLRREGNVLIHEGKTETSLEELKKQWVTLVS-LSQVLGLEVKIEEQVSNISEGLSNIEIESLIQQRLEAKKAKNYSEADRIRNELQSQ 472
>gi|37520420|ref|NP_923797.1| cysteinyl-tRNA synthetase [Gloeobacter violaceus PCC 7421] >gi|61216274|sp|Q7NMB5|SYC_GLOVI Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|35211414|dbj|BAC88792.1| cysteinyl-tRNA synthetase [Gloeobacter violaceus PCC 7421] (482 aa)
Score = 642, Expect = 7.3e-65, Identities = 128/317 (40%), Positives = 195/317 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINN-----QKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKN---QLENII 317
           ++IY+ +++  +  V L+   +KMYVCG TVY++ H+G+ R  + +D + R  +  GY VT++ N TD+DDKI+ +A++E      ++  Y   YF+ +  +N+  ++  +PR +  + +I   I ++ +  +AY   GDVY+   +  +YGK+S K+L EL  G     + E+  +K +P DFALWK    G   WD  +  GRPGWH ECS ++ K LG+ IDIH GG DL+FPHHENE  Q+ AV  K LAR WMH   LN+ N     +KMSKSL NF   +DL   +    +R F  +TSY NP+ F+ E    S+    +LE ++
  S:     3 LQIYNTLTRRKEPFVPLEAGTVKMYVCGVTVYDYCHLGHGRTYVVWDTVRRYLISRGYAVTYVQNFTDVDDKILRRAQQEGTTMEAVAEKYIAAYFEDMDRLNVLRAD-SYPRATQTMPEIGALIDRLTSIGYAYPAAGDVYYSVRRFAEYGKLSGKRLAELEAGASERLQDEELARKKDPFDFALWKGAKPGEPAWDSPWGAGRPGWHIECSAMVRKSLGETIDIHAGGEDLQFPHHENEIAQSEAVTGKPLARYWMHNAFLNVVNSSGAEEKMSKSLGNFKTLRDLFEVFPPMALRLFLLKTSYRNPIAFSAEAFKGSEQNWRELEEVL 332
>gi|77360989|ref|YP_340564.1| cysteinyl-tRNA synthetase [Pseudoalteromonas haloplanktis TAC125] >gi|109894923|sp|Q3IF51|SYC_PSEHT Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|76875900|emb|CAI87121.1| cysteine tRNA synthetase [Pseudoalteromonas haloplanktis TAC125] (459 aa)
Score = 641, Expect = 7.9e-65, Identities = 145/433 (33%), Positives = 249/433 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           + IY+ +++  ++   + +  I MYVCG T+Y++ HIG+ R  + FDV+ R    +GY++ ++ NITD+DDKI+ +A E      +L+        +   ++N+   +++ P V+ H+ +I   +++++    AY+  DGDV FD +   QYG +S + L  L  G + E    K++P DF LWK+   G  +W   +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   NN      W+H G + +N +KMSKSL NF   +++L +Y+  +VR+F     Y + LN++ ENL  +++ LE I   L   +  +  E   NE  ++F K+    + ++FN P  +  + E  K  + L+++ + ++  +L F L   ++++LG+        +     DDE  +   L+ K N  +  KN++ +D+ R  L
  S:     2 VNIYNTLTRQKEQFKPMVEGKIDMYVCGITIYDYCHIGHARTFVGFDVIVRYLRHIGYDLKYVRNITDVDDKIIKRANENGESINDLTVRMTKAMHEDFDSLNMLRPDVE-PTVTAHMDEIIEMVERLITKGHAYVAADGDVLFDVSTFEQYGALSQQDLTMLQSGSRVEVAQDKDDPLDFVLWKKAKAGEPSWSSPWGEGRPGWHIECSAMSSKHLGEHFDIHGGGSDLQFPHHENEIAQSCCANNGKYVNTWIHTGMVQVNKEKMSKSLDNFFTVREVLKQYDAESVRYFLISGHYRSQLNYSQENLDQARSSLERIYTALRGVEP-VACELDDNEYVIKFRKA----MDDDFNTPEALPVLFELAKELN-LVKDIDSQQAGQLAFILGS-ISEVLGVAQQDPEAFLQGGQDDDEVAQIEALIVKRNDARASKNWAAADEARDAL 440
>gi|56708635|ref|YP_170531.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110671107|ref|YP_667664.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. tularensis FSC198] >gi|123063359|sp|Q14G14|SYC_FRAT1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|61216126|sp|Q5NEL1|SYC_FRATT Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56605127|emb|CAG46249.1| Cysteinyl-tRNA synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321440|emb|CAL09632.1| Cysteinyl-tRNA synthetase [Francisella tularensis subsp. tularensis FSC 198] >gi|151569508|gb|EDN35162.1| hypothetical protein FTBG_01042 [Francisella tularensis subsp. tularensis FSC033] (464 aa)
Score = 641, Expect = 8.0e-65, Identities = 152/424 (35%), Positives = 234/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNLFD----------DEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NITDIDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   + DV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++ +           E  +L+ +  + K++KN+  +D+ R  L ++ ++
  S:    22 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITDIDDKIIKRANENGESTTELVERNIKAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANSDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYVRADEIRNQLQQQGII 451
>gi|89211820|ref|ZP_01190157.1| Cysteinyl-tRNA synthetase, class Ia [Halothermothrix orenii H 168] >gi|89158575|gb|EAR78286.1| Cysteinyl-tRNA synthetase, class Ia [Halothermothrix orenii H 168] (484 aa)
Score = 641, Expect = 8.3e-65, Identities = 155/430 (36%), Positives = 258/430 (60%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIA-VNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTE----------NLINSKNQLENIIYNLNIFKSHLIIEQK--------YNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFE---ELNKLHFNLSYLLTKILGIIHVNLF----DDEAIELLNKW--------NKLKQEKNFSESDKYR 430
           +++Y+ +S K +K   L+   ++MYVCG TV N+ HIG++R  + +DV+ R     GY VT++ N TDI++KIV +A+EE +  LEL+  Y   Y + ++ + I  +++ + R +D IK+I   ++K+++  +AY V+G+VYF   K + YGK+S + L+E+  G + E N +K +P DFALWK+   G ++WD  +  G PGWH ECS +  KYLG +IDIHGGG DL FPHHENE  Q+ +    K   + W+H G +N+  +KMSKSL NF   +++L E+  + VR+F     Y +P++F  E           L+N+   +  I+    I K+ +    K         N+K  EF+++    + ++FN       + E  +  +  + +  FE   E +K+      L  +   I+ ++L     D+   E+LN          ++ +QEKN+  +D+ R
  S:     2 LRVYNTLSRKKEKFTPLETGKVRMYVCGLTVQNYAHIGHIRSAVNYDVIRRYLEYKGYEVTYVQNFTDINEKIVARAREEGLRPLELADKYTKAYLEDIEKMKIKRADV-YCRATDTIKEIIKMVKKLLDKGYAYEVNGNVYFSVEKFSDYGKLSGRNLEEMQAGARVEVNEEKRHPMDFALWKKAPAGEISWDSPWGKGWPGWHIECSAMSIKYLGKRIDIHGGGTDLIFPHHENEIAQSESCTGEKPFVKYWLHNGSVNLKGEKMSKSLGNFFTVREILKEFKPDEVRYFLLTKHYRSPIDFNFEEVEAARKSWRKLVNTYQVMVQILEKGVITKNKITENTKGENTIISILNKKEKEFEEA----MDDDFNTARATGVMHELAREINTFVNSPEFELNGETSKVLKKAQNLFDRFSDILGLDLAFSSSDEVDNEILNNLVDFILEIRDEARQEKNWQLADRIR 462
>gi|114563765|ref|YP_751278.1| cysteinyl-tRNA synthetase [Shewanella frigidimarina NCIMB 400] >gi|122299286|sp|Q07ZX5|SYC_SHEFN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|114335058|gb|ABI72440.1| cysteinyl-tRNA synthetase [Shewanella frigidimarina NCIMB 400] (460 aa)
Score = 641, Expect = 9.1e-65, Identities = 152/435 (34%), Positives = 242/435 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LF-----DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +S+  +E   ++   I MYVCG T+Y+  HIG+ R  ++FD++ R    +GY V F  NITD+DDKI+ +A E N     L+     +       +N+   + + PR + HI++I + +Q++++   AY+  +GDV F      +YG++S + LD+L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +   L      L ++    E  +   KS    + ++FN P   S + E ++  +  L+  +  E + L  +L   L  +LG+I       F     DDE  E   L+ + N+ + EK++  +D  R  L E
  S:     2 LKIYNSISRDKQEFKPINPGKIGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYIGYEVNFQRNITDVDDKIIKRAAENNESCESLTERLIAEMHQDFDALNMKRPDFE-PRATLHIEEIIDMVQRLLDRDHAYVASNGDVLFSVASFPEYGQLSGQNLDQLQAGARVEIDNAKRNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLDNFFTIRDVLKHYDAETVRYFLLSGHYRSQLNYSEDNLKQARAALERLYTALKGLD--LTVDAAPAEAFVAKFKS---AMDDDFNTPEAYSVLFEMVREIN-RLKTTDMAEASALGVSLKQ-LADVLGLISQTPEAFFKGEGSDDEVAEIEALIVERNRARTEKDWPAADVARDRLNE 442
>gi|15922576|ref|NP_378245.1| cysteinyl-tRNA synthetase [Sulfolobus tokodaii str. 7] >gi|21264015|sp|Q96YC3|SYC_SULTO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|15623366|dbj|BAB67354.1| 471aa long hypothetical cysteinyl-tRNA synthetase [Sulfolobus tokodaii str. 7] (471 aa)
Score = 641, Expect = 9.4e-65, Identities = 158/433 (36%), Positives = 253/433 (58%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFD-KSNLIELTNNFN---------------LPNIVSFIEEKIKYSSILLRNK-NFEELNKLHFNLS------YLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           ++IY+ + +  + + +++ + +KMYVCGPTVY+++HIG+ R  ++FD + R     GYNV  + NITDIDDKI+ KA+E      E+  +Y   Y + L  + I     + PRV+ HIK+I N+IQK+++   AY+   G VYFD      YG +S  K +E   G+  E   +K NP DFALWK    G   W+  +  GRPGWH ECS +  +YLG++ DIHGGGIDL FPHHENE  Q+ A+  K   + W+HV +L I  +KMSKSL N I   + L ++  + +R+++  + Y + L+F  ++L  +KN L  +   ++I +  +    KY  K+ +   + N++EL  +F+               +  IVS +  KI+YS   +     F+ L + ++         Y   ++LG +      D  +E+    N+L+ +K +  SD+ R +L
  S:     6 IRIYNTLGRKIQPLETVEPQTVKMYVCGPTVYDYLHIGHGRTFVSFDAMVRYLRLRGYNVIRVQNITDIDDKIIKKAQETGKDWTEIVDFYTKDYLNALTQLKIEID--QHPRVTYHIKEIINFIQKLIDKGHAYVAKSGSVYFDVDSFPSYGLLSGTKKEEWNQGE--EFVKEKKNPYDFALWKAWKPGEPYWESPWGKGRPGWHIECSTMSMRYLGEEFDIHGGGIDLIFPHHENERAQSEALLGKQWVKYWVHVSYLTIRKEKMSKSLGNIIPLNEALKKWGPSVLRYWYLSSHYRSSLDFNEDSLEQAKNALTRLKDAISIIRDVIKEGPKYYSKDEDIQVQRNIVELIKSFHAAMSEDFDTAKALSYIHEIVSLVFGKIQYSRDFMSAMLAFDALRQFNYVFGVMDEEFYPTYEMLGKV-----IDAVVEIR---NQLRMKKMYDLSDQIRAIL 452
>gi|186684074|ref|YP_001867270.1| cysteinyl-tRNA synthetase [Nostoc punctiforme PCC 73102] >gi|186466526|gb|ACC82327.1| cysteinyl-tRNA synthetase [Nostoc punctiforme PCC 73102] (524 aa)
Score = 640, Expect = 9.8e-65, Identities = 158/419 (37%), Positives = 241/419 (57%)
  Q:    15 SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL------KKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQL--------------ENIIYNLNIFKSHLIIEQKYNEK---NLEFDKSNLI-----ELTNN-FNLPN----IVSFIEEKIKYSSILLRNKNFE-ELNKLHFNLSYLLT--KILGI--------IHVNLFDDEAIEL-LNKWNKLKQEKNFSESDKYRKLL 433
           +++   +KMY CG TVY++ H+G+ R  I +DV+ R    +GY V +I N TDIDDKI+N+A  E+     +++ +   YF+ +  + I  ++ ++PR +  +  I+  I ++    FAY  DGDVY+   +  +YGK+S +KL+++  G     N+      KK +P DFALWK    G   W+  +  GRPGWH ECS ++   LGD IDIH GG DL FPHHENE  Q+ AV  K LAR W+H G + ++ +KMSKSL NFI  ++LL    N   VR F     Y  P++FT E +  + N                E + ++L      L  E+++++    N ++   NL      E+ NN FN P     +    +E  +   IL+     E   +KL      L+T   +LG+          +N   D  IE  + +  + +Q KNF+ESD+ R  L
  S:    41 TVEAGKVKMYYCGVTVYDYCHLGHARACIVWDVVRRYLQFIGYEVRYIQNFTDIDDKILNRACVEHSSMEAVANRFIKAYFEDMARLGIREAD-EYPRATHTMNGIQRLIHELEKKGFAYPADGDVYYAVRQFAEYGKLSGRKLEDMQAGKSERVNVEDPEYQKKKDPFDFALWKAAKPGETAWESPWGAGRPGWHIECSAMVRDRLGDTIDIHAGGADLIFPHHENEIAQSEAVTGKPLARYWLHNGMVKVDGEKMSKSLGNFITIRELLDRGVNPMAVRLFVLTAQYRTPIDFTDEAIAAATNGWHTIKEGLLFGYQYGEKLGWDLGTGDLGLGTEEEFSQSPIPNPQYPVPNLYVERFQEIVNNDFNFPGGLTVLFELAKELRREGHILVHEGKTETSPDKLKHQWQTLVTLAGVLGLEAEIEAETDKINGLSDAEIEAKIQQRQEARQGKNFAESDRIRDEL 505
>gi|91226019|ref|ZP_01260946.1| cysteinyl-tRNA synthetase [Vibrio alginolyticus 12G01] >gi|91189460|gb|EAS75737.1| cysteinyl-tRNA synthetase [Vibrio alginolyticus 12G01] (460 aa)
Score = 640, Expect = 9.9e-65, Identities = 149/435 (34%), Positives = 241/435 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF-------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR +  I +I   ++K++   FAY+ D GDV F+  K N+YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L     +            E+       + ++FN P   S + +  +  +  L+ +N E+ ++L   L   L  ++GI+H +   F       DDE  E   L+   N  +  K+++ +D  R  L E
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGESCDSLTERLIGEMHADFDALNMKRPDVE-PRATQFIAEIIELVEKLIERGFAYVADNGDVMFEVGKFNEYGKLSKQDLDQLQAGARVDIETAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSLRGLDLN-----AAPAGGEEYVSRFTAAMNDDFNTPEAYSVLFDMAREVN-RLKTENLEKASELG-ALMRELADVIGILHQDPEAFLKGDAGNDDEVAEIEALIKLRNDSRAAKDWANADMARDKLTE 443
>gi|119510000|ref|ZP_01629141.1| cysteinyl-tRNA synthetase [Nodularia spumigena CCY9414] >gi|119465324|gb|EAW46220.1| cysteinyl-tRNA synthetase [Nodularia spumigena CCY9414] (477 aa)
Score = 640, Expect = 1.0e-64, Identities = 155/433 (35%), Positives = 238/433 (54%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNL------KKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKY-----NEK-NLEFDKSNLIELTN-NFNLPNIVSFIEEKIKYSSILLRNKNF-----------EELNKLHFNLSYLLTKILGIIHV---------NLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + +Y+ +++  +   +++   +KMY CG TVY++ H+G+ R  I +DV+ R    +GY V +I N TDIDDKI+ +++EE+     ++  Y   YF+ +  + I  ++ ++PR +  +  I+  I ++ N  FAY  DGDVY+   + N+YGK+S +KL+++  G      +      KK +P DFALWK    G   W+  +  GRPGWH ECS ++   LGD IDIH GG DL FPHHENE  Q+ AV  K LA  W+H G + ++ +KMSKSL NF   +DLL        VR F     Y  P++FT + +  + N         +  K  L+   +Y      EK   E       E  N +FN P  ++ + E  K    L R  N            EEL K  +    +L ++ G++            L D E   L+ +    ++ KNF+ESD+ R  L
  S:     3 LTLYNTLTRRQEAFATVEPGKVKMYYCGVTVYDYCHLGHARACIVWDVVRRYLQFIGYEVRYIQNFTDIDDKILKRSREEHSSMEAVAERYINAYFEDMGRLGIKPAD-EYPRATHTMNGIQRLIHELENKGFAYPADGDVYYAVRQFNEYGKLSGRKLEDMQAGASERVQVEDPEYQKKKDPFDFALWKAAKPGEPAWESSWGAGRPGWHIECSAMVRDRLGDTIDIHAGGADLIFPHHENEIAQSEAVTGKPLATYWLHNGMVKVDGEKMSKSLGNFTTIRDLLDRGVEPMAVRLFVLMAQYRKPIDFTDDAIAAATN-------GWHTLKEGLLFGYEYGGVGSGEKLTSEIHIQRFQEAVNDDFNFPGGLAVLFELAKE---LRRQGNIIVHQGKTETSPEELQK-QWQTLVILAEVFGLVAQPEAENAIIEGLSDAEIENLIQQRQAARKSKNFAESDRIRDQL 459
>gi|46143889|ref|ZP_00133878.2| COG0215: Cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208389|ref|YP_001053614.1| cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae L20] >gi|187629818|sp|A3N0S3|SYC_ACTP2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|126097181|gb|ABN74009.1| cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae L20] (459 aa)
Score = 640, Expect = 1.2e-64, Identities = 153/433 (35%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--------NLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIY+ + +  +E   ++   + MYVCG TVY+  H G+ R  ++FDV+ R    LGYN+ ++ NITD+DDKI+ +A E N    +L      +       +NI   +++ PR + HI +I   ++K++ N  AY+  DGDV FD     +YG +S + L++L  G + E    K NP DF LWK +  G  +W   +  GRPGWH ECS + +K LG+  DIHGGG DL FPHHENE  Q+   +  D    W+H G L I+++KMSKSL NF   + +L +Y + T+R+FF    Y + LN++ +NL  +++ LE +  +L      L +E    E+ +E  K+    + ++FN P  ++ + E I      L+ ++  + N L   L   L  +LG+++         +  +DE  E   L+ + N+ K  KN++ +D+ R  L
  S:     2 LKIYNTLKREKEEFKPINPNQVGMYVCGVTVYDLCHFGHGRTFVSFDVIARYLRYLGYNLRYVRNITDVDDKIIKRALENNETCDQLVDRMIAEMHKDFDDLNILRPDVE-PRATKHIPEIVAMVEKLIANGHAYVAADGDVMFDVESFKKYGALSRQNLEQLQAGARVEIKSVKKNPMDFVLWKMSKEGEPSWQSPWGNGRPGWHIECSAMNSKELGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGDYVNYWLHTGMLTIDDEKMSKSLGNFFTIRTMLEKYESETLRYFFLTAHYRSLLNYSLDNLDLARSALERLYTSLR--GCDLSVEVAGGEQYVEAFKA---AMDDDFNTPGALAVLFE-IAREVNKLKTEDMAKANGLAVRLKE-LAGVLGLLYQDPEAFLQGDADNDEVAEIEALIKQRNEAKAAKNWAVADEVRDKL 440
>gi|71065916|ref|YP_264643.1| cysteinyl-tRNA synthetase [Psychrobacter arcticus 273-4] >gi|109894925|sp|Q4FRZ9|SYC_PSYA2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|71038901|gb|AAZ19209.1| cysteinyl-tRNA synthetase [Psychrobacter arcticus 273-4] (488 aa)
Score = 640, Expect = 1.2e-64, Identities = 157/428 (36%), Positives = 238/428 (55%)
  Q:     3 IYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSH----LIIEQKY--------------NEKNLEFDKSNLIE----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYR 430
           IYD ++   +    L +  + MYVCG TVY++ HIG+ R ++ FD+  R   +LGY+V ++ NITDIDDKI+ +A E  E IG L  +  + T   +    +   + N + PR +D+I +++  I+ +V+N +AY  D GDVY+       YGK+S + LD++  G + E    K NP DF LWK        W   +  GRPGWH ECS +  K LG+  DIHGGG DL+FPHHENE  Q+ A    + AR WMHVG +N++ +KMSKSL NF   +D++++Y   TVR+F   + Y + +NF+   L  + N L  +   L + +      LI++                    N +F+ S  I     L  + N  + V  IE   + +  L      + LN L   +   L  ++G    +   DEAI+ L+ +    K  KNF+ +D+ R
  S:    16 IYDSLTGRKQSFKPLVEGKVGMYVCGMTVYDYCHIGHARVMVGFDMAVRWLAQLGYDVNYVRNITDIDDKIIARAAENGEEIGAL--TQRFITAMHEDATALGCQSPNAE-PRATDYIDEMQQMIETLVSNDYAYAGDNGDVYYAVDSFADYGKLSKRNLDDMQAGSRVEVENDKRNPFDFVLWKAAKPDEPQWVSSWGQGRPGWHIECSAMSTKCLGNTFDIHGGGHDLQFPHHENEIAQSEAATGCEYARNWMHVGFINVDGEKMSKSLGNFFTIRDVMAKYLPETVRFFLLSSHYRSQVNFSDSALDEAHNSLSRLYQALKVVEQQKGQTLIVDDALINNAYASAPGQDFIKAMNDDFNSSTAISVLFGLARDINKASKVEDIESAWQLAQQL--KALAQTLNILQQPVQQFLQAVIGEAAEDGLTDEAIDSLIIERADAKTNKNFARADEIR 466
>gi|91204303|emb|CAJ71956.1| strongly similar to cysteinyl-tRNA synthetase [Candidatus Kuenenia stuttgartiensis] (492 aa)
Score = 640, Expect = 1.2e-64, Identities = 164/435 (37%), Positives = 251/435 (57%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDI----------DDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG--LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYN--------EKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILL------RNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE-----------------LLNKWNKLKQEKNFSESDKYRKLLME 435
           +K Y+ ++K  KEV   L + ++ MYVCGPTVY+H HIG+ +  +++DV+ R    LGY V ++ NITD+          DDKI+ +A+ E I    L   Y   YF+ +  +N    ++  PR + HI +    I+K+++  +AY+ +G VYF+ +K  +YGK+S +K ++L  G + E NL+K NP DFALWK+      + W   +  G PGWH ECS +  KYLG+ +DIHGGGI+  FPHHE E  Q+ A N+    R W+H   + +N QKM KSL NF+  KD   +Y+  T+R+F   T Y +PL+F+ E L  +   L+ +   +   +    I++  N        EK  E  K+ L  +  + N    ++ + +  K  + LL        K  E++N L+  L      ILGI+ V       IE                 L++  N+L++EK F  SD  R  L E
  S:     3 LKFYNSITKK-KEVFKPLVEGHVNMYVCGPTVYDHPHIGHAKSYVSYDVIVRYLRYLGYKVCYVQNITDVGHLTDNADAGDDKILARAQRERIEPAVLVEIYTRSYFEDMDALNNLRPDIS-PRATAHIPEQIELIEKLISKGYAYVSNGSVYFEVSKYREYGKLSGRKQEDLEAGARIEINLEKRNPNDFALWKKAEPAHIMRWKSPWGEGFPGWHLECSAMSMKYLGESLDIHGGGIENMFPHHECEIAQSEAANDMTFVRYWIHNNMVTVNGQKMGKSLGNFVTLKDAFKKYHPLTIRFFILSTHYRSPLDFSNEALDAADKGLKRLFNTIKRVRRQ--IDEAANGETTVLVYEKLEEHKKAFLNAMDEDINTSGAIAALFDLSKEVNALLDSGEEVSKKCMEDINSLYQELG---DGILGIVPVRKEVKADIEDDFSEGDKSVLKEVMGVLIDTRNQLRKEKLFQLSDFIRNKLTE 475
>gi|119471530|ref|ZP_01613944.1| cysteinyl-tRNA synthetase [Alteromonadales bacterium TW-7] >gi|119445473|gb|EAW26759.1| cysteinyl-tRNA synthetase [Alteromonadales bacterium TW-7] (459 aa)
Score = 640, Expect = 1.2e-64, Identities = 139/366 (37%), Positives = 216/366 (59%)
  Q:     1 MKIYDFVSKTDKEVS--LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELS-SYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIK 366
           ++IY+ +++  ++    +D K I MYVCG T+Y++ HIG+ R  + FDV+ R    +GYN+ ++ NITD+DDKI+ +A E  E+I +L L  +    + FD L  +         P V+ H+ +I   +++++    AY+  DGDV FD +   QYG +S + L  L  G + E    K++P DF LWK+   G  +W   +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   NN +    W+H G + +N +KMSKSL NF   +D+L EY+  +VR+F     Y + LN++ ENL  +++ LE I   L   K  +  E + NE  ++F K+    + ++FN P  +  + E  K
  S:     2 VQIYNTLTRQKEQFKPMVDGK-IDMYVCGITIYDYCHIGHARTFVGFDVIVRYLRHIGYNLKYVRNITDVDDKIIKRANENKESINDLTLRMTKAMHEDFDSLNMLRPDVE----PTVTGHMDEIIEMVERLIAKGHAYVAADGDVLFDVSTFEQYGALSQQDLTMLQSGSRVEVAQDKDDPLDFVLWKKAKAGEPSWSSPWGEGRPGWHIECSAMSSKHLGEHFDIHGGGSDLQFPHHENEIAQSCCANNGEYVNTWIHTGMVQVNKEKMSKSLDNFFTVRDVLKEYDPESVRYFLISGHYRSQLNYSQENLDQARSSLERIYTALRDVKP-IECELESNEFVIKFRKA----MDDDFNTPEALPVLFELAK 364
>gi|187931126|ref|YP_001891110.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712035|gb|ACD30332.1| cysteinyl-tRNA synthetase [Francisella tularensis subsp. mediasiatica FSC147] (459 aa)
Score = 639, Expect = 1.3e-64, Identities = 151/424 (35%), Positives = 236/424 (55%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK---ILGIIHVNLFD----------DEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++   IKMY CG TVY+  HIG+ R  I FDV+NR F   GY+VT + NIT+IDDKI+ +A E      EL         D+   +NI   + K PR ++ I ++   I+ ++   +AY   +GDV++  TK   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LG+  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    ++L EY+   VR+F   T Y + +N++ ENL N+K  +E +    N  +    IE    +   E+++  +  + N+FN P  ++ +    K  + L     ++         +YLL K   +LGI+  ++ +           E  +L+ +  + K++KN++ +D+ R  L ++ ++
  S:    17 IEANKIKMYACGVTVYDDCHIGHARTYIAFDVINRYFKYRGYDVTLVRNITNIDDKIIKRANENGESTTELVERNIKAMHDVFARLNILKPS-KEPRATETIPEMVAMIETLIKKGYAYQGANGDVFYRVTKFADYGKLSKQNLEALQQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGNTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTIVEVLEEYHPEVVRYFLASTVYRSEINYSKENLENAKASVERL---FNALRDIEPIEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTLKTTNKYKA-----SGYAYLLRKLCDVLGILFTDIEEYFKQGDGADASEIEKLIAERTQAKKDKNYARADEIRNQLQQQGII 446
>gi|157363627|ref|YP_001470394.1| cysteinyl-tRNA synthetase [Thermotoga lettingae TMO] >gi|157314231|gb|ABV33330.1| cysteinyl-tRNA synthetase [Thermotoga lettingae TMO] (463 aa)
Score = 639, Expect = 1.3e-64, Identities = 153/437 (35%), Positives = 239/437 (54%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNI-KMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV-NLFDDEAIE-----LLNKWNKLKQEKNFSESD----KYRKLLMEKK 437
           M+ Y+ +SK  +E   ++  I +MYVCGPTVY  +HIGN RP++ FD L R     GY V  + N TDIDDKI+NK+ E ++   ++S  +  +Y+     + +   N   P+ SD + +I N IQ ++    AY+VDGDVYF      +YG++S++ +DEL  G + + N KK +P DFALWK    G   W   +  GRPGWH ECS +  K LG  +DIH GG DL FPHHENE  Q+ A+  K   + W+H G +     KMSKS  N  L ++ L +Y  + ++ FF    Y +P+ F+ + L ++      I      F+S         +  +   +S  I+ L ++FN P  ++ I E +   +  + + N  +  K++  L      +LG+  +    D+ +IE     L++   +L+ +K +  SD    K RK+ +E K
  S:     1 MRFYNTLSKHIEEFKENEPGIVRMYVCGPTVYGLIHIGNARPMVVFDALRRYLEYRGYRVIMVQNFTDIDDKIINKSIEFSVDFKDISETFIAEYWRDSMALGVRAPNFS-PKTSDFVPEIINAIQNLIAKNHAYVVDGDVYFSVRSFPRYGELSHRSIDELKAGARIDLNEKKRDPLDFALWKSAKPGEPYWKSPWGNGRPGWHIECSVMSTKLLGTTLDIHAGGEDLIFPHHENEKAQSEALTGKTFVKYWLHNGMIKYTGDKMSKSTGNIFLLREALKKYGADALKIFFLSKHYRSPIEFSEKALSSAAKAATRINETFLRFESEFSFAIPKQDSWINEKRSIFIDSLDDDFNTPRALALIFELVNSLNRAMDDGNERDALKIYHLLRREFCPVLGLFDLPERADNRSIEELVKILIDVRAELRAKKQYELSDMIRSKLRKVGIELK 449
>gi|148377308|ref|YP_001256184.1| cysteinyl-tRNA synthetase (cysteine-trnaligase) [Mycoplasma agalactiae PG2] >gi|148291354|emb|CAL58737.1| Cysteinyl-tRNA synthetase (Cysteine-tRNAligase) [Mycoplasma agalactiae PG2] (413 aa)
Score = 639, Expect = 1.6e-64, Identities = 155/419 (36%), Positives = 256/419 (61%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSN-QYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLG-DQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLNI-FKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+YVCGPTVYN  HIGNLRPIITFD + + + EL     F+HNITD+DDKI+NKA + ++ E E++S+Y   Y  +L+ +N++T + K  +V+ +I  I  Y++K+   + AY   +G+V+FD  ++   YG +SN+ +D ++     E++L K    DFALWK T +G+ +   F  GRPGWHTECS LI+K+ G D +DIHGGG+DL FPHHENENIQ+ A+  K LA+ W+  G LN++ +KMSKS+ N ILA+D +++Y    ++  F+    S  +N T+E + N K   N+ + +++ + I +K+ ++  + Y++       +  +E  +     +    +  +IK  +   +  + E    L F LS    ++  I   N +    +E+ ++W      K++ ++DK R+ L++  L+
  S:     2 LKIYVCGPTVYNEPHIGNLRPIITFDFMLKAYRELNKEFKFVHNITDVDDKIINKAIQMDVKESEVASFYFKSYQRLLRMLNVNTIS-KIEKVTKNINVINKYVEKLYQTENAYKDANGNVWFDVLRNKGNYGLVSNQNIDNMVF---DENSLLKRFKGDFALWKSTAVGIKFRSSFGMGRPGWHTECSALIDKHFGSDGVDIHGGGMDLTFPHHENENIQHYALYQKQLAKEWIRCGQLNLDCEKMSKSVGNVILAEDFINKYGAAILKLIFFNAKVSASINITSELIENMKAIENKYKKVLFKIFINYKNEILNRENYSKSEF---VTKALEAVSQLEFSDFNFMLNNEIKQFN---KEPSLERAKDLFFLLSLFHKELTNISFYNRY----LEIYDQWRYFIGIKDYKKADKLREKLIKNSLI 413
>gi|82703002|ref|YP_412568.1| cysteinyl-tRNA synthetase [Nitrosospira multiformis ATCC 25196] >gi|109894912|sp|Q2Y7U5|SYC_NITMU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|82411067|gb|ABB75176.1| cysteinyl-tRNA synthetase [Nitrosospira multiformis ATCC 25196] (464 aa)
Score = 639, Expect = 1.6e-64, Identities = 147/439 (33%), Positives = 242/439 (55%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTN-NFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK----ILGIIHVN-------------LFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KI++ +++  +E + L    +K+YVCG TVY++ H+G+ R ++ FD++ R F    ++VT++ NITDIDDKI+ +A+E       L++ +     +    + +   + + PR + H++D+   IQ +V+ K AY   +GDVY+   +   YGK+S K LDEL  G++   +  KN+P DF LWK    G   WD  +  GRPGWH ECS +   YLG+  DIHGGG DL+FPHHENE  Q+   +       WMH G + +N++KMSKSL NF   +++L+ +    VR+F  +  Y +PLN+    L ++   L+ +   L   + H  +E  +++       S   E  N +FN P  ++ + +               E+NK        L K    +LG++  +              F  E +E L+ +    +  K++ E+D+ RK LME  ++
  S:     2 LKIHNSLAREKQEFIPLTPGKVKVYVCGMTVYDYCHLGHARVMVVFDMVQRWFRANRFDVTYVRNITDIDDKIIRRAQENKESIEALTARFIQAMEEDAAALGVEPPSWE-PRATRHVEDMIAMIQVLVDKKLAYPASNGDVYYAVHRFPGYGKLSGKSLDELRAGERVIVDPHKNDPLDFVLWKAAKPGEPQWDSPWGPGRPGWHIECSAMGEHYLGEHFDIHGGGQDLQFPHHENEIAQSEGAHGHPFVNYWMHNGFVRVNDEKMSKSLGNFFTVREILAHFQPEVVRFFILRAHYRSPLNYADMQLEDAGRALDRLYTALKGIEVHDEVEIDWDDPY----ASRFREAMNDDFNTPEALAVLFDLAT------------EVNKTRLPRDIALMKALGGVLGLLQQDPWKYFQQADSEDPAFAPEKVEQLIQQRLVARANKDYREADRIRKELMEANII 445
>gi|85057859|ref|YP_456775.1| cysteinyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] >gi|109894883|sp|Q2NIP7|SYC_AYWBP Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|84789964|gb|ABC65696.1| cysteinyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] (438 aa)
Score = 639, Expect = 1.6e-64, Identities = 148/439 (33%), Positives = 252/439 (57%)
  Q:     1 MKIYDFVSKTDKEVSLDKK-NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++IY+ +++  +    D    I +YVCGPTVYNH+H+GN RP+I FD + R    L + V ++ NITDIDDKI+  + +  + E +L++ Y   + ++L+T+NI T N K P+ + +I  +  YIQ +++  FAY  D  +YF  +K   YGK+  + L +L    + + + +K  P DF LWK+T+ G+ +   +  GRPGWHTEC+ +I +     +DIHGGG DLKFPHHENE  Q  A +++ LA  +MHV  L+  NQKMSKSL N I  KDLL +YN   +++    T Y  P+NF+ + +  ++ + + I Y L     +L +   + +  L+ D   L    + ++F    ++  +E+ IK +    + +  ++L++   +L  +L  ++  I  N    + ++    W   ++ ++F ++D  RK L++K  +
  S:     2 LQIYNSLTRKKEFFKPDHPPQINIYVCGPTVYNHLHLGNTRPLIFFDTVKRYLEMLKFKVYYVVNITDIDDKIIETSLKNQVLEKDLANKYIKSFNNLLETLNIQTINFK-PQATQYINSMILYIQTLLDQGFAYFTDQGIYFRVSKITDYGKLKKQDLSQLKQNVRKQLDPQKEFPGDFILWKKTSQGITYPSPWFAGRPGWHTECATMIEQLFKLPLDIHGGGTDLKFPHHENEIAQTHAHSHQKLANFFMHVERLDYQNQKMSKSLGNIIWCKDLLKQYNPCIIKFLILSTHYRKPINFSYDLMEQTQQKYKKITYFLTKNNFYLKVNHFFCQ-TLDQDIMQLFHQLMQDDFATHKVIDLMEQIIKRAH---QTQILDKLSQFQNSLLLILNTLVIAIPFNKPTKKDLQTYFLWQDARKCRDFIQADILRKQLLDKGFI 438
>gi|163801179|ref|ZP_02195079.1| cysteinyl-tRNA synthetase [Vibrio campbellii AND4] >gi|159175528|gb|EDP60325.1| cysteinyl-tRNA synthetase [Vibrio campbellii AND4] (460 aa)
Score = 638, Expect = 2.1e-64, Identities = 146/435 (33%), Positives = 242/435 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--------NLFDDEAIELLNKWNKLKQE----KNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +      ++N+   +++ PR +  I +I   ++K++   FAY+ D GDV F+  +  +YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L    S+            E+       + ++FN P   S + +  +  +  L+ +N E+ ++L   L   L  ++GI+H         +  DDE +  +    KL+ +    K+++ +D  R  L E
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGESCDSLTDRLIGEMHVDFDSLNMKRPDVE-PRATQFIAEIIELVEKLIERGFAYVADNGDVMFEVRQFKEYGKLSKQDLDQLQAGARVDIETAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSLRGLDSN-----AAPAGGEEYVTRFTAAMNDDFNTPEAYSVLFDMAREVN-RLKTENVEKASELG-ALMRELADVIGILHQDPEAFLKGDAGDDEEVAEIEALIKLRNDSRAAKDWANADMARDKLTE 443
>gi|156974130|ref|YP_001445037.1| cysteinyl-tRNA synthetase [Vibrio harveyi ATCC BAA-1116] >gi|156525724|gb|ABU70810.1| hypothetical protein VIBHAR_01842 [Vibrio harveyi ATCC BAA-1116] (460 aa)
Score = 637, Expect = 2.5e-64, Identities = 148/435 (34%), Positives = 241/435 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF-------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR +  I +I   ++K++   FAY+ D GDV F+  K N+YGK+S + L++L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L     +            E+       + ++FN P   S + +  +  +  L+ +N E+ ++L   L   L  ++GI+H +   F       DDE  E   L+   N  +  K+++ +D  R  L E
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGESCDSLTERLIGEMHADFDALNMKRPDVE-PRATQFIAEIIELVEKLIERGFAYVADNGDVMFEVGKFNEYGKLSKQDLEQLQAGARVDIETAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSLRGLDLN-----AAPAGGEEYVSRYTAAMNDDFNTPEAYSVLFDMAREVN-RLKTENLEKASELG-ALMRELADVIGILHQDPEAFLKGDAGNDDEVAEIEALIKLRNDSRAAKDWANADMARDKLTE 443
>gi|119476779|ref|ZP_01617089.1| cysteinyl-tRNA synthetase [marine gamma proteobacterium HTCC2143] >gi|119450035|gb|EAW31271.1| cysteinyl-tRNA synthetase [marine gamma proteobacterium HTCC2143] (455 aa)
Score = 636, Expect = 3.0e-64, Identities = 124/296 (41%), Positives = 179/296 (60%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI-GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKD-LARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + MYVCGPTVYN VHIGN RP++ FD L R+   L  +V +  NITDIDDKI+  AK        +SS Y T YFD +  +N    ++  P  +DH+ ++   IQ +++   AY  +  + FD    + YGK++ + L+++L G + +    K    DF LWK +T     WD  +  GRPGWH ECS +I K+LG+ IDIHGGGIDL+FPHHENE  Q+   ++ +   R WMH  ++NI+ +KMSKSL NF + KDLL  Y    +R+      Y + LNF+ + L +++  L+N+
  S:    24 VTMYVCGPTVYNRVHIGNARPVVVFDTLYRVLKTLYSSVIYARNITDIDDKIMAAAKAGGETIAAISSRYATAYFDDMAELNNLPPDI-IPYATDHVGEMVAMIQTLIDKGHAYEAESHILFDVKSMSGYGKLAKRSLEDMLAGARVDVADYKKYAGDFVLWKPSTDEEPGWDSPWGRGRPGWHLECSAMIEKHLGNTIDIHGGGIDLQFPHHENELAQSTCAHDGEPFVRYWMHNAYINIDGEKMSKSLGNFRMVKDLLDHYPGEVLRFSILSAHYRSELNFSADALDSAQKTLDNL 320
>gi|190150242|ref|YP_001968767.1| cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915373|gb|ACE61625.1| cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (459 aa)
Score = 636, Expect = 3.2e-64, Identities = 152/433 (35%), Positives = 239/433 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIY+ + +  +E   ++   + MYVCG TVY+  H G+ R  ++FDV+ R    LGYN+ ++ NITD+DDKI+ +A E N    +L      +       +NI   +++ PR + HI +I   ++K++ N  AY+  DGDV FD     +YG +S + L++L  G + E    K NP DF LWK +  G  +W   +  GRPGWH ECS + +K LG+  DIHGGG DL FPHHENE  Q+   +  D    W+H G L I+++KMSKSL NF   + +L +Y + T+R+FF    Y + LN++  NL  +++ LE +  +L      L +E    E+ +E  K+    + ++FN P  ++ + E      K+K   +   N     L +L   L  L       +  +  +DE  E   L+ + N+ K  KN++ +D+ R  L
