>gi|26553675|ref|NP_757609.1| hypothetical protein MYPE2220 [Mycoplasma penetrans HF-2] >gi|26453681|dbj|BAC44013.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (739 aa)
Score = 3093, Expect = 0.0e+00, Identities = 739/739 (100%), Positives = 739/739 (100%)
  Q:     1 MDKIQIIFNKYKLIYKDLSFYTKNKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNILIKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLSTSYHEVFKVFVYDNYNKKRFFNLRNKNEVEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVKNKSYFYIKNEMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLKVSFEEGLAGFVYTLIHLTKTFKSWDLKNDIKEMTNIILFSKVSINRKIKFIDMYKSLKNDLCGTLGIYLYLKEFIEYNKNN 739
           MDKIQIIFNKYKLIYKDLSFYTKNKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNILIKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLSTSYHEVFKVFVYDNYNKKRFFNLRNKNEVEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVKNKSYFYIKNEMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLKVSFEEGLAGFVYTLIHLTKTFKSWDLKNDIKEMTNIILFSKVSINRKIKFIDMYKSLKNDLCGTLGIYLYLKEFIEYNKNN
  S:     1 MDKIQIIFNKYKLIYKDLSFYTKNKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNILIKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLSTSYHEVFKVFVYDNYNKKRFFNLRNKNEVEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVKNKSYFYIKNEMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLKVSFEEGLAGFVYTLIHLTKTFKSWDLKNDIKEMTNIILFSKVSINRKIKFIDMYKSLKNDLCGTLGIYLYLKEFIEYNKNN 739
>gi|166982882|ref|ZP_02254307.1| hypothetical protein BcerAH_11508 [Bacillus cereus AH187] (838 aa)
Score = 438, Expect = 5.0e-41, Identities = 155/443 (34%), Positives = 220/443 (49%)
  Q:    24 NKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFK------SDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKN-VLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIH--DNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEV 466
           N FT  +  L   LP QGWKIH+S   DNYQ IL+I  +YC    I FK+I N       L+K  NR S GK+ITIY  DE       ++LYD+LK F GP +LTDK + ++  I+YRYG          DY+     E I D ++     P+F+  P +E+        S  +L+ +      AI  +N GGIY+AY    + +VVL KE RPY+GI+    S     NE   L     S  TP II+ F E  H ++  E+I+G+   D+            +K  ++   K +  I I+ILK       S  ++ DI   N + +  N    FIDLE     D    FN       N  +   ++L  KN  ++KL  L + +   SN  LYL ++   T   F  FA  Y++P I VE+IN +  SK     LE++  LK ++ DN +V
  S:    33 NFFTQFDLSL-KPLPRQGWKIHISCYYDNYQDILNIVSDYCFRNKITFKYINNTNILFSLLEKSANRFSAGKYITIYPDDEKSFKYILESLYDELKLFNGPYILTDKRYLDAKVIYYRYGLINPQSDSYQDYLIGPDGETIKDLKDCYYFQPDFVTPPFSEELIQEPKYLSKKYLVES------AININNSGGIYIAYAKEMHKKVVL-KEARPYVGISEELTSIYFRKNEKRNLGILASSPYTPNIIDEFWEWEHYYIALEYIEGINFSDYAASAGPAVMHKENKQELIHCYKKIKEIFINILKAVIEFHKSEIVLGDISSDNIIVN--NTSITFIDLEDAQLIDKKPQFNAKTVGFYNEGI---DELSLKNQDKQKLGYLFLNMFSNSNKLLYLDRTGGMTDRIFQSFAIEYQVPKIFVEIINLLIKSKNI--ELEYV--LKLLENDNLKV 468
>gi|168162630|ref|ZP_02597863.1| hypothetical protein BcerH_21213 [Bacillus cereus H3081.97] (701 aa)
Score = 434, Expect = 1.6e-40, Identities = 155/443 (34%), Positives = 220/443 (49%)
  Q:    24 NKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFK------SDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKN-VLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIH--DNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEV 466
           N FT  +  L   LP QGWKIH+S   DNYQ IL+I  +YC    I FK+I N       L+K  NR S GK+ITIY  DE       ++LYD+LK F GP +LTDK + ++  I+YRYG          DY+     E I D ++     P+F+  P +E+        S  +L+ +      AI  +N GGIY+AY    + +VVL KE RPY+GI+    S     NE   L     S  TP II+ F E  H ++  E+I+G+   D+            +K  ++   K +  I I+ILK       S  ++ DI   N + +  N    FIDLE     D    FN       N  +   ++L  KN  ++KL  L + +   SN  LYL ++   T   F  FA  Y++P I VE+IN +  SK     LE++  LK ++ DN +V
  S:    33 NFFTQFDLSL-KPLPRQGWKIHISCYYDNYQDILNIVSDYCFRNKITFKYINNTNILFSLLEKSANRFSAGKYITIYPDDEKSFKYILESLYDELKLFNGPYILTDKRYLDAKVIYYRYGLINPQSDSYQDYLIGPDGETIKDLKDCYYFQPDFVTPPFSEELIQEPKYLSKKYLVES------AININNSGGIYIAYAKEMHKKVVL-KEARPYVGISEELTSIYFRKNEKRNLGILASSPYTPNIIDEFWEWEHYYIALEYIEGINFSDYAASAGPAVMHKENKQELIHCYKKIKEIFINILKAVIEFHKSEIVLGDISSDNIIVN--NTSITFIDLEDAQLIDKKPQFNAKTVGFYNEGI---DELSLKNQDKQKLGYLFLNMFSNSNKLLYLDRTGGMTDRIFQSFAIEYQVPKIFVEIINLLIKSKNI--ELEYV--LKLLENDNLKV 468
>gi|75758357|ref|ZP_00738481.1| Serine/threonine protein kinase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494219|gb|EAO57311.1| Serine/threonine protein kinase [Bacillus thuringiensis serovar israelensis ATCC 35646] (867 aa)
Score = 350, Expect = 1.0e-30, Identities = 95/267 (35%), Positives = 156/267 (58%)
  Q:    26 FTYVNYKLIDS------------LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFK-GPSVLTDKSFKNSCIHYRYGGFKSDYIY----------NERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINS-FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYEN 292
           + + NY LID             LP QGWKIHVS+ +   QQ LDI     + +NI FK++ ++   +    K+ +R S+GKFITIY ++  + ID  + L + L   K GP +L DK + NS +++RYG F S Y+Y          N   E I DKR    + PNF+++P+  ++ + + +        + +DI +A++FSN GG+Y+  +  NN +V+L KE RP+  +++   ++    +NE E L    ++    K I SF    H F+  E+I+G +L ++  +N
  S:    30 YPFDNYILIDGEHWTNLMPKNARLPKQGWKIHVSTDIRESQQTLDIVSKLMIERNISFKYVRSNKELVLKDSKYGDRGSSGKFITIYPENTYQFIDLLRLLENNLAHLKPGPYILNDKRWYNSNVYFRYGAFMSRYVYIDGEKVDAIENLEGELIEDKRVPYYYLPNFVEEPIEIRKMDEELNQVDTSSPLDNFDINEALHFSNGGGVYICKNKSNNMKVIL-KEGRPHAAVDAQGQDAFSRIVNESEILDKLEKAQYPVKKISSFRAWEHYFIEEEYIEGDSLSEWLVKN 319
>gi|115374396|ref|ZP_01461679.1| membrane translocator [Stigmatella aurantiaca DW4/3-1] >gi|115368598|gb|EAU67550.1| membrane translocator [Stigmatella aurantiaca DW4/3-1] (928 aa)
Score = 326, Expect = 5.0e-28, Identities = 115/416 (27%), Positives = 196/416 (47%)
  Q:    35 DSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKSDYIYNERNEK-----------ILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGIN--SFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDF--FYENSLLYF-EPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFN------KNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPL 450
           D  P++G+KIH S+  +N QQ+L   +   + + + FKF+ ++     T +    R   GKFIT Y  D  +L    + L++  +D  GP +L+D+ +K+S  + YRYG FK+ ++ N   E+           + D+R+     P  ++DP  ++   +    S   +L  +Y +  A+  S  GG+Y   DL    +VV IKE RP +  N  S  ++     NE   L     +   P+ I  F E  H F+V +++ G+ L     F + SL+   +  D++V +  +  + I   ++       +   ++ D+   N LFD +  K  FID ES        +      + + F +++W   N +  +    QK L  L+  LI      L LA    + F R    A    LP  L+ L+     S   +D L
  S:   110 DKTPDEGFKIHASTKHENAQQLLRAAVPLFVEEGVAFKFVVDEDILDFTNESARGRGGCGKFITAYPVDVPQLRRLMERLHEATRDLTGPYILSDQRYKDSKTLFYRYGSFKNRFLLNVFGEQEPYMRAPDGSLVPDERQAYFVLPEGVEDPFPQEPEED----SGELILQGRYKVTSALSMSAKGGVYAGEDLQTGAQVV-IKEARPLINRNRRSPHDAVACLHNEYRILSLLAGTGVAPQPIAFFQEWEHSFLVMDYVKGVPLSSLRAFEDFSLMLMTDIRDEDVQRFAQEYLQIARQLILGVRAIHAQGVVIQDVAPQNILFDLEQAKVTFIDFESAWSERLGEHAVVAPIRTLGFGDHQW---NGQRPTMEEDQKALGRLLSNLIFPITPLLSLAPGHWEPFLR--ALAQEKGLPAPLLSLVLGTTGSAAEVDRL 538
>gi|116628610|ref|YP_821229.1| hypothetical protein STER_1920 [Streptococcus thermophilus LMD-9] >gi|116101887|gb|ABJ67033.1| Serine/threonine protein kinase [Streptococcus thermophilus LMD-9] (719 aa)
Score = 315, Expect = 9.6e-27, Identities = 192/674 (28%), Positives = 303/674 (44%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKSDYIYNERNEKIL------DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPT------DKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQK-------KLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEV--FVNKNNDIKLYLQFNKETLEEI--KNNILIKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLSTSYHEVFKVFVYDNYNKKRFFN------LRNKNEVEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVKNKSYFYIKNEMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLKVSFEEGLAGFVYTLIHLTKTFKSWD-LKNDIKEMTNIILFSKVSINRKIKFID 710
           +P QGWKIH+S+ L +YQ ILD   + C      FK+I   +   + L KH ++   GKFITIY K++   +   + LYDK+  + G  +LTD+S+K+S  I YRYG   +  I NER +         D  E    CP F++D +    N   D ++   L H++Y +   I+ S  G +Y+A D  N  +V+ IKE R  + I     +  L LNE   LK        P  IE FT E +L++V E IDG  L     E +LL    +      +K V K+I NL L +  I +          ++ DI  SN L    + + +FIDLE+ ++ N+             +   N+   KN+ QK       K+   +I+L+  S + L    +   T   FY  +    LP  L +               +FI++   +D+ N  +  F+    +I+  ++  ++  E I   N   I   T+   + N K +    L+ + D          + S  ++  + + DN N + F N      L N +  ++ +    L L+    +   + F+K     +  II+N +       YIK+  Y SP ++ G  GLI  +  + + +        I  L   I  +     S   GLAG       L   FK    LK  IK   +I  FS +  N K   ID
  S:    31 VPYQGWKIHISANLIDYQSILDNVYHVCSIFQTPFKYINKISELFRILSKHVSQLEIGKFITIYPKNKETFLLLLEELYDKIPKYTGVQILTDRSYKDSEIIFYRYGVMNARLINNERPKLKFNGTFYEDITEPYYTCPPFVEDIIF---NKVVDDYNIESLFHDRYQMESIIHKSGAGNVYIAIDTINEEKVI-IKEARKKVYITEKILAIDLLLNEKCILKKLKGKVDIPNYIECFTIEGNLYLVEEFIDGQRLDILKPEYNLLIKRNSSELGRYNKKVKKIISNLFLSLYKIHQ-------EGIILEDISSSNILL-TNDDRVFFIDLETAYNKNDGI----------IVETTNECYPKNISQKNEQRDIVKMWYCIIDLLTNSTSLLKYDNTGVSTLNLFYKMSLENNLPKSLRK---------------KFINDFSIVDFKNTFIIKFIEMGLNIEKIVRMQQDLTETILSHNTFEIYGKTILESIDNYKHISNMDLKFSSDPSFSSLYDNCNKSIDDLIGIAILDN-NFELFLNCNLDELLHNMSYYQKYY---LLRLFNDTKICDRVYFIKV----LNSIIKNDIKCIDGVKYIKSNEYFSPYLITGNSGLIIELIKFSKNNNTMKFDEWIRSLSEGISYTYAKGTSLYYGLAGLGLANAWLYYYFKETSFLKTSIKICEHIFDFS-IKQNTKTILID 689
>gi|55821916|ref|YP_140358.1| hypothetical protein stu1948 [Streptococcus thermophilus LMG 18311] >gi|55737901|gb|AAV61543.1| conserved hypothetical protein [Streptococcus thermophilus LMG 18311] (719 aa)
Score = 312, Expect = 2.0e-26, Identities = 193/674 (28%), Positives = 306/674 (45%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKSDYIYNERNEKIL------DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPT------DKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQK-------KLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEV--FVNKNNDIKLYLQFNKETLEEI--KNNILIKSNTLNSLLLNLK---ELDIKYLEKNWDNLSWYEKYFLSTSYHEVFKVFVYDNYNKKRFFNLRNKNEVEQI--FNKIF-LNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVKNKSYFYIKNEMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLKVSFEEGLAGFVYTLIHLTKTFKSWD-LKNDIKEMTNIILFSKVSINRKIKFID 710
           +P QGWKIH+S+ L +YQ ILD   + C      FK+I   +   + L KH ++   GKFITIY K++   +   + LYDK+  + G  +LTD+S+K+S  I YRYG   +  I NER +         D  E    CP F++D +    N   D ++   L H++Y +   I+ S  G +Y+A D  N  +V+ IKE R  + I     +  L LNE   LK        P  IE FT E +L++V E IDG  L     E +LL    +      +K V K+I NL L +  I +          ++ DI  SN L    + + +FIDLE+ ++ N+             +   N+   KN+ QK       K+   +I+L+  S + L    +   T   FY  +    LP  L +               +FI++   +D+ N  +  F+    +I+  ++  ++  E I   N   I   T+   + N K    +D+K+   +    S Y+    + S  ++  + + DN N + F N      +  +  + K + L L+    +   + F+K     +  II+N +       YIK+  Y SP ++ G  GLI  +  + + +        I  L   I  +     S   GLAG       L   FK    LK  IK   +I  FS +  N K   ID
  S:    31 VPYQGWKIHISANLIDYQSILDNVYHVCSIFQTPFKYINKISELFRILSKHVSQLEIGKFITIYPKNKETFLLLLEELYDKIPKYTGVQILTDRSYKDSEIIFYRYGVMNARLINNERPKLKFNGTFYEDITEPYYTCPPFVEDIIF---NKVVDDYNIESLFHDRYQMESIIHKSGAGNVYIAIDTINEEKVI-IKEARKKVYITEKILAIDLLLNEKCILKKLKGKVDIPNYIECFTIEGNLYLVEEFIDGQRLDILKPEYNLLIKRNSSELGRYNKKVKKIISNLFLSLYKIHQ-------EGIILEDISSSNILL-TNDDRVFFIDLETAYNKNDGI----------IVETTNECYPKNISQKNEQRDIVKMWYCIIDLLTNSTSLLKYDNTGVSTLNLFYKMSLENNLPKSLRK---------------KFINDFSIVDFKNTFIIKFIEMGLNIEKIVRMQQDLTETILSHNTFEIHGKTILESIDNYKYISNMDLKF-SSDPSFSSLYDN--CNKSIDDLIGIAILDN-NFELFLNYNLDELLHDMSYYQKYYLLRLFNDTKICDRVYFIKV----LNSIIKNDIKCIDGVKYIKSNEYFSPYLITGNSGLIIELIKFSKNNNTMKFDEWIRSLSEGISYTYAKGTSLYYGLAGLGLANAWLYYYFKETSFLKTSIKICEHIFDFS-IKQNTKTILID 689
>gi|55823834|ref|YP_142275.1| hypothetical protein str1948 [Streptococcus thermophilus CNRZ1066] >gi|55739819|gb|AAV63460.1| conserved hypothetical protein [Streptococcus thermophilus CNRZ1066] (719 aa)