  S:     2 LKIYNTLKREKEEFKPINSNQVGMYVCGVTVYDLCHFGHGRTFVSFDVIARYLRYLGYNLRYVRNITDVDDKIIKRALENNEMCDQLVDRMIAEMHKDFDDLNILRPDVE-PRATKHIPEIVAMVEKLIANGHAYVAADGDVMFDVESFKKYGALSRQNLEQLQAGARVEIKSVKKNPMDFVLWKMSKEGEPSWQSPWGNGRPGWHIECSAMNSKELGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGDYVNYWLHTGMLTIDDEKMSKSLGNFFTIRTMLEKYESETLRYFFLTAHYRSLLNYSLNNLDLARSALERLYTSLR--GCDLSVEVAGGEQYVEAFKA---AMDDDFNTPGALAVLFEIAREVNKLKTEDMAKANGLAARLKELAGVLGLLYQDPEAFLQGDADNDEVAEIEALIKQRNEAKAAKNWAVADEVRDKL 440
>gi|165976334|ref|YP_001651927.1| cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876435|gb|ABY69483.1| cysteinyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (459 aa)
Score = 636, Expect = 3.2e-64, Identities = 153/433 (35%), Positives = 244/433 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--------NLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIY+ + +  +E   ++   + MYVCG TVY+  H G+ R  ++FDV+ R    LGYN+ ++ NITD+DDKI+ +A E N    +L      +       +NI   +++ PR + HI +I   ++K++ N  AY+  DGDV FD     +YG +S + L++L  G + E    K NP DF LWK +  G  +W   +  GRPGWH ECS + +K LG+  DIHGGG DL FPHHENE  Q+   +  D    W+H G L I+++KMSKSL NF   + +L +Y + T+R+FF    Y + LN++  NL  +++ LE +  +L      L +E    E+ +E  K+    + ++FN P  ++ + E I      L+ ++  + N L   L   L  +LG+++         +  +DE  E   L+ + N+ K  KN++ +D+ R  L
  S:     2 LKIYNTLKREKEEFKPINPNQVGMYVCGVTVYDLCHFGHGRTFVSFDVIARYLRYLGYNLRYVRNITDVDDKIIKRALENNETCDQLVDRMIAEMHKDFDDLNILRPDVE-PRATKHIPEIVAMVEKLIANGHAYVAADGDVMFDVESFKKYGALSRQNLEQLQAGARVEIKSVKKNPMDFVLWKMSKEGEPSWQSPWGNGRPGWHIECSAMNSKELGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGDYVNYWLHTGMLTIDDEKMSKSLGNFFTIRTMLEKYESETLRYFFLTAHYRSLLNYSLNNLDLARSALERLYTSLR--GCDLSVEVAGGEQYVEAFKA---AMDDDFNTPGALAVLFE-IAREVNKLKTEDMAKANGLAVRLKE-LAGVLGLLYQDPEAFLQGDADNDEVAEIEALIKQRNEAKAAKNWAVADEVRDKL 440
>gi|159029961|emb|CAO90340.1| cysS [Microcystis aeruginosa PCC 7806] (480 aa)
Score = 636, Expect = 3.3e-64, Identities = 145/413 (35%), Positives = 229/413 (55%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE------DNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL------IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL---------LTKILGI----------IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + MY CG TVY++ H+G+ R  + +DV+ R    LGY V +I N TDIDDKI+N+AK E+     ++  +   YF+ +  + +  ++  +PR +  +  I+  + ++    +AY  DGDVY+   + + YGK+S +KLD+L  G          + +KK +P DFALWK    G  +WD  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   K LA  W+H G + +  +KMSKSL NFI  ++LL++Y+   VR       Y  P++F+ E L  + N    +   L+    HL      I +Q+   +  E        + ++FN    ++ + E  K   +     N     K   NL+ L         L+++LG+          +   +   E   L+ +  + K+ KN++ESD+ R  L
  S:    24 VSMYCCGITVYDYCHLGHARTCVVWDVVRRYLEYLGYKVRYIQNFTDIDDKILNRAKNEHTTMAAVAEKFIQAYFEDMAKLGVRPAD-AYPRATHTLDGIKRLVYELEQKGYAYPSDGDVYYSVRRFSDYGKLSGRKLDDLQAGASGRVETDDPEAIKKQDPFDFALWKGAKPGEPSWDSPWGQGRPGWHIECSAMVKEQLGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLAHYWLHNGMVKVAGEKMSKSLGNFITIRELLAKYDPLAVRLLILGAQYRKPIDFSDEGLQAATNGWHTLQEGLSFGYKHLPPDNPAITDQELENRFQE-------AVNHDFNFAGGLAVLFEIAK--ELRKEGNNLTHAGKTDSNLAQLAVKWHTLVKLSRVLGLEIAADQGETPVSEGISAAEIENLIQQRTEAKKAKNYAESDRIRAEL 458
>gi|120554762|ref|YP_959113.1| cysteinyl-tRNA synthetase [Marinobacter aquaeolei VT8] >gi|187629847|sp|A1U1Q7|SYC_MARAV Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|120324611|gb|ABM18926.1| cysteinyl-tRNA synthetase [Marinobacter aquaeolei VT8] (463 aa)
Score = 636, Expect = 3.4e-64, Identities = 142/439 (32%), Positives = 236/439 (53%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M+IY+ +++  +   +L+   ++MYVCG TVY++ H+G+ R ++ FDV+ R     GY+V ++ NITDIDDKI+ +A E      +L+        +    + + + N + PR +  I DI   IQK++    AY  D GDVYF       YGK+S KKL++L+ G + +    K +P DFALWK    G ++W   +  GRPGWH ECS +  K LGD  DIHGGG DL FPHHENE  Q+           WMH G + +N +KMSKSL NF   +++L +Y    VR+F   + Y + ++++ +NL  +   L  + + L      ++  ++ +    + D+     + ++FN    ++ +   +       R +  EE  K    +   L  +LG++  N            L  ++   ++      ++ K+F+E+D+ R  L+EK ++
  S:     1 MRIYNTLTQQKEAFKTLEPGKVRMYVCGMTVYDYCHLGHARVLVAFDVVTRYLRHRGYDVHYVRNITDIDDKILRRADENGEVYTDLTDRMIRAMHEDEAKLGVLSPNEE-PRATAFIDDIIAMIQKLIAGGHAYAADNGDVYFAVESFPDYGKLSKKKLEDLVAGARVDVQEAKRSPADFALWKAAKPGEVSWQSPWGEGRPGWHIECSAMSTKCLGDTFDIHGGGPDLLFPHHENEIAQSECATGHTFVHTWMHAGAIRVNKEKMSKSLGNFFTIREILEKYPAEVVRYFLVSSHYRSQVDYSEDNLAEAGRTLTKLYHALR----GIVPAKEADVAETDHDRRFAEVMDDDFNTAGAIAVL-HAVANDINHYRREGDEEAAKRSAAVLVRLGAVLGLLQQNPEAFFQADTGSELTAEDIEAMIQARADARKAKDFAEADRIRDDLLEKGII 448
>gi|162139463|ref|YP_001172566.2| cysteinyl-tRNA synthetase [Pseudomonas stutzeri A1501] >gi|187631654|sp|A4VL73|SYC_PSEU5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (461 aa)
Score = 634, Expect = 4.8e-64, Identities = 127/319 (39%), Positives = 196/319 (61%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           + IY+ +SK  +    L+   ++MYVCG TVY+  HIG+ R ++ FDV+ R     GY+VT++ NITDIDDKI+ +A E     + + E  +++ +E +       +N+   +++ PR +DHI  +   IQ +++  FAY   +GDVY+   K   YGK+S +K+++L +G + E +  K +P DF LWK    G  +WD  +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A   K  A  WMH G + ++ +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ++L  +K+ LE   YN
  S:     3 LAIYNTLSKAKEPFRPLEGNKVRMYVCGMTVYDFCHIGHARVMVAFDVVTRWLRHRGYDVTYVRNITDIDDKIIRRASENGEPFQALVERMIAAMHEDE-----TRLNVLRPDVE-PRATDHIAGMHTMIQTLIDKGFAYAPGNGDVYYRVGKFVGYGKLSRRKIEDLKIGARIEVDEAKEDPLDFVLWKGAKPGEPSWDSPWGPGRPGWHIECSVMSTCCLGETFDIHGGGPDLVFPHHENEIAQSEAATGKLYANAWMHAGAVRVDGEKMSKSLGNFFTIREVLEKYHPEVVRYLLVSSHYRSPINYSEDSLREAKSALER-FYN 322
>gi|90411646|ref|ZP_01219656.1| cysteinyl-tRNA synthetase [Photobacterium profundum 3TCK] >gi|90327536|gb|EAS43889.1| cysteinyl-tRNA synthetase [Photobacterium profundum 3TCK] (464 aa)
Score = 634, Expect = 4.8e-64, Identities = 127/366 (34%), Positives = 207/366 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIK 366
           +KIY+ ++K  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R     GY++TF+ NITDIDDKI+ +A E       L+     +       + +   +++ PR ++ I +I    ++++   FAY+  +GDV F+ +K  +YG++S + LD+L  G + + ++ K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+           WMH G + ++ +KMSKSL NF   +D+L  Y+  +VR+F     Y + LN++ ENL  +++ LE +  +L      L  + +  E   EF       + ++FN P   S + + ++
  S:     2 LKIYNSLTKQKEEFKPIQPGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYSGYDLTFVRNITDIDDKIIKRAAENGESCDSLTERLIGEMHKDFDALGMKRPDIE-PRATEFIAEIITMCERLIERGFAYVASNGDVMFEVSKFEEYGRLSRQDLDQLQAGARVDIDMAKRSPLDFVLWKMSKPGEPTWESPWGAGRPGWHIECSAMNSAILGDHFDIHGGGSDLQFPHHENEIAQSCCATGSQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAESVRYFLMSGHYRSQLNYSEENLKQARSALERLYTSLRGLD--LTAQAEGGE---EFVTRFTASMNDDFNTPEAYSVLFDMVR 364
>gi|15643482|ref|NP_228528.1| cysteinyl-tRNA synthetase [Thermotoga maritima MSB8] >gi|6831684|sp|Q9WZH8|SYC_THEMA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|4981244|gb|AAD35801.1|AE001743_3 cysteinyl-tRNA synthetase [Thermotoga maritima MSB8] (460 aa)
Score = 634, Expect = 4.9e-64, Identities = 147/430 (34%), Positives = 226/430 (52%)
  Q:     6 FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF-KSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE------LLNKWNKLKQEKNFSESDKYRKLLME 435
              K ++ V +    ++MYVCGPTVY+ +H+GN RP + FDV  R     GY V  + N TDIDDKI+NKA +  +    ++  +  +Y+     + I  +N   PR +D ++DI   I+K+V   FAY  +  VYFD  K  +YG++S KK+++L+ G + E +  K +P DF+LWK+   G   W   +  GRPGWH EC+ +  K LG+  DIH GG DL FPHHENE  Q  A+  K  AR WMH G +     KMSKS  N    ++ +  Y  + +R+      Y +P++F+ E L +    ++ +   L  + KS  I   K N    E+    +  L ++FN P  VS I E  +  S  + + + E+    +  +      +LG+  +N    E         L+   + L++EK +  SD+ R  L E
  S:     7 LTGKKEEFVPIQPGVVRMYVCGPTVYDLIHVGNARPALVFDVFRRYLEYRGYRVIMVQNFTDIDDKIINKANQLGVDYKTVADTFIAEYWRDAHALGIRPANFH-PRTTDFVEDIVEIIEKLVEKGFAYQTETGVYFDVRKFEKYGELSKKKIEDLIAGARVEVDETKKSPLDFSLWKKAKPGEPCWKSPWGEGRPGWHIECTVMSVKILGESFDIHAGGEDLVFPHHENEKAQAEALTGKVFARYWMHNGMVRFLGDKMSKSTGNIFTVREAVKRYGRDGLRYMILSKHYRSPMDFSEELLQDYSRAVKRVWEILGRYEKSGDIGIPKRNAVYEEYVNRFVEALDDDFNTPVAVSLIFELARNLSKAMDDNDREDALLYYHLIRREFGPVLGLFDLNEEKKEVSSEELLKLLIEVRDVLRKEKRYDLSDRIRDRLRE 443
>gi|163847402|ref|YP_001635446.1| cysteinyl-tRNA synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187601713|ref|ZP_02987941.1| cysteinyl-tRNA synthetase [Chloroflexus sp. Y-400-fl] >gi|163668691|gb|ABY35057.1| cysteinyl-tRNA synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187486391|gb|EDU24364.1| cysteinyl-tRNA synthetase [Chloroflexus sp. Y-400-fl] (472 aa)
Score = 634, Expect = 4.9e-64, Identities = 126/320 (39%), Positives = 192/320 (60%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINN------QKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +++Y+ +S+  + + +++   ++MYVCG T Y+  HIG+    I FDV+ R     GY V  I N TDIDDK++ +A       L LS  Y  ++   L+ +N+  +   +PRVS  +  I  ++Q ++   +AY+VDGDVYF   +   YGK+S + LDE+L G + E + +K +P DFALWK    G  +W+  +  GRPGWH ECS +  ++LG QIDIHGGG DL FPHHENE  Q+ ++  +  AR W+H G L + N      +KMSKSL N +   D LS Y+ +  R     +SY +PL +  E   +++ +LE ++  L
  S:     3 IQLYNTLSRRLEPLETIEPGVVRMYVCGVTPYDEAHIGHAMSAIVFDVIRRYLEFRGYEVRHIVNFTDIDDKVIARANALGQDPLTLSGQYAAEFLAQLQAMNVLPAT-AYPRVSTTMPAIIAFVQGLIERGYAYVVDGDVYFRVRRDEDYGKLSGRSLDEMLSGTRFEVDPRKESPADFALWKAARPGEPSWESPWGPGRPGWHIECSAMAMEHLGPQIDIHGGGTDLIFPHHENEIAQSESLTGQCFARYWVHNGMLQLVNPQTRQVEKMSKSLGNVVTIADFLSRYDADVFRLIVLSSSYRSPLTYNDEVAADNQRKLERLLSAL 329
>gi|192361138|ref|YP_001982161.1| cysteinyl-tRNA synthetase [Cellvibrio japonicus Ueda107] >gi|190687303|gb|ACE84981.1| cysteinyl-tRNA synthetase [Cellvibrio japonicus Ueda107] (466 aa)
Score = 634, Expect = 5.7e-64, Identities = 153/439 (34%), Positives = 245/439 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF---KSHLIIEQKYNEKNLEFDKSNLIELTNNFN----LPNIVSFIEEKIKYSSILLRN---KNFEELNKLHFNLSYLLTKILGIIHVN------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           ++IY+ +S+  +E   L    I MYVCG TVY++ HIG+ R ++ FDV+ +     G++VT++ NITDIDDKI+ +A E      +L+  +     +    + I   +++ PR +  I  I N  Q +++  +AY   +GDVY+  T+   YGK++NK +DELLVG + E +  K +P+DF LWK    G   W   +  GRPGWH ECS +     G   DIHGGG DL FPHHENE  Q+ A N       WMH G + ++ +KMSKSL NF   +D+L +Y+   VR+    + Y +P+N+  +NL+ ++  LE     L  +   +S  + E + +    ++ +S +  + ++FN    L ++   + E        L N    + E   +L   L   L  ILGI+  N            +  +E   L+ +  + K+EKN++ +D+ RK L +  +L
  S:     3 LQIYNTLSRQKEEFKPLKPGKISMYVCGITVYDYCHIGHARVLVAFDVITKFLRSQGWDVTYVRNITDIDDKIIKRANENGEQYTDLTKRFIDYMHEDEARLGIARPDIE-PRATAFIDQIINMNQALIDKGYAYPASNGDVYYRVTRFADYGKLTNKNVDELLVGARIEVDEIKEDPRDFVLWKAAKAGEPAWKSPWGQGRPGWHIECSAMSKDCCGTTFDIHGGGPDLPFPHHENEIAQSEAANGCKYVNYWMHAGAVRVDGEKMSKSLGNFFTIRDVLEKYHPEVVRFLLVSSHYRSPINYAEDNLVEARTGLERFYGALRDYADVESLPLTELQAS----DYYRSFVAAMNDDFNTRVALASMYDLVRE--------LNNAGKTDVERAQRLAGELK-ALGLILGILQENPRVFLQTGTSGQIAAEEVDRLVAERIQAKKEKNYARADEVRKQLADNGIL 452
>gi|119872615|ref|YP_930622.1| cysteinyl-tRNA synthetase [Pyrobaculum islandicum DSM 4184] >gi|189082073|sp|A1RTJ7|SYC_PYRIL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|119674023|gb|ABL88279.1| cysteinyl-tRNA synthetase [Pyrobaculum islandicum DSM 4184] (473 aa)
Score = 634, Expect = 6.2e-64, Identities = 149/435 (34%), Positives = 242/435 (55%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNI-KMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGEL-----ELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENE-NIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL-----IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKY--SSILLRNKNFEELNKLHFNLSYL-LTKILGIIHVNLFDDEAIE----LLNKWNKLKQEKNFSESDKYRKLLME 435
           M+IY+  ++  +E +     + + YVCG T Y+H+H+G+ R  + FD+  R    LGY V  + N TDIDDKI+N+AKEE   E      E+   Y  +YF++ K + I  +   +PRV+++++D+  +I  +V   +AY+  DG VYF+  K   YG +S +K++EL+ G + E    K NP DFALWK  T G   WD  +  GRPGWH EC  +  K+LG   D HGGG DL FPHHENE  I        + AR W+HVG+L +  +KMSKSL N I  +++LS+++   +R  +  + Y  P+ FT E L  +++  + +    +     L       ++   ++ L++ ++    L ++ + P  V  +    +Y  S++L + +       L     Y+ +  +LG++       E  E    L+    KL+QE+ +  +D  R+ L E
  S:     1 MRIYNTATRQVEEFTTYVPRLARGYVCGITPYDHMHVGHGRVYVFFDIFRRYLERLGYEVRLVINFTDIDDKIINRAKEEFGHEAYKRWREIPERYIAEYFEMTKKLYIKPA-YAYPRVTENVEDMVKWISTLVEKGYAYVAPDGSVYFEVAKVPNYGVLSRQKIEELVAGARVEPEPGKRNPLDFALWKSWTPGEPWWDSPWCPGRPGWHLECVVMSTKHLGAPFDFHGGGADLIFPHHENEIAIARAYFGVDNFARYWIHVGYLTVRGEKMSKSLGNIITLREVLSKHSGEALRLAYAMSHYRKPMEFTYELLQQAEDMAKTLYTAYDELSQALRDAGEKDQEPLAQEALKYAEAFYGALDDDMSTPEAVQQLYGMARYIISTVLHKIEKISRETALTILNKYVEMADVLGVLERRQIPKELEEVVKTLVEVRAKLRQERQYQLADYIRQRLAE 455
>gi|58336686|ref|YP_193271.1| cys-tRNA synthetase cycrs [Lactobacillus acidophilus NCFM] >gi|81311530|sp|Q5FM34|SYC_LACAC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|58254003|gb|AAV42240.1| cys-tRNA synthetase cycrs [Lactobacillus acidophilus NCFM] (477 aa)
Score = 633, Expect = 6.4e-64, Identities = 159/435 (36%), Positives = 256/435 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS----EDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINS-------KNQLENIIYNL---NIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNL------SYLLT-----KILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           ++IY+ +++  +E   L    I MYVCGPTVYN++HIGN R  I FD + R F   GY V ++ N TD+DDK++N+A+ E I   EL+  +   + +    +NI  + +  PR +  IKDI N+++ +++  +AY VDGDVY+   K   YG++S++ +++L  G       E+  +K +P DFALWK  +    + WD  +  GRPGWH ECS +  KYLG+ IDIHGGG DL+FPHHENE  Q+ A  ++     WMH G + +  + +KMSKSL NF+   D+L + +   +R+F     Y   +N++ ENL  +       KN L NI Y +      K+   + +  NE   +F    +  + ++FN+ N ++ I + +    ++  N N + ++K    L      ++LL      K L        D+E  EL++K ++ +  K+++ SD+ R  L E
  S:     4 VRIYNTLTRKKEEFKPLVPGQISMYVCGPTVYNYIHIGNARSSIAFDTIRRYFEYKGYQVKYVSNFTDVDDKMINEARAEKITVPELAEKFINAFLEDTTALNIEPATLH-PRATHEIKDIINFVKVLIDKGYAYEVDGDVYYRAKKFQHYGELSDQNIEQLEEGASEHINDEEQNRKEDPIDFALWKAQKGPDEIAWDSPWGKGRPGWHIECSVMSTKYLGNTIDIHGGGQDLEFPHHENEIAQSEAKTDQKFVNYWMHNGFVTVGKDQEKMSKSLHNFVTVHDILRKIDPQVLRFFMASVQYRRQINYSEENLKQAATILDRFKNTLTNINYRIADDTPTKTSEDLVKAINETEEKF----VAAMDDDFNVQNALTSIYDLL---PVVNANANSDNVDKDALKLFEEKLAAWLLVFGVDIKKLCAQTTGSNDEEIEELVSKRDEARNNKDWATSDQIRDQLKE 460
>gi|15641850|ref|NP_231482.1| cysteinyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591342|ref|ZP_01678630.1| cysteinyl-tRNA synthetase [Vibrio cholerae 2740-80] >gi|121730275|ref|ZP_01682651.1| cysteinyl-tRNA synthetase [Vibrio cholerae V52] >gi|147673703|ref|YP_001217382.1| cysteinyl-tRNA synthetase [Vibrio cholerae O395] >gi|153225606|ref|ZP_01954801.1| cysteinyl-tRNA synthetase [Vibrio cholerae MAK 757] >gi|187631647|sp|A5F763|SYC_VIBC3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|11387140|sp|Q9KQZ9|SYC_VIBCH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|9656376|gb|AAF94996.1| cysteinyl-tRNA synthetase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121546806|gb|EAX56972.1| cysteinyl-tRNA synthetase [Vibrio cholerae 2740-80] >gi|121627977|gb|EAX60538.1| cysteinyl-tRNA synthetase [Vibrio cholerae V52] >gi|124117267|gb|EAY36010.1| cysteinyl-tRNA synthetase [Vibrio cholerae MAK 757] >gi|146315586|gb|ABQ20125.1| cysteinyl-tRNA synthetase [Vibrio cholerae O395] (459 aa)
Score = 633, Expect = 6.8e-64, Identities = 123/319 (38%), Positives = 194/319 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV+ R    LGY++TF+ NITDIDDKI+ +A E       L+     + +     +NI   +++ PR + +I++I   +++++   FAY+ D GDV F+ ++ ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  + +GRPGWH ECS + +  LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE  +YN
  S:     2 LKIYNSLTRQKEEFKPIVAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVARYLRYLGYDLTFVRNITDIDDKIIKRAAENAETCESLTERLIQEMYADFDALNIKRPDVE-PRATAYIEEIIALVERLIERGFAYVADNGDVMFEVSQYSEYGKLSKQDLDQLQAGARVDIEAAKRSPLDFVLWKMSKPGEPTWESPWGSGRPGWHIECSAMNSSILGTHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLER-LYN 321
>gi|87122362|ref|ZP_01078243.1| cysteinyl-tRNA synthetase [Marinomonas sp. MED121] >gi|86162337|gb|EAQ63621.1| cysteinyl-tRNA synthetase [Marinomonas sp. MED121] (460 aa)
Score = 633, Expect = 7.2e-64, Identities = 152/436 (34%), Positives = 248/436 (56%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELS-SYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN-IFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKY-----------SSILLRNKNF--EELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +K+Y+ +S K ++ V L    + MYVCG TVY++ HIG+ R +I+FD++ R     G+++ ++ NITD+DDKI+ +A E +     L+    E Q  D LK  N      + P+ ++ +++I + I  +V+  FAY    GDVYF T K   YGK++N+KL+++L G + +    K NP DF LWK    G ++W   +  GRPGWH ECS +    LG   DIHGGG DLKFPHHENE  Q+   N  D    WMH G + +NN+KMSKSL NF   +D+L +YN   +R+    + Y +P++++ ++L+ +K  LE +  +L     +   I   Y E+  +        + ++FN P  +S + + ++            + IL +  +   E L  L  +  Y L     +++  + + E   L+ +  + +++KNF+ SD+ R  L E+
  S:     2 LKVYNTLSGKKEEFVPLVPGKVGMYVCGNTVYDYCHIGHARAMISFDIIARHIRFSGFDLNYVRNITDVDDKIIKRAAENDETPESLTLRMIEAQTQDELKLGNKLPD--REPKATEFMQEIIDMISVLVDKGFAYQGSTGDVYFRTEKHEAYGKLNNRKLEDMLAGARIDVESAKENPADFVLWKSAKEGEVHWQSPWGIGRPGWHIECSAMSTNCLGPHFDIHGGGPDLKFPHHENEIAQSECANGTDYVNYWMHCGAVRVNNEKMSKSLGNFFTVRDVLEKYNPEVIRFLMVSSQYRSPIDYSEQSLLEAKVGLERMYTSLQGQALTDDYIASSYTERYQQ-------AMDDDFNTPVAISVLFDLVRELNKAKASAADNAPILAKELSVLAELLGLLGQDPEYFLKN--SVLNNGISEAEIETLIAERIQARKDKNFARSDEIRDELSEQ 444
>gi|166365576|ref|YP_001657849.1| cysteinyl-tRNA synthetase [Microcystis aeruginosa NIES-843] >gi|189082070|sp|B0JJL5|SYC_MICAN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|166087949|dbj|BAG02657.1| cysteinyl-tRNA synthetase [Microcystis aeruginosa NIES-843] (480 aa)
Score = 633, Expect = 7.4e-64, Identities = 146/413 (35%), Positives = 230/413 (55%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSE------DNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL------IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL------LTKILGIIHVNLFDDEA------------IE-LLNKWNKLKQEKNFSESDKYRKLL 433
           + MY CG TVY++ H+G+ R  + +DV+ R    LGY V +I N TDIDDKI+N+AK E+     ++  +   YF+ +  + +  ++  +PR +  +  I+  + ++    +AY  DGDVY+   + + YGK+S +KLD+L  G          + +KK +P DFALWK    G  +WD  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   K LA  W+H G + +  +KMSKSL NFI  ++LL++Y+   VR       Y  P++F+ E L  + N    +   L+    HL      I +Q+   +  E        + ++FN    ++ + E  K   +     N     K   NL+ L      L K+  ++ + +  D+             IE L+ +  + K+ KN++ESD+ R  L
  S:    24 VSMYCCGITVYDYCHLGHARTCVVWDVVRRYLEYLGYKVRYIQNFTDIDDKILNRAKNEHTTMAAVAERFIEAYFEDMAKLGVRPAD-AYPRATHTLDGIKRLVYELEQKGYAYPSDGDVYYSVRRFSDYGKLSGRKLDDLQAGASGRVETDDPEAIKKQDPFDFALWKGAKSGEPSWDSPWGQGRPGWHIECSAMVKEQLGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLAHYWLHNGMVKVAGEKMSKSLGNFITIRELLAKYDPLAVRLLILGAQYRKPIDFSDEGLQAATNGWHTLQEGLSFGYKHLPPDNPAITDQELENRFQE-------AVNHDFNFAGGLAVLFEIAK--ELRKEGNNLTHAGKTDSNLAQLAVKWHTLVKLSRVLGLEMAADQGETPVSEGISAADIENLIQQRTEAKKAKNYAESDRIRAEL 458
>gi|153830573|ref|ZP_01983240.1| cysteinyl-tRNA synthetase [Vibrio cholerae 623-39] >gi|148873935|gb|EDL72070.1| cysteinyl-tRNA synthetase [Vibrio cholerae 623-39] >gi|150421926|gb|EDN13902.1| cysteinyl-tRNA synthetase [Vibrio cholerae AM-19226] (459 aa)
Score = 633, Expect = 7.4e-64, Identities = 123/319 (38%), Positives = 194/319 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV+ R    LGY++TF+ NITDIDDKI+ +A E       L+     + +     +NI   +++ PR + +I++I   +++++   FAY+ D GDV F+ ++ ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE  +YN
  S:     2 LKIYNSLTRQKEEFKPIVAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVARYLRYLGYDLTFVRNITDIDDKIIKRAAENAETCESLTERLIQEMYADFDALNIKRPDVE-PRATAYIEEIIALVERLIERGFAYVADNGDVMFEVSQYSEYGKLSKQDLDQLQAGARVDIEAAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLER-LYN 321
>gi|73540824|ref|YP_295344.1| cysteinyl-tRNA synthetase [Ralstonia eutropha JMP134] >gi|109894927|sp|Q473D3|SYC_RALEJ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|72118237|gb|AAZ60500.1| cysteinyl-tRNA synthetase [Ralstonia eutropha JMP134] (462 aa)
Score = 633, Expect = 7.7e-64, Identities = 123/316 (38%), Positives = 195/316 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ +++  +  V ++   ++MYVCG TVY++ H+G+ R ++ FD+++R     GY+VTF+ NITDIDDKI+ +A E  E IG+L  + + +  + D    + I   + + PR +D++  + + I K+  N  AY   DGDV +   K + YGK+S K L++L  G++   N  K +P DF LWK           W+ K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+   + K    +WMH G + +N++KMSKSL NF   +++L EY+   VR+F  +  Y +PLN++  +L ++++ L  +
  S:     4 LNIYNTLAREKQPFVPIEPGKVRMYVCGMTVYDYCHVGHARVMVVFDMVHRWLRAAGYDVTFVQNITDIDDKIIRRAAENGETIGQLT-TRFIQYMHEDA-DALGIVRPDHE-PRATDYVPQMLDLIGKLEANGLAYQATDGDVNYSVRKFDGYGKLSGKSLEDLRAGERVTANDAKQDPLDFVLWKSAKESEPPESKWNSKWGMGRPGWHIECSAMSCTLLGEHFDIHGGGADLQFPHHENEIAQSEGASGKPFVNVWMHNGFVRVNDEKMSKSLGNFFTIREVLKEYDAEVVRFFILRAHYRSPLNYSDAHLDDARHALTRL 324
>gi|16124715|ref|NP_419279.1| cysteinyl-tRNA synthetase [Caulobacter crescentus CB15] >gi|24418699|sp|Q9AAY2|SYC_CAUCR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|13421633|gb|AAK22447.1| cysteinyl-tRNA synthetase [Caulobacter crescentus CB15] (463 aa)
Score = 633, Expect = 7.7e-64, Identities = 130/316 (41%), Positives = 184/316 (58%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLEL-GYN-VTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQN-IAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +KI+D +++  ++ V  D + + MYVCGPTVYN+ HIGN RP++ FDVL R+   L G + V +  N+TD+DDKI  KA +E +    ++  Y   Y      +      ++ P+ ++HI  I   I ++V N  AY  +G V FDT     YG++S + LDE++ G + E    K +P DF LWK +      W+  +  GRPGWH ECS +I+K LG  IDIH GGIDL FPHHENE  Q+  A     LA  WMH G L+++ +KMSKSL N I+  +LL       +RW      Y  PL++T E L  SK  L+ +
  S:     3 LKIHDTLTREKRDFVPADPQRVTMYVCGPTVYNYAHIGNFRPVVVFDVLFRVLRHLYGEDAVVYARNVTDVDDKINQKAADEGVPISVITDRYLAAYHQDADALGALRPTLE-PKATEHIGAILEMIGQLVENGSAYAAEGHVLFDTQSFADYGQLSGRPLDEMIAGARVEVAPYKRHPADFVLWKPSKENEPEWESPWGAGRPGWHIECSAMIDKALGQTIDIHAGGIDLTFPHHENEVAQSRCAHKTSVLANYWMHNGFLDMSGEKMSKSLGNVIIPHELLETTPGEVIRWALLSAHYRQPLDWTPELLEQSKKSLDRL 322
>gi|33152217|ref|NP_873570.1| cysteinyl-tRNA synthetase [Haemophilus ducreyi 35000HP] >gi|38372510|sp|Q7VMA0|SYC_HAEDU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|33148439|gb|AAP95959.1| cysteinyl-tRNA synthetase [Haemophilus ducreyi 35000HP] (459 aa)
Score = 633, Expect = 8.0e-64, Identities = 152/439 (34%), Positives = 246/439 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII----------HVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ + +  +E   ++   + MYVCG TVY+  H G+ R  ++FDV+ R     GYN+ ++ NITD+DDKI+ +A E N     L      +  +    +NI   +++ PR ++HI +I   ++K++ N  AY+  DGDV FD T  NQYG +S + LD+L  G + E    K NP DF LWK++     +W   +  GRPGWH ECS + NK LG+  DIHGGG DL FPHHENE  Q+   +  +    W+H G L I+ +KMSKS+ NF   + +L  Y+  ++R+FF    Y + L+++T+NL  +++ LE +   L      L ++    E  +   K+    + ++FN P  ++ + E  +  +  L+ ++ ++ N L   L   L  +LG++           VN+     IE L+ + N+ K  KN++ +D+ R  L    +L
  S:     2 LKIYNTLKREKEEFKPINPAQVGMYVCGVTVYDLCHFGHGRTFVSFDVIARYLRYSGYNLRYVRNITDVDDKIIKRALENNESCEALVERMIAEMHNDFDALNIMRPDVE-PRATEHIAEIIAMVEKLIMNGHAYVAADGDVMFDVTSFNQYGALSRQNLDQLQAGARVEIKSAKKNPMDFVLWKRSKENEPSWLSPWGNGRPGWHIECSAMNNKELGEHFDIHGGGADLMFPHHENEIAQSCCAHQGEYVNYWLHTGMLTIDKEKMSKSVGNFFSIRHMLGLYDAESLRYFFLTAHYRSLLDYSTDNLDLARSALERLYTALR--GCDLSVQANGGENYVTAFKT---AMDDDFNTPAALAVLFEMAREVN-KLKTEDQQQANALAVCLKE-LAAVLGLLTQDPDNFLKGEVNIDQTAEIEALIQQRNQAKANKNWAVADQVRGKLKAMNIL 446
>gi|116491535|ref|YP_811079.1| cysteinyl-tRNA synthetase [Oenococcus oeni PSU-1] >gi|116092260|gb|ABJ57414.1| cysteinyl-tRNA synthetase [Oenococcus oeni PSU-1] (467 aa)
Score = 632, Expect = 8.4e-64, Identities = 146/410 (35%), Positives = 240/410 (58%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDN----LKKNNPQDFALWK-QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTN-TVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI-------IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD------EAIE-LLNKWNKLKQEKNFSESDKYR 430
           I MYVCGPTVYN++H+GN R  I FD + R  L  GY+V F+ N TD+DDKI+N+A+EE + E  ++S Y   +++  K +NI  +  +  R ++ I DI  ++  +++  +AY   G VYF   K+  YG ++++ L++L VG     +      K +P DFALWK +    + WD  +  GRPGWH ECS +  KYLG  IDIHGGGIDL FPHH +E  Q+ A   K     W+H G +N+NN+KMSKSL NF    +LLS Y+    +R+    T Y  P+N+++  L  ++ +L+ I       K+          I+Q  +++   F ++    + ++FN+ N ++ I E ++ ++  + + + ++  K    +   + +++G+  ++  +       + IE LL K    +  KN+ +SD+ R
  S:    23 ITMYVCGPTVYNYIHVGNARSSIAFDTIRRYLLYRGYDVNFVSNFTDVDDKIINRAQEEGVSENAIASKYIKAFYEDTKPLNIIPATTR-TRATEVIPDIIEFVSDLIDKGYAYESQGGVYFRVRKAGNYGLLAHENLEDLEVGASGRLDDGALALKEDPLDFALWKNEPRQVIKWDSPWGQGRPGWHIECSVMSTKYLGYTIDIHGGGIDLAFPHHTDEMAQSEAHTGKQFVHYWLHNGFVNVNNEKMSKSLGNFTTVHELLSSYDDPMAIRFLMTATHYRRPINYSSSELERARVELDRIRTAYRRLKNADFKIGDDPQIDQLVSKQTAAFVEA----MDDDFNVANALAAIFELVRLANSYVDSGDVKD--KSAQEILRQIAELIGVFGISGLETKKESLPKKIELLLKKRETARINKNWQQSDQLR 445
>gi|115480611|ref|NP_001063899.1| Os09g0556500 [Oryza sativa (japonica cultivar-group)] >gi|113632132|dbj|BAF25813.1| Os09g0556500 [Oryza sativa (japonica cultivar-group)] >gi|125606594|gb|EAZ45630.1| hypothetical protein OsJ_029113 [Oryza sativa (japonica cultivar-group)] (569 aa)
Score = 632, Expect = 9.0e-64, Identities = 144/413 (34%), Positives = 229/413 (55%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE---------LTNNFNLPNIVSFIEEKIKYSSILL-------RNKNFEELNKLHFNLSYLLTKILGII-----------------HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + MYVCG T Y+  HIG+ R  + FDVL R    L + V ++ N TDIDDKI+ +A +       LS  Y   +   +  ++    +++ PRVSDHI  I N I++I++N  AY + GDVYF      +YG +S +KLD+   G++   + +K NP DFALWK    G  +WD  +  GRPGWH ECS +   YLG   DIHGGG DL FPHHENE  Q+ A         W+H G +N+N+QKMSKSL NF+  + +   Y+   +R F   T Y +P+N+T E L  + ++L      L   +      Q      L  + +N I+         ++++ +    ++ I E +K  + LL       + K  E L+ +   +  +L+ +LG++                   ++ +++ ++ + +    ++ K + +SD+ RK L
  S:    94 VGMYVCGVTPYDDSHIGHARAYVAFDVLYRYLRYLDHKVRYVRNFTDIDDKIIARANQLGEDPFSLSKRYSDDFLSDMANLHCLPPSVE-PRVSDHIDQIINMIKQIIDNDCAYAIGGDVYFSVENFPEYGDLSGRKLDDNRAGERVAVDERKKNPADFALWKAAKDGEPSWDSPWGPGRPGWHIECSAMSAHYLGHSFDIHGGGEDLIFPHHENEIAQSRAACCDSSINYWIHNGFVNVNSQKMSKSLGNFVTIRKVTELYHPLALRMFLLGTHYRSPINYTIEQLNVASDRLYYTYQTLQDCEESCQQHQSKAGDPLPVNTTNCIQKLHDEFETSMSDDLHTSVALAAISEPLKVMNDLLHTRKGKKQEKRLESLSAMEEKIRMVLS-VLGLLPSSYYEALQQLREKALRRASMTEEQVLQKIEERTSARKAKQYEKSDEIRKEL 538
>gi|167837113|ref|ZP_02463996.1| cysteinyl-tRNA synthetase [Burkholderia thailandensis MSMB43] (465 aa)
Score = 632, Expect = 9.1e-64, Identities = 122/316 (38%), Positives = 192/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWK----QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ HIG+ R ++ FDV+ R     GY VT++ NITDIDDKI+ +A E       L+S +          + +   +++ PR +D I  +   I+K+  N +AY   DGDV +   K   YGK+S K L++L  G++   N  K +P DF LWK    Q   G +W+ K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++++KMSKSL NF   +++L +++   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHIGHARMVVVFDVVQRWLRAAGYRVTYVRNITDIDDKIIRRAVENGETIQSLTSRFTRAMNVDFDALGVERPDIE-PRATDFIPQMLGMIEKLEANGYAYQAKDGDVNYSVRKFANYGKLSGKSLEDLRAGERVAANDAKEDPLDFVLWKRAKPQDPAGASWESKYGAGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDSEKMSKSLGNFFTIREVLEKFDAEVVRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|196189672|gb|EDX84636.1| cysteinyl-tRNA synthetase [Synechococcus sp. PCC 7335] (486 aa)
Score = 632, Expect = 9.9e-64, Identities = 153/431 (35%), Positives = 245/431 (56%)
  Q:     3 IYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDK----SEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLL---SEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSH----LIIEQKYNEKNLE-FDKSNL----IELTNNFNLPNIVSFI----EEKIKYSSILLR----NKNFEELNKLHFNLSYLLTKILGI-------IHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           IY+ +S+  +    L  + + MY CG TVY++ H+G+ R  I +D + R     GYNV ++ N TDIDDKI+N+A++EN     ++  Y T YF+ +  +NI  ++ ++   +  I  I+  I ++    +AY   GDVY+   K   YGK+S +KLD++  G      ++ +  K +P DFALWK        W+  +  GRPGWH ECS ++   LGD IDIH GG DL+FPHHENE  Q+ A   K LA  WMH G +N++  KMSKSL NF   ++LL   +  +   VR F  Q+ Y  PL+FT E ++ +K     +   LN    H       +   +E  ++  D++ +    I + ++FN P  ++ +    +E  + S++++     + N  EL +  +     L  +LG+       +   +  +  IE L+ +    KQ KN++ESD+ R  L
  S:     5 IYNTLSRQKEAFKPLSPEQVTMYCCGVTVYDYCHLGHARSYIVWDTIRRYLSWRGYNVRYVQNFTDIDDKILNRARQENSSMEAVAKEYTTAYFEDMARLNILEAD-EYTYATHTIDGIKRLIHQLEQKGYAYSAKGDVYYSVRKFEGYGKLSGRKLDDMEAGRSGRVGTQADSIKQDPFDFALWKSAKPDEPAWESTWGPGRPGWHIECSAMVRDRLGDTIDIHMGGADLQFPHHENEIAQSEAATGKPLATYWMHNGMVNVDGTKMSKSLGNFTTIRNLLDAEAAPDPMAVRMFVMQSQYRMPLDFTEEAIVAAKKGWSTLNEGLNFGVRHGEDLGWAKAAADEIAVDALDQAAVEQFRISMDDDFNTPGAIAVLFGLAKELQRQSNVIIHEGAADANPAELQQ-QWQTLVTLAGVLGLEAQAIESVDAGVLSEAEIETLIAQRANAKQAKNYAESDRIRDEL 467
>gi|78777410|ref|YP_393725.1| cysteinyl-tRNA synthetase [Sulfurimonas denitrificans DSM 1251] >gi|109894960|sp|Q30R91|SYC_THIDN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|78497950|gb|ABB44490.1| cysteinyl-tRNA synthetase [Sulfurimonas denitrificans DSM 1251] (466 aa)
Score = 632, Expect = 1.0e-63, Identities = 159/434 (36%), Positives = 248/434 (57%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQT-TIGLNWDLKFSTGRPGWHTECSCLINKYLGD-----QIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRN--KNFEELNKLHFNLSYLLTKILGIIHVNLFD-----------DEAIELLNKWNKLKQEKNFSESDKYRKLLM 434