Score = 312, Expect = 2.1e-26, Identities = 191/674 (28%), Positives = 303/674 (44%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKSDYIYNERNEKIL------DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPT------DKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQK-------KLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEV--FVNKNNDIKLYLQFNKETLEEI--KNNILIKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLSTSYHEVFKVFVYDNYNKKRFFN------LRNKNEVEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVKNKSYFYIKNEMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLKVSFEEGLAGFVYTLIHLTKTFKSWD-LKNDIKEMTNIILFSKVSINRKIKFID 710
           +P QGWKIH+S+ L +YQ ILD   + C      FK+I   +   + L KH ++   GKFITIY K++   +   + LYDK+  + G  +LTD+S+K+S  I YRYG   +  I NER +         D  E    CP F++D +    N   D ++   L H++Y +   I+ S  G +Y+A D  N  +V+ IKE R  + I     +  L LNE   LK        P  IE FT E +L++V E IDG  L     E +LL    +      +K V K+I NL L +  I +          ++ DI  SN L    + + +FIDLE+ ++ N+             +   N+   KN+ QK       K+   +I+L+  S + L    +   +   FY  +    LP  L +               +FI++   +D+ N  +  F+    +I+  ++  ++  E I   N   I   T+   + N K +    L+ + D          + S  ++  + + DN N + F N      L N +  ++ +    L L+    +   + F+K     +  II+N +       YIK+  Y SP ++ G  GLI  +  + + +        I  L   I  +     S   GLAG       L   FK    LK  IK   +I  FS +  N K   ID
  S:    31 VPYQGWKIHISANLIDYQSILDNVYHVCSIFQTPFKYINKISELFRILSKHVSQLEIGKFITIYPKNKETFLLLLEELYDKIPKYTGVQILTDRSYKDSEIIFYRYGVMNARLINNERPKLKFNGTFYEDITEPYYTCPPFVEDIIF---NKVVDDYNIESLFHDRYQMESIIHKSGAGNVYIAIDTINEEKVI-IKEARKKVYITEKILAIDLLLNEKCILKKLKGKVDIPNYIECFTIEGNLYLVEEFIDGQRLDILKPEYNLLIKRNSSELGRYNKKVKKIISNLFLSLYKIHQ-------EGIILEDISSSNILL-TNDDRVFFIDLETAYNKNDGI----------IVETTNECYPKNISQKNEQRDIVKMWYCIIDLLTNSTSLLKYDNTGVSSLNLFYKMSLENNLPKSLRK---------------KFINDFSIVDFKNTFIIKFIEMGLNIEKIVRMQQDLTETILSHNTFEIHGKTILESIDNYKHISNMDLKFSSDPSFSSLYDNCNKSIDDLIGIAILDN-NFELFLNYNLDELLHNMSYYQKYY---LLRLFNDTKICDRVYFIKV----LNSIIKNDIKCIDGVKYIKSNEYFSPYLITGNSGLIIELIKFSKNNNTMKFDEWIRSLSEGISYTYAKGTSLYYGLAGLGLANAWLYYYFKETSFLKTSIKICEHIFDFS-IKQNTKTILID 689
>gi|21224977|ref|NP_630756.1| serine/threonine protein kinase [Streptomyces coelicolor A3(2)] >gi|3334812|emb|CAA19960.1| putative serine/threonine protein kinase [Streptomyces coelicolor A3(2)] (930 aa)
Score = 308, Expect = 6.7e-26, Identities = 87/253 (34%), Positives = 129/253 (50%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNE-----------KILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFF 289
           LP QGWKIHVS+ LDN + +LD    +C++    FKF+ +     Q   K+ +R  +GKF+T+Y  DE E       L + L    GP +L+D    +  +H RYGGF     Y+   E            + D R      P ++  P   + +   D+ S+  +    Y +  A++FSN GG+YLA D     RVVL KE RP+ G+ +        L+ E   L+  +    TP++++  T   H F+V EHIDG  L  FF
  S:    88 LPAQGWKIHVSACLDNAESVLDRVWRHCVDGGTAFKFVPSRYLLHQRNAKYADRAGSGKFVTVYPADEAEFERLVGELSELLAGEPGPHILSDLRIGDGPVHVRYGGFTRRDCYDADGELRPAVSGPDGVLVPDLRGPVFRIPEWVDPPAFLRPHL--DARSAVTVTGMPYTVESALHFSNGGGVYLARDTRTGARVVL-KEARPHAGLAADGADAVTRLHRERRALERLSGLACTPEVLDHRTVGEHHFLVLEHIDGKPLNTFF 349
>gi|116513251|ref|YP_812157.1| Serine/threonine protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092566|gb|ABJ57719.1| serine/threonine protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (833 aa)
Score = 305, Expect = 1.4e-25, Identities = 107/337 (31%), Positives = 172/337 (51%)
  Q:    28 YVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFK-GPSVLTDKSFKNSCIHYRYGGFKSDY-----------IYNERNEKILDKREIGKHCPNFIKD-PLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGL----NEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVL-DIKLSNFLFDCKNKKTYFIDLESIHDNNETF 364
           YV Y+  D LP QGWKIH+S+T+   Q +LD      + + + FKF  +   ++++  K+ +R  +GKFIT+Y + E E       L    + F  GP +L+D++++ S +++RYGGFK  Y           IY+    K+ D+R       +F+KD P+  K   N       F    +Y + +A++FSN GG+YL  DL+   +VVL KE R   G+++   + K G     NE E L+   +       ++ FT   H F+V E+I G +L++         F   D       K   + I++ LK     I +  L + D+ LSN L   ++     IDLE+     E +
  S:    51 YVLYE-PDELPVQGWKIHLSATVKQAQGMLDAVALCLIKQKVSFKFQSSLEQYVESNSKYADRGESGKFITVYPRGEEEFACLLAELQKLTETFALGPYILSDQNWQESNVYFRYGGFKPLYLVNAAGERVPAIYDPAGNKVADQRLPYYQQADFVKDLPIFGK---NTFPKQEAFAPLEEYQVKEALHFSNAGGVYL--DLHEGKKVVL-KEGRQQAGLDA---NLKDGFARVENEAEILRQLADLTGVVNYLDDFTSWRHHFLVEEYIAGQSLEELLATE--FPFVVGDLEKKARYKAKAIKILEQLKELLKQIHARGLAVGDLSLSNILV-TEDGDVRLIDLENAGKATEKY 392
>gi|104774737|ref|YP_619717.1| hypothetical protein Ldb2095 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423818|emb|CAI98833.1| Hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (731 aa)
Score = 305, Expect = 1.5e-25, Identities = 111/402 (27%), Positives = 207/402 (51%)
  Q:    36 SLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKS--DYIYNERNEKILDKREIGKH-CPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGL----NEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLES---IHDNNETF-NKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELI 437
           SLP QG+KIHVS+TL NYQ ILD   +     N  FK+I N +   Q L        TGK+ITIY + E       + +YD +    G  + TD++F++S  ++YRYG   S  D+I +ERN K+    E+  +  P+F+K+P   K  +  ++    +LL         I   + GG+Y A D+Y  + V+   ++R       F +S +  +    NE + L  + + +  PK+++SF E+   F+V  +I G+ + D   E     F    +N     K +  I+++ L+      + +  + DI  SN + D +++K + +D+     + + +E+F  +   F + R  +L+ +L+  +    +   L++ +  ++N+FL + +S  +++  F   A   K+P + ++++
  S:    50 SLPRQGFKIHVSATLQNYQVILDKVYDLSCENNFTFKYISNYSLLEQYLGGTGPLWMTGKYITIYPETESRFEKLIRTIYDLVGKEDGIPIFTDQAFRDSKNVYYRYGIINSDDDFIRDERNNKLYRDHELRTYQLPSFVKEPFESKNEHKLETIGKKYLLKG------IISRKSSGGVYRAQDIYGRDVVIKRAKYR-------FKDSEETEIQKLQNERKNLINWEKYDFIPKVLDSFYEQKDFFLVESYIKGVLIDDLRAE-----FIGDKRNSFYFAK-IRHIVLNYLRCLQRLHNDSFFLGDISASNIIVDFESEKVFLVDVSQSALLTNMDESFYYRTKGFYDRRVDNLSPELQDVH----QSGYLVMSVFSRANDFLKIDQSGKQSWNFFIKQAAQEKIPAVFIKVM 440
>gi|62422831|ref|ZP_00378011.1| COG0515: Serine/threonine protein kinase [Brevibacterium linens BL2] (867 aa)
Score = 304, Expect = 1.9e-25, Identities = 90/319 (28%), Positives = 162/319 (50%)
  Q:    38 PNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFK-GPSVLTDKSFKNSCIHYRYGGF-KSDY---------IYNERNEKILDKREIGKHCPNFIKDP--LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNST--KLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLY--FEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLF--DCKNKKTYFIDLES 356
           P QGWKIHV++T+D+    +    +   +K   FK       ++++  K+ NR  +GK IT+Y  D+ + +     L    ++F+ GP +LTD+ +++S ++YRYG F + ++         I +E  + + D+R  G   P+++  P  + E++   D    S  L++  Y I  A++FSN GG+Y   D   +  VVL KE RP  G++        ++G +E             P+ I+ F E  H F+V  H++G  +  +  EN       +P D      ++++  I+ D +       S    + D++ +N +   D    +  FIDLE+
  S:    52 PRQGWKIHVTATVDDAAACIKQVADVLFDKETPFKVCRTRQRYVRSNSKYGNRAGSGKLITVYPADDNQFVAYLDLLEASTRNFRPGPYILTDRRWRDSNVYYRYGAFVRQEFEHEGKTLLGIADESGQMVEDQRVPGYSVPDWVNVPAKVREEEQFRDQEEGSGRLIN--YGIESALHFSNGGGVYSGRDQRTDESVVL-KEGRPRAGLDGTLVDAFDRIG-HEARMFHRLGACAYVPRNIDDFVEWEHRFLVMSHVEGTHMGRYIAENYPFQRSLDPCD-----YVESITEIVADAVAGLTSIHSRGVALGDVQPTNIIIREDESETRVCFIDLEA 380
>gi|104773280|ref|YP_618260.1| putative Ser/Thr protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422361|emb|CAI96877.1| Putative Ser/Thr protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (833 aa)
Score = 302, Expect = 2.9e-25, Identities = 86/255 (33%), Positives = 140/255 (54%)
  Q:    35 DSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFK-GPSVLTDKSFKNSCIHYRYGGFKSDY-----------IYNERNEKILDKREIGKHCPNFIKD-PLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGL----NEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFF 289
           D LP QGWKIH+S+T+   Q +LD      + + + FKF  +   ++++  K+ +R  +GKFIT+Y + E E       L    + F  GP +L+D++++ S +++RYGGFK  Y           IY+    K+ D+R       +F+KD P+  K   N       F    +Y + +A++FSN GG+YLA  L+   +VVL KE R   G+++   + K G     NE E L+   +       ++ FT   H F+V E+I G +L++  
  S:    57 DELPVQGWKIHLSATVKQAQGMLDEVAPCLIKQKVSFKFQSSLEQYVESNSKYADRGESGKFITVYPRGEEEFACLLAELQKLTETFALGPYILSDQNWQESNVYFRYGGFKPLYLVNAAGERVPAIYDPAGNKVADQRLPYYQQADFVKDLPIFGK---NTFPKQEAFAPLEEYQVKEALHFSNAGGVYLA--LHEGKKVVL-KEGRQQAGLDA---NLKDGFARVENEAEILRQLADLTGVVNYLDDFTSWRHHFLVEEYIAGQSLEELL 319
>gi|29834045|ref|NP_828679.1| membrane translocator [Streptomyces avermitilis MA-4680] >gi|29611170|dbj|BAC75214.1| putative membrane translocator [Streptomyces avermitilis MA-4680] (882 aa)
Score = 297, Expect = 1.4e-24, Identities = 86/262 (32%), Positives = 137/262 (52%)
  Q:    38 PNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNE-----------KILDKREIGKHCPNFIKDP-LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTES----NTTPKIIESFTEENHLFVVREHIDGLTLKDFFYE-NSLLYFEP 299
           P QGWKIH S+T  N ++I      YC+ + I FKF+           K+  R ++GKF+TIY  DE +L    + L ++L   +GP +LTD  + +  ++ RYG F   ++ +ER              + D+R+     P ++  P   E Q    ++ +   L    Y I KA++FSN GG+Y   D  +  +VVL KE RP+ G+ S        +  +E+ KY  E        P++ + FT  +H F+V + ++G  L  FF E + LL  +P
  S:    68 PAQGWKIHASATRANAERIATDVWEYCVPRRIPFKFVPGPHLLHLRNAKYAGRDTSGKFVTIYPADEEQLHLVLRELGERLDGCEGPYILTDLRWNDGPLYVRYGAFARSFVVDERGSLVPAVRDGEGTLVPDRRQPSFQVPEWVTLPAFLEPQLAARNTTTVGDL---PYRIEKALHFSNGGGVYAGTDTRDGRKVVL-KEGRPHAGLAS---DGADAIARLEREKYALEQVSGLGVVPEVRDWFTLGDHRFLVMDFLEGRPLNSFFAERHPLLTPDP 339
>gi|134100763|ref|YP_001106424.1| serine/threonine protein kinase [Saccharopolyspora erythraea NRRL 2338] >gi|133913386|emb|CAM03499.1| serine/threonine protein kinase [Saccharopolyspora erythraea NRRL 2338] (844 aa)
Score = 263, Expect = 1.1e-20, Identities = 86/319 (26%), Positives = 148/319 (46%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDY----------IYNERNEKILDKREIGKHCPNFIKDP------LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYEN-SLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLE 355
           LP QGWK+HVS+TL N +++L     YCL + + FK + +    +    K+  R ++GK +TIY  D+  L      L  +L+   GP +L+D  ++   ++ RYGGF   +          I     E + DKR  G   P+++  P      L  ++  +  +F         Y +  +++FSN GG+Y A    +   VVL KE RP+ G++         L+ E E L+        P + E F    H F+  + + G  L  +      L    PT++ +    +  + ++  + +  D       +  D+   N L D ++ +   ID E
  S:    58 LPAQGWKVHVSATLGNAERVLAAVHRYCLRERVAFKHLRSPRVLLARNAKYAPRSASGKLVTIYPVDDEHLATVLTELAPQLRGEPGPYILSDLRYEQGPLYVRYGGFAERWVEFDGTRVLAIAGPDGELVPDKRNPGFSLPDWVSPPECLSASLAARKGGDRAAFG--------YRVTSSMHFSNGGGVYRAVRKSDGAEVVL-KEARPHAGLDRDGTDAVARLHREHEVLRRLDGIGGVPAVHELFQLWEHTFLAMDLVPGTPLGTWLARTYPLTRQHPTEQEIADYTRRALALLERVERLLDRVHGRGVVFGDLHGLNVLVD-EDDEVSVIDFE 384
>gi|116513453|ref|YP_812359.1| Serine/threonine protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092768|gb|ABJ57921.1| Serine/threonine protein kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (750 aa)
Score = 258, Expect = 4.3e-20, Identities = 180/717 (25%), Positives = 324/717 (45%)
  Q:    15 YKDLSFYTKNKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDK--LKDFKGPSVLTDKSFKNS-CIHYRYGGFK--SDYIYN--ERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQ--KKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNI-DWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNIL--IKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLS-TSYHEVFKVFVYDNY----NKKRFFNLRNKNE------VEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVK--NKSYFYIKN-EMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLK-VSFEEGLAGFVYTLIHLTKTFKSWDLKNDIKEM-TNIILFSKVSINRKIKFIDMYKSLKNDLC-GTLGIYLYLKE 731
           YK ++  +K +F    +   + +P+QG+KIH+S+T  NYQ ILD   + C +  I FK+I N    +  L    +  ++GKFITIY     +       LY+   LK   G ++ +D+ +++S  I YRYG  K    +IYN   + ++  D   +    P ++ +P  +   N+DDS +  +L   K    + +     G  +LA+   +    VL      Y+ +      T    NE   +K   + +  P  I  F+E+   F+  E   GL++ D+  ++   + +   +   K I +    I D+LK           + DI   N L D +     F+DLE      E  +K  +F         N      + Q  ++L+ L+I   C+ N FL +  S   T   F  +A+ + LP + V++I  +       DP + + NL  + D  + E   N  + + L   F  E ++ +   ++  I+ +   +L    ++ D+ +   N + +S Y++Y    T ++++F      N+     K+    L++ +E      + Q++  +   + ++    K I         I Y  E  +    N  +F I     Y SP   +GT G+I ++  Y ++  D      I+ L+ +I   ++ K  S   GL  F+Y L    K FKS    NDI+EM  N+ L+S VS   +    + ++ +  D   G  GI   +++
  S:    23 YKKIARDSKKRFLQFCFSNAE-IPDQGFKIHISATQINYQVILDEVFDLCKSNLIDFKYISNREQLLDNLAGKDDLWASGKFITIYPSSLDDFKKVIVKLYENNVLKVQDGIAIFSDRRYRDSNVIFYRYGRLKGPDKWIYNPITKLKEYRDYESMEYRLPAWVDEPFPD---NSDDSKTCKYLF-KKIIPTEGLNSKPSGATFLAHVAGSEEEFVLKNAHPGYMNLGV--ACTDSLKNEAVNIKRMMKFDFIPNYIADFSEDEDYFLCEEKECGLSVDDYRADSHHNFIDKKLRK--KTINDYRKSITDLLKNVQILHDERIFLGDISSENVLVDPETNLVSFVDLEQ-SVFLEDHSKIAFFARTEGFFDENTPFLAPIAQDNQQLAYLLISFFCRGNMFLLIDHSGAMTINFFKQYASTHNLPKVFVDVIMDLLE-----DPNQRLDNLVEVLDKMDCENLYNSEDLVSLD-DFQYELVKSVYLAMIDGIQIDDKKTLFFE-EDTDLIF---NENMVSIYKEYLQKPTIFNDIFFEKKMHNHVISEGKRLVEMLKDGDERLAETSLVQVYALLLCTIKIASPSEKII-----IDSLINYTQEKYMESTINGRFFRITEYSTYLSPYFADGTAGMINILLEYKEKFHDTKYDASILDLVNSISQEHMPKNSSLYRGLGSFIYVLQKFKKIFKSSKRDNDIREMFRNLPLYSIVSNGNRYMVDESFRRISLDFADGNAGIIFLIEQ 743
>gi|194365907|ref|YP_002028517.1| serine/threonine protein kinase [Stenotrophomonas maltophilia R551-3] >gi|194348711|gb|ACF51834.1| serine/threonine protein kinase [Stenotrophomonas maltophilia R551-3] (894 aa)
Score = 257, Expect = 5.8e-20, Identities = 92/324 (28%), Positives = 151/324 (46%)
  Q:    36 SLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQ-TLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYG---GFKSDYIYNERNEKIL--------DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLG------INSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHD 359
           +LP+ GWKIH+S   +N +Q L +     +   + FKF C+D   +  +L K  +R   GKFITIY +D  +  +  + LY   +   GP VLTD+++++S  ++YRYG   G      Y    +  L        D R  G   P  + DP          + +   +L+ +Y +   + F+  GGIY   D     +VV I+E R +        +N   N  K    E   L+  + +   P  +E F E N+ F+V+E +D ++L D        YF   ++      + +   I  I +          ++ D+  SN +F     +  FIDLE  H+
  S:    59 ALPH-GWKIHLSCIPENAEQTLAVMTPVVVEAGVSFKF-CSDPFMLGLSLGKGWSRFQAGKFITIYPRDRQQFQELLERLYQVTQGLSGPHVLTDRAYRDSTVVYYRYGAHAGVSRPDPYGSLQQGYLLADGTWHEDVRGAGFRLPPGVDDPCVAAAAAP--TPAGPIVLNGRYQVHGVLKFNGTGGIYRGRDTTTGQKVV-IREVRGFSDADGAELVNGMVNGIK---REARILQKLSATGLVPVFVELFKEWNNWFLVQEQLDAISLWD---SAMAFYFAEDEQRACDGFERIRRRISQIAEALQVVHEHGVVLRDLTRSNVMFTAAG-EVKFIDLEFAHE 389
>gi|182436190|ref|YP_001823909.1| AmfT protein [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464706|dbj|BAG19226.1| AmfT protein [Streptomyces griseus subsp. griseus NBRC 13350] (875 aa)
Score = 255, Expect = 8.4e-20, Identities = 86/320 (26%), Positives = 152/320 (47%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDY-----------IYNERNEKILDKREIGKHCPNFIKDP--LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYEN-SLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLES 356
           LP QGWKIHVS+ LDN   +L+  + +CL   + FK + +         K+ +R  +GKFIT+Y   +    +   AL   L+   GP +L+D    +  +H RYG F + +           + + +   + D R      P+++  P  LT       ++ ++  L    Y + KA++FSN GG+YL  D     +VVL KE RP+ G+ +        L  E   L+     +  P + ++F   +H F+V ++I G TL   F     L    P+ + + +       +   + +  +       ++ D+ +SN + D +N +   +D E+
  S:    65 LPPQGWKIHVSAALDNAVSVLERVVAHCLEHRLAFKCVPSAGLLALRNAKYADRAGSGKFITVYPPSDEAFPEVCGALMTLLEGEHGPYILSDLRCGDGPVHTRYGAFAARFCSGPDGRPVPAVADPQGRLVPDDRGPAFRVPSWVTPPGFLTPHL----EARAAVGLADLPYTVEKALHFSNGGGVYLGRDTRTGEQVVL-KEARPHAGLAADGADAVARLERERTALEQLAGLDCVPAVRDAFEVGDHRFLVLQYIPGTTLNTVFARRFPLARQHPSPELLAEHAAWAAELYGKVERAVEAVHGRGIVISDLHMSNVMVDEENARIVLLDFEA 394
>gi|15022415|dbj|BAB62264.1| membrane translocator [Streptomyces griseus] (891 aa)
Score = 255, Expect = 8.5e-20, Identities = 86/320 (26%), Positives = 152/320 (47%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDY-----------IYNERNEKILDKREIGKHCPNFIKDP--LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYEN-SLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLES 356
           LP QGWKIHVS+ LDN   +L+  + +CL   + FK + +         K+ +R  +GKFIT+Y   +    +   AL   L+   GP +L+D    +  +H RYG F + +           + + +   + D R      P+++  P  LT       ++ ++  L    Y + KA++FSN GG+YL  D     +VVL KE RP+ G+ +        L  E   L+     +  P + ++F   +H F+V ++I G TL   F     L    P+ + + +       +   + +  +       ++ D+ +SN + D +N +   +D E+
  S:    81 LPPQGWKIHVSAALDNAVSVLERVVAHCLEHRLAFKCVPSAGLLALRNAKYADRAGSGKFITVYPPSDEAFPEVCGALMTLLEGEHGPYILSDLRCGDGPVHTRYGAFAARFCSGPDGRPVPAVADPQGRLVPDDRGPAFRVPSWVTPPGFLTPHL----EARAAVGLADLPYTVEKALHFSNGGGVYLGRDTRTGEQVVL-KEARPHAGLAADGADAVARLERERTALEQLAGLDCVPAVRDAFEVGDHRFLVLQYIPGTTLNTVFARRFPLARQHPSPELLAEHAAWAAELYGKVERAVEAVHGRGIVISDLHMSNVMVDEENARIVLLDFEA 410
>gi|104773466|ref|YP_618446.1| hypothetical protein Ldb0301 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422547|emb|CAI97140.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (750 aa)
Score = 255, Expect = 8.7e-20, Identities = 179/717 (24%), Positives = 323/717 (45%)
  Q:    15 YKDLSFYTKNKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDK--LKDFKGPSVLTDKSFKNS-CIHYRYGGFK--SDYIYN--ERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQ--KKLSILMIELICKSNNFLYLAKSINKTFERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNI-DWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNIL--IKSNTLNSLLLNLKELDIKYLEKNWDNLSWYEKYFLS-TSYHEVFKVFVYDNY----NKKRFFNLRNKNE------VEQIFNKIFLNLYLSKNVNKNIQFLKKAKQDIKYIIENKLVK--NKSYFYIKN-EMYSSPNVLNGTCGLIFLMNLYYQQSQDDYMKNKIILLLPTIKSSNLLK-VSFEEGLAGFVYTLIHLTKTFKSWDLKNDIKEM-TNIILFSKVSINRKIKFIDMYKSLKNDLC-GTLGIYLYLKE 731
           YK ++  +K +F    +   + +P+QG+KIH+S+T  NYQ ILD   + C +  I FK+I N    +  L    +  ++GKFITIY     +       LY+   LK   G ++ +D+ +++S  I YRYG  K    +IYN   + ++  D   +    P ++ +P  +   N+DDS +  +    K    + +     G  +LA+   +    VL      Y+ +      T    NE   +K   + +  P  I  F+E+   F+  E   GL++ D+  ++   + +   +   K I +    I D+LK           + DI   N L D +     F+DLE      E  +K  +F         N      + Q  ++L+ L+I   C+ N FL +  S   T   F  +A+ + LP + V++I  +       DP + + NL  + D  + E   N  + + L   F  E ++ +   ++  I+ +   +L    ++ D+ +   N + +S Y++Y    T ++++F      N+     K+    L++ +E      + Q++  +   + ++    K I         I Y  E  +    N  +F I     Y SP   +GT G+I ++  Y ++  D      I+ L+ +I   ++ K  S   GL  F+Y L    K FKS    NDI+EM  N+ L+S VS   +    + ++ +  D   G  GI   +++
  S:    23 YKKIARDSKKRFLQFCFSNAE-IPDQGFKIHISATQINYQVILDEVFDLCKSNLIDFKYISNREQLLDNLAGKDDLWASGKFITIYPSSLDDFKKVIVKLYENNVLKVQDGIAIFSDRRYRDSNVIFYRYGRLKGPDKWIYNPITKLKEYRDYESMEYRLPAWVDEPFPD---NSDDSKTCKYFF-KKIIPTEGLNSKPSGATFLAHVAGSEEEFVLKNAHPGYMNLGV--ACTDSLKNEAVNIKRMMKFDFIPNYIADFSEDEDYFLCEEKKCGLSVDDYRADSHHNFIDKKLRK--KTINDYRKSITDLLKNVQILHDERIFLGDISSENVLVDPETNLVSFVDLEQ-SVFLEDHSKIAFFARTEGFFDENTPFLAPIAQDNQQLAYLLISFFCRGNMFLLIDHSGAMTINFFKQYASTHNLPKVFVDVIMDLLE-----DPNQRLDNLVEVLDKMDCENLYNSEDLVSLD-DFQYELVKSVYLAMIDGIQIDDKKTLFFE-EDTDLIF---NENMVSIYKEYLQKPTIFNDIFFEKKMHNHVISEGKRLVEMLKDGDERLAETSLVQVYALLLCTIKIASPSEKII-----IDSLINYTQEKYMESTINGRFFRITEYSTYLSPYFADGTAGMINILLEYREKFHDTKYDASILDLVNSISQEHMPKNSSLYRGLGSFIYVLQKFKKIFKSSKRDNDIREMFRNLPLYSIVSNGNRYMVDESFRRISLDFADGNAGIIFLIEQ 743
>gi|166712323|ref|ZP_02243530.1| serine/threonine protein kinase [Xanthomonas oryzae pv. oryzicola BLS256] (811 aa)
Score = 253, Expect = 1.5e-19, Identities = 88/316 (27%), Positives = 154/316 (48%)
  Q:    54 QQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKS----DYIYNERN-------EKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLK-------YFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENS-LLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIY 369
           + +L+     C +    FKF  ++    + L K   R+S GKF+TIY     +     + LY  L+D +GP +L+D+ +K+S  + YRYGGF++    D+   E++         + D+R      P F+ D    + +   D+  +  L  ++Y I   + FSN GG+Y    + +   VV IKE RP++      ++   GL+ + +LK           S   P+ +  F E  H F+V+E I G TL+++  + +  LY   +  +V   ++    I  D+++        + +  DI  +N + D ++    FID E         N NIY
  S:     5 KTVLERVTRVCTDDGTEFKFASDEFIHRKLLSKSAARQSGGKFMTIYPAGIEKFEGLIETLYRTLQDIQGPYILSDRQYKDSGAVFYRYGGFRAFTVRDFSGREKSMILDDDFRLVEDQRIPHFRVPAFVTDKRWGQIDEPADAVGADVLFGDEYAIESVLKFSNAGGVYAGRRVADGLSVV-IKEARPHV------DAEINGLDPLNRLKKEQRILHVLEGSGIAPRPLGWFVEWEHTFLVQEKIAGKTLREYCLDATKSLYPGSSQADVRTWLQKSAAIGADLIEKVRLLHVQDIVFGDISTNNIIIDPESLTLRFIDFEGALQVGVDENINIY 333
>gi|194339884|gb|EDX20850.1| serine/threonine protein kinase [Streptomyces sp. Mg1] (571 aa)
Score = 251, Expect = 2.5e-19, Identities = 80/253 (31%), Positives = 127/253 (50%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKIL-----------DKREIGKHCPNFIKDP-------LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNT-----------------TPKIIESFTEENHLFVVREHIDGLTLKDFF 289
           LP+QGWKIHVSS   + + +L+    YCL++ I FKF+           K+  R S+GKF T+Y  D+ EL      L   L   +GP +L+D  ++   ++ RYGGF   +  +   E++L           D R  G   P++   P          +     D           Y + + ++FSN GG+YLA     +  VVL KE RPY G++      + G++ + +L++  E  T                  P     F+   H F+ +EHI+G +L  + 
  S:    94 LPDQGWKIHVSSCAADAEAVLETLHAYCLSERITFKFLRGLPILQVQNSKYAPRGSSGKFCTVYPVDDAELERCLDGLGTLLAGRRGPYILSDARWEQGPLYLRYGGFVERHCRDAAGERVLALAGPDGALVPDVRGAGFSVPDWAPVPDCIAPAVAARRATRGPDL---------PYTVERVLHFSNAGGVYLARRAEGDPPVVL-KEARPYAGLD------QRGVDAVTRLRHEHEVLTRLAGIPGVPALPGGDPAVPGEQSLFSVWEHEFLAQEHIEGQSLSQWL 365
>gi|15901452|ref|NP_346056.1| hypothetical protein SP_1612 [Streptococcus pneumoniae TIGR4] >gi|14973104|gb|AAK75696.1| conserved domain protein [Streptococcus pneumoniae TIGR4] (330 aa)
Score = 249, Expect = 5.0e-19, Identities = 87/278 (31%), Positives = 140/278 (50%)
  Q:    31 YKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTD-KSFKNSCIHYRYGGFKSDYIYNERNEKIL-------------DKREIGKHCPNFIKDPLTEKQN----NNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINS--FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFF--YENSLLYFEPTDKNVLKVI 308
           Y L D +P QGWKIH+SS + +   I  I        N  FK + N     +         +  KFIT+Y K E E       L ++L +FK P +L+D +   +S +HYRYG F     Y+E+N+K++             DKR+     P++  D  +E++           SS     NKY + K I  SN G +Y A    +  +V+ IK+ RP++  ++   W +     NE   LK   + + T  + + F   +  F+V+E +DGL  ++F    E+SL   E T  N++ ++
  S:    24 YYLSDKMPAQGWKIHISSQIKDAVNIFKIVYKLSQLNNCSFKVVKNLEELKKINSPREMSPTANKFITLYPKSESEAKSMICNLTNRLSEFKAPKILSDYQCGMHSPVHYRYGAFLKKQAYDEKNKKVIYLLLDEKRKNYVEDKRQNFPSLPSWKMDLFSEEEKRIYFQTTCEVSSKDSAINKYKMEKIIKRSNKGNVYRAIRKSDGQKVI-IKQSRPFVNYDAEGEWTALDDIKNEAHMLKKLADKSYTTNLTDEFYIVDDYFLVQEQVDGLNFEEFIRETEHSLNIREKTLDNIVNIV 322
>gi|182438598|ref|YP_001826317.1| hypothetical protein SGR_4805 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178467114|dbj|BAG21634.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] (873 aa)
Score = 248, Expect = 5.5e-19, Identities = 74/246 (30%), Positives = 118/246 (47%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKIL-----------DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNK-------YDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGL-NEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTL 285
           QGWKIHVS+  +  ++ L      C    + FKF+ ++   +    K+ +R   GKFIT+Y  DE   +     L   L   +GP +L+D    ++ ++ RYG F S +  +   E++L           D+R +    P ++  P         D+   H             YD+ +++ FSN GGIYLA       RVVL +E RP+ G++   +     L  E   L      +  P++    T   H F++ EHI+G TL
  S:    63 QGWKIHVSTVPEEAEETLLDTARICRAHGVPFKFLRSERALLLMSGKYMSRAGAGKFITLYPPDERVFLRVLDELTRALAGRRGPYILSDLRIGDAPVYIRYGAFVSRWCLDGNGERVLALRHPSGELVPDERGVVFRIPPWVTVP---------DALRPHLAARAAAGDAGFPYDVSESLQFSNAGGIYLARHRETGRRVVL-REARPHSGLDEAGDDAVTRLRREHRALTALAGLDCVPEVYGVRTVWEHHFLIEEHIEGTTL 317
>gi|134100560|ref|YP_001106221.1| membrane translocator [Saccharopolyspora erythraea NRRL 2338] >gi|133913183|emb|CAM03296.1| membrane translocator [Saccharopolyspora erythraea NRRL 2338] (917 aa)
Score = 248, Expect = 5.9e-19, Identities = 72/247 (29%), Positives = 124/247 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFK-NSCIHYRYGGF------KSDYIY-----NERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTK-LGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLK 286
           QGWK+HVS+T+     +L  C+   L+    FKF    A+       H  R   GKF+T Y +D+ + +   +AL+       GP +L+D+ ++  S +HYRYG F       +D +Y     +   E + D RE     P +++ P    + +   S +   LL +++ + +AI  +N GG+Y A DL    + V+IKE RP+  + S     + +   E   L+        P+++E F +  HL++    + G  L+