           M I+D   K  +E +  ++  + +YVCGPTVY+  H+G+ +  + FD+L R+    GY VT+  NITDIDDKI+N+A+E+N    E++ +Y   Y   +  + I   +++ P+ ++ +  +   +QK+++NK AY  D GDVYFDT+  ++Y  +SN+  DE     + + + +K NP DFALWK      + +   F  GRPGWH ECS +I K+L        +DIHGGG DL FPHHENE  Q     +  LA  WMH G +NI+ +KMSKSL N    KD L  Y+   +R++   T Y +  NF  E+L  +K +L+  IY L       +    Y ++  +F K  L  L+++ N+   ++ IEE I  ++  L    K+ E   +   NLS+ + KILG    N ++            E  +L+ K  + K+ K+F+ SD  R  ++
  S:     1 MFIFDSAKKIKREFIPQEQGKVSLYVCGPTVYDDAHLGHAKSALVFDLLCRVLNANGYEVTYARNITDIDDKIINRAQEQNKTIKEVTDFYTDAYHKEMALLGISRPDIE-PKATESLDAMYALVQKLLDNKHAYTTDDGDVYFDTSSDSKYLTLSNRVQDESEKLQRVQSSSQKRNPADFALWKSIHDESVTFGSPFGKGRPGWHLECSAMIEKHLSKPNAKFAVDIHGGGADLLFPHHENEAAQTRCATDHALAAYWMHNGFVNIDGEKMSKSLGNSFFLKDALKIYDGEVLRFYLLSTHYRSNFNFNEEDLATAKKRLDK-IYRLK----KRLFGVTYEDEKTDFKKELLETLSDDLNISASLALIEEMITRANETLDTAGKHKELKREALSNLSF-IEKILGFGIKNPYEYFQFGVNEETKTEIAKLIEKRAEAKKSKDFAASDMLRDKIL 448
>gi|30316152|sp|Q8DHW6|SYC_SYNEL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (486 aa)
Score = 632, Expect = 1.1e-63, Identities = 149/436 (34%), Positives = 247/436 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWK-----QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI-----IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLH--------------FNLSYLLTKILGI---------IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           + +Y+ +S+  +  S L  + + +Y CG TVY++ H+G+ R  + +DVL R    LGY V ++ N TDIDDKI+ +A E       +S  Y   Y   +  +NI  ++  +PR ++ I +I N IQ +++  +AY+  GDVY+   +   YGK+S ++L++L+ G     + E+  +K +P DFALWK     + ++   W+  +  GRPGWH ECS ++ +  G  +DIH GG+DL FPHHENE  Q+ AV  + LAR W+H G + +N +KMSKSL NF   +DLL++  +   +R    Q  Y  PL+FT E L  +    + +   L++ +   +      E + + K   F ++    +  + N    ++ I E       L +  N E+   LH              ++    L ++LG+         + V L D+E   L+      +Q KN++ESD+ R LL+ +
  S:     3 LHLYNTLSRRLEPFSPLHPERVTIYACGVTVYDYCHLGHARSYVAWDVLRRYLTFLGYTVHYVQNFTDIDDKILRRAYENGETMATVSDRYIAAYHQDMAALNILPAS-AYPRATEVIPEIINLIQGLLDRGYAYVAGGDVYYAVAQFPSYGKLSGRQLEQLMAGASGRIEEEEEQRKRHPLDFALWKAAKPEEMSVYHPWEAPWGKGRPGWHIECSAMVRQAFGATVDIHCGGMDLIFPHHENEIAQSEAVTQQPLARFWLHNGFVTVNTEKMSKSLGNFTTIRDLLAQGLDPMALRLLVLQAQYRKPLDFTPEALTAAAKGWQTLGEALHLHQQIPLPPIDAAEVRSHPKTEAFCQA----MDEDLNTAAALAVIFE-------LAKTLNREQHRYLHGGGWGRSPAEVSRDWHTLVTLAQVLGLEAKEESNPALTVELTDEEIQALIAARTAARQAKNYTESDRLRDLLLAQ 465
>gi|56460141|ref|YP_155422.1| cysteinyl-tRNA synthetase [Idiomarina loihiensis L2TR] >gi|61216136|sp|Q5QYP3|SYC_IDILO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|56179151|gb|AAV81873.1| Cysteinyl-tRNA synthetase [Idiomarina loihiensis L2TR] (459 aa)
Score = 631, Expect = 1.1e-63, Identities = 138/414 (33%), Positives = 236/414 (57%)
  Q:    20 NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL---LTKILGIIHVN-----LFDDEAI----ELLNKWNKLKQEKNFSESDKYRKLL 433
           ++ +YVCG T Y++ HIG+ R  + FD++ R   +LGY+V ++ NITD+DDKI+ +A E      +++  +  +       +N+   +++ PRV+ H+ +I   I++++ N  AY   +GDV FD +  N YGK+S + L++L  G + + +  K +P DF LWK    G  +W   +  GRPGWH ECS +  K+LG   DIHGGG DL FPHHENE  Q+   N  +  + WMH G + ++N+KMSKSL NF   + +L +Y+  TVR+F   + Y + LN+T ENL  + + LE +   L         E+  ++    F ++    + ++ N P  +S + E  +       N+N E        L+++   L +++G++  +       DD+ +     L+ K N+ +++K+++ +D+ R  L
  S:    23 HVGIYVCGVTTYDYCHIGHARTYVAFDIVVRYLRKLGYSVKYVRNITDLDDKIIKRAAENGEDFHQVTERFIREMHKDFDALNLVRPDIE-PRVTSHMDEIILMIERLIENGNAYEAGNGDVLFDVSTFNDYGKLSRQDLEQLQAGSRVDVDAAKQDPLDFVLWKSAKPGEPSWSSPWGEGRPGWHIECSAMNKKHLGSTFDIHGGGSDLSFPHHENEIAQSCCANQSEYVKYWMHSGMVQVDNEKMSKSLGNFFTIRSVLEQYDAETVRYFLLSSHYRSQLNYTQENLDQAHSALERLYTALRDITPQTASEELRSKYWQSFQQA----MDDDLNAPEAMSVLFEIAREI-----NRNRESAPDTAAQLAHVLLELAEVMGLLQQSPEEFLQGDDDDVAKIEALIAKRNQAREDKDWAAADEARDEL 440
>gi|167458063|ref|ZP_02324270.1| cysteinyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415595|gb|EDR82320.1| cysteinyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-1] (481 aa)
Score = 631, Expect = 1.1e-63, Identities = 129/375 (34%), Positives = 211/375 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNN-----KDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK 375
           ++++D ++   +E V L+   +++YVCGPTVY++ H+G+ R  + +DV+ R     G  V F+ N TD+DDKI+ +A E     + L+S +   + + +  +     +++ PRVS HI +I   I ++V   FAY   +GDVY+   K  +YG++S + LD+L+ G + E    K +P DFALWK    G   W+  +  GRPGWH ECS +  K+LG  ID+H GG DL FPHH NE  Q++A  +     +D AR WMH G + I+++KMSKSL NF   +D+L+ ++   +R+F   T Y    NF+ + L  ++ +L  +   +   K+  +           F +     L ++FN P ++  + E    ++ L   K
  S:     3 IQVHDTLTAQKRELVPLEPGKLRLYVCGPTVYDYSHLGHARCYVVWDVVVRHLRARGLEVRFVRNFTDVDDKIIQRANERGEDPIALASRFADAFHEDMDALGNLRPDVE-PRVSGHIPEIVALIARLVERGFAYAPGNGDVYYAVRKFPEYGRLSKRNLDDLIAGARVEPGEAKRDPLDFALWKAAKPGEPAWESPWGKGRPGWHIECSAMTQKHLGAPIDLHAGGKDLVFPHHTNEIAQSVAATSDGLHAEDFARYWMHNGFVQIDDEKMSKSLGNFFTIRDVLARFDGEALRFFLLGTHYRRDFNFSDQVLAEAERRLSALYETVE--KAERLGAGAAPAAEPAFVERARAALDDDFNTPQVLGIVAEAFTEANALADRK 382
>gi|163768612|ref|ZP_02175599.1| cysteinyl-tRNA synthetase [Anaeromyxobacter sp. K] >gi|196172842|gb|ACG73815.1| cysteinyl-tRNA synthetase [Anaeromyxobacter sp. K] (481 aa)
Score = 631, Expect = 1.1e-63, Identities = 129/375 (34%), Positives = 211/375 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNN-----KDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK 375
           ++++D ++   +E V L+   +++YVCGPTVY++ H+G+ R  + +DV+ R     G  V F+ N TD+DDKI+ +A E     + L+S +   + + +  +     +++ PRVS HI +I   I ++V   FAY   +GDVY+   K  +YG++S + LD+L+ G + E    K +P DFALWK    G   W+  +  GRPGWH ECS +  K+LG  ID+H GG DL FPHH NE  Q++A  +     +D AR WMH G + I+++KMSKSL NF   +D+L+ ++   +R+F   T Y    NF+ + L  ++ +L  +   +   K+  +           F +     L ++FN P ++  + E    ++ L   K
  S:     3 IQVHDTLTAQKRELVPLEPGKLRLYVCGPTVYDYSHLGHARCYVVWDVVVRHLRARGLEVRFVRNFTDVDDKIIQRANERGEDPIALASRFADAFHEDMDALGNLRPDVE-PRVSGHIPEIVALIARLVERGFAYAPGNGDVYYAVRKFPEYGRLSKRNLDDLIAGARVEPGEAKRDPLDFALWKAAKPGEPAWESPWGKGRPGWHIECSAMTQKHLGAPIDLHAGGKDLVFPHHTNEIAQSVAATSDGLHAEDFARYWMHNGFVQIDDEKMSKSLGNFFTIRDVLARFDGEALRFFLLGTHYRRDFNFSDQVLAEAERRLSALYETVE--KAERLGAGAAPAAEPAFVERARAALDDDFNTPQVLGIVAEAFTEANALADRK 382
>gi|94310030|ref|YP_583240.1| cysteinyl-tRNA synthetase [Ralstonia metallidurans CH34] >gi|93353882|gb|ABF07971.1| cysteinyl-tRNA synthetase [Ralstonia metallidurans CH34] (491 aa)
Score = 631, Expect = 1.2e-63, Identities = 121/316 (38%), Positives = 195/316 (61%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ +++  +  V ++   ++MYVCG TVY++ H+G+ R ++ FD+++R     GY+VT++ NITDIDDKI+ +A E  E IG+L  + + +  + D    + +   + + PR ++++  + N I+K+     AY   DGDV +   K   YGK+S K L++L  G++   N  K +P DF LWK           WD K+ +GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+   + +    +WMH G + +N++KMSKSL NF   +D+L EY+   VR+F  +  Y +PLN++  +L ++++ L  +
  S:    33 LNIYNTLAREKQPFVPIEPGKVRMYVCGMTVYDYCHVGHARVMVVFDMVHRWLRAAGYDVTYVQNITDIDDKIIRRAAENGETIGQLT-TRFIQYMHEDA-TALGVIRPDYE-PRATEYVPQMLNIIEKLEAKGLAYQATDGDVNYSVRKFPGYGKLSGKSLEDLRAGERVNANDAKQDPLDFVLWKSAKATEPPESKWDSKWGSGRPGWHIECSAMSCTLLGEHFDIHGGGADLQFPHHENEIAQSEGASGRPFVNMWMHNGFVRVNDEKMSKSLGNFFTIRDVLKEYDAEVVRFFILRAHYRSPLNYSDAHLDDARHALTRL 353
>gi|28897924|ref|NP_797529.1| cysteinyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633] >gi|31076996|sp|Q87QJ9|SYC_VIBPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|28806138|dbj|BAC59413.1| cysteinyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633] (460 aa)
Score = 631, Expect = 1.2e-63, Identities = 123/320 (38%), Positives = 190/320 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+             +N+   +++ PR +  I +I   ++K++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGESCESLTERLIGDMHADFDALNMKRPDVE-PRATQFIAEIIELVEKLIERGFAYVADNGDVMFEVGKFDEYGKLSKQDLDQLQAGARVDIETAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSTILGDHFDIHGGGSDLQFPHHENEIAQSCCAHDTKYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSL 323
>gi|56749448|sp|Q7MLR5|SYC_VIBVY Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (460 aa)
Score = 631, Expect = 1.2e-63, Identities = 122/320 (38%), Positives = 192/320 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR + +I++I   +++++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K  P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE +  +L
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGETCDSLTERLIGEMHADFDALNMKRPDVE-PRATQYIQEIIELVERLIERGFAYVADNGDVMFEVNKFDEYGKLSKQDLDQLQAGARVDVETAKRCPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSL 323
>gi|161501802|ref|NP_761714.2| cysteinyl-tRNA synthetase [Vibrio vulnificus CMCP6] >gi|30316151|sp|Q8D8R1|SYC_VIBVU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) (460 aa)
Score = 631, Expect = 1.2e-63, Identities = 122/320 (38%), Positives = 192/320 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR + +I++I   +++++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K  P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE +  +L
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGETCDSLTERLIGEMHADFDALNMKRPDVE-PRATQYIQEIIELVERLIERGFAYVADNGDVMFEVNKFDEYGKLSKQDLDQLQAGARVDVETAKRCPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSL 323
>gi|124028047|ref|YP_001013367.1| cysteinyl-tRNA synthetase [Hyperthermus butylicus DSM 5456] >gi|123978741|gb|ABM81022.1| Cysteinyl-tRNA synthetase [Hyperthermus butylicus DSM 5456] (490 aa)
Score = 631, Expect = 1.2e-63, Identities = 127/296 (42%), Positives = 179/296 (60%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLK-KNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIA-VNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++MYVCGPTVY++ H+G+ R  + FD + R     GYNV  + NITDIDDKI+N+A+EE     E+   Y   YF+ L+ + I       PRV+ HI++I  +I+ +++  +AY+   G VYF+  K   YG++S +   E     + ED LK K NP DFALWK    G   W+  +  GRPGWH ECS + ++YLGDQ DIHGGG DL FPHHENE  Q+ A    K   R W+H G+L I  +KMSKSL N I  ++ L +++  T+R +     Y   L+F+ E+L  +K  L  +
  S:    36 VRMYVCGPTVYDYTHLGHARTYVAFDAIKRYLRLRGYNVYHVQNITDIDDKIINRAREEGKDWREIVETYAKDYFEGLRALRIKID--MHPRVTSHIREIIEFIEGLIDKGYAYVAPSGSVYFEVDKYPDYGRLSGRFHPEEW--RQEEDVLKEKKNPYDFALWKAWKPGEPYWEAPWGRGRPGWHIECSVMASRYLGDQFDIHGGGQDLIFPHHENERAQSEAYFGKKPWVRYWLHTGYLTIRGEKMSKSLGNIIPLREALKKWSPETLRLWILSAHYRTQLDFSEESLEQAKANLRRL 331
>gi|90415956|ref|ZP_01223889.1| cysteinyl-tRNA synthetase [marine gamma proteobacterium HTCC2207] >gi|90332330|gb|EAS47527.1| cysteinyl-tRNA synthetase [marine gamma proteobacterium HTCC2207] (450 aa)
Score = 631, Expect = 1.2e-63, Identities = 129/301 (42%), Positives = 173/301 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQN-IAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +D + + MYVCGPTVYN VHIGN RP + FD L RL   L  NV +  NITDIDDKI+  A E       LS+ Y   YFD ++ +N +      P  + HI ++ + I ++V  + AY  +G V F       YGK+S + LD++L G + E    K    DF LWK +      WD  +  GRPGWH ECS +I K+LG+ IDIHGGG DL FPHHENE  Q+  A + K +A +WMH G +NI  +KMSKSL NF +  DLL +Y    +R+      Y +  NF  + L ++   L+ I
  S:    11 IDSQRVTMYVCGPTVYNRVHIGNARPAVVFDTLYRLLTSLYPNVQYARNITDIDDKIMKTAAELGEDISVLSTRYAEAYFDDMQALN-NLPPTIVPYATQHIPEMTDMISRLVAKEHAYESEGHVLFAVQSMADYGKLSGRSLDDMLAGARVEVASYKKYAGDFILWKPSADDEPGWDSPWGRGRPGWHLECSAMIEKHLGESIDIHGGGQDLIFPHHENEIAQSCCAHDGKPVANVWMHNGFINIEGEKMSKSLGNFRMVNDLLEQYPGEVLRYVILSAHYRSEQNFGKDLLDSAWRSLDAI 312
>gi|125564667|gb|EAZ10047.1| hypothetical protein OsI_031279 [Oryza sativa (indica cultivar-group)] (569 aa)
Score = 631, Expect = 1.3e-63, Identities = 144/413 (34%), Positives = 229/413 (55%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE---------LTNNFNLPNIVSFIEEKIKYSSILL-------RNKNFEELNKLHFNLSYLLTKILGII-----------------HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           + MYVCG T Y+  HIG+ R  + FDVL R    L + V ++ N TDIDDKI+ +A +       LS  Y   +   +  ++    +++ PRVSDHI  I N I++I++N  AY + GDVYF      +YG +S +KLD+   G++   + +K NP DFALWK    G  +WD  +  GRPGWH ECS +   YLG   DIHGGG DL FPHHENE  Q+ A         W+H G +N+N+QKMSKSL NF+  + +   Y+   +R F   T Y +P+N+T E L  + ++L      L   +      Q      L  + +N I+         ++++ +    ++ I E +K  + LL       + K  E L+ +   +  +L+ +LG++                   ++ +++ ++ + +    ++ K + +SD+ RK L
  S:    94 VGMYVCGVTPYDDSHIGHARAYVAFDVLYRYLRYLDHKVRYVRNFTDIDDKIIARANQLGEDPFSLSKRYSDDFLSDMANLHCLPPSVE-PRVSDHIDQIINMIKQIIDNDCAYAIGGDVYFSVENFPEYGDLSGRKLDDNRAGERVAVDERKKNPADFALWKAAKDGEPSWDSPWGPGRPGWHIECSAMSAHYLGHSFDIHGGGEDLIFPHHENEIAQSRAACCDSSINYWIHNGFVNVNSQKMSKSLGNFVTIRKVTELYHPLALRMFLLGTHYRSPINYTIEQLNVASDRLYYTYQTLQDCEESCQQHQSKAGDPLPVNTTNCIQKLHDEFETSMSDDLHTSVALAAISEPLKVMNDLLHTRKGKKQEKRLESLSAMEEKIRMVLS-VLGLLPSSYYEALQQLREKALRRASMTEEQVLQKIEERTSARKAKQYEKSDEIRKEL 538
>gi|153839789|ref|ZP_01992456.1| cysteinyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810] >gi|149746697|gb|EDM57685.1| cysteinyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810] (463 aa)
Score = 631, Expect = 1.4e-63, Identities = 123/320 (38%), Positives = 190/320 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+             +N+   +++ PR +  I +I   ++K++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L
  S:     5 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGESCESLTERLIGDMHADFDALNMKRPDVE-PRATQFISEIIELVEKLIERGFAYVADNGDVMFEVGKFDEYGKLSKQDLDQLQAGARVDIETAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSTILGDHFDIHGGGSDLQFPHHENEIAQSCCAHDTKYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSL 326
>gi|91793850|ref|YP_563501.1| cysteinyl-tRNA synthetase [Shewanella denitrificans OS217] >gi|123356646|sp|Q12L98|SYC_SHEDO Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|91715852|gb|ABE55778.1| cysteinyl-tRNA synthetase [Shewanella denitrificans OS217] (459 aa)
Score = 631, Expect = 1.4e-63, Identities = 147/433 (33%), Positives = 241/433 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS-HLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL--------FDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIY+ +S+  +E   +    I MYVCG T+Y+  HIG+ R  ++FD++ R    LGY V F  NITD+DDKI+ +A E N     L+     +       +N+   + + P+ + H+ +I   +Q++++   AY+  DGDV F      +YG++S + +D+L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS +  K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +++ LE +      FK   L +     ++ +   KS    + ++FN P   S + + ++  +  L+  +    + L  ++   L  +LGI+ V++         DDE  E   L+ + N+ + EK+++ +D  R  L
  S:     2 LKIYNSMSREKQEFKPITPGKIGMYVCGITIYDLCHIGHGRTFVSFDMIVRYLRYLGYEVNFQRNITDVDDKIIKRAAENNESCDALTERLTAEMHKDFDALNMVRPDFE-PKATLHMPEIIEMVQRLLDRGHAYVAPDGDVLFSVASYKEYGRLSGQNIDQLQAGARVEIDHNKQNPMDFVLWKMSKPGEPTWESPWGAGRPGWHIECSAMNGKHLGTHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLKHYDAQTVRYFLLSGHYRSQLNYSEDNLKQARSALERL---YTAFKDLDLTVTAAPADEYVTKFKS---AMNDDFNTPEAYSVLFDMVREIN-RLKTTDMGAASALGVSMKQ-LADVLGIVSVDIETFFKGSGSDDEVAEIEALIVERNRARTEKDWAAADVARDRL 440
>gi|167563301|ref|ZP_02356217.1| cysteinyl-tRNA synthetase [Burkholderia oklahomensis EO147] >gi|167570473|ref|ZP_02363347.1| cysteinyl-tRNA synthetase [Burkholderia oklahomensis C6786] (465 aa)
Score = 630, Expect = 1.4e-63, Identities = 120/316 (37%), Positives = 193/316 (61%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT----IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ HIG+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+S +          + +   +++ PR ++ I  +   I+K+  N +AY   DGDV +   K   YGK+S K L++L  G++   N  K +P DF LWK+      +G +WD K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++++KMSKSL NF   +++L  ++   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHIGHARMVVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRAVENGETIRSLTSRFTDAMNADFDALGVERPDIE-PRATEFIPQMLGMIEKLEANGYAYQAKDGDVNYSVRKFAGYGKLSGKSLEDLRAGERVAANDAKEDPLDFVLWKRAKPEEPVGASWDSKYGLGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDSEKMSKSLGNFFTIREVLENFDAEVVRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|84488953|ref|YP_447185.1| hypothetical protein Msp_0124 [Methanosphaera stadtmanae DSM 3091] >gi|84372272|gb|ABC56542.1| CysS [Methanosphaera stadtmanae DSM 3091] (456 aa)
Score = 630, Expect = 1.5e-63, Identities = 145/359 (40%), Positives = 216/359 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKD-LARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL----IIEQKYNEKNLEFDKSNLIELTNN-FNLPNIVS 359
           +K+Y  +++  +E+ +    IK++VCGPTVY++ HIG+ R  I+FDV+ R     GY+V ++ NITDIDDKI+ +AKE N   LELS  +E +Y   ++T+N+   N  + R ++H+ +I N IQ +++  +AY  +  VYFD +K   +GK+SN+ LD+L       D+ KK +P+DFALWK+      W+  +  GRPGWH E + +   Y G Q DIHGGG+DL FPHH+ E  Q  A + K+ L   WMH G LN++ +KMSKSL NFI  K+LL        R+F   T Y +P++F+ + L  ++N L+ I     I    L    + E K  +++LE  K       NN FN P  +S
  S:     2 IKVYSTMTRQKEELKVTNNKIKLFVCGPTVYDYSHIGHARTYISFDVIVRYLKHEGYSVFYLQNITDIDDKIIKRAKENNEDPLELSHRFEKEYLKDMETLNVSNVNF-YARATEHMNEIINQIQDLIDKGYAYDTETGVYFDVSKFEDFGKLSNRNLDDLQNTRIQIDSTKK-DPKDFALWKKQDEQPYWESPWGNGRPGWHIEDTAITEAYFGPQYDIHGGGLDLIFPHHDAEIAQMEASSGKEPLVEYWMHTGFLNVSGEKMSKSLGNFITIKELLEIVTPEVYRFFVLSTHYRSPIDFSEDTLKQAENSLKRIQNTGKIIIDKLTEDNLPEGKVLDEDLELFKEEFFNAMNNDFNTPIALS 364
>gi|148980442|ref|ZP_01816064.1| cysteinyl-tRNA synthetase [Vibrionales bacterium SWAT-3] >gi|145961245|gb|EDK26558.1| cysteinyl-tRNA synthetase [Vibrionales bacterium SWAT-3] (461 aa)
Score = 630, Expect = 1.5e-63, Identities = 150/435 (34%), Positives = 243/435 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV+ R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR ++ I +I   ++K++   FAY+  +GDV F+  K ++YGK+S + LD+L  G + + +  K +P DF +WK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   +  D    WMH G + ++ +KMSKSL NF   +DLL+ Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L      L       E   E+       + ++FN P   S + E  +  +  ++ ++ E+ + L   L   L  I+GI+H +   F        DDE  E   L+   N  +  K+++ +D  R  L E
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVTRYLRYLGYDLTFVRNITDIDDKIIKRANENGESCDSLTERLIGEMHADFDALNMKRPDVE-PRATEFITEIIELVEKLIERGFAYVASNGDVMFEVKKFDEYGKLSKQDLDQLQAGARVDVDSAKRSPLDFVVWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHGTDYVNTWMHSGMVMVDREKMSKSLGNFFTIRDLLAHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSLRGLD--LTAAPAGGE---EYVTRFSTAMNDDFNTPEAYSVLFEMAREIN-RIKTESIEKASGLG-ALMRELADIIGILHQDPEAFLQGDAAGNDDEVAEIEALIKLRNDSRASKDWANADLARDKLNE 444
>gi|39938627|ref|NP_950393.1| cysteinyl-tRNA synthetase [Onion yellows phytoplasma OY-M] >gi|61216243|sp|Q6YR75|SYC_ONYPE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|39721736|dbj|BAD04226.1| cysteinyl-tRNA synthetase [Onion yellows phytoplasma OY-M] (438 aa)
Score = 630, Expect = 1.5e-63, Identities = 147/419 (35%), Positives = 241/419 (57%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE--LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           I MYVCGPTVYNH+H+GN RP+I FD + R    L + V ++ NITDIDDKI+  A +  + E +L++ Y   + ++LKT+NI T N K P+ + +I  +  YIQ +++  FAY  D  +YF  +K + YGK+  + L +L    + + + +K  P DF LWK+T+ G+ +   +  GRPGWHTEC+ +I +     +DIHGGG DLKFPHHENE  Q  A +++ LA  +MHV  L+  NQKMSKSL N I  KDLL +YN   ++     T Y  P+NF+ + +  ++ + + I   L     +L + Q ++ + L+ D   L    + ++     ++  +E+ IK +    + +  ++L++   +L  +L  +   I  N      ++    W   ++ ++F+++D  RK L++K  +
  S:    23 INMYVCGPTVYNHLHLGNTRPLIFFDTVKRYLEMLNFRVYYVVNITDIDDKIIENALKNQVLEQDLANKYIKSFNNLLKTLNIQTINFK-PQATQYINSMIVYIQTLLDQGFAYFTDQGIYFRVSKIDDYGKLKKQDLSQLKQNARKQLDPQKEFPGDFILWKKTSQGITYPSPWFAGRPGWHTECATMIEQLFKLPLDIHGGGTDLKFPHHENEIAQTHAHSHQKLANFFMHVERLDYQNQKMSKSLGNIIWCKDLLKQYNPCIIKLLILSTHYRKPINFSYDLMEQAQQKYQKITDFLTKNNFYLKVNQ-FSCQALDQDIMQLFHQLMQDDLATHKVIDLMEQTIKQAH---QTQILDKLSQFQNSLLLILNILGITIPFNKPTKTDLQTYFLWQDARKYRDFAQADILRKQLLDKGFI 438
>gi|194562993|ref|YP_002098016.1| Cysteinyl-tRNA synthetase [Burkholderia dolosa AUO158] >gi|124894617|gb|EAY68497.1| Cysteinyl-tRNA synthetase [Burkholderia dolosa AUO158] (465 aa)
Score = 630, Expect = 1.7e-63, Identities = 120/316 (37%), Positives = 193/316 (61%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN--IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + +++  ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+++ +N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W+ K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRRSGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIGAMHEDEDALGIQRPDIE-PRATQFIPQMLGMIEQLESNGYAYQATDGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKPEDPEGASWESKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVVRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|186476148|ref|YP_001857618.1| cysteinyl-tRNA synthetase [Burkholderia phymatum STM815] >gi|184192607|gb|ACC70572.1| cysteinyl-tRNA synthetase [Burkholderia phymatum STM815] (465 aa)
Score = 630, Expect = 1.8e-63, Identities = 130/365 (35%), Positives = 210/365 (57%)
  Q:     1 MKIYDFVSKTDKE--VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT----IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKI 365
           ++IY+ +++ DK+  V L +  ++MYVCG TVY++ H+G+ R ++ FD++ R    LGY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR ++ +  +   I+K+  N +AY   DGDV +   K   YG +S K L++L  G++   N  K +P DF LWKQ+         W+ K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G++ I+N+KMSKSL NF   +++L++Y+   VR+F  +  Y +PLN++  +L +++  L  +   L         E  +NE   +  ++    + ++FN P  VS + E +
  S:     4 LRIYNTLAR-DKQNFVPLHEGEVRMYVCGMTVYDYCHVGHARVMVVFDIVQRWLRTLGYKVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIAALHEDADALGIERPDLE-PRATEFVPQMLGMIEKLEANGYAYQAADGDVNYAVRKFENYGALSGKSLEDLRAGERVAANDAKQDPLDFVLWKQSKPDEPADTGWESKYGRGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATRQTFVNYWMHNGYVQIDNEKMSKSLGNFFTIREVLAKYDAEVVRFFIARAHYRSPLNYSDVHLDDARGALARLYTALKDTPPQ-AGEVDWNEAYAQRFRA---AMNDDFNTPVAVSVLFELV 369
>gi|54308291|ref|YP_129311.1| cysteinyl-tRNA synthetase [Photobacterium profundum SS9] >gi|61216519|sp|Q6LT67|SYC1_PHOPR Cysteinyl-tRNA synthetase 1 (Cysteine--tRNA ligase 1) (CysRS 1) >gi|46912719|emb|CAG19509.1| putative cysteinyl-tRNA synthetase [Photobacterium profundum SS9] (464 aa)
Score = 630, Expect = 1.8e-63, Identities = 127/361 (35%), Positives = 205/361 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFI 361
           +KIY+ ++K  +E   +    I MYVCG T+Y+  HIG+ R  ++FDV++R     GY++TF+ NITDIDDKI+ +A E       L+     +       + +   +++ PR ++ I +I    ++++   FAY+  +GDV F+ +K  +YG++S + LD+L  G + + ++ K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+           WMH G + ++ +KMSKSL NF   +D+L+ Y+  +VR+F     Y + LN++ +NL  +++ LE +  +L      L  + +  E   EF       + ++FN P   S +
  S:     2 LKIYNSLTKQKEEFKPIQPGKIGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYSGYDLTFVRNITDIDDKIIKRAAENGESCESLTERLIGEMHKDFDALGMKRPDIE-PRATEFIAEIIILCERLIERGFAYVASNGDVMFEVSKFEEYGRLSRQDLDQLQAGARVDIDMAKRSPLDFVLWKMSKPGEPTWESPWGAGRPGWHIECSAMNSAILGDHFDIHGGGSDLQFPHHENEIAQSCCATGSQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLAHYDAESVRYFLMSGHYRSQLNYSEDNLKQARSALERLYTSLRGLD--LTAQAEGGE---EFVTRFTASMNDDFNTPEAYSVL 359
>gi|167586800|ref|ZP_02379188.1| cysteinyl-tRNA synthetase [Burkholderia ubonensis Bu] (407 aa)
Score = 629, Expect = 1.9e-63, Identities = 121/316 (38%), Positives = 191/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+ +  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +WD K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     W+H G + ++N+KMSKSL NF   +D+L +Y+   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAVGYRVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIAAMHEDEDALGIQRPDIE-PRATHFIPQMLGMIETLEANGYAYQANDGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKPEDPEGASWDSKYGAGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWIHNGFVQVDNEKMSKSLGNFFTIRDVLEQYDAEVVRFFIVRTHYRSPLNYSDVHLDDARAALTRL 324
>gi|77917718|ref|YP_355533.1| cysteinyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] >gi|109894916|sp|Q3A8C9|SYC_PELCD Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|77543801|gb|ABA87363.1| cysteinyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] (481 aa)
Score = 629, Expect = 1.9e-63, Identities = 114/310 (36%), Positives = 183/310 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK 310
           +++Y+ ++   +E   L    + MYVCG TVY++ HIG+ R  + FD++ R    +G++VT++ N TD+DDKI+ +A E  I    L+  +   + + +  + +    ++ P+ + HI  I N +Q++++   AY   GDVYF       Y K+S + +DE+  G +     +K NP DFALWK    G  +W+  +  GRPGWH ECS +  +YLG+  DIHGGG DL FPHHENE  Q+     K   + W+H G +N+N +KMSKSL NF   +D+L  Y+   +R+F     Y +P++F+ +NL +++
  S:     3 LRVYNTMTGRKEEFEPLQPGKVGMYVCGVTVYDYCHIGHARANVVFDIIYRYLQFIGFDVTYVRNYTDVDDKIIKRANERGISSDTLAGEFIQAFDEDMNRLGLAEPTIQ-PKATCHIDHIVNLVQRLIDRGIAYESQGDVYFSVEDFPSYLKLSKRNMDEMRSGARITPGEQKRNPMDFALWKAAKPGEPSWESPWGPGRPGWHIECSAMSMEYLGESFDIHGGGKDLVFPHHENEIAQSEGATGKPFVKYWLHNGFVNVNQEKMSKSLGNFFTIRDILQTYDPEVLRFFILTAHYRSPIDFSDQNLQDAR 313
>gi|16123250|ref|NP_406563.1| cysteinyl-tRNA synthetase [Yersinia pestis CO92] >gi|108808560|ref|YP_652476.1| cysteinyl-tRNA synthetase [Yersinia pestis Antiqua] >gi|108811182|ref|YP_646949.1| cysteinyl-tRNA synthetase [Yersinia pestis Nepal516] >gi|145599972|ref|YP_001164048.1| cysteinyl-tRNA synthetase [Yersinia pestis Pestoides F] >gi|149365066|ref|ZP_01887101.1| cysteinyl-tRNA synthetase [Yersinia pestis CA88-4125] >gi|153947472|ref|YP_001401974.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758] >gi|162421370|ref|YP_001605813.1| cysteinyl-tRNA synthetase [Yersinia pestis Angola] >gi|165927660|ref|ZP_02223492.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Orientalis str. F1991016] >gi|166011255|ref|ZP_02232153.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214354|ref|ZP_02240389.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398585|ref|ZP_02304109.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422736|ref|ZP_02314489.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423331|ref|ZP_02315084.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|123073499|sp|Q1CKY1|SYC_YERPN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|123372235|sp|Q1C4U1|SYC_YERPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|187470969|sp|A7FL46|SYC_YERP3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|187470970|sp|A4TP63|SYC_YERPP Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|21264007|sp|Q8ZCC0|SYC_YERPE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|108774830|gb|ABG17349.1| cysteinyl-tRNA synthetase [Yersinia pestis Nepal516] >gi|108780473|gb|ABG14531.1| cysteinyl-tRNA synthetase [Yersinia pestis Antiqua] >gi|115348729|emb|CAL21675.1| cysteinyl-tRNA synthetase [Yersinia pestis CO92] >gi|145211668|gb|ABP41075.1| cysteinyl-tRNA synthetase [Yersinia pestis Pestoides F] >gi|149291479|gb|EDM41553.1| cysteinyl-tRNA synthetase [Yersinia pestis CA88-4125] >gi|152958967|gb|ABS46428.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758] >gi|162354185|gb|ABX88133.1| cysteinyl-tRNA synthetase [Yersinia pestis Angola] >gi|165920414|gb|EDR37691.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989933|gb|EDR42234.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204483|gb|EDR48963.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958327|gb|EDR55348.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051089|gb|EDR62497.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057501|gb|EDR67247.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Mediaevalis str. K1973002] (461 aa)
Score = 629, Expect = 2.0e-63, Identities = 149/435 (34%), Positives = 236/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    + MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L++    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G   W+  +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + + I      L+N++    N L   L   L ++LG++  +  LF        DDE  +   L+ + N  +  KN++ +D  R  L E
  S:     2 LKIFNTLSRQKEEFKPIHAGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRAIENNETCEQLTTRMLAEMHKDFDALNLERPDLE-PRATHHIAEIIEMTERLIARGHAYVASNGDVMFAVDSDPDYGVLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPRWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGAEFEARFRTAMDDDFNTPEAYSVLFD-IAREVNRLKNEDMAAANGLAAELRK-LAQVLGLLEQDPELFLQGGAQADDDEVAKIEALIKQRNDARSSKNWALADAARDQLNE 444
>gi|117617683|ref|YP_857264.1| cysteinyl-tRNA synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559090|gb|ABK36038.1| cysteinyl-tRNA synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (458 aa)
Score = 629, Expect = 2.0e-63, Identities = 148/435 (34%), Positives = 238/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQY---FDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSY-----LLTKILGIIHVN----LFDDEAIE-------LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG T+Y+H HIG+ R  + FDV+ R     GY + ++ N+TD+DDKI+ +A E  +   +L++         FD L  +         PR + HI +I   +Q +++ + AY+ D GDV F       YGK+S + L++L  G + +    K NP DF LWK +  G   WD  +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   +  D    WMH G + ++ +KMSKSL NF   +D+L+ Y+  TVR+F     Y + LN++ +NL  ++  LE +   L    +        +E+   F ++    + ++FN P   S + +       L+R  N ++   +    +       L  +LGI+  +    L  DEA E       L+ + N+ + +KN++ +D  R  L E