  S:    81 QGWKLHVSATMGTAGAVLQRCLPVLLDAERPFKFAITLAHVYALNSGHAPRYGAGKFLTCYPEDDEQAVGLAEALHLATTGLSGPVILSDRPYRPGSIVHYRYGSFVNRRVLTNDGLYRHIIDSPTGETVPDLREPRYTPPEWVRCPFPAAE-SAPSSGARRILLGDRFAVREAIRHANKGGLYRAQDL-RTGKPVVIKETRPHTVVGSDGTCAQDMLRAEARALEALAPLGVAPEVVEFFEQSGHLYLAMRDLQGPPLR 338
>gi|182684564|ref|YP_001836311.1| hypothetical protein SPCG_1594 [Streptococcus pneumoniae CGSP14] >gi|182629898|gb|ACB90846.1| hypothetical protein SPCG_1594 [Streptococcus pneumoniae CGSP14] (316 aa)
Score = 245, Expect = 1.2e-18, Identities = 82/261 (31%), Positives = 130/261 (49%)
  Q:    31 YKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTD-KSFKNSCIHYRYGGFKSDYIYNERNEKIL-------------DKREIGKHCPNFIKDPLTEKQN----NNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINS--FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYE 291
           Y L D +P QGWKIH+SS + +   I  I        N  FK + N     +         +  KFIT+Y K E E       L ++L +FK P +L+D +   +S +HYRYG F     Y+E+N+K++             DKR+     P++  D  +E++           SS     NKY + K I  SN G +Y A    +  +V+ IK+ RP++  ++   W +     NE   LK   + + T  + + F   +  F+V+E +DGL  ++F  E
  S:    24 YYLSDKMPAQGWKIHISSQIKDAVNIFKIVYKLSQLNNCSFKVVKNLEELKKINSPREMSPTANKFITLYPKSESEAKSMICNLTNRLSEFKAPKILSDYQCGMHSPVHYRYGAFLKKQAYDEKNKKVIYLLLDEKRKNYVEDKRQNFPSLPSWKMDLFSEEEKRIYFQTTCEVSSKDSAINKYKMEKIIKRSNKGNVYRAIRKSDGQKVI-IKQSRPFVNYDAEGEWTALDDIKNEAHMLKKLADKSYTTNLTDEFYIVDDYFLVQEQVDGLNFEEFIRE 303
>gi|149013292|ref|ZP_01834050.1| hypothetical protein CGSSp19BS75_09069 [Streptococcus pneumoniae SP19-BS75] >gi|147762957|gb|EDK69903.1| hypothetical protein CGSSp19BS75_09069 [Streptococcus pneumoniae SP19-BS75] (330 aa)
Score = 244, Expect = 1.6e-18, Identities = 86/278 (30%), Positives = 140/278 (50%)
  Q:    31 YKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTD-KSFKNSCIHYRYGGFKSDYIYNERNEKIL-------------DKREIGKHCPNFIKDPLTEKQN----NNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINS--FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFF--YENSLLYFEPTDKNVLKVI 308
           Y L D +P QGWKIH+SS + +   I  I        N  FK + N     +         +  KFIT+Y K E +       L ++L +FK P +L+D +   +S +HYRYG F     Y+E+N+K++             DKR+     P++  D  +E++           SS     NKY + K I  SN G +Y A    +  +V+ IK+ RP++  ++   W +     NE   LK   + + T  + + F   +  F+V+E +DGL  ++F    E+SL   E T  N++ ++
  S:    24 YYLSDKMPAQGWKIHISSQIKDAVNIFKIVYKLSQLNNCSFKVVKNLEELKKINSPREMSPTANKFITLYPKSESKAKSMICNLTNRLSEFKAPKILSDYQCGMHSPVHYRYGAFLKKQAYDEKNKKVIYLLLDEKRKNYVEDKRQNFPSLPSWKMDLFSEEEKRIYFQTTCEVSSKDSAINKYKMEKIIKRSNKGNVYRAIRKSDGQKVI-IKQSRPFVNYDAEGEWTALDDIKNEAHMLKKLADKSYTTNLTDEFYIVDDYFLVQEQVDGLNFEEFIRETEHSLNTREKTLDNIVNIV 322
>gi|111657301|ref|ZP_01408064.1| hypothetical protein SpneT_02001487 [Streptococcus pneumoniae TIGR4] (832 aa)
Score = 242, Expect = 2.7e-18, Identities = 104/323 (32%), Positives = 163/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E + TPKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    19 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSETPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 344
>gi|15901198|ref|NP_345802.1| hypothetical protein SP_1344 [Streptococcus pneumoniae TIGR4] >gi|14972827|gb|AAK75442.1| conserved hypothetical protein [Streptococcus pneumoniae TIGR4] (869 aa)
Score = 240, Expect = 5.4e-18, Identities = 104/323 (32%), Positives = 163/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E + TPKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    56 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSETPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 381
>gi|148989460|ref|ZP_01820819.1| hypothetical protein CGSSp6BS73_04765 [Streptococcus pneumoniae SP6-BS73] >gi|168575803|ref|ZP_02721718.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016] >gi|147925003|gb|EDK76084.1| hypothetical protein CGSSp6BS73_04765 [Streptococcus pneumoniae SP6-BS73] >gi|183578318|gb|EDT98846.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016] (869 aa)
Score = 239, Expect = 6.3e-18, Identities = 104/323 (32%), Positives = 163/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E + TPKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    56 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSETPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 381
>gi|149007001|ref|ZP_01830670.1| hypothetical protein CGSSp18BS74_09845 [Streptococcus pneumoniae SP18-BS74] >gi|147761305|gb|EDK68271.1| hypothetical protein CGSSp18BS74_09845 [Streptococcus pneumoniae SP18-BS74] (504 aa)
Score = 238, Expect = 7.8e-18, Identities = 104/323 (32%), Positives = 163/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E + TPKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    56 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSETPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 381
>gi|148993101|ref|ZP_01822695.1| hypothetical protein CGSSp9BS68_10435 [Streptococcus pneumoniae SP9-BS68] >gi|147928302|gb|EDK79319.1| hypothetical protein CGSSp9BS68_10435 [Streptococcus pneumoniae SP9-BS68] (869 aa)
Score = 238, Expect = 8.9e-18, Identities = 103/323 (31%), Positives = 163/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S +L  +E + LK   E + TPKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    56 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSERLA-SECKALKILNEWSETPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 381
>gi|149011577|ref|ZP_01832773.1| hypothetical protein CGSSp19BS75_06412 [Streptococcus pneumoniae SP19-BS75] >gi|147764008|gb|EDK70940.1| hypothetical protein CGSSp19BS75_06412 [Streptococcus pneumoniae SP19-BS75] (467 aa)
Score = 238, Expect = 9.2e-18, Identities = 100/323 (30%), Positives = 162/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKILDKREIGKHC-----------------PNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+     ++  + ++D+  +G                    P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S +L  +E + LK   E +  PKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    19 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPS--RDDEKKVVIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSERLA-SECKALKILNEWSEMPKIYWYGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 344
>gi|29899142|gb|AAP03109.1| putative serine/threonine protein kinase [Streptomyces griseochromogenes] (909 aa)
Score = 237, Expect = 1.1e-17, Identities = 74/253 (29%), Positives = 135/253 (53%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKL----KDFKGPSVLTDKSFK-NSCIHYRYGGFKS-DYIYNERNEKIL----------DKREIGKHCPNFI-KDPLTEKQN---NNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGL-NEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYEN 292
           QGWK+H+S+T  +   +L    +      + FKF    A   +   +  +R S GKFIT+Y        D  +AL D+L    +   GP +L+D+ ++  S +HYR+G F     + NE + + +          D+RE     P++  +DP T ++    + D + +    L ++Y + + +  +  GG+Y A D  + +RV+ +K+ RP+    +     +    +E   L++F     TP+ +  F ++  LF+V+E I GLTL+D+  +N
  S:    49 QGWKLHISATPLSAPLVLARAADVLAAHRLPFKFAGTLARVAELCSRRTDRGSGGKFITVYPDGHD---DRLRALADELHLTTEGLPGPGILSDRPYRPGSLVHYRFGAFNGVPMLGNEASYEAMLMAPDGSLDRDRREAWFCPPSWAPRDPFTGQRPASPDPDRAGARPVRLDDRYVVHEVVRHAFTGGVYRATDERDGSRVI-VKQARPHTEATATGEDVRDARRHEAAMLEHFASFGRTPRPVALFEQQGDLFLVQEAIAGLTLRDWVAQN 318
>gi|116515683|ref|YP_816646.1| hypothetical protein SPD_1179 [Streptococcus pneumoniae D39] >gi|116076259|gb|ABJ53979.1| conserved hypothetical protein [Streptococcus pneumoniae D39] (869 aa)
Score = 235, Expect = 2.0e-17, Identities = 103/323 (31%), Positives = 162/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E +  PKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    56 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSEAPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 381
>gi|15903248|ref|NP_358798.1| hypothetical protein spr1205 [Streptococcus pneumoniae R6] >gi|15458839|gb|AAL00009.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] (878 aa)
Score = 235, Expect = 2.2e-17, Identities = 103/323 (31%), Positives = 162/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E +  PKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    65 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSEAPKIYWHGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 390
>gi|148997605|ref|ZP_01825210.1| hypothetical protein CGSSp11BS70_01917 [Streptococcus pneumoniae SP11-BS70] >gi|147756660|gb|EDK63701.1| hypothetical protein CGSSp11BS70_01917 [Streptococcus pneumoniae SP11-BS70] (869 aa)
Score = 232, Expect = 4.1e-17, Identities = 103/323 (31%), Positives = 163/323 (50%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S KL  +E + LK   E + TPKI        H F+  E++ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    56 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSEKLA-SECKALKILNEWSETPKIYWHGKIWEHTFLGIEYMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 381
>gi|148985707|ref|ZP_01818861.1| hypothetical protein CGSSp3BS71_04799 [Streptococcus pneumoniae SP3-BS71] >gi|147922188|gb|EDK73310.1| hypothetical protein CGSSp3BS71_04799 [Streptococcus pneumoniae SP3-BS71] (467 aa)
Score = 231, Expect = 6.3e-17, Identities = 102/323 (31%), Positives = 161/323 (49%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNER---------NEKILDKR------EIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY--LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTD--KNVLKVIKNLVLIIIDIL-KFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNE 362
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +    I+ RYG F+      ++         +E + D+R        G   P+F+   L +K     D     F++ N      AI FSN GGIY A  L  + + +++KE RPY  LG +  ++S +L  +E + LK   E +  PKI        H F+  EH+ G+ L  +   N  LY E  D  K+ L  +  +V  +ID+  KF+    S N    D+ L N L   +++ +     +++  N+E
  S:    19 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQKLESALKQYNGPYILSDKRWDEVPIYLRYGVFRPSRDDEKKVAIDELIVGDEVVKDERLPVFKIPKGIVPPDFLNKWLDKKDKKQGD---FPFIIDN------AIRFSNSGGIYNA-RLKEDGKKIILKEARPYTGLGFDGTYSSERLA-SECKALKILNEWSEMPKIYLYGKIWEHTFLGIEHMKGVPLNRWVTNNFPLY-EVVDKTKDYLLRVSKIVEKLIDLTNKFH----SENVYHQDLHLGNILVKDEDEISIIDWEQAVFSNDE 344
>gi|116513183|ref|YP_812090.1| Serine/threonine protein kinase [Lactococcus lactis subsp. cremoris SK11] >gi|116108837|gb|ABJ73977.1| Serine/threonine protein kinase [Lactococcus lactis subsp. cremoris SK11] (614 aa)
Score = 230, Expect = 7.1e-17, Identities = 136/481 (28%), Positives = 227/481 (47%)
  Q:    25 KFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKS-DYIYNERNEKIL-DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVL--DIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKT-------FERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNI-LIKSNTLNSLLLN 505
           KFTY   +    LP  G+KIHVS T+++Y+++  +  N+   + + +K++    +FI+ + K      +GK  TIY ++          L + L  F+G  +L+D++F NS  + YR+G F++ D     +N KI  D ++     P +I DP  ++    ++         N  D+ K I  +N G IY        N+ +++KE R  +       S +L  NE    +    ++   + IE F+   + + V + IDG TL++F  + SL  F+   +N L +   ++  +I+IL       + +K+V+  DI   NFL D K  K +FIDLES H  NE   K        +L + +KL       +K+  L++ LI + N F    +S+ +T       FERF +  N       + +L+  ++    T   LE    L     D             ++L  +KE LEE KN +  IK N    L LN
  S:     3 KFTYFTTESY-KLPKYGFKIHVSVTIESYEEVFGLATNFLSKQELFYKYLSTREDFIENISKTAAPAESGKLFTIYPENIKATERILVDLSEILVKFEGVYILSDRNFNNSKTVFYRFGFFQNIDECTIVKNGKIWEDFQKTYFDLPAWISDPFYQENKEMNEKNRL-----NDLDLTKIIRQNNGGNIYFG---TVKNQKIIVKESRANILTFVNLKSEELRENEFFMSELLNSADFL-QPIEKFSAWINHYYVYKFIDGQTLREFQSKFSL--FDNLTENKLVIFSKIIKQLIEILG-----EAHHKMVILDDIHPDNFLID-KAYKIHFIDLESAHKFNE-LEKVTAKTKGFYLKIWSKLTETEKDLRKVGQLILFLIGQLNVFNQQERSLEETIILAAKIFERFEVETN-------ISDLLIYLFTGSSTKKALEISKKLYFYKSD-------------IFLHISKEYLEEPKNLVTFIKENKFEHLGLN 457
>gi|10957179|ref|NP_047334.1| hypothetical protein pMRC01_050 [Lactococcus lactis] >gi|3582249|gb|AAC56045.1| L. lactis predicted coding region ORF00050 [Lactococcus lactis] (614 aa)
Score = 224, Expect = 3.7e-16, Identities = 133/481 (27%), Positives = 222/481 (46%)