  S:     2 LKIYNTLTRQKEEFKPIHPGKVGMYVCGVTIYDHCHIGHGRTFVAFDVVARYLRYSGYQLNYVRNVTDVDDKIIKRAAETGVTCDDLTARLIGDMHADFDALGMVRPDVE----PRATQHIGEIIELVQSLLDKEHAYVADNGDVMFIVDSYADYGKLSGQDLEQLQAGARVDVVDAKRNPLDFVLWKMSKPGEPTWDSPWGPGRPGWHIECSAMNSKHLGNHFDIHGGGSDLQFPHHENEIAQSCCAHGGDYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLAHYDAETVRYFLMSGHYRSQLNYSEDNLKQARAALERMYTALRDLPA--AAAAGGDEQVARFKEA----MDDDFNTPEAYSALFD-------LVREINRQKGEDMAVAAALGARLRELGAVLGILQQDPEAFLKGDEADEEVAEIEQLIAQRNQARADKNWAAADAARNRLTE 441
>gi|148653067|ref|YP_001280160.1| cysteinyl-tRNA synthetase [Psychrobacter sp. PRwf-1] >gi|187629854|sp|A5WEW9|SYC_PSYWF Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|148572151|gb|ABQ94210.1| cysteinyl-tRNA synthetase [Psychrobacter sp. PRwf-1] (505 aa)
Score = 629, Expect = 2.2e-63, Identities = 153/433 (35%), Positives = 239/433 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN----IFKSHLIIEQKYNEKNLEFDKSN----LIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEE------------------LNKLHFNLSYLLTKILGIIHVNLFDDEAIE-LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIYD ++   +    L    I MYVCG TVY++ HIG+ R ++ FDV++R    LGY V ++ NITDIDDKI+ +A E  E IGEL    + +  + D    +     + + PR ++HI ++ + I  +   + AY   +GDVY+       YGK+S +KL++L  G + + +  K NP DF LWK    G   W   +  GRPGWH ECS +  K LG+  DIHGGG DL+FPHHENE  Q+ A      A  WMHVG +N++ +KMSKSL NF   ++++ +++  T+R+F   + Y + +NF+   L  + + L  I   L     +  + +   +     N E   ++    +  + ++FN P  +S +    K  + L R+ +  +                  LN    N +  L   +G +  +   DE IE L+ +    K  KNF+ +D+ R LL
  S:    25 LKIYDSMTTNKRSFEPLQAGKIGMYVCGMTVYDYCHIGHARVMVAFDVVSRWLRHLGYEVNYVRNITDIDDKIIARANENGEPIGELT-HRFIKAMHEDA-AALGCENPDAE-PRATEHIDEMLDMIGTLEQKQHAYAASNGDVYYAVDTFEGYGKLSKRKLEDLQAGSRVDVDTDKKNPFDFVLWKAAKAGEPQWASSWGGGRPGWHIECSAMSTKCLGNSFDIHGGGHDLQFPHHENEIAQSEAATGCTYAHNWMHVGFINVDGEKMSKSLGNFFTIREVMQKFHPETIRFFILSSHYRSQVNFSDAALKEAHSGLTRIYQALKAADAVLNTSVSAAESIESINAEHAGTHSADFIAAMNDDFNTPQAISVLFSLAKEVNKLARDADDADTQAQLQLQAVQLRALAGILNIGQLNPAEFLQAQIGEVAEDQMSDEQIEALIQERLDSKANKNFARADEIRDLL 486
>gi|168700079|ref|ZP_02732356.1| cysteinyl-tRNA synthetase [Gemmata obscuriglobus UQM 2246] (519 aa)
Score = 628, Expect = 2.4e-63, Identities = 119/281 (42%), Positives = 168/281 (59%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMK----FPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQ-----TTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNF 301
           + MYVCGPTVY   HIG++   + FD + R    LGY V ++ NITD+DDK++ +A+E+     EL++     YF  LK +NI  S+      FPR + HI  +   IQ ++    AY VD  VYFD +K   YGK++N+  +++  G + E N KK NP DFALWK        +  +   K   GRPGWH EC+C+  K LG+ +DIHGGG+DL+FPHHENE  Q+ +   K  AR+WMH G L + + KM+ SL N +   D L       +R+F   T Y +P++ 
  S:    24 VTMYVCGPTVYKPSHIGHMVGPVIFDTVKRYLTYLGYKVKWVVNITDVDDKLIGRAQEQKTTVPELAAKMTEDYFACLKALNIAVSSPDGIDVFPRATQHIGGMIQVIQDLIKKDHAYEVDDGVYFDVSKDADYGKLTNRDPEQMEAGARLEPNPKKRNPGDFALWKSKPGEPAEVQFDSPFKCGRGRPGWHIECTCMAIKELGETLDIHGGGLDLQFPHHENELAQSESWTGKPFARVWMHNGLLKLKSGKMAGSLGNVLNVADALKAVGGGALRFFVLNTHYRSPIDL 313
>gi|22125011|ref|NP_668434.1| cysteinyl-tRNA synthetase [Yersinia pestis KIM] >gi|45440695|ref|NP_992234.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Microtus str. 91001] >gi|21957858|gb|AAM84685.1|AE013714_1 cysteine tRNA synthetase [Yersinia pestis KIM] >gi|45435553|gb|AAS61111.1| cysteinyl-tRNA synthetase [Yersinia pestis biovar Microtus str. 91001] (476 aa)
Score = 628, Expect = 2.4e-63, Identities = 149/435 (34%), Positives = 236/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    + MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L++    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G   W+  +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + + I      L+N++    N L   L   L ++LG++  +  LF        DDE  +   L+ + N  +  KN++ +D  R  L E
  S:    17 LKIFNTLSRQKEEFKPIHAGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRAIENNETCEQLTTRMLAEMHKDFDALNLERPDLE-PRATHHIAEIIEMTERLIARGHAYVASNGDVMFAVDSDPDYGVLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPRWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGAEFEARFRTAMDDDFNTPEAYSVLFD-IAREVNRLKNEDMAAANGLAAELRK-LAQVLGLLEQDPELFLQGGAQADDDEVAKIEALIKQRNDARSSKNWALADAARDQLNE 459
>gi|113867241|ref|YP_725730.1| cysteinyl-tRNA synthetase [Ralstonia eutropha H16] >gi|123134207|sp|Q0KCA9|SYC_RALEH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|113526017|emb|CAJ92362.1| Cysteinyl-tRNA synthetase [Ralstonia eutropha H16] (462 aa)
Score = 628, Expect = 2.5e-63, Identities = 149/439 (33%), Positives = 238/439 (54%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDD----EAIELLNKWNKL-KQEKNFSESDKYRKLLMEKKLL 439
           + IY+ +++  +  V ++   ++MYVCG TVY++ H+G+ R ++ FD+++R     GY VT++ NITDIDDKI+ +A E  E IGEL  + + +  + D      I   +   PR +D++  + + I K+     AY   DGDV +   K   YGK+S K L++L  G++   N  K +P DF LWK           WD K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+   + K    +WMH G + IN++KMSKSL NF   +++L  Y+   VR+F  +  Y +PLN++  +L ++++ L  +   L         + +     +++D+ +       + ++FN P  +S + +     +         +L  L   L  L       +     DD    E IE L    K  K E+NF+E+D+ R  L+E  ++
  S:     4 LNIYNTLAREKQPFVPIEPGKVRMYVCGMTVYDYCHVGHARVMVVFDMVHRWLRAAGYEVTYVQNITDIDDKIIRRAAENGETIGELT-TRFIQYMHEDAAALGVIRPDHE--PRATDYVPQMLDMIGKLEAKGLAYQASDGDVNYSVRKFAGYGKLSGKSLEDLRAGERVSANDAKQDPLDFVLWKSAKASEPPESKWDSKWGAGRPGWHIECSAMSCTLLGEHFDIHGGGADLQFPHHENEIAQSEGASGKPFVNMWMHNGFVRINDEKMSKSLGNFFTIREVLKSYDAEVVRFFILRAHYRSPLNYSDAHLDDARHALTRLYTALK--------DSQPGGCAVDWDEPHARRFAEAMGDDFNTPIAMSVLFDLASEINRTGSTAAARQLKGLAGTLGLLERDPHTFLQGGRSDDGISPEQIETLIAARKTAKVERNFAEADRIRAQLLEAGIV 448
>gi|168067577|ref|XP_001785689.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162662678|gb|EDQ49502.1| predicted protein [Physcomitrella patens subsp. patens] (491 aa)
Score = 628, Expect = 2.6e-63, Identities = 143/380 (37%), Positives = 218/380 (57%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDG-DVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE----NIIYNLNIFKSHLIIEQKYNEKNLEFDKSN----LIEL------------TNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV 400
           + MYVCG T Y++ HIG+ R  + FDVL R    +GY+VT++ N TDIDDKI+ +A E     L LS  +  ++   ++ +     N++ PRVSDHI  I   I +I+ NK  Y+++G DVYF+      YG +S +K +E   G++   + +K NP DFALWK    G   WD  +  GRPGWH ECS +  ++LG + DIHGGG+DL FPHHENE  Q+ A         W+H G + ++N+KMSKS+ NF   +++L  Y+   +RWF   T Y  P+N+       SK QLE     + Y   IF++ +  EQ  +++  +    N     IEL             ++ N P +V+   E  K+ + L+  +   +      +L  L+T+I  +++V
  S:    16 VSMYVCGVTTYDYSHIGHARVYVAFDVLFRYLKSVGYDVTYVRNFTDIDDKIIKRANEVGEDPLNLSRRFCDEFQVDMELLRCLPPNVE-PRVSDHIPQIIKMISQIIENKNGYVMEGGDVYFEVDTLPTYGCLSGRKQEENRAGERVLVDNRKRNPADFALWKSAKPGEPAWDSPWGPGRPGWHIECSAMSAEHLGHKFDIHGGGMDLIFPHHENEIAQSCAACADSRVGYWLHNGFVTVDNEKMSKSVGNFFTIREVLELYHPLALRWFLLGTHYRAPVNY-------SKRQLEVASDRVFY---IFQTLVDCEQILSQQVDKVAACNPSKEAIELVKSIKNTFRTSMADDLNTPVVVASFSESFKFMNDLMHTRKGRKDKTRLVSLQLLITEIQEVMNV 406
>gi|194334830|ref|YP_002016690.1| cysteinyl-tRNA synthetase [Prosthecochloris aestuarii DSM 271] >gi|194312648|gb|ACF47043.1| cysteinyl-tRNA synthetase [Prosthecochloris aestuarii DSM 271] (481 aa)
Score = 628, Expect = 2.6e-63, Identities = 124/314 (39%), Positives = 186/314 (59%)
  Q:     3 IYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDI----------DDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDEL-LVGDKSEDNLKKNNPQDFALWKQTTIG--LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           IY+ +++  +E + L    + MYVCGPTVY H H+G+ +  ++FDV+ +     GY V +I NITD+          +DKI  +A++E I  +E++ YY   Y++ +  + I   N+  P  + HI D  N I  ++    AY V+G+VYF      +YGK+S +  +E    G + E   +K +P DFALWK+   G  + WD  + +G PGWH ECS +  KYLG+ IDIHGGG++ KFPHHE E  Q+ A   K   R WMH   + +N  KM KSL NFI  KD+   +    +R+F  Q+ Y +PL+F+   +  S+  LE +
  S:     5 IYNSLNRVKEEFIPLQDGVVTMYVCGPTVYGHAHLGHAKSYVSFDVVAKWLRHSGYRVKYIQNITDVGHLTDDSDEGEDKIARQARKERIDPMEIAQYYTRSYYEDMDRLGIDRPNIA-PTATGHIPDQVNLISTLIEKGHAYEVNGNVYFSVESFKEYGKLSGRTTEEARQSGGRVETRSEKRHPADFALWKKAEPGHLMKWDSPWGSGYPGWHAECSAMAMKYLGETIDIHGGGMENKFPHHECEIAQSEAATGKPYVRYWMHNNMVTVNGTKMGKSLGNFINLKDIFKRFAPVVIRFFILQSHYRSPLDFSETAIDASRTGLEKL 331
>gi|145617534|ref|ZP_01773599.1| cysteinyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|144946323|gb|EDJ81383.1| cysteinyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|197089521|gb|ACH40792.1| cysteinyl-tRNA synthetase [Geobacter bemidjiensis Bem] (480 aa)
Score = 628, Expect = 2.6e-63, Identities = 144/439 (32%), Positives = 247/439 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLII---------EQKYNEKNLEFDKSNLIELTNNFN-------LPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII-----------------HVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +++Y+ ++ + +E V ++   + MYVCG TVY+H HIG+ R  + FD++ R     G  VT++ N TDIDDKI+N+A  + +   E+S  +  ++ + +  + +     + P+ ++HI +I   +Q +++  FAY    DV++   +   Y K+S + L+++  G + + + +K +P DFALWK    G   W+  +  GRPGWH ECS +  K+LG+ +DIHGGG DL FPHHENE  Q+ A + K   + W+H G +NIN++KMSKSL NF   K++L  Y+   +R+F     Y +P++F+ +NL  ++  LE I   L      L             ++ EK   F       + ++FN       L ++V  I  ++  +S  L  +   E+ K        +  +LGI                   + +  +E   L+ +  + ++ KNF   D+ R LL+EK ++
  S:     3 LRVYNTLTGSKEEFVPINPGKVGMYVCGVTVYDHCHIGHARANVVFDMIYRHLRSKGLEVTYVRNYTDIDDKIINRANRDGVPYNEISERFIKEFDNDMARLMLQLPTFQ-PKATEHIPEIIALVQTLIDKGFAYQSGSDVFYRVDRFEGYLKLSKRNLEDMQAGARIDVDERKEHPMDFALWKGAKPGEPYWESPWGQGRPGWHIECSAMSTKFLGETLDIHGGGKDLIFPHHENEIAQSEAASGKPFVKYWLHNGFVNINSEKMSKSLGNFFTIKEILESYDAEVLRFFLLSAHYRSPIDFSDQNLKEAELGLERIYKALAGIYERLASGANTPAGADNAEFVEKVAGFAGRFGDAMDDDFNTALALGHLFDLVRVINRELPTASTGLLEQAKAEVAK--------MAAVLGICDSVPAAFLQRMKDRKTSDIEMSAEEIEALIAERAEARKAKNFKRGDEIRDLLLEKNIV 467
>gi|72080968|ref|YP_288026.1| cysteinyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] (401 aa)
Score = 628, Expect = 2.7e-63, Identities = 168/418 (40%), Positives = 240/418 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSI----LLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           ++KKN+ +Y+CGPTVY+ VHIGNLR II FD +       G+++ F+HNITDIDDKI+ KA+E  I E EL+  Y  +YF IL+  NI     K  RV++ I+ I  YI+ +    F Y   + D+ FD  K   YG IS +K++ LL  DK+    K NN  DF LWK+T  GL +   F  GRPGWHTEC+ LI  Y   + +D+HGGG+DL FPHHENEN Q+ A+    +A  W   G +N+N +KM+KSL+N +LAKD   +YN + +R  F   + + P+N T E + N K  +E            +  E  +++KN   +K+  +E   N        FIE K   ++     L++ K    + K+  NL +  TK+         D E+ E +  WNKL  +KN+SE+DK R+ L
  S:     1 MNKKNLNIYLCGPTVYSDVHIGNLRTIIIFDAIFECLKNKGFSINFLHNITDIDDKIIEKAQELGISEAELTEKYTNEYFKILEIFNIKKPT-KIVRVTEKIEKIIEYIKLLEKKGFTYYNKNNDLVFDILKIPNYGIISGQKIESLL--DKNTKKTKSNN--DFVLWKKTQKGLFFKSLFGLGRPGWHTECAALIYDYFQKKSLDLHGGGVDLIFPHHENENAQHFALTGNPIAENWFRSGFVNLNGKKMAKSLNNVLLAKDFSHKYNPDIIRSIFLSINPTVPINLTEELIKNHKKLIEKY--------QKICFEWYFDKKN---EKTEKVEQVLNL-------FIEGKFAKANFLIMELIKQKENSTIRKIFLNLRFNFTKM-------RLDPESQEKIKNWNKLIMDKNYSEADKIREEL 394
>gi|194532016|ref|YP_002067451.1| cysteinyl-tRNA synthetase [Vibrio cholerae MO10] >gi|125617970|gb|EAZ46518.1| cysteinyl-tRNA synthetase [Vibrio cholerae MO10] (448 aa)
Score = 628, Expect = 2.9e-63, Identities = 119/299 (39%), Positives = 183/299 (61%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           + MYVCG T+Y+  HIG+ R  ++FDV+ R    LGY++TF+ NITDIDDKI+ +A E       L+     + +     +NI   +++ PR + +I++I   +++++   FAY+ D GDV F+ ++ ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  + +GRPGWH ECS + +  LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE  +YN
  S:    12 VGMYVCGVTIYDLCHIGHGRTFVSFDVVARYLRYLGYDLTFVRNITDIDDKIIKRAAENAETCESLTERLIQEMYADFDALNIKRPDVE-PRATAYIEEIIALVERLIERGFAYVADNGDVMFEVSQYSEYGKLSKQDLDQLQAGARVDIEAAKRSPLDFVLWKMSKPGEPTWESPWGSGRPGWHIECSAMNSSILGTHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLER-LYN 310
>gi|37679546|ref|NP_934155.1| cysteinyl-tRNA synthetase [Vibrio vulnificus YJ016] >gi|37198290|dbj|BAC94126.1| cysteinyl-tRNA synthetase [Vibrio vulnificus YJ016] (509 aa)
Score = 627, Expect = 3.1e-63, Identities = 122/320 (38%), Positives = 192/320 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR + +I++I   +++++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K  P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE +  +L
  S:    51 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGETCDSLTERLIGEMHADFDALNMKRPDVE-PRATQYIQEIIELVERLIERGFAYVADNGDVMFEVNKFDEYGKLSKQDLDQLQAGARVDVETAKRCPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSL 372
>gi|42569504|ref|NP_565717.2| tRNA synthetase class I (C) family protein [Arabidopsis thaliana] (563 aa)
Score = 627, Expect = 3.6e-63, Identities = 133/363 (36%), Positives = 210/363 (57%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDK----SNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKL 383
           + MYVCG T Y+  HIG+ R  +TFDVL R    LGY V+++ N TD+DDKI+ +AKE     + LS  +  ++   ++ +     +++ PRVSDHI  I + I++I++N +AY VDGD+YF   K   YGK+S +KL++   G++   + +K +P DFALWK    G   W+  +  GRPGWH ECS +   YLG   DIHGGG+DL FPHHENE  Q+ A  +      W+H G + ++++KMSKSL NF   + ++  Y+   +R F   T Y +P+N+ ++ L+ S +  E I Y   I+++    E    EK+  F+     S+ +   N F    + S  ++ +   ++   ++  + +N L
  S:    86 VGMYVCGVTAYDLSHIGHARVYVTFDVLLRYLKHLGYEVSYVRNFTDVDDKIIARAKELEEDPISLSRRFCEEFNRDMEQLQCLDPSVQ-PRVSDHIPQIIDLIKQILDNGYAYKVDGDIYFSVDKFPTYGKLSGRKLEDNRAGERVAVDTRKKHPADFALWKAAKEGEPFWESPWGRGRPGWHIECSAMSAAYLGYSFDIHGGGMDLVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFFTIRQVIDLYHPLALRLFLMGTHYRSPINY-SDFLLESAS--ERIFY---IYQTLHDCESALGEKDSTFENGSVPSDTLTSINTFRTEFVASMSDDLLTPVTLAAMSEPLKTINDL 446
>gi|187631650|sp|Q4A786|SYC_MYCH7 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|144575567|gb|AAZ54003.2| cysteinyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] (406 aa)
Score = 627, Expect = 3.6e-63, Identities = 168/418 (40%), Positives = 240/418 (57%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQ-IDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSI----LLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLL 433
           ++KKN+ +Y+CGPTVY+ VHIGNLR II FD +       G+++ F+HNITDIDDKI+ KA+E  I E EL+  Y  +YF IL+  NI     K  RV++ I+ I  YI+ +    F Y   + D+ FD  K   YG IS +K++ LL  DK+    K NN  DF LWK+T  GL +   F  GRPGWHTEC+ LI  Y   + +D+HGGG+DL FPHHENEN Q+ A+    +A  W   G +N+N +KM+KSL+N +LAKD   +YN + +R  F   + + P+N T E + N K  +E            +  E  +++KN   +K+  +E   N        FIE K   ++     L++ K    + K+  NL +  TK+         D E+ E +  WNKL  +KN+SE+DK R+ L
  S:     6 INKKNLNIYLCGPTVYSDVHIGNLRTIIIFDAIFECLKNKGFSINFLHNITDIDDKIIEKAQELGISEAELTEKYTNEYFKILEIFNIKKPT-KIVRVTEKIEKIIEYIKLLEKKGFTYYNKNNDLVFDILKIPNYGIISGQKIESLL--DKNTKKTKSNN--DFVLWKKTQKGLFFKSLFGLGRPGWHTECAALIYDYFQKKSLDLHGGGVDLIFPHHENENAQHFALTGNPIAENWFRSGFVNLNGKKMAKSLNNVLLAKDFSHKYNPDIIRSIFLSINPTVPINLTEELIKNHKKLIEKY--------QKICFEWYFDKKN---EKTEKVEQVLNL-------FIEGKFAKANFLIMELIKQKENSTIRKIFLNLRFNFTKM-------RLDPESQEKIKNWNKLIMDKNYSEADKIREEL 399
>gi|24373357|ref|NP_717400.1| cysteinyl-tRNA synthetase [Shewanella oneidensis MR-1] >gi|30316159|sp|Q8EG22|SYC_SHEON Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|24347617|gb|AAN54844.1|AE015623_6 cysteinyl-tRNA synthetase [Shewanella oneidensis MR-1] (459 aa)
Score = 627, Expect = 3.8e-63, Identities = 150/435 (34%), Positives = 239/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LF-----DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   ++   + MYVCG TVY+  HIG+ R  ++FD++ R     GY V F  NITDIDDKI+ +A E       L+     +       +N+   + + PR + HI +I + +++++    AY+  DGDV F      +YG++S + L++L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + I+ +KMSKSL NF   +D+LS Y+  TVR+F     Y + +N++ ENL  ++  LE +     I    L +     E   EF       + ++FN P   S + + ++  +  L+  +  E + L  ++   L  +LG++H +    F     DDE  E   L+ + N+ + EK++  +D  R  L E
  S:     2 LKIYNSITRQKQEFKPINPGKVGMYVCGVTVYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDIDDKIIKRANENQEDCNTLTDRLIGEMHKDFDALNMKRPDFE-PRATLHIAEIIDMVERLLARGHAYVAADGDVLFSVASFPEYGRLSGQNLEQLQAGARVEVDDNKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMIDREKMSKSLGNFFTIRDVLSHYDAETVRYFLLSGHYRSQINYSEENLKQARAALERLY--TAIKDVDLTVAAAPAE---EFVAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKLTDMAEASALAVSMKQ-LADVLGLLHQSPDAFFKGEGSDDEVAEIEALIVERNRARTEKDWPAADVARNRLNE 442
>gi|78066853|ref|YP_369622.1| cysteinyl-tRNA synthetase [Burkholderia sp. 383] >gi|109894879|sp|Q39EY8|SYC2_BURS3 Cysteinyl-tRNA synthetase 2 (Cysteine--tRNA ligase 2) (CysRS 2) >gi|77967598|gb|ABB08978.1| cysteinyl-tRNA synthetase [Burkholderia sp. 383] (465 aa)
Score = 627, Expect = 3.9e-63, Identities = 120/316 (37%), Positives = 191/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN--IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + +++  ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     D    + I   +++ PR ++ I  +   I+ +  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQSGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIGAMHDDESALGIQRPDIE-PRATEFIPQMLGMIETLETNGYAYQATDGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKPEDPEGTSWASKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|51595384|ref|YP_069575.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis IP 32953] >gi|186894407|ref|YP_001871519.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis PB1/+] >gi|61216168|sp|Q66DK9|SYC_YERPS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|51588666|emb|CAH20275.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis IP 32953] >gi|186697433|gb|ACC88062.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis PB1/+] (461 aa)
Score = 626, Expect = 4.3e-63, Identities = 148/433 (34%), Positives = 235/433 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KI++ +S+  +E   +    + MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L++    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G   W+  +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + + I      L+N++    N L   L   L ++LG++  +  LF        DDE  +   L+ + N  +  KN++ +D  R  L
  S:     2 LKIFNTLSRQKEEFKPIHAGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRAIENNETCEQLTTRMLAEMHKDFDALNLERPDLE-PRATHHIAEIIEMTERLIARGHAYVASNGDVMFAVDSDPDYGVLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPRWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGAEFEARFRTAMDDDFNTPEAYSVLFD-IAREVNRLKNEDMAAANGLAAELRK-LAQVLGLLEQDPELFLQGGAQADDDEVAKIEALIKQRNDARSSKNWALADAARDQL 442
>gi|150399135|ref|YP_001322902.1| cysteinyl-tRNA synthetase [Methanococcus vannielii SB] >gi|166200152|sp|A6UP68|SYC_METVS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|150011838|gb|ABR54290.1| cysteinyl-tRNA synthetase [Methanococcus vannielii SB] (475 aa)
Score = 626, Expect = 4.4e-63, Identities = 131/320 (40%), Positives = 207/320 (64%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           ++IY+ ++K+++   +L+ + +K+YVCGPTVY+  HIG+ R  ++FD++ R    +GY+V  + N TDIDDKI+N+A   N+   ++S  Y   + + +KT+N+  +++ +P+V+++I +I ++I K++   FAY  D  VYF+  K   YGK+SN  L+ L+  DK E   +K N  DFALWK    G   W   F  GRPGWH ECS +  KYLG+Q DIHGGG DL FPHHENE  Q+ A + K+    W+H G + +N +KMSKSL NF+   ++  +Y+   +R FF Q  Y +P+++T E++ ++K  L+  +YN+
  S:     2 LRIYNTITKSEEVFKTLNNEEVKIYVCGPTVYDETHIGHGRTYVSFDIIRRYLEHIGYSVKLVINFTDIDDKIINRALNLNVTPKKISEKYIEIFLNDMKTLNVKPADI-YPKVTENIPEIISFIDKLIEKGFAYKTDSGVYFEIEKFKDYGKLSNINLENLISEDKLESKSEKKNRFDFALWKNKKSGEPYWKSPFGDGRPGWHIECSVMSMKYLGEQFDIHGGGRDLSFPHHENEIAQSSAYSGKNWVNYWVHTGFVMVNGEKMSKSLGNFVTISEISKKYSPEVLRLFFIQRHYKSPIDYTEESMEHAKASLQK-LYNV 321
>gi|194289323|ref|YP_002005230.1| cysteine tRNA synthetase [Cupriavidus taiwanensis] >gi|193223158|emb|CAQ69163.1| cysteine tRNA synthetase [Cupriavidus taiwanensis] (462 aa)
Score = 626, Expect = 4.5e-63, Identities = 123/316 (38%), Positives = 190/316 (60%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           + IY+ +++  +  V ++   ++MYVCG TVY++ H+G+ R ++ FD+++R     GY VT++ NITDIDDKI+ +A E  E IGEL  + + +  + D      I   +   PR +D++  + + I K+     AY   DGDV +   K + YGK+S K L++L  G++   N  K +P DF LWK           WD K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+   + K    +WMH G + IN++KMSKSL NF   +++L  Y+   VR+F  +  Y +PLN++  +L ++++ L  +
  S:     4 LNIYNTLAREKQPFVPIEPGKVRMYVCGMTVYDYCHVGHARVMVVFDMVHRWLRAAGYEVTYVQNITDIDDKIIRRAVENGETIGELT-TRFIQYMHEDAAALGVIRPDHE--PRATDYVPQMLDMIGKLEAKGLAYQASDGDVNYSVRKFDGYGKLSGKSLEDLRAGERVSANDAKQDPLDFVLWKSAKASEPPESKWDSKWGAGRPGWHIECSAMSCALLGEHFDIHGGGADLQFPHHENEIAQSEGASGKPFVNLWMHNGFVRINDEKMSKSLGNFFTIREVLKAYDAEVVRFFILRAHYRSPLNYSDAHLDDARHALTRL 324
>gi|170699316|ref|ZP_02890365.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria IOP40-10] >gi|170135808|gb|EDT04087.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria IOP40-10] (465 aa)
Score = 626, Expect = 4.6e-63, Identities = 120/316 (37%), Positives = 191/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN--IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + +++  ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+K+  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQSGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRALENGETIKSLTDRFIGAMHEDEAALGIQRPDIE-PRATQFIPQMLGMIEKLETNGYAYQAADGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKADDPQGASWASKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|172061028|ref|YP_001808680.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria MC40-6] >gi|171993545|gb|ACB64464.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria MC40-6] (465 aa)
Score = 626, Expect = 4.6e-63, Identities = 120/316 (37%), Positives = 191/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN--IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + +++  ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+K+  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQSGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRALENGETIKSLTDRFIGAMHEDEAALGIQRPDIE-PRATQFIPQMLGMIEKLETNGYAYQAADGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKADDPQGASWASKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|86157699|ref|YP_464484.1| cysteinyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-C] >gi|109894880|sp|Q2IQG7|SYC_ANADE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|85774210|gb|ABC81047.1| cysteinyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-C] (481 aa)
Score = 626, Expect = 4.8e-63, Identities = 130/375 (34%), Positives = 211/375 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNN-----KDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK 375
           ++++D ++   +E V L+   +++YVCGPTVY++ H+G+ R  + +DV+ R     G  V F+ N TD+DDKI+ +A E     + L+S +   + + +  +     +++ PRVS HI +I   I ++V   FAY   +GDVY+   K  +YG++S + LD+L+ G + E    K +P DFALWK    G   WD  +  GRPGWH ECS +  K+LG  ID+H GG DL FPHH NE  Q++A  +     +D AR WMH G + I+++KMSKSL NF   +D+L+ ++   +R+F   T Y    NF+ + L  ++ +L  +   +   K+  +           F +     L ++FN P ++  + E    ++ L   K
  S:     3 IQVHDTLTAQKRELVPLEPGKLRLYVCGPTVYDYSHLGHARCYVVWDVVVRHLRARGLEVRFVRNFTDVDDKIIQRANERGEDPIALASRFADAFHEDMDALGNLRPDVE-PRVSGHIPEIVALIARLVERGFAYAPGNGDVYYAVRKFPEYGRLSKRNLDDLIAGARVEPGEAKRDPLDFALWKAAKPGEPAWDSPWGKGRPGWHIECSAMTQKHLGAPIDLHAGGKDLVFPHHTNEIAQSVAATSDGLHAEDFARYWMHNGFVQIDDEKMSKSLGNFFTIRDVLARFDGEALRFFLLGTHYRRDFNFSDQVLAEAERRLSALYETVE--KAERLGAGVEPGAEPAFVERARAALDDDFNTPQVLGIVAEAFTEANALADRK 382
>gi|156937781|ref|YP_001435577.1| cysteinyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I] >gi|187629828|sp|A8AB68|SYC_IGNH4 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|156566765|gb|ABU82170.1| cysteinyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I] (464 aa)
Score = 626, Expect = 4.9e-63, Identities = 139/379 (36%), Positives = 221/379 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIA-VNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL-EFDKSNLIELT-----------NNFNLPNIVSFIEEKIKYSSILLRNKNFEE 379
           +K+++ +++  ++   L+   ++MYVCGPTVY+H HIG+ R  + FD++ +     GYNV  + NITDIDDKI+N+A+E  +   E++  Y  +YF+++K + +  +    PRV+DHI DI  ++Q +V+  +AY+    VYFD  K   YG++S  K  ++    + E    K NP DFALWK    G   WD  +  GRPGWH ECS + +KYLG Q D+HGG  DL FPHHENE  Q+ A    +   + W+H G+L +  +KMSKSL N +  KD+L  +    VR++     Y   L+F+ E L  +K  L  +   ++  +   I++++  +  L E++   + E++           N+FN P   + + E ++     L NK  EE
  S:     2 LKVFNTLTRRLEDFKPLEPPLVRMYVCGPTVYDHSHIGHARTWVAFDIIKKYLRLKGYNVIHVQNITDIDDKIINRARELGVSWKEVADTYTNEYFELMKKLKVFPT--VHPRVTDHIDDIIEFVQDLVDKGYAYVTQSGVYFDVDKYPYYGQLSGIKDKKMW--SQEEFVKDKKNPYDFALWKCAKPGEPWWDSPWCKGRPGWHIECSTMSSKYLGKQFDVHGGARDLIFPHHENEIAQSEARFGVRPWVKYWLHSGYLTVKGEKMSKSLGNIVPLKDVLKSFEPEVVRYWLSSAHYRTELDFSWERLEEAKRSLTRMRMTVDELRK--IVKKESPKGKLDEWEIKAIYEVSKIRNEFYDAMDNDFNTPEAWAAVREALR-----LGNKAIEE 384
>gi|147668707|ref|YP_001213525.1| cysteinyl-tRNA synthetase [Dehalococcoides sp. BAV1] >gi|187629809|sp|A5FP90|SYC_DEHSB Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|146269655|gb|ABQ16647.1| cysteinyl-tRNA synthetase [Dehalococcoides sp. BAV1] (457 aa)
Score = 626, Expect = 5.3e-63, Identities = 126/306 (41%), Positives = 183/306 (59%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNN-KDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL 306
           MKIY+ +S K ++ V L+   +KMYVCG T  +  HIG+    I FDV+ R     GY V +I N TDIDDKI+ KA  + I    L+      + D +  +NI  ++  +PR +  +  I   +  +++  +AY VDG VY    K + YGK+S++ L++++ G + E + +K  P DFALWK T  G  +W+  +  GRPGWH ECS +  +YLG+QIDIHGGG DL FPHHENE  Q+   +  K   + W+H G L +  +KMSKSL N +  K+ LS Y+ + +R F   +SY NPL ++ E L
  S:     1 MKIYNTLSGKLEEFVPLENDKVKMYVCGITPQSEPHIGHAMSYINFDVIRRYLTYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAALNITPADY-YPRATQEVPKIIEIVSGLIDKGYAYAVDGSVYLRVQKVDGYGKLSHRTLEQMMAGARVEIDEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQIDIHGGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTIKEALSRYSADALRIFVLSSSYRNPLTYSEEAL 308
>gi|67153448|ref|ZP_00415193.1| Cysteinyl-tRNA synthetase, class Ia [Azotobacter vinelandii AvOP] >gi|67087581|gb|EAM07047.1| Cysteinyl-tRNA synthetase, class Ia [Azotobacter vinelandii AvOP] (461 aa)
Score = 625, Expect = 5.7e-63, Identities = 123/319 (38%), Positives = 191/319 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN------IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           + IY  +SK  +    L+   ++MYVCG TVY+  HIG+ R ++ FDV++R     GY+VT++ NITDIDDKI+ +A E        +G +  + + +    ++L+  +        PR +DHI  +   I+ +++  +AY   +GDVY+   K   YGK+S +K+++L +G + E    K +P DF LWK    G  +W+  +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A   K  A IWMH G + ++ +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ++L  ++  LE   YN
  S:     3 LSIYSTLSKGKEAFKPLEGNKVRMYVCGMTVYDFCHIGHARVMVAFDVVSRWLRHSGYDVTYVRNITDIDDKIIRRANENGESFQDLVGRMIAAMHEDEARLNVLRPDS-------EPRATDHIAGMHAMIRTLIDKSYAYAPGNGDVYYRVGKFEGYGKLSRRKIEDLKIGARIEPGEAKEDPLDFVLWKGAKPGEPSWESPWGAGRPGWHIECSVMSTCCLGETFDIHGGGPDLVFPHHENEIAQSEAATGKRYANIWMHAGAVRVDGEKMSKSLGNFFTIREVLEKYHPEVVRYLLVSSHYRSPINYSEDSLREARAALER-FYN 322
>gi|22299370|ref|NP_682617.1| cysteinyl-tRNA synthetase [Thermosynechococcus elongatus BP-1] >gi|22295553|dbj|BAC09379.1| cysteinyl-tRNA synthetase [Thermosynechococcus elongatus BP-1] (463 aa)
Score = 625, Expect = 5.7e-63, Identities = 145/416 (34%), Positives = 236/416 (56%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD----KSEDNLKKNNPQDFALWK-----QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSE-YNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLI-----IEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLH--------------FNLSYLLTKILGI---------IHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEK 436
           + +Y CG TVY++ H+G+ R  + +DVL R    LGY V ++ N TDIDDKI+ +A E       +S  Y   Y   +  +NI  ++  +PR ++ I +I N IQ +++  +AY+  GDVY+   +   YGK+S ++L++L+ G     + E+  +K +P DFALWK     + ++   W+  +  GRPGWH ECS ++ +  G  +DIH GG+DL FPHHENE  Q+ AV  + LAR W+H G + +N +KMSKSL NF   +DLL++  +   +R    Q  Y  PL+FT E L  +    + +   L++ +   +      E + + K   F ++    +  + N    ++ I E       L +  N E+   LH              ++    L ++LG+         + V L D+E   L+      +Q KN++ESD+ R LL+ +
  S:     1 MTIYACGVTVYDYCHLGHARSYVAWDVLRRYLTFLGYTVHYVQNFTDIDDKILRRAYENGETMATVSDRYIAAYHQDMAALNILPAS-AYPRATEVIPEIINLIQGLLDRGYAYVAGGDVYYAVAQFPSYGKLSGRQLEQLMAGASGRIEEEEEQRKRHPLDFALWKAAKPEEMSVYHPWEAPWGKGRPGWHIECSAMVRQAFGATVDIHCGGMDLIFPHHENEIAQSEAVTQQPLARFWLHNGFVTVNTEKMSKSLGNFTTIRDLLAQGLDPMALRLLVLQAQYRKPLDFTPEALTAAAKGWQTLGEALHLHQQIPLPPIDAAEVRSHPKTEAFCQA----MDEDLNTAAALAVIFE-------LAKTLNREQHRYLHGGGWGRSPAEVSRDWHTLVTLAQVLGLEAKEESNPALTVELTDEEIQALIAARTAARQAKNYTESDRLRDLLLAQ 442
>gi|196238249|ref|ZP_03137025.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 7425] >gi|196218039|gb|EDY12682.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 7425] (494 aa)
Score = 625, Expect = 5.8e-63, Identities = 123/301 (40%), Positives = 187/301 (62%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVG-----DKSEDNLKKNNPQDFALWK-----QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLL-SEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           L+  ++KMY CG TVY++ H+G+ R  I +DV+ R     GY V ++ N TDIDDKI+N+A++EN     +S  +   Y + ++ +NI  +++ +P+ +D I +I   IQ +V+  +AY VDGDVY+   +   YGK+S ++L+++  G     D +E   KK +P DFALWK     + ++   WD  +  GRPGWH ECS ++ K LG  IDIH GG+DL FPHHENE  Q+ A    DLA  W+H G +NI  +KMSKSL NF   +  L S  +   +R F  Q  Y  P++F+ E +  +++  + +
  S:    19 LEPGHVKMYCCGVTVYDYCHLGHARSYIVWDVVRRYLQWSGYQVRYVQNFTDIDDKILNRARQENSTMQAVSDRFIQAYHEDMQRLNILLADV-YPKATDVIPEIIQLIQTLVDQGYAYAVDGDVYYAVDRFPDYGKLSGRQLEQMQAGASGRVDDTEP--KKRHPLDFALWKAAKSEELSVYQPWDSPWGKGRPGWHIECSAMVRKELGHTIDIHCGGMDLIFPHHENEIAQSEAATRADLAHYWLHNGFVNIQGEKMSKSLGNFKTIRAFLNSGVDPMMLRLFVLQAHYRKPIDFSDETITAAQHSWQTL 327
>gi|167648484|ref|YP_001686147.1| cysteinyl-tRNA synthetase [Caulobacter sp. K31] >gi|189082061|sp|B0T101|SYC_CAUSK Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|167350914|gb|ABZ73649.1| cysteinyl-tRNA synthetase [Caulobacter sp. K31] (462 aa)
Score = 625, Expect = 5.8e-63, Identities = 138/359 (38%), Positives = 202/359 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLEL-GYN-VTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKD-LARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVS 359
           +K+YD +++  ++ V  D   + MYVCGPTVYNH HIGN RP++ FDVL RL   + G + V +  N+TD+DDKI  KA  E +    ++  Y   Y +    +     +++ P+ ++H+  I   I ++V N  AY  +G V FDT     YG++S + LD+++ G + E    K +P DF LWK +      WD  +  GRPGWH ECS +I+K LG  IDIHGGGIDL FPHHENE  Q+   +    LA  W+H G L++  +KMSKSL N I+  +LL       +RW      Y  PL++T E +  SK  L+ +   L   K+   +E   +E + E     +  L+++ N P  VS
  S:     3 LKLYDTMAREKRDFVPADPGRVTMYVCGPTVYNHAHIGNFRPVVVFDVLFRLLRHVYGEDAVVYARNVTDVDDKINAKATAEGVEIKVITDRYLAAYHEDAAALLTLPPSLE-PKATEHMGPIIEMIGELVANGSAYAAEGHVLFDTQAFPDYGQLSGRDLDDMIAGARVEVAPYKRHPADFVLWKPSKENEPEWDSPWGAGRPGWHIECSAMIDKTLGQTIDIHGGGIDLAFPHHENELAQSRCAHGAPVLANYWLHNGFLDMAGEKMSKSLGNVIIPHELLKTTPGEAIRWALLSGHYRQPLDWTPELIEQSKKALDRLYGALRRAKT---VEAGESEPSDEV----MAALSDDLNTPLAVS 358
>gi|51246780|ref|YP_066664.1| cysteinyl-tRNA synthetase [Desulfotalea psychrophila LSv54] >gi|61216190|sp|Q6AJ23|SYC_DESPS Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|50877817|emb|CAG37657.1| probable cysteinyl-tRNA synthetase [Desulfotalea psychrophila LSv54] (489 aa)
Score = 625, Expect = 6.0e-63, Identities = 118/302 (39%), Positives = 186/302 (61%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFT 302
           +++Y+ +S K +    ++  ++K+YVCG T Y++ HIG+ R  + FD++ R    L Y VTF+ N TDIDDKI+ +A E  +    L+  +  ++   +  +     +++ P+ ++HI+++ + IQ++V+   AY   GDVY+      +YGK+S + ++++  G +   N +K NP DFALWK +  G  +W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+   N K  A  W+H G + I ++KMSKSL NF+  KD+L  Y+   +R F + T Y NPL+F+
  S:     3 IRVYNTLSGKKEPLQPIEPNHVKLYVCGITSYDYCHIGHARSALAFDMIVRYLRYLDYKVTFVRNFTDIDDKIIARANETGVTAQALAERFIDEFHTDMDNLGTLRPDIE-PKATEHIQEMIDIIQELVDKDMAYPSAGDVYYVVNSFPEYGKLSGRNIEDMQAGARISINEQKRNPMDFALWKASKPGEPSWESPWGPGRPGWHIECSAMSRKYLGENFDIHGGGKDLIFPHHENEIAQSEGANGKPFANTWIHHGFVTIKDEKMSKSLGNFLTIKDILDHYHPEILRAFIFSTQYRNPLDFS 305
>gi|170025371|ref|YP_001721876.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis YPIII] >gi|169751905|gb|ACA69423.1| cysteinyl-tRNA synthetase [Yersinia pseudotuberculosis YPIII] (461 aa)
Score = 625, Expect = 6.9e-63, Identities = 147/433 (33%), Positives = 236/433 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KI++ +S+  +E   +    + MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L++    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G   W+  +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++           +EF+      + ++FN P   S + + I      L+N++    N L   L   L ++LG++  +  LF        DDE  +   L+ + N  +  K+++ +D  R  L
  S:     2 LKIFNTLSRQKEEFKPIHAGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRAIENNETCEQLTTRMLAEMHKDFDALNLERPDLE-PRATHHIAEIIEMTERLIARGHAYVASNGDVMFAVDSDPDYGVLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPRWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGVEFEARFRTAMDDDFNTPEAYSVLFD-IAREVNRLKNEDMAAANGLAAELRK-LAQVLGLLEQDPELFLQGGAQADDDEVAKIEALIKQRNDARSSKDWALADAARDQL 442
>gi|119774358|ref|YP_927098.1| cysteinyl-tRNA synthetase [Shewanella amazonensis SB2B] >gi|187631632|sp|A1S4X2|SYC_SHEAM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|119766858|gb|ABL99428.1| cysteinyl-tRNA synthetase [Shewanella amazonensis SB2B] (459 aa)
Score = 624, Expect = 6.9e-63, Identities = 151/433 (34%), Positives = 236/433 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN----------IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIY+ +S+  +E   +    I MYVCG T+Y+  HIG+ R  + FD++ R     GY V +  NITD+DDKI+ +A E            IGE+          FD L  +         PR + HI +I + + ++++   AY+  DGDV FD +    YG++S + L++L  G + E +  K NP DF LWK +  G   WD  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L+ Y+  TVR+F     Y + LN++ +NL  ++  LE +   L      L +E    +   EF    +  + ++FN P   S + + ++  +  L+  +    ++L   L   L ++LGI+      F       DE  E   L+ + N+ + EK++  +D  R  L
  S:     2 LKIYNSISRQKEEFKPIQPGKIGMYVCGVTIYDLCHIGHGRTFVCFDMIVRYLRYRGYEVNYQRNITDVDDKIIKRANENGESCDSLTERLIGEMHAD-------FDALNMVRPSFE----PRATLHIDEIIDMVTRLLDRGHAYVAADGDVLFDVSSYAAYGRLSGQDLEQLQAGARVEVDENKRNPMDFVLWKMSKPGEPTWDSPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNTWMHTGMVMVDREKMSKSLGNFFTIRDVLAHYDAQTVRYFLLSGHYRSQLNYSEDNLKQARASLERMYTALKGLD--LTVEAAGAD---EFVSRFMAAMDDDFNTPEAYSVLFDMVREIN-RLKTSDMAAASQLGVALKE-LAEVLGILSSTPEAFLQGEGNADEVAEIEALIVERNRARAEKDWPAADVARDRL 440
>gi|73748013|ref|YP_307252.1| cysteinyl-tRNA synthetase [Dehalococcoides sp. CBDB1] >gi|109894897|sp|Q3ZWG4|SYC_DEHSC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|73659729|emb|CAI82336.1| cysteinyl-tRNA synthetase [Dehalococcoides sp. CBDB1] (457 aa)
Score = 624, Expect = 7.5e-63, Identities = 157/433 (36%), Positives = 235/433 (54%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNN-KDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLN-----IFKSHLIIEQKYNEKNLEF---DKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNK-LKQEKNFSESDKYRKLL 433
           MKIY+ +S K +K V L+   +KMYVCG T  +  HIG+    I FDV+ R     GY V +I N TDIDDKI+ KA  + I    L+      + D +  +NI  ++  +PR +  +  I   +  ++   +AY V G VY    K + YGK+S++ L++++ G + E + +K  P DFALWK T  G  +W+  +  GRPGWH ECS +  +YLG+QIDIHGGG DL FPHHENE  Q+   +  K   + W+H G L +  +KMSKSL N +  K+ LS Y+ + +R F   +SY NPL ++ E L  ++   E +           FK   +  + Y E+  ++   D +    L   F+L   ++ IE +   S+     K F+EL  +   LS ++ +      V  F    IELL +  K L+  K +  +DK R  L
  S:     1 MKIYNTLSGKLEKFVPLENGKVKMYVCGITPQSEPHIGHAMSYINFDVIRRYLTYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAALNITPADY-YPRATQEVPKIIEMVSGLIEKGYAYAVGGSVYLRVQKVDGYGKLSHRTLEQMMAGARVEIDEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQIDIHGGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTIKEALSRYSADALRIFVLSSSYRNPLTYSEEALEAAEKGAERLRQTAARKDNPQFKETAVDTKAYRERFTQYMDNDFNTSAALATIFDLSRELNRIEGEAGKSTD--GQKLFKELADI-LGLSLIVAESKTGTDVAPF----IELLIELRKDLRVAKQYQLADKIRTSL 437
>gi|149175961|ref|ZP_01854578.1| cysteinyl-tRNA synthetase [Planctomyces maris DSM 8797] >gi|148845115|gb|EDL59461.1| cysteinyl-tRNA synthetase [Planctomyces maris DSM 8797] (518 aa)
Score = 624, Expect = 7.9e-63, Identities = 126/314 (40%), Positives = 191/314 (60%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINN------------------------QKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE 314
           ++IY+ +S+  ++  ++    + +Y+CGPTVY H HIG++   +  D + R      Y+V F++NITDIDDK++NKA E NI   +L++     YFD L+T+ + T    FP+ +D+I+ ++  IQ +++  FAY +DGDVYF     N+YG +S +K++E++ G + E N KK NP DFALWK++  G   WD  +  GRPGWH ECS +  K LGD  DIHGGG+DL FPHHENE  Q+     K   R W+H G +  ++                         K+S S       K+L + +    VR F   T Y +P+ F+ EN+  +   +E
  S:     3 LRIYNTLSRKKEDFQTIKPGKVGIYLCGPTVYKHSHIGHMVGPVIIDTIARYLTYNNYDVKFVNNITDIDDKLINKAAELNISVEKLAADMTQDYFDNLETMGVDTIT-DFPKATDYIEAMQEIIQSLIDKDFAYPLDGDVYFSAAADNKYGCLSGRKIEEMIAGTRVEANDKKKNPADFALWKKSRPGEPAWDSPWGPGRPGWHIECSAMSRKLLGDSFDIHGGGLDLMFPHHENERAQSECCTGKTYVRYWVHNGLMQASDAAGKVGGQHDRHGDVAVDQQAQEADKLSGS-KGAASVKELFAVHPPEIVRLFLLSTHYRSPIAFSDENIRETGKGIE 340
>gi|134296083|ref|YP_001119818.1| cysteinyl-tRNA synthetase [Burkholderia vietnamiensis G4] >gi|166200137|sp|A4JFD0|SYC_BURVG Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|134139240|gb|ABO54983.1| cysteinyl-tRNA synthetase [Burkholderia vietnamiensis G4] (465 aa)
Score = 624, Expect = 8.3e-63, Identities = 119/316 (37%), Positives = 190/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITD+DDKI+ +A E       L+  +     D    + I   +++ PR +  I  +   I+++  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDVDDKIIRRAVENGESIKSLTDRFIGAMHDDEAALGIQRPDIE-PRATQFIPQMLGMIEQLEANGYAYQASDGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKAEDPEGASWASKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|160872079|ref|ZP_02062211.1| cysteinyl-tRNA synthetase [Rickettsiella grylli] >gi|159120878|gb|EDP46216.1| cysteinyl-tRNA synthetase [Rickettsiella grylli] (466 aa)
Score = 624, Expect = 8.5e-63, Identities = 151/434 (34%), Positives = 244/434 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF----KSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIH--------VNLFDD----EAIE-LLNKWNKLKQEKNFSESDKYRKLLM 434
           +KIY+ +++  +    +  K + MYVCG TVY+  HIG+ R ++ FDV+ R     GY V +I NITDIDDKI+ +A+E N    EL+        +    +N    N + P+ +D I  I   IQ++V+  +AY  + GD+ FD  K   YG ++++ + +L  G +   ++ K +P DF LWK+   G  +W+  +  GRPGWH ECS +    LG+  DIHGGG+DL FPHH+NE  Q+  V +K     W+HVG + I+ QKMSKSL NF   +D+L +Y    VR+F   + Y +P+ ++ ENL  ++  L+ +  +L           ++E+   E   +F+ +    + ++FN P+ ++ + E  +  +  LR  N +   +    L YL + +LGI+         +N   D    E I  L+N  N  +  KN+ E+D+ R  L+
  S:     2 LKIYNTLTQKKEAFKPMIAKKVGMYVCGMTVYDFCHIGHARVVVVFDVILRYLKMQGYQVNYIRNITDIDDKIIKRAQENNESPFELTQRMIKAMHEDFNRLNTLPPNAE-PKATDAIVYIIALIQRLVDKAYAYRSENGDICFDVKKFKTYGDLAHQNVQKLRRGLRVAVDITKKDPLDFVLWKKAKSGEPSWESPWGPGRPGWHIECSAMSMAALGEHFDIHGGGLDLVFPHHQNEIAQSEGVTDKKFVNTWIHVGFVQIDRQKMSKSLGNFFTLRDVLKQYPAEVVRYFLISSHYRSPIQYSLENLQAAQAALQRLYTSLRGLVGKGPQKFVLEESSKEYQEKFEHA----MNDDFNTPDALAILFELARRIN-RLRETNSKHAQRDANCLQYLAS-LLGILQQEPEQFLKLNQEKDPHLVEKINGLMNARNHARAAKNWQEADRIRDELL 448
>gi|11498023|ref|NP_069247.1| cysteinyl-tRNA synthetase (cysS) [Archaeoglobus fulgidus DSM 4304] >gi|3122884|sp|O29836|SYC_ARCFU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|2650218|gb|AAB90823.1| cysteinyl-tRNA synthetase (cysS) [Archaeoglobus fulgidus DSM 4304] (467 aa)
Score = 623, Expect = 9.1e-63, Identities = 148/430 (34%), Positives = 239/430 (55%)
  Q:     1 MKIYDFVSKTDKEVS--LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI---IYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEE---KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYR 430
           M++Y+ +S+  +++   +D K +KMYVCG T Y++ HIG+ R  + FDV  R    LGY V ++ N TD+DDKI+N+A +E   + E++  +  +Y   ++ +N+     + P+V++HI DI  +IQ ++   +AY++DGDVYF       YG++S + L+EL    + E + +K + +DFALWK            +D  +  GRPGWH ECS +  KYLG   DIHGGG DL FPHHENE  Q+ A    +  +IW+H   + I  +KMSKSL N +  +D+L  Y    +R+F     Y +PL++T E L  +K   E +   + NL++  ++L       E N + D  + I      +  + + P+ ++ + E    I  S   L     EEL +    L  +L     +  V     E  E + +  + ++E+NF  +D  R
  S:     1 MEVYNTLSRKIEKLEDIVDGKRVKMYVCGITAYDYSHIGHARSAVFFDVFRRYLEYLGYEVVYVQNFTDVDDKIINRAVKEGKTQKEVAEKFIEEYLKDMEALNVKKPTYQ-PKVTEHIPDIIEFIQNLIEKGYAYVIDGDVYFHVPAFEHYGELSKQSLEEL-NRHRIEPDERKRDVKDFALWKSAKEADLKAQAVFDSPWGRGRPGWHIECSVMSAKYLGVPFDIHGGGKDLIFPHHENERAQSFARFGVEPVKIWVHNDFIRIKGEKMSKSLGNIVRIRDVLQRYEGEVLRYFLLTAHYRSPLDYTEEALERAKRAYEYLRSALINLDMEIAYLKTFGDRKEGN-QVDVEDYIRRFEEAMNRDLHTPDAIAVLHEFAGLINKSLYELSLNQAEELYEAFKRLCGVLGLFEKMERVPALSREDAEKVVERERARKERNFELADAIR 445
>gi|50084652|ref|YP_046162.1| cysteinyl-tRNA synthetase [Acinetobacter sp. ADP1] >gi|61216194|sp|Q6FC71|SYC_ACIAD Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|49530628|emb|CAG68340.1| cysteinyl-tRNA synthetase [Acinetobacter sp. ADP1] (473 aa)
Score = 623, Expect = 9.3e-63, Identities = 138/420 (32%), Positives = 246/420 (58%)
  Q:    20 NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNM------KFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVG--DKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIH---------------VNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +I MYVCG TVY++ HIG+ R ++ FD + R     G++V +I NITDIDDKI+ +A E N    +L+S +       +  +N   + +      + P+ +++I +++N I  +V+   AY   +GDVYF+ +K  +YG++S +KL+++  G  ++ +  ++K +P DF LWK       +W   +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A   +     WMHVG +N++ +KMSKSL NF   +D++ +++   +R+F   + Y +P+NF+   L  +K  L    +    ++  +  +    +K+ +F +   I + ++FN P  ++ + E  +  +  ++ +  E+    +  L + LT+ILG++                ++L DDE   ++ +    K+ K+FS +D  R+ L+++ ++
  S:    24 HIDMYVCGMTVYDYCHIGHARVMVAFDYIIRFLRSQGWDVRYIRNITDIDDKIIKRANENNETIQQLTSRF-------IDAMNEDAAKLGCAEPDEAPKATEYIGEMQNMISTLVDKGSAYPASNGDVYFEVSKFEKYGRLSGRKLEDMQAGASERVDIEVEKKHPFDFVLWKGAKPNEPSWVSPWGNGRPGWHIECSAMSTCCLGNHFDIHGGGSDLTFPHHENEIAQSEASTGEQYVNYWMHVGFINVDGEKMSKSLGNFFTIRDVMEKFHPEVIRYFIVSSHYRSPVNFSDVALKEAKTALTRFYHAFKAYE-QVYGQNDSTQKDEQFIERFNIAMRDDFNTPEAIAVLFELNRELNRAVKEQQAEQAAIYYVTLRH-LTQILGLVQHDVDEFLKSDIGQEVLSLSDDEIQAMIQQRADAKKAKDFSGADAIRQALLDQGVV 459
>gi|120610992|ref|YP_970670.1| cysteinyl-tRNA synthetase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|187629785|sp|A1TPK8|SYC_ACIAC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|120589456|gb|ABM32896.1| cysteinyl-tRNA synthetase [Acidovorax avenae subsp. citrulli AAC00-1] (459 aa)
Score = 623, Expect = 9.6e-63, Identities = 122/316 (38%), Positives = 188/316 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +S+  ++ S L+  +++MYVCG T+Y+  HIG+ R ++ FDV+ R     G  VT++ NITDIDDKI+ +A E  I   +L+        + +  + I    ++ PR ++++  + + I  +     AY    GDV +   +   YGK+S K LDEL  G++      K +P DF LWK    G      WD  F TGRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     K LAR WMH G + ++N+KMSKSL NF   +++L + +  T+R+F  +T Y +PLN++  +L +++  L+ +
  S:     3 LRIYNTLSRAMEDFSPLEPGHVRMYVCGMTIYDLCHIGHARMMMAFDVVQRWLRSSGLRVTYVRNITDIDDKIIRRAVERGITIRQLTDEMTAAMHEDIGALAIEPPTVE-PRATEYVPQMLSLIGTLERKGLAYRAGSGDVNYAVRRFEGYGKLSGKSLDELRAGERVAVQDDKQDPLDFVLWKAAKPGEPPEAKWDSPFGTGRPGWHIECSAMSCATLGESFDIHGGGADLQFPHHENEIAQSEGATGKPLARFWMHNGFVRVDNEKMSKSLGNFFTIREVLQQVDAETLRFFIVRTHYRSPLNYSDVHLQDARASLKRL 323
>gi|71894372|ref|YP_278480.1| cysteinyl-tRNA synthetase [Mycoplasma synoviae 53] >gi|71851160|gb|AAZ43769.1| cysteinyl-tRNA synthetase [Mycoplasma synoviae 53] (406 aa)
Score = 623, Expect = 9.6e-63, Identities = 170/419 (40%), Positives = 250/419 (59%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGD-VYFDTTKS-NQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNWDLKFSTGRPGWHTECSCLINKYLGD-QIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFK--SHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +K+YVCGPTVY+ +HIGN+RPI+TFD++ +    L  +  FIHNITDIDDKI+ KAKE+NI E EL+  Y  +Y + LKT ++ T   K   V+ +++ IE+++ K+     AYL++   +YF+  K+ N YGKISN+ LD++         L+K N  DFALWK T+ G+ +D KF  GRPGWHTEC  LI K  GD Q+DIHGGG+DL FPHHENENIQ  A+  KD+ + W+  G +N+NN+KMSKSL N I     L   + NT+++ F  +S +  +N   ENLI+  + L+  +  L+     ++L I+     K +EF    L EL+ +  +  + + ++   K         + E LNKL F     L   LG  +  L     I+   KW    + K++  +D  R+ L++K L+
  S:     2 LKIYVCGPTVYDELHIGNMRPILTFDLMLKAARYLKKDFIFIHNITDIDDKIIFKAKEQNISEKELAQKYSQKYLNHLKTFSVDTIT-KLEYVTKNLEYIESFLDKLYKRDNAYLIENSGLYFNVEKNLNNYGKISNQNLDDMHFDFDLNSKLQKYNKADFALWKNTSEGIKFDSKFGQGRPGWHTECVALIEKNFGDSQLDIHGGGVDLIFPHHENENIQYQALYQKDITKKWLRSGQINLNNEKMSKSLQNIISVDAFLENNSGNTLKFIFLMSSLTANINL-NENLISDASNLDKKLIKLSFLAKVNNLEIKPCDVSKEMEF----LFELSFSKFMFEVNALLKNANK--------NDLEALNKLLF-----LFNTLGFSYNKLDFSSEIQTYKKWKAALELKDYKSADLLREDLLKKNLI 406
>gi|118602151|ref|YP_903366.1| cysteinyl-tRNA synthetase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567090|gb|ABL01895.1| cysteinyl-tRNA synthetase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (462 aa)
Score = 623, Expect = 1.0e-62, Identities = 158/435 (36%), Positives = 250/435 (57%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQK---YNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL--FDDEAIELLN--------KWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +SK  KEV   ++   + +YVCG TVY++ H+G+ R ++ FDV+ R       NV ++ NITDIDDKI+ +A E       L++ +     +  + + +   +++ PR ++ +K I   I+ ++   FAY   +GDVY+       YGK+S K +D+L  G + E    K NP DF LWK +     +WD  +  GRPGWH ECS +   +LG+  DIHGGG+DL FPHHENE  Q+   NN      WMH+G +NI+++KMSKSL+NF   + +L  YN  T+R+F   + Y +PLNF+ +NL  +K+ L  +   +    +   + +K   Y + ++ F+++    L N+FN P  +S + E  K  + L R K+ ++ N L   L   L   +GI+ ++   F  + I L N          N+ + +KNF+ SD+ R  L E
  S:     2 LKIYNTLSK-QKEVFRPINADKVGIYVCGMTVYDYCHMGHARILVIFDVIIRHLRRYFPNVEYVRNITDIDDKIIKRAIENKEDIYALTNRFIDAMHEDERALGVLPPDVE-PRATNAMKQIFYMIKSLIEKGFAYQAHNGDVYYSVRHFKNYGKLSRKNIDKLEAGARIEIESAKKNPLDFVLWKMSKPNEPSWDSPWGQGRPGWHIECSAMSTHHLGNHFDIHGGGMDLSFPHHENEIAQSEGANNCTFVNTWMHIGFVNIDDEKMSKSLNNFFTIRSILESYNCETLRYFIMSSHYRSPLNFSDDNLNKAKSSLSRLYTAIRGLNTSSTVTEKVPMYFDYSVRFNEA----LDNDFNTPIALSILFELAKTVN-LQRKKDVDQANALA-QLLKKLGDYIGILQMDADKFLKQGISLSNSEVDVKITSRNEARADKNFALSDQIRDKLAE 445
>gi|171184546|ref|YP_001793465.1| cysteinyl-tRNA synthetase [Thermoproteus neutrophilus V24Sta] >gi|170933758|gb|ACB39019.1| cysteinyl-tRNA synthetase [Thermoproteus neutrophilus V24Sta] (474 aa)
Score = 623, Expect = 1.1e-62, Identities = 147/435 (33%), Positives = 241/435 (55%)
  Q:     1 MKIYDFVSKTDKEVSLDKKNI-KMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGEL-----ELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENE-NIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHL-----IIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKY--SSILLRNKNFEELNKLHFNLSYL-LTKILGIIHVNLFDDEAIE----LLNKWNKLKQEKNFSESDKYRKLLME 435
           M+IY+  ++  +E +     + + YVCG T Y+H+H+G+ R  + FD+  R    LGY V  + N TDIDDKIVNKA+EE   E      E+   Y  +YF++ + + I  +   +P+V+++++D+  +I  +V   +AY+  DG VYF+  K   YG +S +K++EL+ G + E    K NP DFALWK  T G   W+  +  GRPGWH EC  +  K+LG   D HGGG DL FPHHENE  I        + AR W+HVG+L +  +KMSKSL N I  +++LS+++   +R  +  + Y  P+ FT E L  +++  + +    +     L       ++   ++ L++  +    L ++ + P  V  +    +Y  S++L R +       L     Y+ +  +LG++       E  E    L+    +L+QE+ +  +D  R+ L E
  S:     1 MRIYNTATRQVEEFTTYVPRLARGYVCGITPYDHMHVGHGRVYVFFDIFRRYLERLGYEVRLVINFTDIDDKIVNKAREEFGHEAYKRWREVPERYIAEYFEMTRRLYIKPA-YAYPKVTENVEDMVKWISTLVEKGYAYVAPDGSVYFEVAKVPNYGVLSRQKIEELIAGARVEPEPGKRNPLDFALWKSWTPGEPWWNSPWCPGRPGWHLECVVMSTKHLGAPFDFHGGGADLIFPHHENEIAIARAYFGVDNFARYWIHVGYLTVRGEKMSKSLGNIITLREVLSKHSGEALRLAYAMSHYRKPMEFTYELLQQAEDMAKTLYTAYDELSQALRDAGEKDQEPIAQEALKYAGAFYGALDDDMSTPEAVQQLYGMARYIISTVLHRVEKISRETALAVLNKYVEMADVLGVLERRQIPKELEEAVKALVETRARLRQERQYQLADYIRQRLAE 455
>gi|94265990|ref|ZP_01289713.1| Cysteine--tRNA ligase [delta proteobacterium MLMS-1] >gi|93453456|gb|EAT03872.1| Cysteine--tRNA ligase [delta proteobacterium MLMS-1] (494 aa)
Score = 623, Expect = 1.1e-62, Identities = 147/438 (33%), Positives = 247/438 (56%)
  Q:     1 MKIYDFVSKTDKE---VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF---------KSHLIIEQKYNEK--NLEFDKSNLIELTNN--------FNLPNIVSFIEEKIKYSSI-----LLRNK--NFEELNKLHFNL------SYLLTKILGIIH-VNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKL 438
           M I    +KT+++     L   +++MYVCG TVY++ HIG+ R ++ FD+L R      Y+VTF+ N TDIDDKI+ +A E+     ELS  +   + + +  +      ++ P+ ++H+ ++   I++++    AY   GDVYF      +YGK+S++ LDE+  G +   N  K +P DF LWK +      W+  +  GRPGWH ECS +  KYLG+  DIHGGG DL FPHHENE  Q+     K  A  W+H G + I ++KM+KSL NF+  +D+L +Y    +R   + T Y NP++++   + +++  L  +   L            ++  +I  K  +K  NLE D    +++  N        F+   I++ + + +  +       LLR+      EL  + F L      +YL  +   ++  +++   E  +LL +    +Q  +++E+D+ R LL  KK+
  S:     1 MPILIHNTKTNRKEPFTPLTDNHVRMYVCGITVYDYCHIGHARSVLVFDMLYRYLRHRRYDVTFVRNFTDIDDKIIKRAAEQQTSCQELSQRFIQAFHEDMAALGTEPPTLE-PKATEHLPEMIALIEELIAKGLAYPAGGDVYFRVRNFTEYGKLSHRALDEMRSGARIAVNELKEDPLDFVLWKGSKPEEPAWESPWGPGRPGWHIECSAMGRKYLGETFDIHGGGKDLVFPHHENEIAQSEGATGKPFANFWIHHGFVTIKDEKMAKSLGNFLTIRDVLKQYPAEVLRLLLFSTHYRNPVDYSEAAMADAETALSRLYAALAAVGKLPAGGAPEATSVITAKDRQKLDNLESDFHQAMDIDFNSAKALGRFFDTVKIINKVRQALPATPATRDLELLRDSAAKLRELGGI-FGLLQEDPAAYLARRQERLLAGLDITPGEIEKLLAQRQTARQNGDWAEADRIRDLLAAKKI 473
>gi|194691858|gb|ACF80013.1| unknown [Zea mays] (573 aa)
Score = 622, Expect = 1.2e-62, Identities = 141/380 (37%), Positives = 213/380 (56%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNW-DLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKN-LEFDKSNLIE---------LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV 400
           + MYVCG T Y+  HIG+ R  + FDV+ R    L Y V ++ N TDIDDKI+ +A +       LS  +   +   +  +     +++ PRVSDHI +I N I++I++N  AY+V GDVYF       YG++S +KLD+   G++   + +K NP DFALWK    G  W D  +  GRPGWH ECS +   YLG   DIHGGG DL FPHHENE  Q+ A         W+H G +N+N+QKMSKSL NF+  + ++  Y+   +R F   T Y +P+N+T E L  + ++L    Y   +    +  +Q+ N  N L  +  N I+         ++++ +    ++ I E +K  + LL  +  ++ +K   +LS L  KI  ++ V
  S:    98 VGMYVCGITPYDDSHIGHARAYVAFDVVYRYLRYLDYEVRYVRNFTDIDDKIIARANQLGEDPFNLSKRFSDDFLLDMANLQCLPPSVE-PRVSDHIDEIINMIKQILDNSCAYVVGGDVYFSVDSFPDYGELSGRKLDDNRAGERVSVDERKRNPADFALWKAAKDGEPWWDSPWGPGRPGWHIECSAMSAHYLGHSFDIHGGGEDLIFPHHENEIAQSRAACCDSTINYWIHNGFVNVNSQKMSKSLGNFVTIRKVIEMYHPLALRMFLLGTHYRSPINYTIEQLNVTSDRLY-YTYQTLLDCEEICQQQQSNTGNSLPANTLNYIQKLHEEFETSMSDDLHTSVALAAISEPLKVMNDLLHTRKGKKQDKRLESLSALEEKIRVVLSV 486
>gi|107028742|ref|YP_625837.1| cysteinyl-tRNA synthetase [Burkholderia cenocepacia AU 1054] >gi|116690099|ref|YP_835722.1| cysteinyl-tRNA synthetase [Burkholderia cenocepacia HI2424] >gi|194558811|ref|YP_002093837.1| Cysteinyl-tRNA synthetase, class Ia [Burkholderia cenocepacia PC184] >gi|123370109|sp|Q1BHP1|SYC_BURCA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|166200131|sp|A0K8K2|SYC_BURCH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|105897906|gb|ABF80864.1| cysteinyl-tRNA synthetase [Burkholderia cenocepacia AU 1054] >gi|116648188|gb|ABK08829.1| cysteinyl-tRNA synthetase [Burkholderia cenocepacia HI2424] >gi|124872602|gb|EAY64318.1| Cysteinyl-tRNA synthetase, class Ia [Burkholderia cenocepacia PC184] (465 aa)
Score = 622, Expect = 1.3e-62, Identities = 120/316 (37%), Positives = 189/316 (59%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+ +  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIGAMHEDETALGIQRPDVE-PRATQFIPQMLGMIETLETNGYAYQAADGDVNYSVRKFADYGKLSGKSLDDLRAGERVAANDAKQDPLDFVLWKRAKADEPEGASWASKYGMGRPGWHIECSAMGCSLLGNHFDIHGGGQDLQFPHHENEIAQSEGATGETFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVVRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|144897394|emb|CAM74258.1| Cysteinyl-tRNA synthetase [Magnetospirillum gryphiswaldense MSR-1] (459 aa)
Score = 622, Expect = 1.3e-62, Identities = 126/304 (41%), Positives = 177/304 (58%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGE-LELSSYYETQYF-DILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           L   ++ MYVCGPTVY+  HIGN RP+I FDVL RL   L  +VT++ NITD+DDKI  ++K+   GE + + +   TQ F D +  +N     ++ PR + HI+ + + IQ ++    AY  +G V F+      YG++S + +DE++ G + E    K N  DF LWK +T  L  WD  +  GRPGWH ECS +  +YLG   DIHGGG DL FPHHENE  Q+   N    AR W+H G+L +  +KMSKSL NF   ++LL       +R     T Y  P ++T E L  ++  L+  +YN
  S:    19 LSPDHVGMYVCGPTVYDRAHIGNARPVIVFDVLYRLLSRLYPSVTYVRNITDVDDKINQRSKDS--GEPIAVITARTTQMFHDDIAELNALPPTIE-PRATAHIQQMIDMIQVLIAKGHAYAAEGHVLFEVGSMADYGQLSRRSMDEMIAGARVEVAPYKKNAGDFVLWKPSTPDLPGWDSPWGRGRPGWHIECSAMSGQYLGQTFDIHGGGQDLVFPHHENEIAQSQCANGAPFARYWLHNGYLMVEGEKMSKSLGNFFTVRELLEAAPGEAIRLCMLSTHYHQPFDWTAEGLKQARATLDR-LYN 321
>gi|70605996|ref|YP_254866.1| cysteinyl-tRNA synthetase [Sulfolobus acidocaldarius DSM 639] >gi|76363434|sp|Q4JCA6|SYC_SULAC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|68566644|gb|AAY79573.1| cysteinyl-tRNA synthetase [Sulfolobus acidocaldarius DSM 639] (469 aa)
Score = 622, Expect = 1.3e-62, Identities = 138/354 (38%), Positives = 209/354 (59%)
  Q:    15 SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI---------ELTNNF-------NLPNIVSFIEEKIKYS 368
           S D   +KMYVCGPTVY++VHIG+ R  + FD + R     G+NV  + NITDIDDKI+ +A E      E+  YY   Y + LK + +     + PRV+ HI++I +++QK+V+   AY+   G VYFD      YG +S  K +E   G+  E   +K NP DFALWK    G   W+  +  GRPGWH ECS +  +YLG+Q DIHGGG+DL FPHHENE  Q+ ++  K   + W+HV +L IN +KMSKSL N I   + L ++  + +R+++  T Y N ++++ + L  +++ L+ +   + I +S +  E K +    E      I          ++N+F       N+  I + +  KI+Y+
  S:    19 SFDPLTVKMYVCGPTVYDYVHIGHGRAFVGFDGIVRYLKLRGFNVIRVQNITDIDDKIIKRANETGKDWREIVDYYTKDYMESLKALKVEID--QHPRVTSHIQEIIDFVQKLVDKGHAYITSSGSVYFDVDSFPSYGLLSGSKKEEWNQGE--EIVKEKKNPYDFALWKAWKPGEPYWESPWGKGRPGWHIECSTMSTRYLGEQFDIHGGGVDLVFPHHENERAQSESLLGKIWVKYWVHVAYLTINKEKMSKSLGNIIPLNEALKKWGPSVLRFWYLSTKYRNSIDYSEQTLEQARSSLQRLKDAMGIIRSVIKEEPKSHSNEEEISTQREIISLIGKFHEAMSNDFDTATALSNIYEIANLVFTKIQYT 386
>gi|148260406|ref|YP_001234533.1| cysteinyl-tRNA synthetase [Acidiphilium cryptum JF-5] >gi|187629816|sp|A5FYD2|SYC_ACICJ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|146402087|gb|ABQ30614.1| cysteinyl-tRNA synthetase [Acidiphilium cryptum JF-5] (449 aa)
Score = 622, Expect = 1.3e-62, Identities = 125/298 (41%), Positives = 178/298 (59%)
  Q:    17 DKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQN-IAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE 314
           D  ++K+YVCGPTVY+  H+GN R ++ FD L RL   L   VT++ NITDIDDKI  +A E  E IGE+  ++   + + + +  +     +++ PR + HI DI   I++++    AY  +G V F      +YGK S +  +ELL G + +    K +P DF LWK +   L  WD  +  GRPGWH ECS +I+  LG+ IDIHGGG DL FPHHENE  Q+  A    + AR+W+H G L ++ QKMSKSL NF   +D+L E     VR+   +T Y   L+F+T  L  +K +L+
  S:    21 DPAHVKLYVCGPTVYDRAHLGNARTVVVFDTLVRLLRHLFPRVTYVRNITDIDDKINARAAETGETIGEI--TARTTSWFHEDMAALYCAPPDIE-PRATGHIGDIIALIERLIARGHAYAAEGHVLFAVATDAEYGKFSGRSPEELLAGARVDVATYKRDPGDFVLWKPSPPDLPGWDSPWGRGRPGWHIECSAMIHATLGETIDIHGGGADLIFPHHENEIAQSCCAFPGSEFARVWVHAGMLQVDGQKMSKSLGNFRTVQDVLGEAPGEAVRFLLLKTHYRGVLDFSTAALAEAKRELD 319
>gi|119719811|ref|YP_920306.1| cysteinyl-tRNA synthetase [Thermofilum pendens Hrk 5] >gi|187631645|sp|A1RYM3|SYC_THEPD Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|119524931|gb|ABL78303.1| cysteinyl-tRNA synthetase [Thermofilum pendens Hrk 5] (474 aa)
Score = 622, Expect = 1.4e-62, Identities = 156/433 (36%), Positives = 245/433 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAV-NNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENII---------------------YNLNIFKSHLIIEQK-YNEKNLEFDKSNLIELTNNFNLPNIV-SFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELLNKWN-KLKQEKNFSESDKYRKLL 433
           +++Y+ +S++ +    +++  + +YVCGPTVY++ H+G+ R  + FDV+ R     GY+V  + NITDIDDKI+N+A++E     E+   Y   Y + L+ + +       PRV++HI +I +++QK++++  AY+   G VYFD      YG++S  +LD+ +   + E   +K NP DFALWK    G   WD  +  GRPGWH ECS + +KYLG + DIHGGG DL FPHHENE  Q+ A+   K   + WMH G L +  +KMSKSL N +  +DL   Y+   VR +     Y   L F+ E L  +K+ L+ +                      + L +F+  L   ++ Y   + +F+ S          L  +V S +  K  Y  +L   + FEE N++   L   L   LG   V L  DE ++L+ +   KL+++KN+  +D  R  L
  S:     2 LRVYNTLSRSLEVFEPVEEGRVSIYVCGPTVYDYSHVGHARTYVAFDVIKRYLRLRGYDVVHVQNITDIDDKIINRARDEGRDWREIVDEYTKDYLEALQKLRVLVD--VHPRVTEHISEIIDFVQKLIDSGHAYVAPSGSVYFDVDTYPDYGRLSG-RLDKKM-WSQEEFASEKKNPYDFALWKARKPGEPYWDSPWGPGRPGWHIECSVMSSKYLGRRFDIHGGGTDLIFPHHENERAQSEALFGEKPWVKYWMHTGMLQVRGEKMSKSLKNIVPLRDLFRSYDPLVVRLWLATAHYRTVLQFSDEVLEQAKSNLQRLRGAVQLLKNLAKEVEPEGRLSDWELGVFREMLDARREFYASMDDDFNASGAFAAV--MKLTGLVYSQVSAKPTYLLVLRALRLFEEFNRVLGVLDEDLA--LGAAEV-LPVDELLDLIVEVRAKLREQKNYELADYIRSKL 453
>gi|77974235|ref|ZP_00829776.1| COG0215: Cysteinyl-tRNA synthetase [Yersinia frederiksenii ATCC 33641] (473 aa)
Score = 622, Expect = 1.4e-62, Identities = 150/435 (34%), Positives = 235/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    I MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L+S    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G  +W+  +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + +      ++K   I   N    EL K        L  +LG++  +  LF        DDE  +   L+ + N  +  K+++ +D  R  L E
  S:    14 LKIFNTLSRQKEEFKPIHAGKIGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRAIENNETCEQLTSRMLAEMHKDFDALNLERPDLE-PRATHHIPEIIELTERLIARDHAYVASNGDVMFAVDSDPDYGLLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPSWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGAEFEARFRAAMDDDFNTPEAYSVLFDIAREVNRLKTEDIAAANGLAAELRK--------LAHVLGLLEQDPELFLQSGAQTDDDEVAKIEALIKQRNDARSSKDWALADSARDQLNE 456
>gi|115352164|ref|YP_774003.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria AMMD] >gi|122322791|sp|Q0BDV4|SYC_BURCM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|115282152|gb|ABI87669.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria AMMD] (465 aa)