  Q:    25 KFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKS-DYIYNERNEKIL-DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIYFINNRWLSLNNKLRSKNVLQKKLSILMIELICKSNNFLYLAKSINKT-------FERFYIFANNYKLPLILVELINKMYYSKKTIDPLEFISNLKNIDWDNYEVFVNKNNDIKLYLQFNKETLEEIKNNI-LIKSNTLNSLLLN 505
           KFTY   +    LP  G+KIHVS+T+++Y+++ D+   Y L + + +K++    +FI+ + K      +GK  TIY ++        + L + L  F    +L+D++F +S  + YR+G F++ D     RN KI  D ++     P ++ DP  +++   ++         N  D+ K I  +N G IY        N+ +++KE R  +       S +L  NE    ++   +N +  I +     NH +V +  IDG TL++F    SL      DK V+        II  +++  +     N ++ DI   NFL D K  K +FIDLE  H  +E+  K        +L   +KL       +K+  L++ L+ + N F    +S+ +T       FERF +  N       + EL+  ++    T   LE    L     D             ++L  +KE LEE KN +  IK N   +L LN
  S:     3 KFTYFTTERY-KLPKYGFKIHVSATVESYEKVFDLTKRYLLKQKLYYKYLSTREDFIKNISKTEFPAESGKLFTIYPENIKAAEKILEDLSEILVKFDRVYILSDRNFHSSKTVFYRFGFFQNIDGCTLVRNGKIWKDFQKTYFDLPAWLVDPFYQEKKELNEKNRL-----NDLDLTKIIRQNNGGNIYFG---TLKNQKIIVKESRANILTFVNLKSEELRKNEFLMSEFLNSANFSQPIEKFRAWINHYYVYK-FIDGQTLREFQSNFSLFDNLTVDKLVI-----FSTIIQQLIEILEEAHHKNVILDDIHPDNFLID-KANKIHFIDLEFAHKFDES-RKVTAKTEGFYLKSWSKLTEMKKDLRKVGQLILFLVGQLNVFNQQERSLEETIILAAKIFERFEVKTN-------ISELLTYLFTGSSTKKALEISKKLYFYKSD-------------VFLHISKEYLEEPKNLVTFIKENKFENLGLN 457
>gi|55820281|ref|YP_138723.1| putative protein kinase [Streptococcus thermophilus LMG 18311] >gi|55822171|ref|YP_140612.1| putative protein kinase [Streptococcus thermophilus CNRZ1066] >gi|55736266|gb|AAV59908.1| conserved hypothetical protein, putative protein kinase [Streptococcus thermophilus LMG 18311] >gi|55738156|gb|AAV61797.1| conserved hypothetical protein, putative protein kinase [Streptococcus thermophilus CNRZ1066] (779 aa)
Score = 206, Expect = 4.0e-14, Identities = 83/256 (32%), Positives = 126/256 (49%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYG--GFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLG--LNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDG----LTLKDFFYEN 292
           +P QGWKIH+SS LD+YQ +L + + YC    I FK+I N+      L         GK ITIY K++    +    L D L  F+GP V++D  ++++ I YRYG    +SDY+       I+D R   +  PN I+DP    +N ND+  +    L    +    I+ S  G +Y +   Y+ N  +L +  +  LG     NST +G   NE + +K        PK   SF E  + ++V   + G    L    F +E+
  S:    32 IPRQGWKIHISSNLDSYQIVLRLIVEYCTKYKIDFKYIYNNKVLKYFLSSDCFTTQAGKCITIYPKNDKLFKNIVLDLADILIGFEGPVVISDMQYRDTNIFYRYGVMAAQSDYLLIG-GTPIMDNRSFFE-LPNGIEDPF---ENINDEYHNVATFLGCTVEPTMIIHESASGNVYESK--YDGNVTILKEGRKNILGT----NSTAIGDIKNEEKIIKQLETLEGIPKYRLSFYEWGNYYLVESKLKGDMLSLIASSFLFES 284
>gi|47078474|gb|AAT09884.1| OsrE [Streptococcus thermophilus] (779 aa)
Score = 206, Expect = 4.1e-14, Identities = 83/256 (32%), Positives = 126/256 (49%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYG--GFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLG--LNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDG----LTLKDFFYEN 292
           +P QGWKIH+SS LD+YQ +L + + YC    I FK+I N+      L         GK ITIY K++    +    L D L  F+GP V++D  ++++ I YRYG    +SDY+       I+D R   +  PN I+DP    +N ND+  +    L    +    I+ S  G +Y +   Y+ N  +L +  +  LG     NST +G   NE + +K        PK   SF E  + ++V   + G    L    F +E+
  S:    32 IPRQGWKIHISSNLDSYQIVLRLIVEYCTKYKIDFKYIYNNKVLKYFLSSDCFTTQAGKCITIYPKNDKLFKNIVLDLADILIGFEGPVVISDMQYRDTNIFYRYGVMAAQSDYLLIG-GTPIMDNRSFFE-LPNGIEDPF---ENINDEYHNVATFLGCTVEPTMIIHESASGNVYESK--YDGNVTILKEGRKNILGT----NSTAIGDIKNEEKIIKQLETLEGIPKYRLSFYEWGNYYLVESKLKGDMLSLIASSFLFES 284
>gi|148986246|ref|ZP_01819167.1| hypothetical protein CGSSp3BS71_07826 [Streptococcus pneumoniae SP3-BS71] >gi|147921791|gb|EDK72920.1| hypothetical protein CGSSp3BS71_07826 [Streptococcus pneumoniae SP3-BS71] (249 aa)
Score = 202, Expect = 1.4e-13, Identities = 71/220 (32%), Positives = 119/220 (54%)
  Q:    92 STGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTD-KSFKNSCIHYRYGGFKSDYIYNERNEKIL-------------DKREIGKHCPNFIKDPLTEKQNNN----DDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINS--FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFF--YENSLLYFEPTDKNVLKVIKNL 311
           +  KFIT+Y K E E       L ++L +FK P +L+D +   +S +HYRYG F     Y+E+N+K++             DKR+     PN+  D  +E++  N        SS     NKY + K I  SN G +Y A    +  +V+ IK+ RP++  ++   W +     NE   LK   + + T  + + F   +  F+V+E +DGL  ++F    E+SL   E T  N++ ++ ++
  S:     4 TANKFITLYPKSESEAKSMICNLTNRLSEFKAPKILSDYQCGMHSPVHYRYGAFLKKQAYDEKNKKVIYLLLDEKRKNYVEDKRQNFPSLPNWKMDLFSEEEKRNYFQTTCEISSKDSAINKYKMEKIIKRSNKGNVYRAIRKSDGQKVI-IKQSRPFVNYDAEGEWTALDDIKNEAHMLKKLADKSYTTNLTDEFYIVDDYFLVQEQVDGLNFEEFIRETEHSLNIREKTLDNIVNIVSDI 244
>gi|116334440|ref|YP_795967.1| Serine/threonine protein kinase [Lactobacillus brevis ATCC 367] >gi|116099787|gb|ABJ64936.1| Serine/threonine protein kinase [Lactobacillus brevis ATCC 367] (850 aa)
Score = 190, Expect = 2.9e-12, Identities = 84/320 (26%), Positives = 143/320 (44%)
  Q:    36 SLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCK--DEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNEKIL-----------DKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLE 355
           +L NQGWKIHVSST   + + LD   +     +  FK        +          +TGK ITIY K   +IEL      LY    +   P + TD  +K+S I  RYG F   Y+ +++ E +L           DKR  G H P+F+K P         + F     +       + +  S  G IY    L      +L + +   L +     S    LNE   L    +    P+++   T  + +F++   + G++L++ F  +S+L     D  ++K+ KNL+  I+++ +       +  ++ D+  SN L + +  + + +D E
  S:    40 NLSNQGWKIHVSSTATEFLESLDAVTSVVRKYDASFKIPRTWHAMLSLTTGAVPLVTTGKMITIYPKQKSDIELETIVNELYRTQNNKLFPPIFTDYQYKDSNIFLRYGSFIEQYVLDDKQEPLLALFDESNVLIPDKRVFGAHTPSFVKVP-----RFITNYFPKRTTMQFPLTQPRLLQRSAKGNIYKV--LTPKGPALLKQGYNGSLAVRGNDTSANRVLNEANILHNIPDYVHKPRVLGISTTSDSVFMLESFMPGVSLENIF-TSSVLIKTMLDTMIIKIAKNLMNQILEVHR-------AGVVIRDLSPSNVLVN-EYGQVFLVDFE 356
>gi|148271857|ref|YP_001221418.1| putative serine/threonine-protein kinase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147829787|emb|CAN00706.1| putative serine/threonine-protein kinase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (884 aa)
Score = 182, Expect = 3.1e-11, Identities = 63/246 (25%), Positives = 107/246 (43%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGK-FITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNE-----------KILDKREIGKHCPNFIKDP-LTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKL-GLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDG 282
           LP  GWK+HVS+T D ++ +       C ++ + FK + +    +    K+  R  +GK F+    +   E       L   L  + GP VL+D     + +  R+G F   +      E            + D+R  G H P  ++ P   E++     +      L   Y I  A++FSN GG+Y A     + R +++KE RP  GI+   +   +    E   L         P I+E+   + H ++    +DG
  S:    61 LPASGWKVHVSATPDAFEPVARAAAGVCADRGVPFKVLADRRMHLVMNSKYTPRGGSGKAFVAYPPQSGGEFERFVDELEQALVGYPGPRVLSDIRISRAPVFARFGAFTDRWGLGADGELFRGLDLPGRGVVPDRRMPGAHVPEGVEVPDWLERRRRGSGA------LEAGYSITGALHFSNAGGVYSAEGA--DGRALVVKESRPGAGIDVDGDDAVVRSEREAAALGRLDGMAGVPSIVETTEVDGHRYLATTRLDG 312
>gi|168486073|ref|ZP_02710581.1| conserved hypothetical protein [Streptococcus pneumoniae CDC1087-00] >gi|183570876|gb|EDT91404.1| conserved hypothetical protein [Streptococcus pneumoniae CDC1087-00] (831 aa)
Score = 178, Expect = 8.2e-11, Identities = 83/268 (30%), Positives = 128/268 (47%)
  Q:    21 YTKNKFTYVNYKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTD-KSFKNSCIHYRYGGFKSDYIY------------NERNEKILDKREIGKHCPNFIKDPLTEKQNN-----NDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIE----QLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDF 288
           Y KN + +V Y   ++   QGWK+HVSS L +   I  I       +   +K +       +         +  KFITIY     +       L +KL+ +K P +L+D +  + S IHYRYG FK+   Y            N R E + D R    + P  +KD  T+ + N     + +   +H L  N Y+I   +  SN G +Y A +  +N +V+ IK  RPY+     WN     ++E++     LK F + + T  +IE F      FVV++ I G    D 
  S:    10 YHKNGWLFVKYS--NNKLTQGWKLHVSSQLKDACNIFYIVAQELEKERCNYKVLDCLDELKKLNSPREVSPTANKFITIYPSSRKQAKRIILNLKEKLEKYKAPRILSDFQCGEYSPIHYRYGAFKAIKNYNFSENKIVYMMKNSRGELVEDLRLSYPYLPEGVKDLFTDMEKNKLFKPSPEIPENHPL--NHYNIECILKKSNRGNVYRAIEKSSNQKVI-IKHARPYV---YSWNDGFSAIDELKSEAANLKVFQDKSYTTDLIEEFYVNEDYFVVQKFIPGYNFFDL 291
>gi|149006676|ref|ZP_01830362.1| hypothetical protein CGSSp18BS74_05442 [Streptococcus pneumoniae SP18-BS74] >gi|147761591|gb|EDK68555.1| hypothetical protein CGSSp18BS74_05442 [Streptococcus pneumoniae SP18-BS74] (138 aa)
Score = 151, Expect = 1.1e-07, Identities = 40/114 (35%), Positives = 56/114 (49%)
  Q:    31 YKLIDSLPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTD-KSFKNSCIHYRYGGF 144
           Y L D +P QGWKIH+SS + +   I  I        N  FK + N     +         +  KFIT+Y K E E       L ++L +FK P +L+D +   +S +HYRYG F
  S:    24 YYLSDKVPAQGWKIHISSQIKDAVNIFKIVYKLSQLNNCSFKVVKNLEELKKINSPREMSPTANKFITLYPKSESEAKSMICNLTNRLSEFKAPKILSDYQCGMHSLVHYRYGAF 138
>gi|134101146|ref|YP_001106807.1| hypothetical protein SACE_4613 [Saccharopolyspora erythraea NRRL 2338] >gi|133913769|emb|CAM03882.1| hypothetical protein [Saccharopolyspora erythraea NRRL 2338] (864 aa)
Score = 148, Expect = 2.2e-07, Identities = 73/307 (23%), Positives = 133/307 (43%)
  Q:    37 LPNQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHH----NRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSF-KNSCIHYRYGGFKSDYIYNERNEKIL------DKREIGK-----HCPNFIKDPLTEK--QNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLG---LNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFD 343
           +P QGWK+HVS+      + LD  +   L+++  FK     A  + TL++ +    +  + GK +T+Y   +  ++     L + L     P + +D+   +++ ++YRY  F+  +  ++  +  L       + E G       CP++  DP   +        +  +H  L  +Y +   +     G +Y A D   + R V++KE R Y+  N   N   L     NE   L         P +I+ F      ++V        L  F  E+ L + EP D       ++L L+   +L   D       +V D+   N + D
  S:    45 IPAQGWKLHVSARPGTLAETLDRVLPLLLSRDCDFKV----AKSVSTLRELNSGDLDPGAVGKALTVY-PPQNSVVRLGNELAEALAGMSAPRIASDRRVRRDAPVYYRYAPFRPQFRVDDNGDFELVVIGPDGQTEAGAAGPEYSCPHWATDPFRPEPAPEAGRTAEPAHTTLGGRYRLTSGVMRGPRGNVYRAVD--PDGRQVVVKEARAYVSENV--NGMDLRGQMRNERRILHALDGVEGVPGLIDHFRHGEDEYLVTTDAGTRDLNRFVGEHGLFFDEPGDTG-----RDLGLLAERLLAVLDAVHERGVVVRDLSPKNIVLD 358
>gi|149002710|ref|ZP_01827642.1| hypothetical protein CGSSp14BS69_04798 [Streptococcus pneumoniae SP14-BS69] >gi|147759321|gb|EDK66314.1| hypothetical protein CGSSp14BS69_04798 [Streptococcus pneumoniae SP14-BS69] (217 aa)
Score = 148, Expect = 2.3e-07, Identities = 38/106 (35%), Positives = 57/106 (53%)
  Q:    40 QGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFK 145
           QGWKIH+SS  ++  ++L      C    I FK +  +  FI    K  +R  +GKFIT Y  ++ EL    + L   LK + GP +L+DK +  + I+ RYG F+
  S:    55 QGWKIHISSEYNSSHELLQDVAKICHEMRIPFKHLSTEDKFIMRNGKLVSRGFSGKFITCY-PNQNELESVLQRLESALKQYNGPYILSDKRWDEAPIYLRYGVFR 159
>gi|116513485|ref|YP_812391.1| serine/threonine kinase protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092800|gb|ABJ57953.1| serine/threonine protein kinase and beta-lactam (PASTA) domains [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (445 aa)
Score = 135, Expect = 8.4e-06, Identities = 79/316 (25%), Positives = 139/316 (43%)
  Q:    39 NQGWKIHVSSTLDNYQQILDICINYCLNKNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNSC-IHYRYGGFKSDY-IYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQL---------KYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVL-DIKLSNFLFDCKNKKTYFIDL 354
           N GWKIH+S+ L N  QI    +      +  FK I +     Q    +      GKFITIY  D+  + +  + LY    D  G  V +D S+K    ++YRYG    D    ++R++K+     + K     I D   E+ N+          L  +Y I KAI  +   G+ LA DL    +V++          + ++N    G++E ++L          +   S+    ++++F   +  FVV E+  G  L +      L  +  +++  L++ +N++  I        + ++ N ++  D+  SN +  C N     ID 
  S:    39 NYGWKIHISAILTNAIQIARKFLTLNQKYHFDFKIISSIPYLEQMNMGYFGNSQVGKFITIY-PDQSAVTETLELLYYYFHDDVGIRVGSDISYKQGLNVYYRYGTLLDDVENIDKRDKKLKPSSNVEK-----IYDYRLERYNS----------LPTRYLILKAIKQNGPSGVLLALDLQTKLKVIIRYA-------DKYYNIESAGIDERDRLISASSLLEKDFVRNSSFFETVVDAFYVNDVFFVVTEYASGYNLDELAKNGQLGLYSLSER--LEIFRNVLRGI--------YVLNDNLIIFRDLSFSNVIL-CPNHTIKIIDF 332
>gi|113476216|ref|YP_722277.1| serine/threonine protein kinase [Trichodesmium erythraeum IMS101] >gi|110167264|gb|ABG51804.1| serine/threonine protein kinase [Trichodesmium erythraeum IMS101] (415 aa)
Score = 132, Expect = 1.9e-05, Identities = 46/170 (27%), Positives = 84/170 (49%)
  Q:   190 FLLHNKYDIFKAIYFSNHGGIYLAYDLYNN--NRVVLIKEFRPYLG-INSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHD 359
           FL   +Y+I K +   + G  Y+A + ++   N+ V+IK+ +P      +  N+ +L   E+E LK        P  I++F E N  ++V+E+I G   KD   E      +P +K        ++ ++IDIL+  DF   +  +  DIK SN +   ++ +   ID  ++ +
  S:     2 FLKKGQYEIIKTLTAGSFGQTYIAINKHSQPPNQEVVIKKLKPQQNDPYTLQNAERLFKKEVESLKKLGYHKQIPTYIDNFEENNEFYLVQEYIKG---KDLTEE-----LKPGNK---LSESEVIHLLIDILEVLDFVHKNGVIHRDIKPSNLMRRTEDNQIVLIDFGAVKE 163
>gi|119512035|ref|ZP_01631130.1| serine/threonine kinase [Nodularia spumigena CCY9414] >gi|119463325|gb|EAW44267.1| serine/threonine kinase [Nodularia spumigena CCY9414] (383 aa)
Score = 125, Expect = 1.0e-04, Identities = 49/192 (25%), Positives = 83/192 (43%)
  Q:   163 IGKHCPNFIKDPLTEKQNNNDDSF----SSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRV-VLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL 354
           +  HCP        + +N  D  F     S  LL ++Y   K I     G  +LA D    ++   +IK+F P   G N+   + +L   E  QL    +    P ++  FT+++  ++V+E I+G  L     +N       ++  + ++++       D+L    FC S   +  DIK  N L D  N K   +D 
  S:     5 LNSHCP--------QPENAADAKFCLSCGSKLLLKDRYRAIKPIGQGGFGKTFLAVDEDKPSKPPCVIKQFYPQAQGTNTLQKAVELFTQEAVQLDDLGQHPQIPALLAYFTQDDRQYLVQEFINGQNLAQELAQNGAF----SESQIWQLLQ-------DLLPVLQFCHSRGVIHRDIKPENILRD-SNAKLVLVDF 182
>gi|67925225|ref|ZP_00518591.1| Protein kinase:Extracellular ligand-binding receptor [Crocosphaera watsonii WH 8501] >gi|67852937|gb|EAM48330.1| Protein kinase:Extracellular ligand-binding receptor [Crocosphaera watsonii WH 8501] (819 aa)
Score = 123, Expect = 1.8e-04, Identities = 43/174 (24%), Positives = 80/174 (45%)
  Q:   194 NKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWN-STKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKN 367
           N Y+I + +    +G  YL +D +N NR  +IK    +    +  N S K+   E++ LK   + +  P++ +SF  +N  F+V+E I+G  L            E    +       L++ ++++L+  DF     +   DIK SN +    ++K   ID  ++ + +  F  N
  S:    16 NTYEIIEELGSGGYGNTYLVHD-HNFNRKAVIKCIETHTTETNVINQSQKIFKKEVKNLKQLGQHDKIPELYDSFILDNKFFIVQELIEGHDL-----------IEEIKPDHHWTENKLIIFLVEVLEILDFVHKQGRTHQDIKPSNLMRRKSDQKIILIDFGAVKEISVLFEYN 178
>gi|186686328|ref|YP_001869524.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] >gi|186468780|gb|ACC84581.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] (378 aa)
Score = 122, Expect = 2.7e-04, Identities = 49/192 (25%), Positives = 84/192 (43%)
  Q:   163 IGKHCPNFIKDPLTEKQNNNDDSF----SSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRV-VLIKEFRPY-LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL 354
           +  HCP        + +N ND  F     S  LL  +Y   K I     G  +LA D    ++   +IK+F P   G N+   + +L   E  QL    +    P+++  FT+E+  ++V+E IDG  L        L +    ++  ++ + N      D+L    FC + + +  DIK  N +    ++K   +D 
  S:     5 LNPHCP--------KPENPNDVKFCRTCGSKLLLKERYRAIKPIGQGGFGRTFLAVDEDKPSKPRCVIKQFYPQSQGTNTLAKAIELFNQEAVQLDELGKHPQIPELLAYFTQEDRQYLVQEFIDGHNLA-----QELAHRGAFNETQIRQLLN------DLLSVLQFCHARHVIHRDIKPENIILRSGDRKLVLVDF 183
>gi|193807719|emb|CAQ38423.1| Ser/Thr protein kinase, putative [Plasmodium knowlesi strain H] (1691 aa)
Score = 122, Expect = 2.7e-04, Identities = 56/198 (28%), Positives = 90/198 (45%)
  Q:   153 RNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNK-YDIFKAIYFSNHGGIYLAYDLYNNNRV---VLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTY 350
           + E I D R +  H  +F     T  + ++    + +   +NK Y I   IY      +Y   ++ N       V++KE R    +N F+            LK+    N  P I + F E+N+ F+V E+ +G TL D+F   SL+      + +  ++KNL+L +       DF  S N +  DIKL N +F  K K+ Y
  S:  1091 KEESIKDGR-VKSHVEDFPNWTTTPLEMSSSICLNPNCTYYNKMYCIVGLIYCGEKSQVYKCMNVLNKKTYAMKVIVKEERDDHHMNEFFQKYLF-------LKHNRHRNVIP-IYDIFDEDNYNFIVMEYCEGCTLLDYFM--SLVPGSLDIQEIKYIMKNLLLGL-------DFLHSHNIIHRDIKLENIMFKRKRKRDY 1274
>gi|17232160|ref|NP_488708.1| serine/threonine kinase [Nostoc sp. PCC 7120] >gi|17133805|dbj|BAB76367.1| serine/threonine kinase [Nostoc sp. PCC 7120] (560 aa)
Score = 122, Expect = 2.8e-04, Identities = 33/125 (26%), Positives = 58/125 (46%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLII 315
           +L N+Y I + +     G  YLA D    N +  IKE  P       W   +   +    + Y  E+   PK  E F ++  LF+V++++ G T  D   E   +    T+  VL++I++L+ ++
  S:    10 VLQNRYRIVQILGQGGFGRTYLAEDQRRFNELCAIKELIPTATGTVAWEKAQELFHREAAILYQIENPQVPKFREKFEQDQRLFLVQDYVAGKTYWDILKERQAIGQAFTELEVLQLIRSLLPVL 134
>gi|196257611|ref|ZP_03156147.1| serine/threonine protein kinase [Cyanothece sp. PCC 7822] >gi|196201211|gb|EDX96030.1| serine/threonine protein kinase [Cyanothece sp. PCC 7822] (445 aa)
Score = 119, Expect = 5.8e-04, Identities = 30/95 (31%), Positives = 50/95 (52%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTK---LGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTL 285
           LL N+Y + K +     G  YL  DL   N + ++K+  P   +   W   K   L   E ++L+   + N TP +   F E+N+L++V+E+I+G  L
  S:    31 LLRNRYRVIKPLGGGGFGRTYLIEDLDKLNELCVLKQLAPQ--VQGSWARQKAIELFEQEAKRLQQLGKQNQTPTLYAYFKEDNYLYLVQEYIEGQNL 126
>gi|158339437|ref|YP_001520614.1| serine/threonine protein kinase, putative [Acaryochloris marina MBIC11017] >gi|158309678|gb|ABW31295.1| serine/threonine protein kinase, putative [Acaryochloris marina MBIC11017] (606 aa)
Score = 116, Expect = 1.4e-03, Identities = 27/105 (25%), Positives = 51/105 (48%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLL 295
           LL ++Y I K I     G  YLA D+ N + + ++K+              +L L E +QL+   ++   P ++  F +  H ++V+E +DG  L++   +N + 
  S:    30 LLRHRYKILKPIGQGGFGKTYLAEDIDNFHELCVVKQLICPTQDQQIEKKLQLFLREAQQLQKLKQNPQVPSLLAYFEDNQHPYLVQEFVDGQNLQEELEQNGIF 134
>gi|149006677|ref|ZP_01830363.1| hypothetical protein CGSSp18BS74_05447 [Streptococcus pneumoniae SP18-BS74] >gi|147761592|gb|EDK68556.1| hypothetical protein CGSSp18BS74_05447 [Streptococcus pneumoniae SP18-BS74] (176 aa)
Score = 116, Expect = 1.4e-03, Identities = 46/160 (28%), Positives = 81/160 (50%)
  Q:   152 ERNEKILDKREIGKHCPNFIKDPLTEKQNNN----DDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSF--WNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFF--YENSLLYFEPTDKNVLKVIKNL 311
           +R   + DKR+     PN+  D  +E++  N        SS     NKY + K I  SN G +Y A    +  +V+ IK+ RP++  ++   W +     NE   LK   + + T  + + F   +  F+V+E +DGL  ++F    E+SL   E T  N++ ++ ++
  S:     5 KRKNYVEDKRQNFPSLPNWKMDLFSEEEKRNYFQTTCEISSKDSAINKYKMEKIIKRSNKGNVYRAIRKSDGQKVI-IKQSRPFVNYDAEGEWTALDDIKNEAHMLKKLADKSYTTNLTDEFYIVDDYFLVQEQVDGLNFEEFIRETEHSLNIREKTLYNIVNIVSDI 171
>gi|186686630|ref|YP_001869826.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] >gi|14574708|gb|AAK68687.1| PknC [Nostoc punctiforme] >gi|186469082|gb|ACC84883.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] (632 aa)
Score = 115, Expect = 1.5e-03, Identities = 34/167 (20%), Positives = 75/167 (44%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYN-NNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESI 357
           LL ++Y + + +     G  Y+A D     N + ++K  +P      F  + +L  +E E L+     +  P+++  F E    ++V+E+I+G TL +            ++  V+++++       ++L+  +F  S   +  DIK  N +    + K   +D  ++
  S:     5 LLDHRYQVIRVLAMGGFGQTYIAQDTRRPGNPICVVKHLKPGTDPRVFDTAKRLFNSEAETLEKLGNHDQIPRLLAYFDENQEFYLVQEYIEGHTLAEELTPGK----RWSESQVIQLLQ-------EVLEILEFVHSQGVIHRDIKPDNIIRRASDNKLVLVDFGAV 161
>gi|186685827|ref|YP_001869023.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] >gi|186468279|gb|ACC84080.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] (416 aa)
Score = 115, Expect = 1.5e-03, Identities = 47/177 (26%), Positives = 77/177 (43%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPY----LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL---ESIHDNNETFNKN 367
           L+ N+Y I K +     G  YLA+D    N   ++KEF P      G+  + N  K     + QL++       PK +  F  +  LF+V+E++DG T      E        ++  V++ +KNL+ ++       ++    N +  DI   N +          ID    + I D NE  N N
  S:    16 LIDNRYIIQKLLGQGGLGRTYLAFDTRRFNEACVLKEFAPIGTGESGLEQYRNLFKREAKILHQLQH----PQIPKFLACFEGDGRLFLVQEYVDGKTYSRLLGELQRQGRNFSEDEVIQWLKNLLPVL-------EYVHQHNIIHRDISPDNIMLPDGKHLPVLIDFGVGKQIADMNEGRNSN 188
>gi|75908216|ref|YP_322512.1| Serine/threonine protein kinase [Anabaena variabilis ATCC 29413] >gi|75701941|gb|ABA21617.1| serine/threonine protein kinase [Anabaena variabilis ATCC 29413] (560 aa)
Score = 115, Expect = 1.6e-03, Identities = 32/125 (25%), Positives = 57/125 (45%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLII 315
           +L N+Y I + +     G  YLA D    N +  IKE  P       W   +   +    + Y  E+   PK  E F ++  LF+V++++ G T  D   E        T+  VL+++++L+ ++
  S:    10 VLQNRYRIVQILGQGGFGRTYLAEDQRRFNELCAIKELIPTATGTVAWEKAQELFHREAAILYQIENPQIPKFREKFEQDQRLFLVQDYVAGKTYWDILTERQATGKAFTELEVLQLMRSLLPVL 134
>gi|186682687|ref|YP_001865883.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] >gi|186465139|gb|ACC80940.1| serine/threonine protein kinase [Nostoc punctiforme PCC 73102] (577 aa)
Score = 114, Expect = 2.3e-03, Identities = 33/125 (26%), Positives = 55/125 (44%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLII 315
           +L N+Y I + +     G  YLA D    N +  IKE        S W   K   +    + Y  E    PK  E F ++  LF+V +++ G T +    E   +    T+  VL++I+ L+ ++
  S:    10 VLQNRYRIIQILGQGGFGRTYLAEDQRRFNELCAIKELISTATEASAWEKAKELFHREAAILYQIEHPQVPKFRERFEQDQRLFLVEDYVAGQTYRAMLAERQAVAKTFTEAEVLQLIQLLLPVL 134
>gi|119487581|ref|ZP_01621191.1| Serine/Threonine protein kinase with WD40 repeats [Lyngbya sp. PCC 8106] >gi|119455750|gb|EAW36886.1| Serine/Threonine protein kinase with WD40 repeats [Lyngbya sp. PCC 8106] (584 aa)
Score = 113, Expect = 2.5e-03, Identities = 37/151 (24%), Positives = 72/151 (47%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFL 341
           LL  ++ I K +     G  YLA D    N   ++K+F P + G  +   + +L   E  QL+   + +  P +   F + N L++++E+++G  L +   E   ++ E       + +KNL+L ++ +++F       N +  DIK  N +
  S:     6 LLRGRFRIIKLLGQGGFGRTYLAEDYDKLNEYCVVKQFVPSVQGTAALQKAIELFEREARQLQQLGKHDQIPTLSAYFEDNNQLYLLQEYVEGENLSELL-EQQGVWNE-------QQVKNLLLSLLPVIEFIH---QKNVIHRDIKPENII 146
>gi|196257574|ref|ZP_03156110.1| serine/threonine protein kinase [Cyanothece sp. PCC 7822] >gi|196201174|gb|EDX95993.1| serine/threonine protein kinase [Cyanothece sp. PCC 7822] (495 aa)
Score = 112, Expect = 3.8e-03, Identities = 37/145 (25%), Positives = 70/145 (48%)
  Q:   197 DIFKAIYFSNHGGIYLAYDLYNNNRV---VLIKEFRPYLG-INSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYF-EPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFL 341
           D ++A+ +   GG    ++  + +R+    +IK+F P+ G   S   +T+L   E EQL+   +    P ++  F ++  L++++E+I+G   +D   E+    F E   + +LK          D+L    F    N +  DIK  N +
  S:    34 DHYRAVRYIGEGGFGRTFEAVDEDRLNTPCVIKQFLPFQGGTQSLNKATELFKREAEQLRELGKHPQIPDLLSYFEQDGRLYLIQEYIEG---QDLLKEHQQGRFSEAKTRQLLK----------DLLPILQFIHQKNVIHRDIKPENII 170
>gi|113475717|ref|YP_721778.1| serine/threonine protein kinase [Trichodesmium erythraeum IMS101] >gi|110166765|gb|ABG51305.1| serine/threonine protein kinase [Trichodesmium erythraeum IMS101] (540 aa)
Score = 111, Expect = 4.3e-03, Identities = 48/202 (23%), Positives = 84/202 (41%)
  Q:   163 IGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDL-YNNNRVVLIKEFRPY-LGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDN-NETF 364
           I   CP     P      N   +  S  +L ++Y I K I     G  +LA D+      + +IKE RP     +    + KL   E E L         P++++ F  +    +V+E++ GLTLK    +  +   E   K            +I++L   D+  +   +  DIK +N +   ++     ID  ++ D+ N+T+
  S:     5 INPACPQ----PQNLNSVNKCTACGSQLILRDRYKIIKPIGKGGFGVTFLAKDISLPGAPICVIKELRPSSTKASELEMARKLFQREAETLGKIGHHPQVPRLLDYFEWKKRFHLVQEYVSGLTLKQEVKKQGIFTEEQGKK-----------FLIEVLSVIDYIHTQGVIHRDIKPTNIIRRSEDGHLVLIDFGAVKDHVNQTY 194