Score = 622, Expect = 1.4e-62, Identities = 119/316 (37%), Positives = 190/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN--IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + +++  ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDI+DKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+K+  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G  W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQSGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIEDKIIRRAVENGETIKSLTDRFIGAMHEDEAALGIQRPDLE-PRATQFIPQMLGMIEKLETNGYAYQAADGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKADDPPGATWASKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|13877761|gb|AAK43958.1|AF370143_1 putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] >gi|15293251|gb|AAK93736.1| putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] >gi|20197327|gb|AAM15026.1| putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] >gi|20197896|gb|AAD20662.2| putative cysteinyl-tRNA synthetase [Arabidopsis thaliana] (493 aa)
Score = 622, Expect = 1.4e-62, Identities = 133/363 (36%), Positives = 210/363 (57%)
  Q:    21 IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDK----SNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKL 383
           + MYVCG T Y+  HIG+ R  +TFDVL R    LGY V+++ N TD+DDKI+ +AKE     + LS  +  ++   ++ +     +++ PRVSDHI  I + I++I++N +AY VDGD+YF   K   YGK+S +KL++   G++   + +K +P DFALWK    G   W+  +  GRPGWH ECS +   YLG   DIHGGG+DL FPHHENE  Q+ A  +      W+H G + ++++KMSKSL NF   + ++  Y+   +R F   T Y +P+N+ ++ L+ S +  E I Y   I+++    E    EK+  F+     S+ +   N F    + S  ++ +   ++   ++  + +N L
  S:    16 VGMYVCGVTAYDLSHIGHARVYVTFDVLLRYLKHLGYEVSYVRNFTDVDDKIIARAKELEEDPISLSRRFCEEFNRDMEQLQCLDPSVQ-PRVSDHIPQIIDLIKQILDNGYAYKVDGDIYFSVDKFPTYGKLSGRKLEDNRAGERVAVDTRKKHPADFALWKAAKEGEPFWESPWGRGRPGWHIECSAMSAAYLGYSFDIHGGGMDLVFPHHENEIAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFFTIRQVIDLYHPLALRLFLMGTHYRSPINY-SDFLLESAS--ERIFY---IYQTLHDCESALGEKDSTFENGSVPSDTLTSINTFRTEFVASMSDDLLTPVTLAAMSEPLKTINDL 376
>gi|127513439|ref|YP_001094636.1| cysteinyl-tRNA synthetase [Shewanella loihica PV-4] >gi|187631636|sp|A3QFX9|SYC_SHELP Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|126638734|gb|ABO24377.1| cysteinyl-tRNA synthetase [Shewanella loihica PV-4] (459 aa)
Score = 622, Expect = 1.5e-62, Identities = 117/316 (37%), Positives = 188/316 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +K+Y+ +++  +E   +    + MYVCG T+Y+  HIG+ R  + FD++ R    +GY+V F  NITD+DDKI+ +A E       L+     + +     +N+   + + PR + H+ +I   +++++    AY+ D GDV F      +YG++S + LD+L  G + E +  K +P DF LWK +  G   WD  +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL+NF   +D+L+ Y+ +TVR+F     Y + LN++ +NL  +K  LE +
  S:     2 LKLYNSLTRQKEEFKPIQPGKVGMYVCGVTIYDLCHIGHGRTFVAFDMIVRYLRYIGYDVNFHRNITDVDDKIIKRATENGESCDALTERLTQEMYHDFDALNMKRPDFE-PRATQHMPEIIEMVERLLERDHAYIADNGDVLFSVASFPEYGRLSGQNLDQLQAGARVEVDENKRDPMDFVLWKMSKPGEPTWDSPWGPGRPGWHIECSAMNSKHLGEHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDKEKMSKSLNNFFTIRDVLAHYDASTVRYFLLSGHYRSQLNYSEDNLKQAKAALERL 319
>gi|167624689|ref|YP_001674983.1| cysteinyl-tRNA synthetase [Shewanella halifaxensis HAW-EB4] >gi|189082075|sp|B0TLV2|SYC_SHEHH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|167354711|gb|ABZ77324.1| cysteinyl-tRNA synthetase [Shewanella halifaxensis HAW-EB4] (459 aa)
Score = 621, Expect = 1.6e-62, Identities = 147/430 (34%), Positives = 241/430 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII--HVNLF------DDEAIE---LLNKWNKLKQEKNFSESDKYR 430
           +K+Y+ +++  ++ V L    + MYVCG T+Y+  HIG+ R  ++FD++ R     GY+V F  NITD+DDKI+ +A E N     L+     +      ++N+   + + PR + HI +I + +++++    AY+   GDV F  +   +YG++S + L++L  G + E    K +P DF LWK +  G   W+  +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ +NL  +K  LE I   L      L +E    +   EF       + ++FN P   S + + ++  +  L+  +  + + L   L   L  +LGI+   V+ F      DDE  E   L+ + N+ + EK++  +D  R
  S:     2 LKLYNSLTRQKEQFVPLQPGKVGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYSGYDVNFQRNITDVDDKIIKRANENNESCDSLTERLIAEMHKDFDSLNMARPDNE-PRATQHIPEIIDMVERLIERDHAYVASSGDVLFSVSSFPEYGRLSGQNLEQLQAGARVEVEDTKRDPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMIDKEKMSKSLNNFFTIRDVLAHYDAATVRYFLLSGHYRSQLNYSEDNLKQAKAALERIYTALKDLD--LSVEAAPAQ---EFVAKFKTAMDDDFNTPEAYSVLFDMVREIN-RLKATDMAKASALGVALKE-LADVLGILGQDVDTFFKGEGSDDEVAEIEALIVERNRARAEKDWPAADVAR 437
>gi|159899627|ref|YP_001545874.1| cysteinyl-tRNA synthetase [Herpetosiphon aurantiacus ATCC 23779] >gi|159892666|gb|ABX05746.1| cysteinyl-tRNA synthetase [Herpetosiphon aurantiacus ATCC 23779] (466 aa)
Score = 621, Expect = 1.6e-62, Identities = 125/320 (39%), Positives = 184/320 (57%)
  Q:     1 MKIYDFVSK-TDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           + IY+ +++ T+    L   ++ MYVCGPTVY+  HIG+    + FDV+ R     GY V  + N TD+DDKI+ +A E+    +EL+  Y   + D L  +N+  +   +PRVS  I  I  +I+ ++    AY   +GDVYF       YGK+S + +D++  G +   +  K++P DFALWK    G   W+  +  GRPGWH ECS +    L +QIDIHGGG DL FPHHENE  Q  ++  K+ A++WMH G L +  +KMSKSL N I     LSE++ + +R      SY  PL +  E L +++ +LE I+  L
  S:     3 LAIYNTLTRQTEPFTPLVADHVSMYVCGPTVYSDAHIGHAMSAVVFDVVRRYLEWSGYTVRHVMNFTDVDDKIIRRANEQGRDPMELAESYTLAFLDQLGQLNVLPAT-AYPRVSTTIPQIIQFIEGLIAKDAAYHASNGDVYFRVRADEDYGKLSRRAVDDMRSGARIAPDEAKDDPLDFALWKSAKPGEPAWESPWGQGRPGWHIECSAMSLHELAEQIDIHGGGNDLIFPHHENEIAQTESLTGKNFAQVWMHNGMLQLAGEKMSKSLGNLITIDQFLSEHSADIMRLLVLSGSYRAPLVYNDEVLADTQRKLERIMSAL 324
>gi|53805250|ref|YP_113028.1| cysteinyl-tRNA synthetase [Methylococcus capsulatus str. Bath] >gi|61216155|sp|Q60BG8|SYC_METCA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|53759011|gb|AAU93302.1| cysteinyl-tRNA synthetase [Methylococcus capsulatus str. Bath] (465 aa)
Score = 621, Expect = 1.6e-62, Identities = 122/306 (39%), Positives = 185/306 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL 306
           +KIY+ +++  +E   L+ + ++MYVCG TVY++ H+G+ R ++ FD++ R    LG  VT++ N+TDIDDKI+ +A E  E IG L  + + E  + D  + + +   + + PR ++ I DI   I  ++    AY+  +GDV++       YG++S K LDEL  G++ E +  K +P DF LWK    G   W   +  GRPGWH ECS +  + LG   DIHGGG+DL+FPHHENE  Q+     +     WMH G + IN +KMSKSL NF   +++L+ Y    VR+F   + Y +PLN++ ENL
  S:     2 LKIYNSLTRQKEEFRPLEPRRVRMYVCGMTVYDYCHLGHARVMVVFDMVARYLRHLGLKVTYVRNVTDIDDKIIRRAVENGETIGALT-ARFIEAMHED-ERALGVLPPDHE-PRATESIDDILAMIGTLIERGHAYVGSNGDVFYAVASFPNYGRLSGKNLDELRAGERIEVDEAKRDPLDFVLWKSAKPGEPFWASPWGPGRPGWHIECSAMSTRCLGAHFDIHGGGMDLQFPHHENEIAQSEGATGEHFVNYWMHNGFVRINEEKMSKSLGNFFTVREILARYRPEVVRFFILNSHYRSPLNYSDENL 309
>gi|167626735|ref|YP_001677235.1| cysteine--tRNA ligase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189082064|sp|B0U0I3|SYC_FRAP2 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|167596736|gb|ABZ86734.1| Cysteine--tRNA ligase [Francisella philomiragia subsp. philomiragia ATCC 25017] (459 aa)
Score = 621, Expect = 1.6e-62, Identities = 157/439 (35%), Positives = 243/439 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFN-LSYLLTK---ILGIIHVNL---------FDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           M  Y+ +S   +E   ++   IKMYVCG TVY+  HIG+ R  I FDV+NR F   G++VTF+ NITDIDDKI+ +A E      +L         D    +NI     K PR +  I ++   I+ +V   FAY   +GDV++   K   YGK+S + L+ L  G + +   +K NP DF LWK    G   WD  +  GRPGWH ECS +  K LGD  DIH GG DL+FPHHENE  Q+ A N    A  W+H G + +N +KMSKSL+NF    +++ EY+   +R+F   T Y + +N++ ENL N++  +E +    N  +    +E    +   E+++  +  + N+FN P  ++ +    K  + L      + +NK   +  ++LL K   +LGI+  ++          D   IE L+ +  + K++KN++ +D+ R  L  + ++
  S:     1 MIFYNSLSGKKEEFKPIEPNKIKMYVCGITVYDDCHIGHARTNIAFDVINRYFKYRGFDVTFVRNITDIDDKIIKRANENGETTDKLVERTIKSMHDAFDKLNI-LRPTKEPRATQTIPEMIAMIETLVEKGFAYQGTNGDVFYRVAKFADYGKLSKQNLEALEQGSRVDVVEEKENPMDFVLWKMAKEGEPAWDSPWGAGRPGWHIECSAMSKKLLGDTFDIHAGGSDLRFPHHENEIAQSEACNECTFANYWLHSGMVKVNAEKMSKSLNNFFTINEVIEEYHPEVIRYFLASTVYRSEINYSKENLDNARASVERL---FNALRDIEPVEVNLPDDASEYEEKFIKAMDNDFNTPEALAVLFSLAKEINTL------KTVNKYKASGYAFLLRKLCDVLGILFTDIEEYFKQGDGIDVSEIEKLIAERTQAKKDKNYARADEIRNDLQNQGII 446
>gi|149191898|ref|ZP_01870131.1| cysteinyl-tRNA synthetase [Vibrio shilonii AK1] >gi|148834246|gb|EDL51250.1| cysteinyl-tRNA synthetase [Vibrio shilonii AK1] (460 aa)
Score = 621, Expect = 1.6e-62, Identities = 120/320 (37%), Positives = 194/320 (60%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV++R    +GY++ F+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR ++ I +I   ++K+++  FAY+ D GDV F+ +K ++YGK+S + LD+L  G + +    K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +++ LE +  +L
  S:     2 LKIYNTLTRQKEEFKPIHAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYVGYDLKFVRNITDIDDKIIKRANENGESCESLTERLIGEMHADFDALNMKRPDVE-PRATEFIAEIIELVEKLIDRGFAYVADNGDVMFEVSKFDKYGKLSKQDLDQLQAGARVDVESAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLDHYDPETVRYFLMSGHYRSQLNYSEDNLNQARSALERLYTSL 323
>gi|91774855|ref|YP_544611.1| cysteinyl-tRNA synthetase [Methylobacillus flagellatus KT] >gi|122985612|sp|Q1H417|SYC_METFK Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|91708842|gb|ABE48770.1| cysteinyl-tRNA synthetase [Methylobacillus flagellatus KT] (455 aa)
Score = 621, Expect = 1.7e-62, Identities = 140/439 (31%), Positives = 235/439 (53%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTK----ILGIIHVNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +++  +  S +    + MYVCG TVY++ H+G+ R ++ FD++NR     GY VT++ NITDIDDKI+ +A E       L+  +     +    + +   +++ PR +D+I ++   I  ++    AY  D GDVY+  +    YGK+S K L++L  G++ E +  K +P DF LWK    G  +WD  +  GRPGWH ECS +  ++LG   DIHGGG DL+FPHHENE  Q+   +       WMH G + ++++KMSKSL NF   +++L +Y+   VR+F  +  Y +PLN+++ +L ++K  L  +    N  +   + +   + +  E ++     L ++FN P   + + E    ++          L  L   L  L       + G     L  DE   L+ +    ++ KNF+E+D+ R  L  + ++
  S:     2 LKIYNTLARAKQTFSPIIPGKVSMYVCGMTVYDYCHLGHARVMVVFDMVNRWLRSSGYEVTYVRNITDIDDKIIARANENGETINALTDRFIAAMNEDAARLGVWRPDLE-PRATDYIHEMIAMIVALIEKHHAYAADNGDVYYAVSSFASYGKLSGKSLEDLRAGERVEVDAHKRDPMDFVLWKAAKPGEPSWDSPWGPGRPGWHIECSAMGARHLGPHFDIHGGGQDLQFPHHENEIAQSEGAHGCTFVNYWMHNGFIRVDDEKMSKSLGNFFTIREVLEKYDAEVVRFFILRAHYRSPLNYSSHHLDDAKQALTRL---YNTLRGRELPQLDIDWRQPEAERFKQ-ALDDDFNTPEAFAVLFELASEANRTGSAVQAALLKALAGQLGLLQRDPDEFLKGEAVAGLSPDEIERLIAERLAARKCKNFAEADRIRDALTAQGII 442
>gi|161524376|ref|YP_001579388.1| cysteinyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] >gi|189350869|ref|YP_001946497.1| cysteinyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] >gi|160341805|gb|ABX14891.1| cysteinyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] >gi|189334891|dbj|BAG43961.1| cysteinyl-tRNA synthetase [Burkholderia multivorans ATCC 17616] (465 aa)
Score = 621, Expect = 1.9e-62, Identities = 118/316 (37%), Positives = 191/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+++  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W+ K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     W+H G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIDAMHEDEDALGIQRPDIE-PRATQFIPQMLGMIERLEANGYAYQATDGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKADDPEGASWESKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWLHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|152980026|ref|YP_001353798.1| cysteinyl-tRNA synthetase [Janthinobacterium sp. Marseille] >gi|166200150|sp|A6SZV1|SYC_JANMA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|151280103|gb|ABR88513.1| Cysteinyl-tRNA synthetase [Janthinobacterium sp. Marseille] (464 aa)
Score = 621, Expect = 1.9e-62, Identities = 145/439 (33%), Positives = 239/439 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHF-NLSYLLTKILGII-----------HVNLFDDE-------AIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +++  +  + ++   ++MYVCG TVY++ HIG+ R ++ FD++ R     GY V ++ NITDIDDKI+ +A E       L+  +     +    + +   + + PR ++++  +   I+ +  N  AY   DGDV +       YGK+S K LD+L  G++ + N  K +P DF LWK +       + W  K+ +GRPGWH ECS +  + LG Q DIHGGG DL+FPHHENE  Q+   +       WMH G + ++N+KMSKSL NF   +++L++Y++  VR+F  +  Y + LN++  +L +++N L  +   L                 L F ++    + ++FN P  V+ + E        L N    E+NK     L+  L  + GI+           H  L + E        +E +      K+ KNF+E+D+ R  L+EK ++
  S:     4 LKIYNTLAREKQPFTPIEPGKVRMYVCGMTVYDYCHIGHARVMVVFDLVQRWLRASGYEVNYVRNITDIDDKIIKRAAENGESISALTQRFIDAMDEDAAALGVQKPDHE-PRATNYVPQMLGLIEALERNGLAYKSSDGDVNYSVRDFPGYGKLSGKSLDDLRAGERVDVNTGKRDPLDFVLWKSSKEAEPDEVKWASKWGSGRPGWHIECSAMACELLGQQFDIHGGGADLQFPHHENEIAQSEGASQHTFVNYWMHNGFVRVDNEKMSKSLGNFFTIREVLAKYDSEVVRFFILRAHYRSQLNYSDAHLDDARNALTRMYTALKGVAPDQAALDMTEAHALRFAEA----MNDDFNTPLAVAVLFE--------LAN----EINKTKSPALARQLVGLAGIVGLLQRPAQQFLHAGLANGEDGEMETFVVEQIEARVNAKKAKNFAEADRIRAELLEKGII 450
>gi|196244227|ref|ZP_03142954.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 8802] >gi|196207675|gb|EDY02467.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 8802] (484 aa)
Score = 621, Expect = 1.9e-62, Identities = 149/439 (33%), Positives = 243/439 (55%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD------KSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELT-------------NNFN----LPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + +Y+ +++  + + +L+   I+MY CG TVY++ H+G+ R  + +DV+ R     GY V +I N TDIDDKI+N+A++E      +S  +   YF+ ++ +++  ++  +PR +  +  I+  + ++    +AY  +GDVY+       YGK+S +KL++L  G       +  +  KK +P DFA+WK    G  +WD  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   K LAR W+H G + +  +KMSKSL NFI  +DLL + +   +R F  Q  Y  P++FT E L  + N    +   L    +H         K L F  S    LT             ++FN    L  +    +E  K  +IL+   + E   ++       L ++ G++ +              L D E  EL+ +    +Q KN++E D+ R  L  + ++
  S:     3 LTVYNTLTRRKEPLETLETGKIRMYCCGITVYDYCHLGHARTCMVWDVVRRYLQWRGYEVQYIQNFTDIDDKILNRARQEGTTMEAVSDRFIEAYFEDMERLHVQKAD-AYPRATHTLNGIKRLVSELEAKGYAYQSNGDVYYSVRHFKDYGKLSGRKLEDLQAGASGRVEVQDPEAAKKKDPFDFAVWKAAKPGEPSWDSPWGQGRPGWHIECSAMVRERLGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLARYWLHNGMVKVEGEKMSKSLGNFITIRDLLDKVDPMAMRLFILQAHYRKPVDFTDEALEAATNGWHTLKEGLLFGYNH--------GKQLNFTASPPHPLTSSPLTQRFQQAVDDDFNFAGGLAILFEIAKELRKEGNILVHQGHTETSPQVLEEQWRTLVELAGVLGLETDISEVQEEVGNGLSDAEIEELIEQRKIARQNKNYAEGDRLRDELKNQGII 470
>gi|153091122|gb|EDN73127.1| cysteine--tRNA ligase [Mannheimia haemolytica PHL213] (458 aa)
Score = 620, Expect = 2.1e-62, Identities = 150/433 (34%), Positives = 241/433 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--------NLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KIY+ + +  +E   ++   + MYVCG TVY+  H G+ R  ++FDV+ R     GYN+ ++ NITD+DDKI+ +A E N    EL      +       +NI   +++ PR + HI +I   ++K+++N  AY+  DGDV FD     +YG +S + L++L  G + E    K NP DF LWK +  G  +W+  +  GRPGWH ECS + +K LG+  DIHGGG DL FPHHENE  Q+   +  D    W+H G L I+ +KMSKSL NF   + +L  Y+  ++R+FF    Y + L+++ +NL  +++ LE +   L   +   +  +   E  +E  K+    + ++FN P  ++ + E I      L+ ++  + N L   L   L  +LG++          +  DDE  E   L+ + N+ K  KN++ +D+ R  L
  S:     2 LKIYNTLKREKEEFKPINPNQVGMYVCGVTVYDLCHFGHGRTFVSFDVIARYLRYSGYNLRYVRNITDVDDKIIKRALENNETCDELVDRMIAEMHKDFDALNILRPDVE-PRATKHIPEIIAMVEKLIHNGHAYVAADGDVMFDVESFQKYGALSRQNLEQLQAGARVEIKSIKKNPMDFVLWKMSKAGEPSWESPWGNGRPGWHIECSAMNSKELGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGDYVNYWLHTGMLTIDKEKMSKSLGNFFSIRHMLGLYDAESLRYFFLTAHYRSLLDYSIDNLDLARSALERLYTAL---RGCDVSGEAIGEHYVEAFKT---AMDDDFNTPGALAVLFE-IARELNKLKTEDMAKANGLAVRLKE-LAGVLGLLEQDPDAFLKGDANDDETAEIEALIKQRNEAKAAKNWAVADEVRDKL 439
>gi|163730992|ref|ZP_02138460.1| cysteinyl-tRNA synthetase [Vibrio fischeri MJ11] >gi|161395722|gb|EDQ20023.1| cysteinyl-tRNA synthetase [Vibrio fischeri MJ11] (461 aa)
Score = 620, Expect = 2.2e-62, Identities = 138/398 (34%), Positives = 226/398 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKS--EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII 398
           +KIY+ +++  +E   + +  + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+             +N+   +++ PR +++IK+I   +++++   FAY+  +GDV F+  K ++YG++S + L++L  G +   E+   K +  DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L+ Y++ TVR+F     Y + LN++ ENL  ++  LE +  +L      L +     E   EF       + ++FN P   S + E  +  +  L+ +N +  +KL   L   L  +LG++
  S:     2 LKIYNSLTRQKEEFKPITEGKVGMYVCGVTIYDLCHIGHGRTFVSFDVISRYLRFLGYDLTFVRNITDIDDKIIKRAAENGETCDALTERLIADMHADFDALNMKRPDVE-PRATEYIKEIVALVERLIERGFAYVASNGDVMFEVKKYDEYGRLSRQDLEQLQAGSRVTLEEASVKRSGMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGDHFDIHGGGSDLMFPHHENEIAQSCCAHDTPYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLAHYDSETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSLRGLD--LSVTPAGGE---EFVGRFSTAMNDDFNTPEAYSVLFEMAREVN-RLKTENLDTASKLG-ALMRELADVLGLL 396
>gi|170733433|ref|YP_001765380.1| cysteinyl-tRNA synthetase [Burkholderia cenocepacia MC0-3] >gi|169816675|gb|ACA91258.1| cysteinyl-tRNA synthetase [Burkholderia cenocepacia MC0-3] (465 aa)
Score = 620, Expect = 2.2e-62, Identities = 120/316 (37%), Positives = 189/316 (59%)
  Q:     1 MKIYDFVSKTDKEVSLDKK--NIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + ++   ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+ +  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQPGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRAVENGETIKSLTDRFIGAMHEDETALGIQRPDVE-PRATQFIPQMLGMIETLETNGYAYQAADGDVNYSVRKFADYGKLSGKSLDDLRAGERVAANDAKQDPLDFVLWKRAKEDEPEGASWASKYGMGRPGWHIECSAMGCSLLGNHFDIHGGGQDLQFPHHENEIAQSEGATGETFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVVRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|89075764|ref|ZP_01162152.1| cysteinyl-tRNA synthetase [Photobacterium sp. SKA34] >gi|89048496|gb|EAR54071.1| cysteinyl-tRNA synthetase [Photobacterium sp. SKA34] (460 aa)
Score = 620, Expect = 2.4e-62, Identities = 119/320 (37%), Positives = 190/320 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +  + +    I MYVCG T+Y+  HIG+ R  ++FDV++R     GY++TF  NITDIDDKI+ +A E       L+     +       + +   +++ PR +  I +I    ++++   FAY+  +GDV F+ +K   YG++S + LD+L  G + + ++ K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  +++ LE +  +L
  S:     2 LKIYNSLTRQKEAFTPIQPGKIGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYSGYDLTFARNITDIDDKIIKRAAENGESCDSLTERLIGEMHADFDALGMKRPDVE-PRATQFIAEIIALCERLIERGFAYVASNGDVMFEVSKYEDYGRLSKQDLDQLQAGARVDIDMAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSAILGDHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLNHYDPETVRYFLMSGHYRSQLNYSEENLKQARSALERLYTSL 323
>gi|177665663|ref|ZP_02941462.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 8801] >gi|172075449|gb|EDT60864.1| cysteinyl-tRNA synthetase [Cyanothece sp. PCC 8801] (484 aa)
Score = 620, Expect = 2.4e-62, Identities = 149/439 (33%), Positives = 242/439 (55%)
  Q:     1 MKIYDFVSKTDKEV-SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGD------KSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELT-------------NNFN----LPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN-------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + +Y+ +++  + + +L+   I+MY CG TVY++ H+G+ R  + +DV+ R     GY V +I N TDIDDKI+N+A++E      +S  +   YF+ ++ +++  ++  +PR +  +  I+  + ++    +AY  +GDVY+       YGK+S +KL++L  G       +  +  KK +P DFA+WK    G  +WD  +  GRPGWH ECS ++ + LG+ IDIH GG DL FPHHENE  Q+ A   K LAR W+H G + +  +KMSKSL NFI  +DLL + +   +R F  Q  Y  P++FT E L  + N    +   L    +H         K L F  S    LT             ++FN    L  +    +E  K  +IL+     E   ++       L ++ G++ +              L D E  EL+ +    +Q KN++E D+ R  L  + ++
  S:     3 LTVYNTLTRRKEPLETLETGKIRMYCCGITVYDYCHLGHARTCMVWDVVRRYLQWRGYEVQYIQNFTDIDDKILNRARQEGTTMEAVSDRFIEAYFEDMEHLHVQKAD-AYPRATHTLNGIKRLVSELEAKGYAYQSNGDVYYSVRHFKDYGKLSGRKLEDLQAGASGRVEVQDPEAAKKKDPFDFAVWKAAKPGEPSWDSPWGQGRPGWHIECSAMVRERLGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLARYWLHNGMVKVEGEKMSKSLGNFITIRDLLDKVDPMAMRLFILQAHYRKPVDFTDEALEAATNGWHTLKEGLLFGYNH--------GKQLNFTASPPHPLTSSPLTQRFQQAVDDDFNFAGGLAILFEIAKELRKEGNILVHQGQTETSPQVLEEQWRTLVELAGVLGLETDISEVQEAVGNGLSDAEIEELIEQRKIARQNKNYAEGDRLRDELKNQGII 470
>gi|148269355|ref|YP_001243815.1| cysteinyl-tRNA synthetase [Thermotoga petrophila RKU-1] >gi|170288013|ref|YP_001738251.1| cysteinyl-tRNA synthetase [Thermotoga sp. RQ2] >gi|147734899|gb|ABQ46239.1| cysteinyl-tRNA synthetase [Thermotoga petrophila RKU-1] >gi|170175516|gb|ACB08568.1| cysteinyl-tRNA synthetase [Thermotoga sp. RQ2] (460 aa)
Score = 620, Expect = 2.5e-62, Identities = 145/430 (33%), Positives = 223/430 (51%)
  Q:     6 FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIF-KSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIE------LLNKWNKLKQEKNFSESDKYRKLLME 435
              K ++ V +    ++MYVCGPTVY+ +H+GN RP + FDV  R     GY V  + N TDIDDKI+NKA +  +    ++  +  +Y+     + I  +N   PR +D + DI   I+++V    AY  +  VYFD  K  +YG++S KK+++L+ G + E +  K  P DF+LWK+   G   W   +  GRPGWH EC+ +  K LG+  DIH GG DL FPHHENE  Q  A+  K  AR WMH G +     KMSKS  N    ++ +  Y  + +R+      Y +P++F+ E L +    ++ +   L  + KS  I   K N    E+    +  L ++FN P  VS I E  +  S  + + + E+    +  +      +LG+  +N    E         L+   + L++EK +  SD+ R  L E
  S:     7 LTGKKEEFVPIQPGVVRMYVCGPTVYDLIHVGNARPAVVFDVFRRYLEYRGYRVIMVQNFTDIDDKIINKANQLGVDYKTVADTFIAEYWRDAHALGIRPANFH-PRTTDFVDDIVEIIERLVEKGVAYQTETGVYFDVRKFEKYGELSKKKIEDLIAGARVEVDETKKFPLDFSLWKKAKPGEPCWKSPWGEGRPGWHIECTVMSVKILGESFDIHAGGEDLVFPHHENEKAQAEALTGKVFARYWMHNGMVRFLGDKMSKSTGNIFTVREAVKRYGRDGLRYMILSKHYRSPMDFSEELLQDYSRAVKRVWEILGRYEKSGDIGIPKRNAVYEEYVNRFVEALDDDFNTPVAVSLIFELARNLSKAMDDNDREDALLYYHLIRREFGPVLGLFDLNEEKKEVSSEELLKLLIEVRDVLRKEKRYDLSDRIRDHLRE 443
>gi|27362386|gb|AAO11241.1|AE016806_231 Cysteinyl-tRNA synthetase [Vibrio vulnificus CMCP6] (436 aa)
Score = 620, Expect = 2.5e-62, Identities = 118/298 (39%), Positives = 180/298 (60%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR + +I++I   +++++   FAY+ D GDV F+  K ++YGK+S + LD+L  G + +    K  P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ ENL  ++  LE +  +L
  S:     1 MYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDIDDKIIKRAAENGETCDSLTERLIGEMHADFDALNMKRPDVE-PRATQYIQEIIELVERLIERGFAYVADNGDVMFEVNKFDEYGKLSKQDLDQLQAGARVDVETAKRCPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSL 299
>gi|171320751|ref|ZP_02909762.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria MEX-5] >gi|171094016|gb|EDT39118.1| cysteinyl-tRNA synthetase [Burkholderia ambifaria MEX-5] (465 aa)
Score = 620, Expect = 2.5e-62, Identities = 119/316 (37%), Positives = 190/316 (60%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN--IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTI----GLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++ DK+V + +++  ++MYVCG TVY++ H+G+ R ++ FD++ R    +GY VT++ NITDIDDKI+ +A E       L+  +     +    + I   +++ PR +  I  +   I+ +  N +AY   DGDV +   K   YGK+S K LD+L  G++   N  K +P DF LWK+       G +W  K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++N+KMSKSL NF   +++L  Y+   +R+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLAR-DKQVFVPRQSGEVRMYVCGITVYDYCHVGHARMLVVFDLVQRWLRAIGYRVTYVRNITDIDDKIIRRALENGETIKSLTDRFIGAMHEDEAALGIQRPDIE-PRATQFIPQMLGMIETLETNGYAYQAGDGDVNYSVRKFANYGKLSGKSLDDLRAGERVAANDAKEDPLDFVLWKRAKADDPQGASWASKYGMGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDNEKMSKSLGNFFTIREVLERYDAEVMRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|118054315|ref|ZP_01522854.1| cysteinyl-tRNA synthetase [Comamonas testosteroni KF-1] >gi|117998441|gb|EAV12606.1| cysteinyl-tRNA synthetase [Comamonas testosteroni KF-1] (481 aa)
Score = 620, Expect = 2.5e-62, Identities = 123/322 (38%), Positives = 189/322 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNI 322
           ++IY+ +S+  +  S L+  +++MYVCG TVY+  H+G+ R ++ FDV+ R     GY VT++ NITDIDDKI+ +A E       L+             + I    ++ PR ++++  +   I K+ +   AY   +GDV +   K   YGK+S K LDEL  G++      K +P DF LWK         + W   F  GRPGWH ECS +  + LG+  DIHGGG DL+FPHHENE  Q+     K  A+ WMH G +N++N+KMSKSL NF   +D+L EY+  T+R+F  ++ Y +PLN++  +L +++  L+ +   L++
  S:    23 LRIYNTLSRALESFSPLEPGHVRMYVCGMTVYDLCHLGHARSMVAFDVVQRWLRASGYKVTYVRNITDIDDKIIRRAVENGETIRSLTDRMIDALHQDADALGIERPTLE-PRATEYVPQMLGMIAKLQDKGLAYQAGNGDVNYAVRKFAGYGKLSGKSLDELNAGERVAVADGKLDPLDFVLWKSAKADEPADVKWQSPFGEGRPGWHIECSAMGCELLGESFDIHGGGADLQFPHHENEIAQSEGATGKPFAQTWMHNGFINVDNEKMSKSLGNFFTIRDVLKEYDAETIRFFVVRSHYRSPLNYSNVHLDDARGALKRLYTALDL 349
>gi|68248628|ref|YP_247740.1| cysteinyl-tRNA synthetase [Haemophilus influenzae 86-028NP] >gi|81336945|sp|Q4QPG7|SYC_HAEI8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|68056827|gb|AAX87080.1| cysteinyl-tRNA synthetase [Haemophilus influenzae 86-028NP] (459 aa)
Score = 620, Expect = 2.6e-62, Identities = 150/434 (34%), Positives = 242/434 (55%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLLM 434
           +KI++ +++ +KE+   + +  + MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +E     + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K+++ +D  R  L+
  S:     2 LKIFNTLTR-EKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWASPWGAGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGTDQSAVVFGGENFVETFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDAEKANGLAARLRE-LGAILGLLQQDPEKFLQAGSDDDEVAKIEALIKQRNEARAAKDWATADAARNELI 441
>gi|196156786|ref|YP_002126275.1| cysteinyl-tRNA synthetase [Alteromonas macleodii 'Deep ecotype'] >gi|88772630|gb|EAR03910.1| cysteinyl-tRNA synthetase [Alteromonas macleodii 'Deep ecotype'] >gi|196112565|gb|ACG66281.1| cysteinyl-tRNA synthetase [Alteromonas macleodii 'Deep ecotype'] (460 aa)
Score = 619, Expect = 2.7e-62, Identities = 122/305 (40%), Positives = 182/305 (59%)
  Q:    12 KEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           K V L +  + +YVCG TVY+  H+G+ R  ++FDVL R    LG +V ++ NITDIDDKI+ +A E       L++       +    IN+   +++ P VS H+ +I   IQ++++  +AY    GDV FD +K   YGK+S + LD+L  G + E    K++P DF LWK T  G   W   +  GRPGWH ECS + +K+LG   DIHGGG DL FPHHENE  Q+    +     +WMH G + +N++KMSKSL NF   +D+L E+++ T+R+F     Y + L+++ +N+  +K  LE +
  S:    14 KFVPLQEGKVGLYVCGITVYDLSHMGHARTYLSFDVLVRYLRHLGLDVKYVRNITDIDDKIIARANENGESFEALTARTIAMMHEDFAAINLLEPDVE-PTVSGHMDEIIEIIQRLMDKGYAYQAKSGDVLFDVSKYEDYGKLSKQDLDQLKAGARVEVAAGKDDPLDFVLWKTTKPGEPAWQSPWGEGRPGWHIECSAMNHKHLGAHFDIHGGGSDLTFPHHENEVAQSCCAYDTPYVNVWMHAGMVQVNDEKMSKSLGNFFTLRDVLKEHDSETLRFFLMSAHYRSQLSYSQDNITQAKAALERL 319
>gi|78189774|ref|YP_380112.1| cysteinyl-tRNA synthetase [Chlorobium chlorochromatii CaD3] >gi|109894890|sp|Q3APK6|SYC_CHLCH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|78171973|gb|ABB29069.1| cysteinyl-tRNA synthetase [Chlorobium chlorochromatii CaD3] (480 aa)
Score = 619, Expect = 2.7e-62, Identities = 154/434 (35%), Positives = 248/434 (57%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDI----------DDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELL-----VGDKSEDNLKKNNPQDFALWKQTTIG--LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFK-----SHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFN--LSYLLTKILGIIHVNLFDDE----AIELLNKWNKL--------KQEKNFSESDKYRKLLM 434
           + IY+ +S+T KE+   L    + +YVCGPTVY H H+G+ +  I+FDV+ R F + GY V +I NITD+          +DKI+ +A+ E    +E++ +Y   +++ +  + +   N+  P  + HI +    ++ ++   +AY V+G+VYF       YGK+S +   E L     VG +SE    K +  DFALWK+   G  + W   +S G PGWH ECS +  KYLG+ IDIHGGG++ KFPHHE E  Q+ A   K   R WMH   + +N  KM KSL NF+  K+LL   N   +R+F  Q+ Y +PL+++   L  +   LE +   L  F+     S  +    Y E+  E        + ++FN P  ++ + +  K  +  L +K   E ++      L+   T  LGI   NL D++    +++ L+K  ++        +++K+F+ SDK R +L+
  S:     3 LAIYNSLSRT-KEIFEPLHSGVVSIYVCGPTVYGHAHLGHAKSYISFDVVVRWFRQSGYKVKYIQNITDVGHLTDDADEGEDKIMKQARLEKTDPMEIAQFYTRSFYEDMDRLGVERPNIA-PTATAHIPEQIALVETLLRKGYAYEVNGNVYFSVNSFAGYGKLSGRTDQEALQSGSRVGIRSE----KRDASDFALWKKAEEGHIMKWQSPWSVGYPGWHLECSAMAMKYLGETIDIHGGGMENKFPHHECEIAQSEAATGKPYVRYWMHNNMVTVNGTKMGKSLKNFVNLKELLQTRNPLALRFFILQSHYRSPLDYSEAALDAAAQGLEKLHETLRRFRHQAAGSGSLDVTPYAERFSE-------AMNDDFNTPIAIAVLFDLSKAINSALDSKGIVEADRAAIEAFLTIAATNTLGIASNNLADEQSNGNSMQRLDKVMQIMLELRHNARKQKDFATSDKIRDMLL 461
>gi|123443257|ref|YP_001007231.1| cysteinyl-tRNA synthetase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|187470968|sp|A1JNP9|SYC_YERE8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|122090218|emb|CAL13084.1| cysteinyl-tRNA synthetase [Yersinia enterocolitica subsp. enterocolitica 8081] (461 aa)
Score = 619, Expect = 3.0e-62, Identities = 148/435 (34%), Positives = 236/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    + MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L++    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G  +W+  +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + +      ++K   I   N    EL KL +        +LG++  +  LF        DDE  +   L+ + N  +  K+++ +D  R  L E
  S:     2 LKIFNTLSRQKEEFKPIHAGKVGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRALENNETCEQLTTRMLVEMHKDFDALNLKRPDLE-PRATHHIPEIIALTERLIARNHAYVAANGDVMFSVESDPDYGLLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPSWESPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGAEFEARFRAAMDDDFNTPEAYSVLFDIAREVNRLKTEDITAANALAAELRKLAY--------VLGLLEQDPELFLQSGAQTDDDEVAKIEVLIKQRNDARSSKDWALADSARDQLNE 444
>gi|145298606|ref|YP_001141447.1| cysteinyl-tRNA synthetase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851378|gb|ABO89699.1| Cysteinyl-tRNA synthetase [Aeromonas salmonicida subsp. salmonicida A449] (458 aa)
Score = 619, Expect = 3.1e-62, Identities = 120/316 (37%), Positives = 183/316 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYY---ETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           +KIY+ +++  +E   +    + MYVCG T+Y+H HIG+ R  + FDV+ R     GY + ++ N+TD+DDKI+ +A E N+   +L+        Q FD L  +         PR + HI +I   ++ ++    AY+ D GDV F       YGK+S + L++L  G +      K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   +  D    WMH G + ++ +KMSKSL NF   +D+L+ Y+  +VR+F     Y + LN++ +NL  ++  LE +
  S:     2 LKIYNTLTRQKEEFKPIHPGKVGMYVCGVTIYDHCHIGHGRTFVAFDVVARYLRYCGYQLNYVRNVTDVDDKIIKRAAETNVTCDDLTERLIGDMHQDFDALGMVRPDVE----PRATQHISEIIELVESLIAQDHAYVADNGDVMFIVDSYADYGKLSGQDLEQLQAGARVGVVDAKRNPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGNHFDIHGGGSDLQFPHHENEIAQSCCAHGGDYVNTWMHSGMVMVDKEKMSKSLGNFFTIRDVLAHYDAESVRYFLMSGHYRSQLNYSEDNLKQARAALERM 319
>gi|90580099|ref|ZP_01235907.1| cysteinyl-tRNA synthetase [Vibrio angustum S14] >gi|90438984|gb|EAS64167.1| cysteinyl-tRNA synthetase [Vibrio angustum S14] (460 aa)
Score = 619, Expect = 3.2e-62, Identities = 117/320 (36%), Positives = 191/320 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +  + +    + MYVCG T+Y+  HIG+ R  ++FDV++R     GY++TF+ NITDIDDKI+ +A E       L+     +       + +   +++ PR +  I +I    ++++   FAY+  +GDV F+ +K   YG++S + LD+L  G + + ++ K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L+ Y+  TVR+F     Y + LN++ +NL  +++ LE +  +L
  S:     2 LKIYNSLTRQKEAFTPIQPGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYSGYDLTFVRNITDIDDKIIKRAAENGESCDSLTERLIGEMHADFDALGMKRPDVE-PRATQFIAEIIALCERLIERGFAYVASNGDVMFEVSKYEDYGRLSKQDLDQLQAGARVDIDMAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSAILGDHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLNHYDPETVRYFLMSGHYRSQLNYSEDNLKQARSALERLYTSL 323
>gi|145570618|gb|ABP79724.1| cysteinyl-tRNA synthetase [Pseudomonas stutzeri A1501] (436 aa)
Score = 619, Expect = 3.4e-62, Identities = 122/297 (41%), Positives = 184/297 (61%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE-----ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYN 319
           MYVCG TVY+  HIG+ R ++ FDV+ R     GY+VT++ NITDIDDKI+ +A E     + + E  +++ +E +       +N+   +++ PR +DHI  +   IQ +++  FAY   +GDVY+   K   YGK+S +K+++L +G + E +  K +P DF LWK    G  +WD  +  GRPGWH ECS +    LG+  DIHGGG DL FPHHENE  Q+ A   K  A  WMH G + ++ +KMSKSL NF   +++L +Y+   VR+    + Y +P+N++ ++L  +K+ LE   YN
  S:     1 MYVCGMTVYDFCHIGHARVMVAFDVVTRWLRHRGYDVTYVRNITDIDDKIIRRASENGEPFQALVERMIAAMHEDE-----TRLNVLRPDVE-PRATDHIAGMHTMIQTLIDKGFAYAPGNGDVYYRVGKFVGYGKLSRRKIEDLKIGARIEVDEAKEDPLDFVLWKGAKPGEPSWDSPWGPGRPGWHIECSVMSTCCLGETFDIHGGGPDLVFPHHENEIAQSEAATGKLYANAWMHAGAVRVDGEKMSKSLGNFFTIREVLEKYHPEVVRYLLVSSHYRSPINYSEDSLREAKSALER-FYN 297
>gi|145639628|ref|ZP_01795231.1| cysteinyl-tRNA synthetase [Haemophilus influenzae PittII] >gi|145642163|ref|ZP_01797732.1| cysteinyl-tRNA synthetase [Haemophilus influenzae R3021] >gi|145271185|gb|EDK11099.1| cysteinyl-tRNA synthetase [Haemophilus influenzae PittII] >gi|145273154|gb|EDK13031.1| cysteinyl-tRNA synthetase [Haemophilus influenzae 22.4-21] (459 aa)
Score = 618, Expect = 3.9e-62, Identities = 150/433 (34%), Positives = 240/433 (55%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KI++ +++ +KE+   + +  + MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +E     + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K++  +D  R  L
  S:     2 LKIFNTLTR-EKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWASPWGAGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGADQSAVVFGGENFVETFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDVEKANGLAARLRE-LGAILGLLQQDPEKFLQAGSNDDEVAKIEALIKQRNEARAAKDWPAADAARNEL 440
>gi|170290560|ref|YP_001737376.1| cysteinyl-tRNA synthetase [Candidatus Korarchaeum cryptofilum OPF8] >gi|170174640|gb|ACB07693.1| cysteinyl-tRNA synthetase [Candidatus Korarchaeum cryptofilum OPF8] (472 aa)
Score = 618, Expect = 3.9e-62, Identities = 123/320 (38%), Positives = 192/320 (60%)
  Q:    19 KNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWK-QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIA-VNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNL 338
           + + M+VCGPTVY++ H+G+ R  + +D L R   +LGY++ ++ NITD+DDKIVN+A EE    +EL+  +E+ Y++ ++ +NI + N+ + R SD++K+I   ++ ++    AY+ +  VYFD T    YGK+S ++ +EL V  + E +  K NP DFALW+ +      W+  +  GRPGWH E + +  K+ G Q DIHGG I+L FPHHE E  Q  +    K   + W+H G L +  +KMSKSL NF+  ++ L EY+ NT+R F     Y +P++F  E L  +++  E II  L   K   I E+   E+  
  S:    26 RRVFMFVCGPTVYDYSHLGHARTYVFYDTLARFLRKLGYSLFYLQNITDVDDKIVNRAAEEGRDPVELAREFESYYYEDMRALNITSVNL-YARASDYLKEIFEQVETLIKLGKAYVTESGVYFDITTFPDYGKLSGQRPEELRV-HRIEPDPTKRNPGDFALWRNRPREEFGWESPWGYGRPGWHIEDTAISIKHFGKQYDIHGGAIELAFPHHEAEIAQAESFTGEKPFVKYWIHTGLLTVEGEKMSKSLGNFVTIREALREYDANTLRIFLLSRHYRSPIDFRWEYLEQARSSYERIINCLENLKELEIGEEGDEEREF 345
>gi|71906558|ref|YP_284145.1| cysteinyl-tRNA synthetase [Dechloromonas aromatica RCB] >gi|109894895|sp|Q47HK6|SYC_DECAR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|71846179|gb|AAZ45675.1| cysteinyl-tRNA synthetase [Dechloromonas aromatica RCB] (456 aa)
Score = 618, Expect = 3.9e-62, Identities = 120/320 (37%), Positives = 194/320 (60%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ + K +K+V   ++   ++MYVCG TVY++ H+G+ R ++ FD++ R     GY+VT++ NITDIDDKI+ +A E      +L++ +     +    + +   + + PR ++++ ++ + I K+  N  AY   DGDV +   K   YGK+S K LD+L  G++ E +  K +P DF LWK    G   W   +  GRPGWH ECS + +K LG   DIHGGG DL+FPHHENE  Q+   N  +    WMH G + ++N+KMSKSL NF   + +L +++   VR+F  +  Y +PLN++  +L +++  L+++ + L
  S:     2 LKIYNSL-KREKQVFTPIEPNKVRMYVCGMTVYDYCHLGHARVMVVFDMVYRWLKASGYDVTYVRNITDIDDKIIKRAIENGETIQQLTNRFIAFMHEDADALGVQRPDYE-PRATEYVPEMLDLIGKLEANGLAYQASDGDVNYAVRKFPGYGKLSGKSLDDLRAGERVEVDSAKQDPLDFVLWKHAKPGEPAWQSPWGDGRPGWHIECSAMSSKLLGQHFDIHGGGQDLQFPHHENEIAQSEGANCCNFVNYWMHNGFVRVDNEKMSKSLGNFFTIRTVLEQFDAEVVRFFILRAHYRSPLNYSDAHLDDARRSLDSLYFAL 323
>gi|78485268|ref|YP_391193.1| cysteinyl-tRNA synthetase [Thiomicrospira crunogena XCL-2] >gi|109894958|sp|Q31H54|SYC_THICR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|78363554|gb|ABB41519.1| cysteinyl-tRNA synthetase [Thiomicrospira crunogena XCL-2] (456 aa)
Score = 618, Expect = 4.2e-62, Identities = 148/436 (33%), Positives = 245/436 (56%)
  Q:     1 MKIYDFVSKTDKEVSLDKKN-IKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHF-NLSYLLTKI---LGIIHVNL------------FDDEAIE-LLNKWNKLKQEKNFSESDKYRKLLMEK 436
           +KIY+  ++  +  +  + N + +YVCG TVY++ H+G+ R ++ FD + R    LGY+VT++ NITDIDDKI+ +A E       L+S +     +  K +N+   +M+ P+ ++++ +IE  I  ++   FAY  + GDVYF     + YG++S K ++EL  G + E N  K +P DF LWK +      W   +  GRPGWH ECS +  K LG+  DIHGGG+DL FPHHENE  Q+     +     WMH G + I+++KMSKSL NF   +++L +Y+   +R+F   + Y +P+N++ ENL  +K  +  +   L +  +    + +  E  LE +   +  + ++FN P  ++ + E  K            E+NK     L+ LL K+   +G++                  DE IE L+ +  + ++ K+FS SD+ R  L+ +
  S:     3 LKIYNTETRQKETFTPIQPNKVGLYVCGVTVYDYCHVGHARVMVVFDTVVRHLRSLGYDVTYVRNITDIDDKIIQRALENKESIQSLTSRFIDAMHEDEKALNVLRPDME-PKATEYMDEIETMISTLIEKDFAYPAENGDVYFHVKADDDYGRLSGKNIEELDSGSRVEINSVKKDPLDFVLWKASKENEPAWQSPWGDGRPGWHIECSAMSTKCLGNHFDIHGGGLDLSFPHHENEIAQSECATGEHYVNSWMHCGFVRIDDEKMSKSLGNFFTIREVLKQYHPEVIRYFLLASHYRSPVNYSEENLDVAKASVGRLYSALELVPAD---QAEPAESKLEAE--FMAAMNDDFNTPQAMAVLFELAK------------EVNKQKSPGLAALLKKLANQIGLLEQTAESFFKSQPSDSDLTDEMIEALIVERAEARKAKDFSRSDEIRDELLAQ 440
>gi|182678882|ref|YP_001833028.1| cysteinyl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634765|gb|ACB95539.1| cysteinyl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC 9039] (458 aa)
Score = 618, Expect = 4.3e-62, Identities = 122/299 (40%), Positives = 182/299 (60%)
  Q:    16 LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLEL--GYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKD-LARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLE 314
           +D  N+++Y CGPTVY+ +HIGN R +I FD+L R+  +L    +V ++ NITD+DDKI  +A E  I    L+      + +  K +N     ++ PR ++H+ ++   I+K+V N  AY+ +G V FD      YGK+S + LD+++ G + E    K +P DF LWK        W+  +  GRPGWH ECS +  K+LG+  DIHGGGIDL FPHHENE  Q  +    D +A +WMH GHL +  QKMSKSL NF+  +D+L ++   TVR+   +T Y  P+++T  +L  S+ +L+
  S:    19 IDPANVRLYACGPTVYDFLHIGNGRMLIVFDLLFRVLRDLYGADHVRYVRNITDVDDKINARAAERGIDIRVLTDEMTAIFHEDAKALNCLPPTVE-PRATEHMAEMIAIIEKLVANGHAYIAEGHVLFDVPSMPDYGKLSKRPLDDMIAGARVEVAPYKRSPTDFVLWKPAKPEEPGWESPWGRGRPGWHLECSAMSWKHLGEVFDIHGGGIDLVFPHHENEVAQTCSAFGHDVMANVWMHNGHLQVEGQKMSKSLGNFLTIRDVLKDWPGETVRFTMLKTHYRQPIDWTLSSLRESQRELD 320
>gi|153000119|ref|YP_001365800.1| cysteinyl-tRNA synthetase [Shewanella baltica OS185] >gi|187631634|sp|A6WLP8|SYC_SHEB8 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|151364737|gb|ABS07737.1| cysteinyl-tRNA synthetase [Shewanella baltica OS185] (459 aa)
Score = 617, Expect = 4.5e-62, Identities = 148/435 (34%), Positives = 235/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LF-----DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    I MYVCG T+Y+  HIG+ R  ++FD++ R     GY V F  NITD+DDKI+ +A E N     L+     +       +N+   + + PR + HI +I + ++ ++    AY+  DGDV F       YG++S + LD+L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +++ LE +     I    L +     E   EF       + ++FN P   S + + ++  +  L+  +  + + L   L   L  +LG++       F     DDE  E   L+ + N+ + EK+++ +D  R  L E
  S:     2 LKIYNSITRQKQEFKPITPGKIGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDVDDKIIKRANENNESCEALTERLIGEMHQDFDALNMLRPDFE-PRATLHIAEIIDMVELLLARGHAYVASDGDVLFSVASYPDYGRLSGQNLDQLQAGARVEVDETKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLLSGHYRSQLNYSEDNLKQARSALERLY--TAIKDVDLTVAAAPAE---EFVAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKLTDMAQASALAVTLKQ-LADVLGLLSQEPEAFFQGGGSDDEVAEIEALIVERNRARTEKDWAAADVARNRLNE 442
>gi|84391753|ref|ZP_00991655.1| cysteinyl-tRNA synthetase [Vibrio splendidus 12B01] >gi|84376466|gb|EAP93345.1| cysteinyl-tRNA synthetase [Vibrio splendidus 12B01] (461 aa)
Score = 617, Expect = 4.6e-62, Identities = 120/320 (37%), Positives = 190/320 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL 320
           +KIY+ +++  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV+ R    LGY++ F+ NITDIDDKI+ +A E       L+     +       +N+   +++ PR ++ I +I   ++K++   FAY+  +GDV F+  K ++YGK+S + LD+L  G + + +  K +P DF LWK +  G   W+  +  GRPGWH ECS + +  LG+  DIHGGG DL+FPHHENE  Q+   +       WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  ++  LE +  +L
  S:     2 LKIYNTLTRQKEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVTRYLRYLGYDLNFVRNITDIDDKIIKRANENGESCDSLTERLIGEMHADFDALNMKRPDVE-PRATEFITEIVELVEKLIERGFAYVASNGDVMFEVKKFDEYGKLSKQDLDQLQAGARVDVDSAKRSPLDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHGTQYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLQHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERLYTSL 323
>gi|160874741|ref|YP_001554057.1| cysteinyl-tRNA synthetase [Shewanella baltica OS195] >gi|187631635|sp|A9KWH4|SYC_SHEB9 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|160860263|gb|ABX48797.1| cysteinyl-tRNA synthetase [Shewanella baltica OS195] (459 aa)
Score = 617, Expect = 4.7e-62, Identities = 148/435 (34%), Positives = 235/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LF-----DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    I MYVCG T+Y+  HIG+ R  ++FD++ R     GY V F  NITD+DDKI+ +A E N     L+     +       +N+   + + PR + HI +I + ++ ++    AY+  DGDV F       YG++S + LD+L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +++ LE +     I    L +     E   EF       + ++FN P   S + + ++  +  L+  +  + + L   L   L  +LG++       F     DDE  E   L+ + N+ + EK+++ +D  R  L E
  S:     2 LKIYNSITRQKQEFKPITPGKIGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDVDDKIIKRANENNESCEALTERLIGEMHQDFDALNMLRPDFE-PRATLHIAEIIDMVELLLARGHAYVASDGDVLFSVASYPDYGRLSGQNLDQLQAGARVEVDETKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLLSGHYRSQLNYSEDNLKQARSALERLY--TAIKDVDLTVAAAPAE---EFIAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKLTDMAQASALAVTLKQ-LADVLGLLSQEPEAFFQGGGSDDEVAEIEALIVERNRARTEKDWAAADVARNRLNE 442
>gi|157374677|ref|YP_001473277.1| cysteinyl-tRNA synthetase [Shewanella sediminis HAW-EB3] >gi|187631638|sp|A8FTH6|SYC_SHESH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|157317051|gb|ABV36149.1| Cysteine--tRNA ligase [Shewanella sediminis HAW-EB3] (459 aa)
Score = 617, Expect = 4.8e-62, Identities = 147/430 (34%), Positives = 240/430 (55%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII--HVNLF------DDEAIE---LLNKWNKLKQEKNFSESDKYR 430
           +K+Y+ +++  +E   L    + MYVCG T+Y+  HIG+ R  ++FD++ R     GY+V F+ NITD+DDKI+ +A E       L+     +       +N+   + + PR + HI +I + ++K++  + AY+  +GDV F  +   +YG++S + LD+L  G + E    K +P DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   +N      WMH G + ++ +KMSKSL+NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +K+ LE +  +L      L +E    +   E+     + + ++FN P   S + E ++  + L    N  + + L   L   L  +LGI+   V+ F       DE  E   L+ + N+ + EK++  +D  R
  S:     2 LKLYNSLTRQKEEFKPLQPGKVGMYVCGITIYDLCHIGHGRTFVSFDMIVRYLRYSGYDVNFLRNITDVDDKIIKRANENKESCESLTERLIGEMHRDFDALNMKRPDFE-PRATLHIPEIIDMVEKLIEKEHAYVSGNGDVLFSVSSFPEYGRLSGQNLDQLQAGARVEVEDTKRDPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGQHFDIHGGGSDLQFPHHENEIAQSCCAHNTPYVNYWMHTGMVMVDKEKMSKSLNNFFTIRDVLEHYDAATVRYFLLSGHYRSQLNYSEDNLKQAKSALERLYTSLKGLD--LSVEAASAD---EYVAKFKVAMDDDFNTPEAYSVLFEMVREINRLKEADN-AKASSLGVKLKE-LADVLGILDQDVDTFFKGEGSTDEVAEIEALIAERNRARAEKDWPAADVAR 437
>gi|170017958|ref|YP_001728877.1| cysteinyl-tRNA synthetase [Leuconostoc citreum KM20] >gi|169804815|gb|ACA83433.1| cysteinyl-tRNA synthetase [Leuconostoc citreum KM20] (469 aa)
Score = 617, Expect = 4.9e-62, Identities = 144/439 (32%), Positives = 250/439 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDEL---LVGDKSEDNL-KKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTV-RWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFN----LSYLLTKILGIIHVNLFDD------EAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           + +Y+ +S+ +KE   ++    + MYVCGPTVYN++HIGN R  I FDV+ R     GY V ++ N TD+DDKI+ +A+EE + E+ ++  Y   + +    +NI  +  +  R +  I DI  +++ +++  +AY   GDVYF   K   YG ++++ L E+     G   +  L +K +P DFA+WK   ++  ++W   +  GRPGWH ECS +  KYL D IDIHGGGIDL FPHH NE  Q+ A   +     W+H G +N+N++KMSKSL NF    D+L+ Y+   V R+    T Y  P+N+  + L  ++ +LE I          +   +  ++ ++++  +  I      + ++FN  N ++ I E +  ++      N+   +++  +    L++ +  ++ +  VN   +      EA  LL+K  + +  ++F+ SD+ R  L +  ++
  S:     2 IHVYNTLSR-EKEAFHAITPGKVNMYVCGPTVYNYIHIGNARSAIAFDVIRRYLEYSGYVVNYVSNFTDVDDKIIQRAREEGVDEMTIADKYAQAFDEDTIPLNIKPATTR-SRATAVIPDIIAFVEDLIHKGYAYESAGDVYFRAKKFKGYGILAHQDLAEMEANAAGRLDDQELTRKEDPIDFAVWKASHSSDEISWVSPWGKGRPGWHIECSVMAQKYLADTIDIHGGGIDLAFPHHTNEIAQSEARTGQTFVNYWLHNGFVNVNDEKMSKSLGNFTTVHDMLAHYDDPMVIRYLLATTQYRRPINYAPDTLEQARAELERIRTAYRNVFFRISTAKTGHDDSVDYAIAEHISHFREAMDDDFNTQNAIASIFELVTIAN------NYASRDEIKLDTATRLTHAIADLMNVFGVNGLSEHLTLSAEAQALLDKRVQARAVRDFNLSDQLRDQLSDMGII 456
>gi|126465424|ref|YP_001040533.1| cysteinyl-tRNA synthetase [Staphylothermus marinus F1] >gi|166225308|sp|A3DLW5|SYC_STAMF Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|126014247|gb|ABN69625.1| cysteinyl-tRNA synthetase [Staphylothermus marinus F1] (477 aa)
Score = 617, Expect = 5.1e-62, Identities = 142/363 (39%), Positives = 213/363 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQN-IAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS--------HLIIEQ--KYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE 363
           +KIY+ +++  +E   +    +KMYVCGPTVY++ HIG+ R  + +D L R     GY+V  + NITDIDDKI+N+A +E     E++  Y   Y + L  +N+       PRV++HIK+I  +IQ +++  +AY+   G VYF+  K  +YG++S +   EL   +K E   +K  P DFALWK    G  +WD  +  GRPGWH ECS + ++YLG Q DIHGGG DL FPHHENE  Q+  A   K   + W+H G + + ++KMSKSL N I  ++   E+   T+R ++  + Y  PL FT E++  ++   E ++   N  K         H + ++  K  EK LE        L+N+FN P  ++ I E
  S:     4 IKIYNTLTRKIEEFKPVSPGFVKMYVCGPTVYDYNHIGHGRVYVVYDALKRYLALRGYHVLHVMNITDIDDKIINRAHQEKRDWREIAETYTRDYLESLGKLNVKVD--LHPRVTEHIKEIIEFIQILIDKGYAYVAPSGSVYFEVDKYPEYGELSGRTNKELWSQEK-EFISEKKKPYDFALWKAWKPGEPHWDAPWGKGRPGWHIECSVMSSRYLGRQFDIHGGGTDLIFPHHENERAQSEAAFGVKPWVKYWVHTGMVMMGSEKMSKSLGNIIPLREAFKEWGPETLRLWYLTSHYRRPLVFTEESIRQAQKYYERLVSVTNTIKKLSREAVSLHRMNDEDLKILEKLLEIRSRFHEALSNDFNTPQALAVISE 377
>gi|148827229|ref|YP_001291982.1| cysteinyl-tRNA synthetase [Haemophilus influenzae PittGG] >gi|187629826|sp|A5UFP3|SYC_HAEIG Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|148718471|gb|ABQ99598.1| cysteinyl-tRNA synthetase [Haemophilus influenzae PittGG] (459 aa)
Score = 617, Expect = 5.6e-62, Identities = 150/433 (34%), Positives = 240/433 (55%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KI++ +++ +KE+   + +  + MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +E     + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K++  +D  R  L
  S:     2 LKIFNTLTR-EKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWSSPWGAGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGADQSAVVFGGENFVETFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDVEKANGLAARLRE-LGAILGLLQQDPEKFLQAGSDDDEVAKIEVLIKQRNEARAAKDWPVADAARNEL 440
>gi|117921105|ref|YP_870297.1| cysteinyl-tRNA synthetase [Shewanella sp. ANA-3] >gi|166225306|sp|A0KYM2|SYC_SHESA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|117613437|gb|ABK48891.1| cysteinyl-tRNA synthetase [Shewanella sp. ANA-3] (461 aa)
Score = 617, Expect = 5.6e-62, Identities = 150/435 (34%), Positives = 237/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN----------IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLF------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG TVY+  HIG+ R  ++FD++ R     GY V F  NITDIDDKI+ +A E            IGE+        + FD L  I         PR + HI +I + +++++    AY+  DGDV F      +YG++S + L++L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + +N++ ENL  ++  LE +   +      L +     E   EF       + ++FN P   S + + ++  +  L+  +  + + +   +   L  +LG++H   + F      DDE  E   L+ + N+ + EK++  +D  R  L E
  S:     4 LKIYNSITRQKQEFKPITPGKVGMYVCGVTVYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDIDDKIIKRANENQEDCNTLTDRLIGEMH-------KDFDALNMIRPDFE----PRATLHIAEIIDMVERLLARGHAYVAADGDVLFSVASFPEYGRLSGQNLEQLQAGARVEVDDNKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLLSGHYRSQINYSEENLKQARAALERLYTAIK--DVDLTVTAAPAE---EFVAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKTTDMAQASAMAVAMKQ-LADVLGLLHQAPDAFFKGEGSDDEVAEIEALIVERNRARAEKDWPAADVARNRLNE 444
>gi|114048058|ref|YP_738608.1| cysteinyl-tRNA synthetase [Shewanella sp. MR-7] >gi|123030490|sp|Q0HTK4|SYC_SHESR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|113889500|gb|ABI43551.1| cysteinyl-tRNA synthetase [Shewanella sp. MR-7] (461 aa)
Score = 616, Expect = 5.9e-62, Identities = 150/435 (34%), Positives = 237/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN----------IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLF------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG TVY+  HIG+ R  ++FD++ R     GY V F  NITDIDDKI+ +A E            IGE+        + FD L  I         PR + HI +I + +++++    AY+  DGDV F      +YG++S + L++L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + +N++ ENL  ++  LE +   +      L +     E   EF       + ++FN P   S + + ++  +  L+  +  + + +   +   L  +LG++H   + F      DDE  E   L+ + N+ + EK++  +D  R  L E
  S:     4 LKIYNSITRQKQEFKPITPGKVGMYVCGVTVYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDIDDKIIKRANENQEDCNTLTDRLIGEMH-------KDFDALNMIRPDFE----PRATLHIAEIIDMVERLLARGHAYVAADGDVLFSVASFPEYGRLSGQNLEQLQAGARVEVDDNKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLGHYDPETVRYFLLSGHYRSQINYSEENLKQARAALERLYTAIK--DVDLTVAPAPAE---EFVAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKTTDMAQASAMAVAMKQ-LADVLGLLHQAPDAFFKGEGSDDEVAEIEALIVERNRARAEKDWPAADVARNRLNE 444
>gi|16272052|ref|NP_438251.1| cysteinyl-tRNA synthetase [Haemophilus influenzae Rd KW20] >gi|1174501|sp|P43816|SYC_HAEIN Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|1573026|gb|AAC21753.1| cysteinyl-tRNA synthetase (cysS) [Haemophilus influenzae Rd KW20] (459 aa)
Score = 616, Expect = 6.8e-62, Identities = 150/433 (34%), Positives = 240/433 (55%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-----ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KI++ +++ +KE+   + +  + MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +      + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K++S +D  R  L
  S:     2 LKIFNTLTR-EKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWASPWGAGRPGWHIECSAMNCKQLGEYFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGTDQSAVAFGGENFVATFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDVEKANGLAARLRE-LGAILGLLQQEPEKFLQAGSNDDEVAKIEALIKQRNEARTAKDWSAADSARNEL 440
>gi|189461692|ref|ZP_03010477.1| hypothetical protein BACCOP_02356 [Bacteroides coprocola DSM 17136] >gi|189431579|gb|EDV00564.1| hypothetical protein BACCOP_02356 [Bacteroides coprocola DSM 17136] (492 aa)
Score = 616, Expect = 7.2e-62, Identities = 150/420 (35%), Positives = 233/420 (55%)
  Q:    14 VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDI----------DDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQ---YGKISNKKLDELLVGDKSEDNLK-KNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILA--------KDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNK------NFEELNKLHFNLSYLLTKILGIIHVNLFDDEAI-----ELLNKWNKLKQEKNFSESDKYRKLL 433
           V L   ++ MYVCGPTVY   H+G+ RP ITFD+L R    LGY V ++ NITD+          +DKI  KA+ E +  +E+  YY  +Y   ++ +N+   +++ P  S HI +    ++ I+ N +AY   G VYFD  K N+   YGK+S + LD+++   +  D  + K+NP DFALWK  Q    + W   +S G PGWH EC+ +  KYLG+  DIHGGG+DL FPHHE E  Q++A    D+ R WMH   + IN QKM KSL NFI          K L   Y+  T+R+F  Q  Y + ++F+ E L  ++  LE ++  +   +     +     +     +     + ++ N P ++S + + I+  + ++  K      + EEL  +     + +  +      N   +EA       LL +  + K  K+++ SDK R  L
  S:    19 VPLHAPHVGMYVCGPTVYGDAHLGHARPAITFDILFRYLTHLGYKVRYVRNITDVGHLEHDADDGEDKIAKKARLEQLEPMEVVQYYLNRYHKAMEALNVLPPSIE-PHASGHIIEQIQLVEGILKNGYAYESQGSVYFDVAKYNKDHHYGKLSGRNLDDVINTTRELDGQQEKHNPADFALWKCAQPEHIMRWPSPWSNGFPGWHCECTAMGRKYLGENFDIHGGGMDLIFPHHECEIAQSVASQGHDMVRYWMHNNMITINGQKMGKSLGNFITLDEFFTGSNKLLTQAYSAMTIRFFILQAHYRSTVDFSNEALQAAEKGLERMMEGVKNLERITPSKTTSGIEPAGLREKCYEAMNDDLNTPIVISHLFDAIRMINTVIDKKATISADDLEELKSVFHTFVFDILGLKAEAENNAAREEAFGKVVDMLLEQRMQAKANKDWATSDKIRDTL 472
>gi|59802301|ref|YP_209013.1| hypothetical protein NGO1993 [Neisseria gonorrhoeae FA 1090] >gi|81311142|sp|Q5F5D6|SYC_NEIG1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|59719196|gb|AAW90601.1| putative cysteinyl-tRNA synthetase [Neisseria gonorrhoeae FA 1090] (473 aa)
Score = 615, Expect = 7.7e-62, Identities = 147/437 (33%), Positives = 251/437 (57%)
  Q:     3 IYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLA----------------RIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL------LTKILGIIHVN-------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           IY+ +++  +  + +D +N++MYVCG TVY++ H+G+ R ++ FD++ R   E GY +T++ NITDIDDKI+ +A E  E IGEL  + + +  + D    + +   +++ P+ +++I  +   I+ ++ N  AY   +GDVY+   +   YG++S K LD+L  G++ E +  K +P DF LWK    G   W+  +  GRPGWH ECS +     GD  DIHGGG DL+FPHHENE  Q++  +                     + W+H G + ++ +KMSKSL NF   +++L +Y+   VR+F  +  Y +PLN++  +L ++K  L  +   L             N    EFD   L E  N +      +  ++     ++ +  +   E+NK   N ++L      L  I+G++  N             L ++E  +L+ +  + + +KN++ESD+ R LL E K++
  S:     4 IYNTLTRQKEPFAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGELN-ARFIQAMHEDA-DALGVLRPDIE-PKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGFKRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGASGHTCGHDHAQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTRLYTTLK------------NTPAAEFD---LSENANGYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKT--NDAHLAGCLKALGGIIGLLQRNPIEFLQGGAVSDGLSNEEIEDLIARRKQARADKNWAESDRIRDLLNEHKII 460
>gi|161506926|ref|YP_001576880.1| cysteinyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] >gi|172048174|sp|A8YTD3|SYC_LACH4 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|160347915|gb|ABX26589.1| Cysteinyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] (476 aa)
Score = 615, Expect = 8.0e-62, Identities = 154/435 (35%), Positives = 250/435 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKS----EDNLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNI--NNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSK---NQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSN---LIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNL------SYLLTKILGIIHVNL------FDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           +K+Y+ +++  +E   L    I MYVCGPTVYN++HIGN R  I FD + R     GY V ++ N TD+DDK++N+A  E     +L+  +   + +    +NI  + +  PR +  IK+I  +IQ +++  +AY   GDVY+   K   YG++S++ ++ L  G       E+  +K +P DFALWK  +    + WD  +  GRPGWH ECS +  KYLGD IDIHGGG DL+FPHHENE  Q+ A   K     W+H G + +  + +KMSKSL NF+   D+L E +   +R+F     Y   +N++ ENL  +    ++ +N + N+N         +  +E      K+N    + + ++FN+ N ++ I + +    I+  N N E+ +K    L      ++LL  + GI    L       +DE  +L+ K ++ +++K+++ SD+ R  L E
  S:     4 VKVYNTLTRKKEEFKPLVPGQISMYVCGPTVYNYIHIGNARSSIAFDTIRRYLEYKGYKVKYVSNFTDVDDKMINEAHAEETTVPKLAEKFINAFLEDTTALNIEPATLH-PRATHEIKEIIAFIQTLIDKGYAYESHGDVYYRAKKFKHYGELSDQNIERLEEGASEHINDEEQNRKEDPIDFALWKAQKEPDEIAWDSPWGKGRPGWHIECSVMSTKYLGDTIDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWLHNGFVTVGKDQEKMSKSLHNFVTVHDILKEVDPQVLRFFMASVQYRRQINYSAENLQQAATILDRFKNTLVNINYRLEDDTPSKDSDELAKAIAKTNEKFEVAMDDDFNVQNALTAIYDLL---PIVNANANAEKADKKSLKLFKDKLSAWLL--VFGIDTEKLCSQSAGSNDEIDQLVKKRDEARKKKDWATSDQIRDQLKE 459
>gi|57233567|ref|YP_180814.1| cysteinyl-tRNA synthetase [Dehalococcoides ethenogenes 195] >gi|109894896|sp|Q3ZAD5|SYC_DEHE1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|57224015|gb|AAW39072.1| cysteinyl-tRNA synthetase [Dehalococcoides ethenogenes 195] (458 aa)
Score = 615, Expect = 9.0e-62, Identities = 124/306 (40%), Positives = 178/306 (58%)
  Q:     1 MKIYDFVS-KTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNN-KDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENL 306
           MKIY+ +S K ++ V L+   +KMYVCG T  +  HIG+    I FDV+ R     GY V +I N TDIDDKI+ KA  + I    L+      + D +  +NI  ++  +PR +  +  I   +  ++   +AY   G VY    K   YGK+S++ L++++ G + E   +K  P DFALWK T  G  +W+  +  GRPGWH ECS +  +YLG+QIDIHGGG DL FPHHENE  Q+   +  K   + W+H G L +  +KMSKSL N +  K+ LS Y+ + +R F   +SY NPL ++ E L
  S:     1 MKIYNTLSGKLEEFVPLEDGKVKMYVCGITPQSEPHIGHAMSYINFDVIRRYLSYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAALNITPADY-YPRATQEVPKIIEMVSGLIEKGYAYEAGGSVYLRVQKVEGYGKLSHRTLEQMMAGARIEPGEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQIDIHGGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTIKEALSRYSADALRIFVLSSSYRNPLTYSEEAL 308
>gi|71280239|ref|YP_270455.1| cysteinyl-tRNA synthetase [Colwellia psychrerythraea 34H] >gi|109894893|sp|Q47XL5|SYC_COLP3 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|71145979|gb|AAZ26452.1| cysteinyl-tRNA synthetase [Colwellia psychrerythraea 34H] (469 aa)
Score = 615, Expect = 9.1e-62, Identities = 134/363 (36%), Positives = 210/363 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV--------DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI---IYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE 363
           ++IY+ +S+  +  + ++   + +YVCG TVY+  HIG+ R  I+FD + R     GY+V ++ NITD++DKI+N+A E N     L+            ++N+   +++ PRV+ H+ +I   I+ +V  + AY+          GDV FD +  N YGK+S + L++L  G + E +  KNNP DF LWK    G  +W   +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+    N      WMH G + ++ +KMSKSL NF   +D+L++Y+  TVR+F     Y + LN++T+NL  ++  +E I   + ++NI   ++I       K+  F K     + ++FN P  ++ + E
  S:     2 LQIYNTLSRQKETFTPINAGKVGLYVCGCTVYDLCHIGHGRTYISFDNIARYLRFSGYDVNYVRNITDVEDKIINRANENNETTEALTERTIAAMHQDFDSLNMARPDLE-PRVTTHMNEIIAMIETLVTKEHAYVAGANAASTGQGDVLFDVSSYNDYGKLSGQNLEQLQSGSRVEVDQNKNNPLDFVLWKSAKPGEPSWSSPWGEGRPGWHIECSAMNAKELGHHFDIHGGGSDLTFPHHENEIAQSCCALNTPYVNYWMHTGMVQVDQEKMSKSLGNFFTIRDVLAQYDAETVRFFLTTGHYRSQLNYSTDNLTQARASVERIYTSLRDVNIESDYVI------NKDSSFVKQFCQAMDDDFNTPQALAVLFE 370
>gi|153871051|ref|ZP_02000318.1| Cysteinyl-tRNA synthetase, class Ia [Beggiatoa sp. PS] >gi|152072482|gb|EDN69681.1| Cysteinyl-tRNA synthetase, class Ia [Beggiatoa sp. PS] (463 aa)
Score = 615, Expect = 9.2e-62, Identities = 129/375 (34%), Positives = 208/375 (55%)
  Q:     6 FVSKTDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKS--HLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEEL 380
              + D    ++   +++YVCG TVY++ H+G+ R +I FDV+ R    LGY VT++ NITDIDDKI+ +A E      +L+  +    ++    +N+   +++ PR +  I +I   IQ +++  +AYL D GDV +   +   YG++S K LD+L  G++ E N  K +P DF LWK    G  +W+  +  GRPGWH ECS +    LG+  DIHGGG+DL+FPHHENE  Q+     +    +WMH G + IN++KMSKSL+NF   +++L  Y    VR+F   + Y + LN++ + L  +K  +  +   +    +      +  YN++        L  + ++FN P  ++ +    K  +IL R K  E +