>gi|75911051|ref|YP_325347.1| WD-40 repeat-containing serine/threonin protein kinase [Anabaena variabilis ATCC 29413] >gi|75704776|gb|ABA24452.1| serine/threonine protein kinase with WD40 repeats [Anabaena variabilis ATCC 29413] (676 aa)
Score = 111, Expect = 4.8e-03, Identities = 40/151 (26%), Positives = 76/151 (50%)
  Q:   191 LLHNKYDIFKAIYFSNHGGI---YLAYDLYNNNRVVLIKEFRPYLGINS-FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFL 341
           LL   Y I K +  S+ GG    YL+ D+   N + ++K+F P +  NS    + +L   E ++L++  E +  P ++  F ++N+LF+V++ I+G         N+LL  +   + V+     +V  ++D+L    +      +  DIK  N +
  S:    31 LLRGHYRIIKVL--SDEGGFGRTYLSEDIDKLNELCVVKQFAPKVQENSAMKKAVELFKQEAQRLQHLGEHHQIPTLLAYFEQDNYLFLVQQFING---------NNLL--QELRQGVVYNESTIVEFLLDLLPVLKYIHERGVIHRDIKPQNII 172
>gi|186908569|ref|ZP_02981445.1| serine/threonine protein kinase [Cyanothece sp. PCC 7424] >gi|186688259|gb|EDU12959.1| serine/threonine protein kinase [Cyanothece sp. PCC 7424] (384 aa)
Score = 109, Expect = 7.5e-03, Identities = 40/176 (22%), Positives = 86/176 (48%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYN-NNRVVLIKEFRPYLGIN-SFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEP-TDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNK 366
           L+ N+Y I + +   N G  Y+A DL+  N+ + ++K+F+P    + +F  + +L   E   L+        P +   F E N+L++V+E+IDG  L +      ++  +P  ++ ++K++K +++ +        +    N +  D+K  N +   +N     ID  ++   ++   K
  S:     9 LIANRYKIVRELGEGNFGKTYMAKDLHKPNHPLCVVKQFKPLQSEHGTFRTALRLFNQEAAILQQLGSHPDIPNLDAFFEENNNLYLVQEYIDGNVLSE-----EIIIGQPWQEEEIIKLLKQILIPL-------KYVHEKNIVHRDLKPDNLMRRAENGHIVLIDFGAVKQISQEIKK 175
>gi|75906309|ref|YP_320605.1| Serine/threonine protein kinase [Anabaena variabilis ATCC 29413] >gi|75700034|gb|ABA19710.1| serine/threonine protein kinase [Anabaena variabilis ATCC 29413] (461 aa)
Score = 109, Expect = 7.8e-03, Identities = 46/169 (27%), Positives = 80/169 (47%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNR-VVLIKEFRPYLGINSFWNSTK-LGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEP-TDKNVLKVIKNLVLIIIDILKFYDFCISSNKLV-LDIKLSNFLFDCKNKKTYFIDLESIHD 359
           LL  +Y I + +     G  Y+A D     +   ++K F+P      F  + + L  +E E L+     +  P+++  F E    F+V+E IDG +LK     N     +P T+K V+ +++      +DIL+F    I  +K++  DIK  N L    + K   ID  ++ +
  S:     5 LLVGRYQIRQMLGGGGFGKTYIALDTQRPGQPKCVVKHFQPVTHNPEFMETARRLFTSEAETLERLGYHDQIPRLLAYFEEHQEFFLVQEFIDGHSLKAEMPPN-----QPWTEKKVIALLQQ----ALDILQF----IHLHKVIHRDIKPENMLRRLHDGKLVLIDFGAVKE 164
>gi|17229751|ref|NP_486299.1| serine/threonine kinase [Nostoc sp. PCC 7120] >gi|17131350|dbj|BAB73958.1| serine/threonine kinase [Nostoc sp. PCC 7120] (461 aa)
Score = 109, Expect = 8.2e-03, Identities = 46/169 (27%), Positives = 80/169 (47%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNR-VVLIKEFRPYLGINSFWNSTK-LGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEP-TDKNVLKVIKNLVLIIIDILKFYDFCISSNKLV-LDIKLSNFLFDCKNKKTYFIDLESIHD 359
           LL  +Y I + +     G  Y+A D     +   ++K F+P      F  + + L  +E E L+     +  P+++  F E    F+V+E IDG +LK     N     +P T+K V+ +++      +DIL+F    I  +K++  DIK  N L    + K   ID  ++ +
  S:     5 LLVGRYQIRQMLGGGGFGKTYIALDTQRPGQPKCVVKHFQPVTHNPEFMETARRLFTSEAETLERLGHHDQIPRLLAYFEEHQEFFLVQEFIDGHSLKAEMPPN-----QPWTEKKVIILLQQ----ALDILQF----IHLHKVIHRDIKPENILRRLHDGKLVLIDFGAVKE 164
>gi|22298869|ref|NP_682116.1| serine/threonine protein kinase [Thermosynechococcus elongatus BP-1] >gi|22295050|dbj|BAC08878.1| serine/threonine protein kinase [Thermosynechococcus elongatus BP-1] (524 aa)
Score = 109, Expect = 8.2e-03, Identities = 47/187 (25%), Positives = 81/187 (43%)
  Q:   173 DPLTEKQNNND-----DSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDL-YNNNRVVLIKEFRPYLGINSFWN-STKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHD 359
           +P   K +N D      +  S  LL+++Y   K +     G  +LA D     N   +IK+ RP          + +L L E   L         P+++     EN  ++++E++ GLTL     +  +  F P  +  +K +   VL I+D L        +  +  DIK +N +    +KK   ID  ++ D
  S:     6 NPNCPKPDNPDGLDICQACGSKLLLNDQYRAIKVLGRGGFGTTFLAVDTKLPGNPTCVIKQLRPAATAPHILTMARELFLREATTLGKVGNHPQLPRLLGYLENENEFYLIQEYVGGLTL-----QQEVKRFGPKSEEEVKQVLQEVLPILDYLH------KNGVIHRDIKPANLIRRDIDKKLVLIDFGAVKD 188
>gi|75908742|ref|YP_323038.1| Serine/threonine protein kinase [Anabaena variabilis ATCC 29413] >gi|75702467|gb|ABA22143.1| serine/threonine protein kinase [Anabaena variabilis ATCC 29413] (376 aa)
Score = 108, Expect = 9.4e-03, Identities = 48/182 (26%), Positives = 77/182 (42%)
  Q:   173 DPLTEKQNNNDD-----SFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRV-VLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL 354
           +P   K  N  D     S  S   L  +Y   K I     G  +LA D    ++   +IK+F P   G N+   + +L   E  QL    +    P+++  FT+++  ++V+E IDGL L            E   K V    + + L + D+L    FC +   +  DIK  N +    + K   +D 
  S:     6 NPRCPKPENPHDVKFCLSCGSKLHLKERYRAIKPIGQGGFGRTFLAVDEDKPSKPRCVIKQFYPQAQGTNTVQKAVELFTQEAIQLDELGKHPQIPELLAYFTQDDRQYLVQEFIDGLNLAQ----------ELAHKGVFSETRTIQL-LNDLLPVLQFCHNRQVIHRDIKPENIILRNSDNKLVVVDF 183
>gi|119511567|ref|ZP_01630675.1| Serine/Threonine protein kinase [Nodularia spumigena CCY9414] >gi|119463802|gb|EAW44731.1| Serine/Threonine protein kinase [Nodularia spumigena CCY9414] (596 aa)
Score = 108, Expect = 9.8e-03, Identities = 39/169 (23%), Positives = 74/169 (43%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLY-NNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTES-NTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHD 359
           LL+N+Y + + +     G  +LA D +  + R  +IK+ +P       +   +     E   L+Y  +S N  PK+   F+E    ++V+E I G TL +           P  +  ++       I++ +L   D+  S   +  DIK  N +    + K + ID  ++ +
  S:     5 LLNNRYQVIQVLGAGGFGETFLAEDTHMPSRRRCVIKQLKPIANDPKTYQMIQQRFEREAATLEYLGDSCNQIPKLYAYFSENGLFYLVQEWIQGPTLTNIVEAKG-----PESETAVRE------ILLSLLSVLDYVHSKGIIHRDIKPDNIILRSADNKPFLIDFGAVKE 165
>gi|158338284|ref|YP_001519461.1| serine/threonine protein kinase, putative [Acaryochloris marina MBIC11017] >gi|158308525|gb|ABW30142.1| serine/threonine protein kinase, putative [Acaryochloris marina MBIC11017] (583 aa)
Score = 108, Expect = 1.0e-02, Identities = 44/173 (25%), Positives = 82/173 (47%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYN-NNRVVLIKEFRPYLGINSFWNSTKLGLNE----IEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNET 363
           LL+N++ I K +     G  YLA D +  + R  ++K+ +P +   S +        E    +EQLK+    +  P++   F +EN LF+++E +DG TL +       L  E   + +L+     VL +++ L+ +        +  DIK  N +    + +   ID  S+  + +T
  S:     2 LLNNRFRILKQLAKGGFGATYLAEDTHMLSRRHCVVKQLQPEVPNQSCYEIALKKFKEEAAVLEQLKH----DQIPQLYGYFEQENRLFLIQEWVDGPTLGEKVRALGQLSAEEVQQMLLR-----VLPVLEYLQNFKV------IHRDIKPDNLILRQVDSRPVLIDFGSMKRHLKT 164
>gi|75910306|ref|YP_324602.1| Serine/threonine protein kinase [Anabaena variabilis ATCC 29413] >gi|75704031|gb|ABA23707.1| serine/threonine protein kinase [Anabaena variabilis ATCC 29413] (496 aa)
Score = 108, Expect = 1.2e-02, Identities = 38/170 (22%), Positives = 70/170 (41%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDN 360
           L++ +Y I K +     G  YLA D    +   ++KEF P          +K       ++ Y  +    P+ +  FT+ +  F+V+E+IDG T  +  +E      +P  +  ++        + D+L   D+      +  DI L N +      K   ID  ++ +N
  S:    16 LIYGRYQIQKLLGKGGFGRTYLALDNQRFDEPCVLKEFVPTASQEKNVCKSKELFEREAKVLYKLKHPQVPQFLAWFTDSDRTFIVQEYIDGRTYSEILFERVSETGQPFSEIEVRT------WLTDVLPVLDYLHDRKIIHRDISLENIMLPHHQSKPVLIDFGAVKEN 179
>gi|17232770|ref|NP_489318.1| serine/threonine kinase [Nostoc sp. PCC 7120] >gi|17134417|dbj|BAB76977.1| serine/threonine kinase [Nostoc sp. PCC 7120] (376 aa)
Score = 107, Expect = 1.3e-02, Identities = 47/182 (25%), Positives = 79/182 (43%)
  Q:   173 DPLTEKQNNNDD-----SFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRV-VLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL 354
           +P   K  N  D     S  S   L  +Y   K I     G  +LA D    ++   +IK+F P   G N+   + +L   E  QL    +    P+++  FT+++  ++V+E IDGL L            E   K V +   +++ ++ D+L    FC +   +  DIK  N +    + K   +D 
  S:     6 NPRCPKPENPHDVKFCLSCGSKLHLKERYRAIKPIGQGGFGRTFLAVDEDKPSKPRCVIKQFYPQAQGTNTVQKAVELFTQEAVQLDELGKHPQIPELLAYFTQDDRQYLVQEFIDGLNLAQ----------ELAHKGVFQE-THIIQLLNDLLPVLQFCHNRQVIHRDIKPENIILRNSDNKLVVVDF 183
>gi|119491229|ref|ZP_01623326.1| hypothetical protein L8106_25475 [Lyngbya sp. PCC 8106] >gi|119453570|gb|EAW34731.1| hypothetical protein L8106_25475 [Lyngbya sp. PCC 8106] (628 aa)
Score = 107, Expect = 1.3e-02, Identities = 39/151 (25%), Positives = 70/151 (46%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLV-LDIKLSNFL 341
           +L   Y + K +     G  Y+A D+   N   ++K+F   + G  +   +T+L   E  QL+   +    P +   F E   LF+V+E+I+G TL     +   ++ EP        +K L+  ++ +LKF    +   K++  DIK  N +
  S:    31 ILRGHYRVIKLLGEGGFGRTYIAEDIDKLNEYCVVKQFTANVQGTGALNKATQLFEQEARQLQQLGKHPQIPTLYAYFEEGKQLFLVQEYIEGETLSQLVKKQG-VWKEPQ-------VKQLLENLLPVLKF----VHEQKVIHRDIKPDNII 171
>gi|113477755|ref|YP_723816.1| serine/threonine protein kinase [Trichodesmium erythraeum IMS101] >gi|110168803|gb|ABG53343.1| serine/threonine protein kinase [Trichodesmium erythraeum IMS101] (882 aa)
Score = 107, Expect = 1.3e-02, Identities = 41/169 (24%), Positives = 76/169 (44%)
  Q:   185 SFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNR-VVLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFID 353
           S     +L  +Y   K I     G  + A D    ++   +IK+F P   G  +   + KL   E E+L      +  P+++  FT+ N  ++V+E IDG  LK    E+       ++  +L+++K+L+ ++       +F  S   +  DIK  N +   K+ +   +D
  S:    28 SCGEKLVLRERYRPLKIIGEGGFGRTFQAVDEDKPSKPFCVIKQFFPQAQGTKNLEKAAKLFAQEAERLDGLGRHSQIPELLAYFTQNNRQYLVQEFIDGQNLKQELEESGAF----SENQILELLKSLLPVL-------EFIHSQQIIHRDIKPENIIRRRKDNQLVLVD 187
>gi|186682047|ref|YP_001865243.1| protein kinase [Nostoc punctiforme PCC 73102] >gi|186464499|gb|ACC80300.1| protein kinase [Nostoc punctiforme PCC 73102] (687 aa)
Score = 107, Expect = 1.3e-02, Identities = 34/114 (29%), Positives = 57/114 (50%)
  Q:   172 KDPLTEKQNNNDDSFSSHF--LLHNKYDIFKAIYFSNHGGI---YLAYDLYNNNRVVLIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTL 285
           + PL   +NN   S  +    LL  +Y   + +  S+ GG    YLA D++  N   ++K+F P L G      + +L   E  +L+   E    P ++  F +  +LF+V++ IDG  L
  S:    10 QKPLNPDKNNYCHSCRAELIPLLGGRYRPTQVL--SDEGGFGRTYLAEDVHKLNECCVVKQFAPKLQGTGPLTKAIELFKQEASRLQELAEHPQIPTLLAYFEQNGYLFLVQQFIDGKNL 127
>gi|156093723|ref|XP_001612900.1| calcium-dependent protein kinase 4, putative [Plasmodium vivax SaI-1] >gi|148801774|gb|EDL43173.1| calcium-dependent protein kinase 4, putative [Plasmodium vivax] (1615 aa)
Score = 107, Expect = 1.4e-02, Identities = 45/158 (28%), Positives = 73/158 (46%)
  Q:   193 HNK-YDIFKAIYFSNHGGIYLAYDLYNNNRV---VLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTY 350
           +NK Y I   IY      +Y   ++ N       V+++E R       F+ +          LK     N  P I + F E + +F+V E+ +G TL D+F   SL+      + +  ++KNL+L +       DF  S+N +  D+KL N +F  K K+ Y
  S:  1112 YNKIYRIVGLIYCGEKSQVYKCMNVLNKKSYAMKVIVREERDAHHTEKFFQNYLF-------LKQTKHRNVIP-IYDIFLEGSFIFIVMEYCEGCTLLDYFM--SLVPGSLDIQEIKCIMKNLLLGL-------DFLHSNNIIHRDVKLENIMFKRKRKRDY 1256
>gi|116873255|ref|YP_850036.1| protein kinase, putative [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742133|emb|CAK21257.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (655 aa)
Score = 107, Expect = 1.4e-02, Identities = 36/117 (30%), Positives = 63/117 (53%)
  Q:   192 LHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTT---PKIIESFT--EENHL-FVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVI 308
           L+++Y I  AI       +YLA+D+  + R V +K  R  L   S         N I + +   +S T+   P I+  +   EEN L ++V EH+DG+ LK + +EN  + +E +   +L+++
  S:     7 LNDRYKILHAIGGGGMANVYLAHDMILD-RDVAVKILRIDLADES---------NLIRRFQREAQSATSLVHPNIVSIYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKSVDIMLQIV 119
>gi|17230611|ref|NP_487159.1| hypothetical protein alr3119 [Nostoc sp. PCC 7120] >gi|17132214|dbj|BAB74818.1| alr3119 [Nostoc sp. PCC 7120] (676 aa)
Score = 106, Expect = 1.7e-02, Identities = 39/151 (25%), Positives = 76/151 (50%)
  Q:   191 LLHNKYDIFKAIYFSNHGGI---YLAYDLYNNNRVVLIKEFRPYLGINS-FWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFL 341
           LL   Y I K +  S+ GG    YL+ D+   N + ++K+F P +  +S    + +L   E ++L++  E +  P ++  F ++N+LF+V++ I+G         N+LL  +   + V+     +V  ++D+L    +      +  DIK  N +
  S:    31 LLRGHYRIIKVL--SDEGGFGRTYLSEDIDKLNELCVVKQFAPKVQEHSAMKKAVELFKQEAQRLQHLGEHHQIPTLLAYFEQDNYLFLVQQFING---------NNLL--QELRQGVVYNESTIVEFLLDLLPVLKYIHERGVIHRDIKPQNII 172
>gi|1237132|gb|AAA93081.1| putative protein kinase; similar to the product encoded by Anabaena pknA gene, GenBank Accession Number U00484; Method: conceptual translation supplied by author (117 aa)
Score = 106, Expect = 1.9e-02, Identities = 28/101 (27%), Positives = 44/101 (43%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYE 291
           +L N+Y I + +     G  YLA D    N +  IKE  P       W   +   +    + Y  E+   PK  E F ++  LF+V++++ G T  D   E
  S:    10 VLQNRYRIVQILGQGGFGRTYLAEDQRRFNELCAIKELIPTATGTVAWEKAQELFHREAAILYQIENPQVPKFREKFEQDQRLFLVQDYVAGKTYWDILKE 110
>gi|186901877|ref|ZP_02974826.1| serine/threonine protein kinase [Cyanothece sp. PCC 7424] >gi|186691169|gb|EDU15796.1| serine/threonine protein kinase [Cyanothece sp. PCC 7424] (679 aa)
Score = 105, Expect = 2.1e-02, Identities = 35/131 (26%), Positives = 66/131 (50%)
  Q:   185 SFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQL-------KYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLII 315
           S  S  +L+ +Y + + +  S+ G  YL  D +  N + +IK+  P L       S    L +IE+L        Y  +    P+  E F  +NHLF+V+++I G T +D      L     T++ + + +K+++ ++
  S:     4 SMDSGVVLNERYRLLRQLGHSSVGCTYLVEDTHRFNELCVIKKLIPQL-------SHAEQLQKIEELFEREAKVLYKLQHPQIPRFRELFRLQNHLFLVQDYIQGQTYRDILSFRQLQGQVFTEEEITQFLKHILPVL 134
>gi|75909515|ref|YP_323811.1| Serine/threonine protein kinase [Anabaena variabilis ATCC 29413] >gi|75703240|gb|ABA22916.1| serine/threonine protein kinase [Anabaena variabilis ATCC 29413] (601 aa)
Score = 105, Expect = 2.5e-02, Identities = 38/172 (22%), Positives = 76/172 (44%)
  Q:   188 SHFLLHNKYDIFKAIYFSNHGGIYLAYDLY-NNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTE-SNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHD 359
           +  LL+N+Y + + +     G   LA D +  + R  +IK+ +P       + S +     E   L++  E +N  P++   F+E    ++V+E I G TL+       +       + ++K       I++ +L   D+  S   +  DIK  N +    ++K   ID  ++ +
  S:     2 TSILLNNRYQVIQVLGAGGFGETLLAEDTHMPSRRRCVIKQLKPVSNDPQAYQSIQQRFEREAATLEFLGEHNNQIPRLYAYFSENGQFYLVQEWIHGQTLRQLLVSQGV-----QSEGIVKT------ILLSLLSVLDYVHSKGIIHRDIKPDNIILRDVDQKPVLIDFGAVKE 165
>gi|149004577|ref|ZP_01829265.1| protein kinase, putative [Streptococcus pneumoniae SP14-BS69] >gi|147757526|gb|EDK64552.1| protein kinase, putative [Streptococcus pneumoniae SP14-BS69] (408 aa)
Score = 103, Expect = 3.7e-02, Identities = 62/250 (24%), Positives = 109/250 (43%)
  Q:    39 NQGWKIHVSSTLDNYQQILDICINYCLN--KNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLG--LNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDF 288
           ++G+KIH+S+++ N   +     ++  +  K I FK + +           +     GKFITIY KD  E       L    K  KG ++ +D  F+ S  ++YRYG F  D  + ++ +K +         P+ +  P+       D     +  + ++Y I + I  +  GG+Y  ++     RV  + +    L +  F N   +   +NE E L    +   TPK+   F  +N  FV  E I    L ++
  S:     9 SKGFKIHLSASILNANLVAKKFFDFIFSREKKINFKILVSIKELSLQNTGLNGYSQVGKFITIYPKDNKEFQRLLHKLEILYKGVKGVNIPSDFRFQLSEVVYYRYGEFVKDSTFKDKRDKKI---------PSNVNVPI------RDYYIPRYNTIPDQYIILEVISKNAKGGVYKVFN--TQKRVYSLLKEASDLSLVDFTNRDSVNRLINEREILVELEKEEFTPKVFNDFYIKNSYFVEFEFIIADKLSEY 246
>gi|156968358|gb|ABU98635.1| putative serine/threonine kinase [Nostoc sp. 'Umbilicaria esculenta cyanobiont' TU021] (194 aa)
Score = 103, Expect = 4.0e-02, Identities = 33/131 (25%), Positives = 60/131 (45%)
  Q:   224 LIKEFRPYL-GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL 354
           +IK+F P   G N+   + +L   E  QL    +    P+++  FT+++  ++V+E IDGL L            E   K V +   +++ ++ D+L    FC +   +  DIK  N +    + K   +D 
  S:    27 VIKQFYPQAQGTNTVQKAVELFTQEAVQLDELGKHPQIPELLAYFTQDDRQYLVQEFIDGLNLAQ----------ELAHKGVFQE-THIIQLLNDLLPVLQFCHNRQVIHRDIKPENIILRNSDNKLVVVDF 147
>gi|2257745|gb|AAC46362.1| ser/thr protein kinase homolog PknD [Nostoc sp. PCC 7120] (509 aa)
Score = 103, Expect = 4.0e-02, Identities = 39/172 (22%), Positives = 75/172 (43%)
  Q:   188 SHFLLHNKYDIFKAIYFSNHGGIYLAYDLY-NNNRVVLIKEFRPYLGINSFWNSTKLGLN-EIEQLKYFTE-SNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHD 359
           +  LL+N+Y + + +     G   LA D +  + R  +IK  +P       + S +     E   L++  E SN  P++   F+E    ++V+E I G TL+       +       + ++K       I++ +L   D+  S   +  DIK  N +    ++K   ID  ++ +
  S:     2 TSILLNNRYQVIQILGAGGFGETLLAEDTHMPSRRRCVIKRLKPVSNDPQAYQSIQQRFEREAATLEFLGEHSNQIPRLYAYFSENGQFYLVQEWIHGHTLRQLLVSQGI-----QGEGIVKT------ILLSLLSVLDYVHSKGIIHRDIKPDNIILRDFDQKPVLIDFGAVKE 165
>gi|145552328|ref|XP_001461840.1| hypothetical protein GSPATT00026791001 [Paramecium tetraurelia strain d4-2] >gi|124429676|emb|CAK94467.1| unnamed protein product [Paramecium tetraurelia] (438 aa)
Score = 103, Expect = 4.3e-02, Identities = 46/166 (27%), Positives = 82/166 (49%)
  Q:   106 ELIDNTKALYDKLKDFKGPSVLTDKSFKNSCIHYRYGGFKSDYIYNERNE--KILDKREIGKHCPNF-IKDPLTEKQNNNDDSFSSHFLLHNKYDIFK--AIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQ-LKYFTESNTTPKIIESFTEEN 271
           E+I+  K L+ +        +LT K  ++  +HY   GF S  I N+  +   ++++ E  +    F +K+    +Q NN DS         KYD+ K   I++ NH   Y+   LY+ N   + K     + + S  +S KL + +I Q +K  ++    P+ ++ FT+EN
  S:    39 EVINKIKELFSEAFFHHYAIILTTKENESMILHYLKEGFTSSIIQNQERQCYTVIERYESQQFKKLFKVKELYDLRQLNNQDSL--------KYDLLKNSCIHYVNHVKEYINQYLYDINEHAIQK-----IELPSLISSIKLLIQKIYQNIKKLSKKELWPEDLKKFTQEN 197
>gi|67920865|ref|ZP_00514384.1| Protein kinase [Crocosphaera watsonii WH 8501] >gi|67856982|gb|EAM52222.1| Protein kinase [Crocosphaera watsonii WH 8501] (569 aa)
Score = 102, Expect = 5.6e-02, Identities = 51/180 (28%), Positives = 80/180 (44%)
  Q:   190 FLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYL---GINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNIY 369
           +L  ++Y I + +   N G  YL  D   +NR  ++K+F   L   G+ +     K   N ++ LK+       P I + F E N L++V E+IDG  L   F E   ++ E   K++LK          D+L   D+    N L  DIK  N +    + K   ID   + + + T    IY
  S:    36 YLFGDRYIIKQVLGEGNFGQTYLVEDQNFHNRKRVLKKFIANLQGKGLETAKELFKREANILDTLKH----EQIPAIYDHFEENNSLYLVEEYIDGDDLVTEF-EQQGIFSEDKIKSLLK----------DLLPVLDYLHQKNLLHRDIKPDNIMRRRYDGKLILIDFGGVKEVSNTRGILIY 203
>gi|15900931|ref|NP_345535.1| protein kinase, putative [Streptococcus pneumoniae TIGR4] >gi|14972536|gb|AAK75175.1| putative protein kinase [Streptococcus pneumoniae TIGR4] (448 aa)
Score = 102, Expect = 5.8e-02, Identities = 62/250 (24%), Positives = 109/250 (43%)
  Q:    39 NQGWKIHVSSTLDNYQQILDICINYCLN--KNILFKFICNDANFIQTLQKHHNRKSTGKFITIYCKDEIELIDNTKALYDKLKDFKGPSVLTDKSFKNS-CIHYRYGGFKSDYIYNERNEKILDKREIGKHCPNFIKDPLTEKQNNNDDSFSSHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLG--LNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDF 288
           ++G+KIH+S+++ N   +     ++  +  K I FK + +           +     GKFITIY KD  E       L    K  KG ++ +D  F+ S  ++YRYG F  D  + ++ +K +         P+ +  P+       D     +  + ++Y I + I  +  GG+Y  ++     RV  + +    L +  F N   +   +NE E L    +   TPK+   F  +N  FV  E I    L ++
  S:    49 SKGFKIHLSASILNANLVAKKFFDFIFSREKKINFKILVSIKELSLQNTGLNGYSQVGKFITIYPKDNKEFQRLLHKLEILYKGVKGVNIPSDFRFQLSEVVYYRYGEFVKDSTFKDKRDKKI---------PSNVNVPI------RDYYIPRYNTIPDQYIILEVISKNAKGGVYKVFN--TQKRVYSLLKEASDLSLVDFTNRDSVNRLINEREILVELEKEEFTPKVFNDFYIKNSYFVEFEFIIADKLSEY 286
>gi|196176958|gb|EDX71968.1| protein kinase domain [Microcoleus chthonoplastes PCC 7420] (656 aa)
Score = 101, Expect = 6.1e-02, Identities = 37/154 (24%), Positives = 71/154 (46%)
  Q:   188 SHFLLHNKYDIFKAIYFSNHGGIYLAYDLYNNNR-VVLIKEFRP-YLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFL 341
           S  LL  +Y   + I     G  +LA D    ++   +IK+F P Y G +    +T+L   E  +L    +    P+++  FT++N  ++V+E IDG  L     +  +      ++ + ++++       D+L   +F  S + +  DIK  N +
  S:    26 SKLLLRERYRSLRLIGQGGFGKTFLAVDEDKPSKPQCVIKQFFPLYQGTSDVQKATELFEREAVRLDELGKHPQIPELLAHFTQDNRQYLVQEFIDGQNLAQILAKEGVF----NEQQIREMLR-------DLLSILEFIHSRSVIHRDIKPENII 170
>gi|192808520|ref|ZP_03037196.1| protein of unknown function RIO1 [Geobacillus sp. Y412MC10] >gi|192802491|gb|EDV78995.1| protein of unknown function RIO1 [Geobacillus sp. Y412MC10] (283 aa)
Score = 101, Expect = 6.2e-02, Identities = 38/164 (23%), Positives = 74/164 (45%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDL 354
           +L ++Y + + I   ++G IY   D   +  +V +K+ RP  G     +  K  LN    +    +    P   + FT+  H ++V  ++DG TL+D  +E+ + Y E             + I + +L+   +      + LD+++ N LF  K+ + + ID 
  S:    24 VLGSRYTVQEMIGEGSYGIIYQCRD-QQSGHIVAVKQSRPSKG-----DYAKELLNREAAILSSLQHPQIPAYRDFFTDSRHSYLVMSYMDGDTLEDLIFEHGMKYGE----------AECLHIALQLLELVRYLHEQGYVHLDLRIPNVLF--KDGRIHLIDF 169
>gi|77410300|ref|ZP_00786732.1| serine/threonine protein kinase [Streptococcus agalactiae COH1] >gi|77171090|gb|EAO74527.1| serine/threonine protein kinase [Streptococcus agalactiae COH1] (155 aa)
Score = 99, Expect = 1.0e-01, Identities = 36/152 (23%), Positives = 69/152 (45%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKII---ESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLF 342
           L   +Y I K+I       +YLA DL  +N  V IK  R      + + + ++ +   ++        T P I+   +   E+   F+V E++DG  LK +  +N+ L    ++  V++++  +V I+ ++L           +  D+K  N L 
  S:     7 LFAGRYRILKSIGRGGMADVYLARDLILDNEEVAIKVLR------TNYQTDQIAVARFQREARAMAELTHPNIVAIRDIGEEDGQQFLVMEYVDGFDLKKYIQDNAPL----SNNEVVRIMNEVVRIMNEVLSAMSLAHQKGIVHRDLKPQNILL 151
>gi|196254805|ref|ZP_03153344.1| serine/threonine protein kinase [Cyanothece sp. PCC 7822] >gi|196204002|gb|EDX98818.1| serine/threonine protein kinase [Cyanothece sp. PCC 7822] (701 aa)
Score = 98, Expect = 1.4e-01, Identities = 29/125 (23%), Positives = 58/125 (46%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDLYNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLII 315
           +L+ +Y   + +  S+ G  YL  D +  + + ++KE  P L         +       ++ Y  +    P+  E F  +  LF+V+++I G T  D     +L     T++ V +++KNL+ +I
  S:     6 VLNERYRTLRQLGHSSVGSTYLVEDTHRFDELCVVKELIPQLEHPEQLQKIEELFEREAKVLYKLQHPQIPRFRELFRHQKRLFLVQDYIQGQTYGDLLKIRALQGQTFTEEEVTQLLKNLLPVI 130
>gi|186899927|ref|ZP_02972887.1| serine/threonine protein kinase with TPR repeats [Cyanothece sp. PCC 7424] >gi|186692863|gb|EDU17479.1| serine/threonine protein kinase with TPR repeats [Cyanothece sp. PCC 7424] (576 aa)
Score = 94, Expect = 4.5e-01, Identities = 43/178 (24%), Positives = 80/178 (44%)
  Q:   191 LLHNKYDIFKAIYFSNHGGIYLAYDL-YNNNRVVLIKEFRPYLGINSFWNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKNKKTYFIDLESIHDNNETFNKNI 368
           ++ N+Y I K +     G  YLA D    +N + ++K       I +F   T+     + +L      +  P  ++    +NH+++V+++I G +LKD F  N   + E   KN+L+ +  ++  +            +N +  DIK SN +   K+ K   ID     + N T  +N+
  S:     7 IIGNRYKILKFLGKGGFGVTYLAEDTRLEDNYLCVVKHLTNSQAIENFRERTRREATILRELG--NNHSQIPAFLDYLEVDNHIYIVQQYIGGTSLKDVFAVNP-QWNEQQVKNLLRELLLILQNV----------HQANIIHRDIKPSNLIRSQKDNKIVLIDFGVAREYNSTTQQNL 172
>gi|119944475|ref|YP_942155.1| serine/threonine protein kinase [Psychromonas ingrahamii 37] >gi|119863079|gb|ABM02556.1| serine/threonine protein kinase [Psychromonas ingrahamii 37] (569 aa)
Score = 93, Expect = 5.5e-01, Identities = 41/151 (27%), Positives = 70/151 (46%)
  Q:   196 YDIFKAIYFSNHGGIYLAYDLYNNNRVVL------IKEFRPYLGINSF----WNSTKLGLNEIEQLKYFTESNTTPKIIESFTEENHLFVVREHIDGLTLKDFFYENSLLYFEPTDKNVLKVIKNLVLIIIDILKFYDFCISSNKLVLDIKLSNFLFDCKN 346
           Y+I + IY S+   ++LA D  +   VV+      ++  R YL   SF    W + +L    +             K IE   + N L++V E+IDG+TL  +  +N     +PT   V K+I+        +  F+        +  D++ +N + DC N
  S:   271 YEILREIYISSRSHVFLALDSESGQTVVIKTPSTELRNNRQYL--ESFMLEEWIAKRLNNPHV------------AKAIEPTRKRNFLYLVSEYIDGITLTQWMTDNP----KPTINQVRKIIEQTAK---GLQAFH----RQEMIHQDLRPNNIMIDCNN 406