  S:     8 LTKQKDPFTPIEPGKVRLYVCGMTVYDYCHVGHARVMIVFDVVVRYLRSLGYEVTYVRNITDIDDKIIQRANENGEDINQLTDRFIQAMYEDTDALNVIRPDIE-PRATQSIPEIVAMIQSLLDKNYAYLTDNGDVCYAIQRFENYGQLSGKHLDDLRAGERVEVNESKQHPLDFVLWKTAKPGEPSWESPWGAGRPGWHIECSAMSTHCLGNHFDIHGGGMDLQFPHHENEIAQSEGATGETFVNVWMHNGFVRINDEKMSKSLNNFFTVREVLERYQPEVVRYFILTSHYRSELNYSEQELEAAKQSITRLYIAIRDLPNTDEPCPDDSYNQR-------FLTAMNDDFNTPEALAALFSLSKEINILRRKKVSEAI 378
>gi|83719803|ref|YP_442471.1| cysteinyl-tRNA synthetase [Burkholderia thailandensis E264] >gi|167581386|ref|ZP_02374260.1| cysteinyl-tRNA synthetase [Burkholderia thailandensis TXDOH] >gi|167621097|ref|ZP_02389728.1| cysteinyl-tRNA synthetase [Burkholderia thailandensis Bt4] >gi|109894888|sp|Q2SX78|SYC_BURTA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|83653628|gb|ABC37691.1| cysteinyl-tRNA synthetase [Burkholderia thailandensis E264] (465 aa)
Score = 615, Expect = 9.2e-62, Identities = 117/316 (37%), Positives = 187/316 (59%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT----IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENI 316
           ++IY+ +++  ++ V      ++MYVCG TVY++ HIG+ R ++ FD++ R     GY VT++ NITDIDDKI+ +A E       L+  +          + +   +++ PR +D I  +   I+K+  N +AY   DGDV +   K   YGK+S K L++L  G++      K++P DF LWK+       G +W+ K+  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     +     WMH G + ++++KMSKSL NF   +++L +Y+   VR+F  +T Y +PLN++  +L +++  L  +
  S:     4 LRIYNTLARDKQDFVPRQPGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLRAAGYRVTYVRNITDIDDKIIRRALENGETIQSLTRRFIDAMNADFDALGVERPDIE-PRATDFIPQMLGMIEKLEANGYAYQAKDGDVNYSVRKFANYGKLSGKSLEDLRAGERVAAKDAKDDPLDFVLWKRAKPEEPAGASWESKYGAGRPGWHIECSAMGCTLLGEHFDIHGGGQDLQFPHHENEIAQSEGATGQTFVNYWMHNGFVQVDSEKMSKSLGNFFTIREVLEKYDAEVVRFFIVRTHYRSPLNYSDVHLDDARASLTRL 324
>gi|145633713|ref|ZP_01789439.1| cysteinyl-tRNA synthetase [Haemophilus influenzae 3655] >gi|144985473|gb|EDJ92294.1| cysteinyl-tRNA synthetase [Haemophilus influenzae 3655] (459 aa)
Score = 615, Expect = 9.6e-62, Identities = 142/399 (35%), Positives = 224/399 (56%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIH 399
           +KI++ +++ +KE+   + +  + MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +    L+W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +E     + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG++ 
  S:     2 LKIFNTLTR-EKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENELSWASPWGAGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGTDQSAVAFGGENFVETFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDTEKANGLAARLRE-LGAILGLLQ 395
>gi|16082163|ref|NP_394604.1| cysteinyl-tRNA synthetase [Thermoplasma acidophilum DSM 1728] >gi|21264025|sp|Q9HJ27|SYC_THEAC Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|10640458|emb|CAC12272.1| probable cysteinyl-tRNA synthetase [Thermoplasma acidophilum] (452 aa)
Score = 615, Expect = 9.9e-62, Identities = 151/435 (34%), Positives = 248/435 (57%)
  Q:     1 MKIYDFVSK-TDKEVSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLN-WDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVN-NKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-----ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNK----LHFNLSYLLTKILGIIHVNLFDDEAI--ELLNKWNKLKQEKNFSESDKYRKLLME 435
           M+ Y+ +++  D+   ++   I M+VCGPTV +H HIG+ R  I FD + +L   LGY+V ++ NITDIDDKI+NKA+E NI   +++  Y  ++ + +  + + + N  F + + +I +I + I +++   +AY     VYF+ +K   YG++SN+ LD+++ G +   N  K NP+DF LWK+   G   WD  +  GRPGWH E + +   Y G + DIHGGG DL FPHHE E  Q  A++  K L+  W+H G +N+NN+KMSKSL NF+  +++L EY    +R+     +Y   L+F+   L  S+ Q+E   Y  + F+    +       +L  D S +I     E TN+F+  ++     + I ++  L  NKN E +++       ++   +    GI+         I  +LL+    L+ E+ F E+D+ R LL++
  S:     1 MRFYNTLTRDVDEFKEMNSGRINMFVCGPTVQDHFHIGHARTYIFFDAVAKLLRNLGYSVFYLQNITDIDDKIINKAREMNIQPQDVADMYLREFLEDMSALKVTSVNY-FAKSTLYINEIISQISRLIEKGYAYETSDGVYFEVSKFADYGQLSNQSLDQIIHGYRVAVNENKRNPEDFVLWKKRKPGEPYWDSPWGPGRPGWHIEDTAITETYFGPEYDIHGGGSDLIFPHHEAEIAQMRAISGRKYLSHYWIHTGMINVNNEKMSKSLKNFVTIREVLKEYRPEDLRYALLNANYRTQLDFSKGLLEESRKQVE---YLNSTFRK---LVNASGNSDLSADPSAVIKRMVDEATNDFDFRSV---FRDLIDFAGDL--NKNIESISRPAAQKAIDVFRWVDSFAGILLPETARLSGIIDDLLDLRKNLRTERKFQEADRIRDLLLK 437
>gi|154175222|ref|YP_001408206.1| cysteinyl-tRNA synthetase [Campylobacter curvus 525.92] >gi|166200139|sp|A7GYB4|SYC_CAMC5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|112802485|gb|EAT99829.1| cysteinyl-tRNA synthetase [Campylobacter curvus 525.92] (460 aa)
Score = 614, Expect = 1.0e-61, Identities = 157/433 (36%), Positives = 248/433 (57%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGLNW-DLKFSTGRPGWHTECSCLINKYLGD----QIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSS--ILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           M+I+D V K       +      +Y+CGPTVY+  H+G+ +  ++FD+L R+ LELGY V F+ N TDIDDKI+ K  +      E++  Y   Y   +  +N+   ++K P+ +  ++ I NYIQK+V+   AY +   +YFDT K  +Y  +S K  +  L+  + + N +K + +DF LWK       W +  F  GRPGWH+EC  +I +YL +    +IDIH GGIDL FPHHENE  Q     +K LA+ WMH G + +NN+KMSKSL N    KD L       +R++   + Y    N++ E+L  +K +L+  IY L   K  L +     E N  F  S L  L+++ N    ++ ++E +K ++  + L  KN     ++  NL + +T++ G+  ++ F        DDE  +   LL++  + K+E+NFS++D+ RK L
  S:     1 MQIFDSVKKQKVAFEPIKSGKASIYLCGPTVYDDAHLGHAKSAVSFDLLRRVLLELGYEVKFVRNYTDIDDKILKKMSDTGKSLEEITQRYIASYEADMSALNVMQPDIK-PKATQCLEAIINYIQKLVDKGVAYELKDGIYFDTGKDARYFSLSGKDNNTDLIA-RVQSNDEKRDEKDFVLWK---FDDKWYESPFGRGRPGWHSECVAMIKQYLSNDGEYEIDIHAGGIDLLFPHHENEAAQCRCAEHKKLAKYWMHNGFIKVNNEKMSKSLGNSFFVKDALKSVPGEALRFYLIASHYRAHFNYSQEDLFAAKKRLDK-IYRLK--KRVLGVSAGTCEPN--FKASVLEALSDDLNTSKALASVDEFVKSANDGLDLDPKNKALKAQIAANLEF-ITRVFGVGAMDGFEYFQFGVSDDEKAKIKALLDERTQAKKERNFSKADEIRKKL 441
>gi|194099737|ref|YP_002002872.1| CysS [Neisseria gonorrhoeae NCCP11945] >gi|193935027|gb|ACF30851.1| CysS [Neisseria gonorrhoeae NCCP11945] (475 aa)
Score = 614, Expect = 1.1e-61, Identities = 147/437 (33%), Positives = 251/437 (57%)
  Q:     3 IYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKE--ENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLA----------------RIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYL------LTKILGIIHVN-------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           IY+ +++  +  + +D +N++MYVCG TVY++ H+G+ R ++ FD++ R   E GY +T++ NITDIDDKI+ +A E  E IGEL  + + +  + D    + +   +++ P+ +++I  +   I+ ++ N  AY   +GDVY+   +   YG++S K LD+L  G++ E +  K +P DF LWK    G   W+  +  GRPGWH ECS +     GD  DIHGGG DL+FPHHENE  Q++  +                     + W+H G + ++ +KMSKSL NF   +++L +Y+   VR+F  +  Y +PLN++  +L ++K  L  +   L             N    EFD   L E  N +      +  ++     ++ +  +   E+NK   N ++L      L  I+G++  N             L ++E  +L+ +  + + +KN++ESD+ R LL E K++
  S:     6 IYNTLTRQKEPFAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYPLTYVRNITDIDDKIIARAAENGETIGELN-ARFIQAMHEDA-DALGVLRPDIE-PKATENIPQMIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGFKRDPLDFVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIAQSVGASGHTCGHDHAQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQYDPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTRLYTTLK------------NTPAAEFD---LSENANGYTRRFYAAMNDDFGTVEAVAVLFELAGEVNKT--NDAHLAGCLKALGGIIGLLQRNPIEFLQGGAVSDGLSNEEIEDLIARRKQARADKNWAESDRIRDLLNEHKII 462
>gi|37527666|ref|NP_931010.1| cysteinyl-tRNA synthetase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|61216271|sp|Q7N0S5|SYC_PHOLL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|36787101|emb|CAE16176.1| cysteinyl-tRNA synthetase (cysteine--tRNA ligase) (CysRS) [Photorhabdus luminescens subsp. laumondii TTO1] (461 aa)
Score = 614, Expect = 1.1e-61, Identities = 147/435 (33%), Positives = 234/435 (53%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTN-NFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNL-FDDEAI----ELLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    + MYVCG T+Y+  HIG+ R  ++FDV+ R    LGY++T++ N+TD+DDKI+ +A E +    +L+     + +     +NI   +++ PR + HI++I    + ++    AY+ D GDV F       YG +S + L +L  G + E    K NP DF LWK +  G  +W+  +  GRPGWH ECS + +K LG+  DIHGGG DL FPHHENE  Q+   ++      WMH G + ++ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN+T +NL  ++  LE     L         +        E  ++  I+  N +FN P   S + +      ++K   +   N    EL KL   L  L  +    +H  +  DDE I     L+ + N  ++ K++  +D  R  L E
  S:     2 LKIFNTLSRQKEEFKPIHPGKVGMYVCGITIYDLCHIGHGRTFVSFDVVARYLRYLGYDLTYVRNVTDVDDKIIKRAAENSESCDDLTGRMLAEMYKDFDALNILRPDLE-PRATRHIQEIIALTESLIKRGHAYVADNGDVMFSVESDQDYGLLSRQDLSQLQAGARVEVADVKRNPMDFVLWKMSKPGEPSWESPWGAGRPGWHIECSAMNSKQLGNHFDIHGGGADLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMVDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLLSGHYRSQLNYTEDNLKQARTALERFYTALR------GTDASVPPAGGEIFEARFIDAMNDDFNTPEAYSVLFDMVREINRLKSEDMDAANGLAAELRKLAGILGLLQQQPEQFLHRGIQADDEEIAKIEALIKQRNDARKNKDWPLADSARNQLNE 444
>gi|50122074|ref|YP_051241.1| cysteinyl-tRNA synthetase [Pectobacterium atrosepticum SCRI1043] >gi|61216191|sp|Q6D2E4|SYC_ERWCT Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|49612600|emb|CAG76050.1| cysteinyl-RNA synthetase [Erwinia carotovora subsp. atroseptica SCRI1043] (461 aa)
Score = 614, Expect = 1.1e-61, Identities = 146/435 (33%), Positives = 239/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIH----------VNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    + MYVCG TVY+  HIG+ R  + FDV+ R    LGY++ ++ NITDIDDKI+ +A E      +L++    +       +NI   + + PR + HI DI   ++ ++  + AY+  +GDV F    ++ YG +S + LD+L  G + E    K NP DF LWK +  G  +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   ++      WMH G + ++ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ +NL  ++  LE +   L    +   +E    +   EF+      + ++FN P   S + +  +  +  L+ ++ +  N+L   L   L+ +LG++             + DDE  E   L+ +    +  K+++ +D+ R  L E
  S:     2 LKIFNTLSRQKEEFKPIHADQVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRYLGYSLKYVRNITDIDDKIIKRAIENGETSDQLTTRMIAEMHADFDALNILRPDAE-PRATHHIADIIEMVETLITRRHAYVASNGDVMFSVDTASGYGVLSRQDLDQLRAGARVEITEVKRNPMDFVLWKMSKPGEPHWSSPWGEGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHDGPYVNYWMHSGMVMVDREKMSKSLNNFFTVRDVLAYYDPETVRYFLMSGHYRSQLNYSEDNLKQARAALERLYIALR--GTDPSVEAHGGD---EFEARFHDAMDDDFNTPEAYSVLFDMAREVN-RLKAEDVQAANQLASTLRK-LSGVLGLLEQDPEQFLQNGAQVNDDEVKEIEALIQQRKDARATKDWALADQARDRLNE 444
>gi|59712207|ref|YP_204983.1| cysteinyl-tRNA synthetase [Vibrio fischeri ES114] >gi|71657967|sp|Q5E4F1|SYC_VIBF1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|59480308|gb|AAW86095.1| cysteinyl-tRNA synthetase [Vibrio fischeri ES114] (461 aa)
Score = 614, Expect = 1.2e-61, Identities = 138/398 (34%), Positives = 225/398 (56%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKS--EDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII 398
           +KIY+ +++  +E   + +  + MYVCG T+Y+  HIG+ R  ++FDV++R    LGY++TF+ NITDIDDKI+ +A E       L+             +N+   +++ PR +++IK+I   +++++   FAY+  +GDV F+  K ++YG +S + L++L  G +   E+   K +  DF LWK +  G   W+  +  GRPGWH ECS + +  LGD  DIHGGG DL FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L+ Y++ TVR+F     Y + LN++ ENL  ++  LE +  +L      L +     E   EF       + ++FN P   S + E  +  +  L+ +N +  +KL   L   L  +LG++
  S:     2 LKIYNSLTRQKEEFKPITEGKVGMYVCGVTIYDLCHIGHGRTFVSFDVISRYLRFLGYDLTFVRNITDIDDKIIKRAAENGETCDALTERLIADMHADFDALNMKRPDVE-PRATEYIKEIIALVERLIERGFAYVASNGDVMFEVKKYDEYGCLSRQDLEQLQAGSRVTLEEASVKRSGMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSSILGDHFDIHGGGSDLMFPHHENEIAQSCCAHDTPYVNTWMHSGMVMVDREKMSKSLGNFFTIRDVLAHYDSETVRYFLMSGHYRSQLNYSEENLNQARASLERLYTSLRGLD--LSVTPAGGE---EFVGRFSTAMNDDFNTPEAYSVLFEMAREVN-RLKTENIDTASKLG-ALMRELADVLGLL 396
>gi|77958384|ref|ZP_00822418.1| COG0215: Cysteinyl-tRNA synthetase [Yersinia bercovieri ATCC 43970] (480 aa)
Score = 614, Expect = 1.2e-61, Identities = 136/390 (34%), Positives = 213/390 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYL 390
           +KI++ +S+  +E   +    I MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E +    +L++    +       +N+   +++ PR + HI +I   +++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G  +W+  +  GRPGWH ECS + +K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + +      ++K   I   N    EL KL   L  L
  S:    21 LKIFNTLSRQKEEFKPIHAGKIGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRAIENSETCEQLTTRMLAEMHKDFDALNLERPDLE-PRATHHIPEIIELVERLIARDHAYVASNGDVMFAVDSDPDYGLLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPSWESPWGAGRPGWHIECSAMNSKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDAN-----AAPAGGAEFEARFRAAMDDDFNTPEAYSVLFDIAREVNRLKTEDIAAANGLAAELRKLAHVLGLL 413
>gi|149376716|ref|ZP_01894474.1| cysteinyl-tRNA synthetase [Marinobacter algicola DG893] >gi|149358955|gb|EDM47421.1| cysteinyl-tRNA synthetase [Marinobacter algicola DG893] (436 aa)
Score = 614, Expect = 1.2e-61, Identities = 139/417 (33%), Positives = 228/417 (54%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTI--NIHTSNMKF--------PRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG-LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL-NIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN------------LFDDEAIELLNKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           MYVCG TVY++ H+G+ R ++ FDV+ R     GY+V ++ NITDIDDKI+ +A E   GE+         Y D+ + +   +H    K         P  +D+I DI   I K+V+   AY  D GDVYF     + YGK+S KKL++L+ G + +    K +P DF LWK    G ++W   +  GRPGWH ECS + N+ LG+  DIHGGG DL FPHHENE  Q+   N       WMH G + +N +KMSKSL NF   +++  +Y    VR+F   + Y + ++++ +NL  +   L  + + L  +  +  + E +++++  E        + ++FN     + +       ++  R    E+ N+    +   L  +LG++  +            L  D+   ++      +++K+F+E+D+ R  L +K ++
  S:     1 MYVCGMTVYDYCHLGHARVLVAFDVITRYLRHSGYDVHYVRNITDIDDKILRRADEN--GEV---------YSDLTQRMIKAMHEDEAKLGVLSPTEEPCATDYINDIVAMIHKLVSGGHAYAADNGDVYFSVESYSDYGKLSKKKLEDLVAGARVDVQEAKRSPADFVLWKAAKEGEVSWPSPWGDGRPGWHIECSAMSNRCLGETFDIHGGGPDLLFPHHENEIAQSECANGHTFVNTWMHAGAIRVNKEKMSKSLGNFFTIREIFEKYAPEVVRYFLVSSHYRSQVDYSEDNLAEAGRTLTRLYHALRGLVPAKNVAETEHDQRFAE-------AMDDDFNTAGATAVLHAVANEINLHRREGRDEKANE-QAAVLVRLGGVLGLLQQDPEAFFQADTGGELSADDIAAMIQARADARKQKDFAEADRIRDELADKGVI 423
>gi|46133695|ref|ZP_00157587.2| COG0215: Cysteinyl-tRNA synthetase [Haemophilus influenzae R2866] (435 aa)
Score = 614, Expect = 1.2e-61, Identities = 146/411 (35%), Positives = 225/411 (54%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +E     + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K++  +D  R  L
  S:     1 MYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWASPWGAGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGADQSAVVFGGENFVETFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDVEKANGLAARLRE-LGAILGLLQQDPEKFLQAGSNDDEVAKIEALIKQRNEARAAKDWPAADAARNEL 416
>gi|58699028|ref|ZP_00373873.1| cysteinyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534456|gb|EAL58610.1| cysteinyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila ananassae] (468 aa)
Score = 614, Expect = 1.3e-61, Identities = 157/435 (36%), Positives = 243/435 (55%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTT-----IGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQN-IAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLL-SEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLT-KILGIIH--------VNLFDDEAIELLNKWNKLKQEKNFSESDKYRKLLME 435
           +++Y+ ++K  +  + +DK ++KMYVCGPTVY+  HIGN R ++ +DVL +L       VT++ NITDIDDKI+N A E+N     +++YY   + D +++IN      + P+ ++++  I   I+ ++ +  AY  D  VYF+    ++YG +S KK DEL+ G + E N  K +P DF LWK        +   W+  +  GRPGWH ECS +   YLG   DIHGGGIDL+FPHHENE  Q+  A      A+ WMH G L +N +KMSKSL N +  +DLL S      +R+   +T Y  PL++ TEN+I+   +  N  Y L    S  +     +E N E  K  +  L N+ N+P  ++ + E          NK   E  KL    S++ + + +G++           +   E   L++     KQ K+++ +DK R  L +
  S:    13 VRLYNTLTKKKELFIPIDKDHVKMYVCGPTVYDTAHIGNARSVVVYDVLFQLLKFCYGKVTYVRNITDIDDKIINAASEKNSNIESITTYYIKAFHDDMESINCKKPTYE-PKATENVDYIIKLIEHLLQSGHAYESDKHVYFNIESYHEYGALSGKKTDELVPGSRVEVNENKKHPGDFVLWKPANDIDYKLSSYWNSPWGEGRPGWHIECSAMSYAYLGKDFDIHGGGIDLQFPHHENEIAQSKSAFAGSMFAKYWMHNGFLTVNEEKMSKSLFNIVKVRDLLDSGIKGEVIRYALLKTHYRKPLDW-TENVISDAQETLNKFYRL----SRGLDTINIDESNAEISKDFIDALKNDLNIPEALAILHEMAAKI-----NKMSNESEKLKLTESFVKSARFIGLLESSYQEWFTAGVSHQEIERLIDLRRAAKQNKDYNTADKIRDQLKQ 453
>gi|157962505|ref|YP_001502539.1| cysteinyl-tRNA synthetase [Shewanella pealeana ATCC 700345] >gi|187631637|sp|A8H617|SYC_SHEPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|157847505|gb|ABV88004.1| cysteinyl-tRNA synthetase [Shewanella pealeana ATCC 700345] (459 aa)
Score = 614, Expect = 1.3e-61, Identities = 146/430 (33%), Positives = 242/430 (56%)
  Q:     1 MKIYDFVSKTDKE-VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGII--HVNLF------DDEAIE---LLNKWNKLKQEKNFSESDKYR 430
           +K+Y+ +++  ++ V L    + MYVCG T+Y+  HIG+ R  ++FD++ R     GY+V F  NITD+DDKI+ +A E       L+     +       +N+   + + PR + H+ +I   ++K++  + AY+  +GDV F  +   +YG++S + L++L  G + E    K +P DF LWK +  G   W+  +  GRPGWH ECS + +K+LG+  DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL+NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +K+ LE I   L      L +E    E+ +   KS    + ++FN P   S + + ++  +  L+  +  + + L   L   L  +LGI+   V+ F      DDE  E   L+ + N+ + EK++  +D  R
  S:     2 LKLYNSLTRQKEQFVPLQPGKVGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYSGYDVNFQRNITDVDDKIIKRANENKESCDSLTERLIAEMHRDFDALNMARPDNE-PRATLHMPEIIEMVEKLIEREHAYVASNGDVLFSVSSFPEYGRLSGQNLEQLQAGARVEVEDAKRDPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDKEKMSKSLNNFFTIRDVLGHYDATTVRYFLLSGHYRSQLNYSEDNLKQAKSGLERIYTALKDLD--LTVEAAPAEEFVAKFKS---AMDDDFNTPEAYSVLFDMVREIN-RLKATDMAKASALGVALKQ-LADVLGILGQDVDTFFKGEGNDDEVAEIEALIVERNRARAEKDWPAADVAR 437
>gi|113970833|ref|YP_734626.1| cysteinyl-tRNA synthetase [Shewanella sp. MR-4] >gi|123029526|sp|Q0HH98|SYC_SHESM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|113885517|gb|ABI39569.1| cysteinyl-tRNA synthetase [Shewanella sp. MR-4] (461 aa)
Score = 614, Expect = 1.3e-61, Identities = 150/435 (34%), Positives = 237/435 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEEN----------IGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHV--NLF------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    + MYVCG TVY+  HIG+ R  ++FD++ R     GY V F  NITDIDDKI+ +A E            IGE+        + FD L  I         PR + HI +I + +++++    AY+  DGDV F      +YG++S + L++L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + +N++ ENL  ++  LE +   +      L +     E   EF       + ++FN P   S + + ++  +  L+  +  + + +   +   L  +LG++H   + F      DDE  E   L+ + N+ + EK++  +D  R  L E
  S:     4 LKIYNSITRQKQEFKPITPGKVGMYVCGVTVYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDIDDKIIKRANENQEDCNTLTDRLIGEMH-------KDFDALNMIRPDFE----PRATLHITEIIDMVERLLARGHAYVAADGDVLFSVASFPEYGRLSGQNLEQLQAGARVEVDDNKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLGHYDPETVRYFLLSGHYRSQINYSEENLKQARAALERLYTAIK--DVDLTVAPAPAE---EFVAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKTTDMAQASAMAVAMKQ-LADVLGLLHQAPDAFFKGEGSDDEVAEIEALIVERNRARVEKDWPAADVARNRLNE 444
>gi|53732614|ref|ZP_00154808.2| COG0215: Cysteinyl-tRNA synthetase [Haemophilus influenzae R2846] (435 aa)
Score = 613, Expect = 1.3e-61, Identities = 146/411 (35%), Positives = 225/411 (54%)
  Q:    23 MYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIE-----LTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           MYVCG TVY+  HIG+ R  + FDV+ R    LGY++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   +  GRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N  E     + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K+++ +D  R  L
  S:     1 MYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWPSPWGAGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGTDQSAVVFGGENFAETFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDVEKANGLAVRLRE-LGAILGLLQQDPEKFLQAGSNDDEVAKIEALIKQRNEARAAKDWATADAARNEL 416
>gi|153807261|ref|ZP_01959929.1| hypothetical protein BACCAC_01539 [Bacteroides caccae ATCC 43185] >gi|149130381|gb|EDM21591.1| hypothetical protein BACCAC_01539 [Bacteroides caccae ATCC 43185] (493 aa)
Score = 613, Expect = 1.4e-61, Identities = 133/304 (43%), Positives = 186/304 (61%)
  Q:    14 VSLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDI----------DDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVDGDVYFDTTKSNQ---YGKISNKKLDELLVGDKSED-NLKKNNPQDFALWK--QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILA--------KDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENII 317
           V L   ++ MYVCGPTVY   H+G+ RP ITFDVL R    LGY V ++ NITD+          +DKI  KA+ E +  +E+  YY  +Y   ++ +N+ + +++ P  S HI +    +QKI++  +AY  +G VYFD  K N+   YGK+S + LD++L   +  D   +K NP DFALWK  Q    + W   +S G PGWH EC+ +  KYLG+  DIHGGG+DL FPHHE E  Q++A    D+   WMH   + IN  KM KSL NFI          K L   Y   T+R+F  Q  Y + ++F+ E LI S+  L+ +I
  S:    19 VPLHAPHVGMYVCGPTVYGDAHLGHARPAITFDVLFRYLTHLGYKVRYVRNITDVGHLEHDADEGEDKIAKKARLEELEPMEVVQYYLNRYHKAMEALNVLSPSIE-PHASGHIIEQIQLVQKILDAGYAYESEGSVYFDVAKYNKDHHYGKLSGRNLDDVLNTTRDLDGQSEKRNPADFALWKKAQPEHIMRWPSPWSDGFPGWHAECTAMGRKYLGEHFDIHGGGMDLIFPHHECEIAQSVASQGDDMVHYWMHNNMITINGTKMGKSLGNFITLDEFFNGTHKLLTQAYTPMTIRFFILQAHYRSTVDFSNEALIASEKGLQRLI 345
>gi|77979327|ref|ZP_00834746.1| COG0215: Cysteinyl-tRNA synthetase [Yersinia intermedia ATCC 29909] (461 aa)
Score = 613, Expect = 1.4e-61, Identities = 149/435 (34%), Positives = 234/435 (53%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEE------KIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN--LF--------DDEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KI++ +S+  +E   +    I MYVCG T+Y+  HIG+ R  + FDV+ R    LGY++T++ N+TD+DDKI+ +A E N    +L++    +       +N+   +++ PR + HI +I    ++++    AY+  +GDV F       YG +S + LD+L  G + E    K NP DF LWK +  G  +W   +  GRPGWH ECS +  K LG   DIHGGG DL FPHHENE  Q+   ++      WMH G + I+ +KMSKSL+NF   +D+L+ Y+  TVR+F     Y + LN++ ENL  ++  LE +   L    ++            EF+      + ++FN P   S + +      ++K   I   N    EL K        L  +LG++  +  LF        DDE  +   L+ + N  +  K+++ +D  R  L E
  S:     2 LKIFNTLSRQKEEFKPIHAGKIGMYVCGITIYDLCHIGHGRTFVAFDVVARYLRYLGYSLTYVRNVTDVDDKIIKRALENNESCEQLTTRMLAEMHKDFDALNLKRPDLE-PRATHHIPEIIALTERLIARDHAYVASNGDVMFAVDSDPDYGLLSRQDLDQLQAGARVEVADVKRNPMDFVLWKMSKPGEPSWASPWGPGRPGWHIECSAMNGKQLGAHFDIHGGGSDLMFPHHENEIAQSTCAHDGPYVNYWMHSGMVMIDKEKMSKSLNNFFTIRDVLAYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDANAT-----PAGGAEFEARFRAAMDDDFNTPEAYSALFDIAREVNRLKTEDITAANGLAAELRK--------LAHVLGLLEQDPELFLQSGAQTNDDEVAKIEALIKQRNDARSSKDWALADSARDQLNE 444
>gi|145636711|ref|ZP_01792377.1| cysteinyl-tRNA synthetase [Haemophilus influenzae PittHH] >gi|145270009|gb|EDK09946.1| cysteinyl-tRNA synthetase [Haemophilus influenzae PittHH] (459 aa)
Score = 613, Expect = 1.5e-61, Identities = 150/433 (34%), Positives = 240/433 (55%)
  Q:     1 MKIYDFVSKTDKEV--SLDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLVD-GDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLI-----ELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGI--------IHVNLFDDEAIE---LLNKWNKLKQEKNFSESDKYRKLL 433
           +KI++ +++ +KE+   + +  + MYVCG TVY+  HIG+ R  + FDV+ R    L Y++T++ NITD+DDKI+ +A E      +L      + +     +N+   + + PR + HI +I   ++K++    AY+ D GDV FD     +YGK+S + L++L  G + E N  K NP DF LWK +     +W   + TGRPGWH ECS +  K LG+  DIHGGG DL FPHHENE  Q+   +       W+H G + ++ +KMSKSL NF   +D+L+ YN   VR+F     Y + LN++ ENL  ++  LE +   L          +  ++  + F   N +      + ++FN PN +S + E  +  +  L+ ++ E+ N L   L   L  ILG+        +     DDE  +   L+ + N+ +  K++S +D  R  L
  S:     2 LKIFNTLTR-EKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRSLDYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALNVLRPDFE-PRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQLQAGARIEINEIKKNPMDFVLWKMSKENEPSWSSPWGTGRPGWHIECSAMNCKQLGEHFDIHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVLNHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTAL----------RGTDQSAVAFGGENFVATFREAMDDDFNTPNALSVLFEMAREIN-KLKTEDVEKANGLAARLRE-LGAILGLLQQEPEKFLQAGSDDDEVAKIEALIKQRNEARVAKDWSAADSARNEL 440
>gi|121593996|ref|YP_985892.1| cysteinyl-tRNA synthetase [Acidovorax sp. JS42] >gi|187629817|sp|A1W6E1|SYC_ACISJ Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|120606076|gb|ABM41816.1| cysteinyl-tRNA synthetase [Acidovorax sp. JS42] (458 aa)
Score = 613, Expect = 1.5e-61, Identities = 125/322 (38%), Positives = 188/322 (58%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWK----QTTIGLNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNI 322
           ++IY+ +S+  +E S L+  +++MYVCG TVY+  H+G+ R +I FDV+ R     G  VT++ NITDIDDKI+ +A E       L+             + I     + PR + ++  + + I  +     AY   +GDV +   K   YGK+S K LDEL  G++      K++P DF LWK    +    + W   F  GRPGWH ECS +    LG+  DIHGGG DL+FPHHENE  Q+     K  AR+WMH G +N++N+KMSKSL NF   +D+L EY+  TVR+F  ++ Y +PLN++  +L +++  L+ +   L++
  S:     3 LRIYNTLSRALEEFSPLEPGHVRMYVCGMTVYDLCHLGHARSMIAFDVVQRWLRASGLAVTYVRNITDIDDKIIKRAVENGETIRSLTDRMIDALHQDADALGIERPTHE-PRATAYVPQMLDMIGTLQGKGLAYQAGNGDVNYAVRKFPGYGKLSGKSLDELNAGERVAVQDGKHDPLDFVLWKSAKPEEPADVKWRSPFGEGRPGWHIECSAMGCALLGESFDIHGGGADLQFPHHENEIAQSEGATGKPFARLWMHNGFINVDNEKMSKSLGNFFTIRDVLKEYDAETVRFFVVRSHYRSPLNYSNVHLDDARAALKRLYTALSL 329
>gi|126173835|ref|YP_001049984.1| cysteinyl-tRNA synthetase [Shewanella baltica OS155] >gi|187631633|sp|A3D302|SYC_SHEB5 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|125997040|gb|ABN61115.1| cysteinyl-tRNA synthetase [Shewanella baltica OS155] (459 aa)
Score = 613, Expect = 1.6e-61, Identities = 146/435 (33%), Positives = 234/435 (53%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYLV-DGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIGL-NWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFIEEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVN---LFD-----DEAIE---LLNKWNKLKQEKNFSESDKYRKLLME 435
           +KIY+ +++  +E   +    I MYVCG T+Y+  HIG+ R  ++FD++ R     GY V F  NITD+DDKI+ +A E N     L+     +       +N+   + + PR + HI +I + ++ ++    AY+  DGDV F       YG++S + LD+L  G + E +  K NP DF LWK +  G   W+  +  GRPGWH ECS + +K+LG   DIHGGG DL+FPHHENE  Q+   ++      WMH G + ++ +KMSKSL NF   +D+L  Y+  TVR+F     Y + LN++ +NL  +++ LE +   +      L +     E   EF       + ++FN P   S + + ++  +  L+  +  + + L   L   L  +LG++       F      DE  E   L+ + N+ + EK+++ +D  R  L E
  S:     2 LKIYNSITRQKQEFKPITPGKIGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYAGYEVNFQRNITDVDDKIIKRANENNESCEALTERLIGEMHQDFDALNMLRPDFE-PRATLHIAEIIDMVELLLARGHAYVASDGDVLFSVASYPDYGRLSGQNLDQLQAGARVEVDETKQNPMDFVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIAQSCCAHDTPYVNYWMHTGMVMVDREKMSKSLGNFFTIRDVLGHYDAETVRYFLLSGHYRSQLNYSEDNLKQARSALERLYTAIK--DVDLTVAAAPAE---EFVAKFKAAMDDDFNTPEAYSVLFDMVREIN-RLKLTDMAQASALAVTLKQ-LADVLGLLSQEPEAFFQGGGSYDEVAEIEALIVERNRARTEKDWAAADVARNCLNE 442
>gi|160897948|ref|YP_001563530.1| cysteinyl-tRNA synthetase [Delftia acidovorans SPH-1] >gi|160363532|gb|ABX35145.1| cysteinyl-tRNA synthetase [Delftia acidovorans SPH-1] (461 aa)
Score = 613, Expect = 1.6e-61, Identities = 121/322 (37%), Positives = 190/322 (59%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAYL-VDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNLNI 322
           ++IY+ +S+  +  S ++  +++MYVCG TVY+  H+G+ R ++ FDV+ R     G+ VT++ NITDIDDKI+ +A E       L+             + I     + PR ++++  + + I ++ +   AY   DGDV F   K   YGK+S K LDEL  G++      K +P DF LWK         + W   +  GRPGWH ECS +  + LG+  DIHGGG DL+FPHHENE  Q+     K  +++WMH G +N++N+KMSKSL NF   +D+L EY+  TVR+F  ++ Y +PLN++  +L +++  L+ +   L++
  S:     3 LRIYNTLSRALEAFSPIEPGHVRMYVCGMTVYDLCHLGHARSMVAFDVVQRWLRASGHRVTYVRNITDIDDKIIRRAVENGETIRSLTDRMIDALHQDADALGIERPTHE-PRATEYVPQMLSMIGRLQDKGLAYQGTDGDVNFAVRKFPGYGKLSGKSLDELQAGERVAVQDGKQDPLDFVLWKSAKPAEPEEVKWASPWGVGRPGWHIECSAMGCEMLGESFDIHGGGADLQFPHHENEIAQSEGATGKPFSQVWMHNGFINVDNEKMSKSLGNFFTIRDVLKEYDAETVRFFVVRSHYRSPLNYSDVHLNDARGALKRLYTALSL 329
>gi|134094511|ref|YP_001099586.1| cysteine tRNA synthetase [Herminiimonas arsenicoxydans] >gi|166200149|sp|A4G4M2|SYC_HERAR Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) >gi|133738414|emb|CAL61459.1| Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) [Herminiimonas arsenicoxydans] (462 aa)
Score = 613, Expect = 1.7e-61, Identities = 143/439 (32%), Positives = 241/439 (54%)
  Q:     1 MKIYDFVSKTDKEVS-LDKKNIKMYVCGPTVYNHVHIGNLRPIITFDVLNRLFLELGYNVTFIHNITDIDDKIVNKAKEENIGELELSSYYETQYFDILKTINIHTSNMKFPRVSDHIKDIENYIQKIVNNKFAY-LVDGDVYFDTTKSNQYGKISNKKLDELLVGDKSEDNLKKNNPQDFALWKQTTIG----LNWDLKFSTGRPGWHTECSCLINKYLGDQIDIHGGGIDLKFPHHENENIQNIAVNNKDLARIWMHVGHLNINNQKMSKSLSNFILAKDLLSEYNTNTVRWFFYQTSYSNPLNFTTENLINSKNQLENIIYNL-NIFKSHLIIEQKYNEKNLEFDKSNLIELTNNFNLPNIVSFI-----EEKIKYSSILLRNKNFEELNKLHFNLSYLLTKILGIIHVNLFDDEAIELL-----NKWNKLKQEKNFSESDKYRKLLMEKKLL 439
           +KIY+ +++  +  + +D   ++MYVCG TVY++ HIG+ R ++ FD++ R     G++VT++ NITDIDDKI+ +A E      +L+  +     +    + +   + + PR ++++  +   I  +  N  AY   DGDV +       YGK+S K LD+L  G++ + N  K++P DF LWK +       + W  K+ +GRPGWH ECS +  + LG+Q DIHGGG DL+FPHHENE  Q+   +       WMH G + ++N+KMSKSL NF   +++L +++   VR+F  +  Y + LN++  +L +++N L  +   L ++   HL ++          D  N     ++FN P  ++ +     E   + S +L R     +L  L   +  L       +H  L   + +E L