>gi|26553475|ref|NP_757409.1| rRNA methylase [Mycoplasma penetrans HF-2] >gi|26453481|dbj|BAC43813.1| rRNA methylase [Mycoplasma penetrans HF-2] (238 aa)
Score = 1013, Expect = 2.3e-108, Identities = 238/238 (100%), Positives = 238/238 (100%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
           MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL
  S:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
>gi|171920305|ref|ZP_02931653.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171920685|ref|ZP_02931909.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178781|ref|ZP_02964580.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024333|ref|ZP_02997010.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039643|ref|ZP_02998348.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 8] >gi|188518553|ref|ZP_03004014.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188568722|ref|ZP_03005476.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 2] >gi|188592536|ref|ZP_03005861.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 10] >gi|171902719|gb|EDT49008.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171903421|gb|EDT49710.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209398|gb|EDU06441.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019013|gb|EDU57053.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997944|gb|EDU67041.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (239 aa)
Score = 348, Expect = 3.0e-31, Identities = 102/231 (44%), Positives = 147/231 (63%)
  Q:     1 MKKFFGKKAVIEAF-KQNELSEVYYVSYFDELKEFKSKN-IKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           M   FGKKA+++A   +  +S+VY +S   EL    +KN I    VN+ +F +++  + HQNI     + +    T  +SF++ I +      ++L+LDEI+DP NFGAI RT+ +F V  II+KK++Q  IN+ VIKTS+G +NY+  ++VNNLS  +  L+ E +W   T+L  KS P  K     NK V IVGNENKGVS LI K++D  ++I+M   VQSLNV V+T IIL
  S:     1 MNYNFGKKALLDAIGNKQSISKVYLLSKNYELINLINKNKITYEIVNEAWFKQFDHSLNHQNIAFKLVKKNFQ-KTGLESFLKLIKD--KKNALVLILDEIEDPRNFGAIIRTANAFGVDAIIYKKHHQASINDLVIKTSMGAINYIYMIEVNNLSNTIKNLQDEGFWVYATSL-LKSQPYEKVDY-ANKTVFIVGNENKGVSPLILKNADQSIRIDMFGDVQSLNVGVATGIIL 230
>gi|13357681|ref|NP_077955.1| rRNA methylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761850|ref|YP_001752207.1| RNA methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508755|ref|ZP_02958228.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11357049|pir||A82931 rRNA methylase UU124 [imported] - Ureaplasma urealyticum >gi|6899082|gb|AAF30530.1|AE002113_4 rRNA methylase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827427|gb|ACA32689.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675688|gb|EDT87593.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 14 str. ATCC 33697] (239 aa)
Score = 346, Expect = 4.9e-31, Identities = 102/231 (44%), Positives = 146/231 (63%)
  Q:     1 MKKFFGKKAVIEAF-KQNELSEVYYVSYFDELKEFKSKN-IKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           M   FGKKA+++A   +  +S+VY +S   EL    +KN I    VN+ +F +++  + HQNI     + +    T  +SF++ I +      ++L+LDEI+DP NFGAI RT+  F V  II+KK++Q  IN+ VIKTS+G +NY+  ++VNNLS  +  L+ E +W   T+L  KS P  K     NK V IVGNENKGVS LI K++D  ++I+M   VQSLNV V+T IIL
  S:     1 MNYNFGKKALLDAIGNKQSISKVYLLSKNYELINLINKNKITYEIVNEAWFKQFDHSLNHQNIAFKLVKKNFQ-KTSLESFLKLIKD--KKNALVLILDEIEDPRNFGAIIRTANGFGVDAIIYKKHHQASINDLVIKTSMGAINYIYMIEVNNLSNTIKNLQDEGFWVYATSL-LKSQPYEKVDY-ANKTVFIVGNENKGVSPLILKNADQSIRIDMFGDVQSLNVGVATGIIL 230
>gi|12045106|ref|NP_072917.1| RNA methyltransferase [Mycoplasma genitalium G37] >gi|1723134|sp|P47494|Y252_MYCGE Uncharacterized tRNA/rRNA methyltransferase MG252 >gi|3844850|gb|AAC71472.1| RNA methyltransferase, TrmH family, group 3 [Mycoplasma genitalium G37] >gi|166079076|gb|ABY79694.1| RNA methyltransferase, TrmH family, group 3 [synthetic Mycoplasma genitalium JCVI-1.0] (242 aa)
Score = 343, Expect = 1.0e-30, Identities = 87/202 (43%), Positives = 131/202 (64%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E K  N +++  N  F ++Y ++ HQ ++ +   + L I    D  ++ + N       +++LDEIQDP NFGAI RT  + +V GIIFKKNNQ+ IN TV+KTS+G+V Y N ++V NLS  + KLK+  +WTV + LD    P+   K D  K ++IVGNE++GV++LI K++D  +KI M++ + SLNVSV+  IIL+
  S:    41 LIEAKKINFQIHSTNW-FNNQYRDINHQELVAVLDTNQLLI--PLDQLVKVVENKKC--STLVMLDEIQDPYNFGAILRTCLASEVDGIIFKKNNQVPINNTVMKTSMGSVFYQNLVQVANLSYTITKLKEIGFWTVVSTLDPIWKPIDYRKVDFAKKILIVGNEDRGVNQLITKNADCRIKIPMNNKINSLNVSVALGIILF 238
>gi|13508094|ref|NP_110043.1| tRNA/rRNA methyltransferase [Mycoplasma pneumoniae M129] >gi|2500862|sp|P75424|Y355_MYCPN Uncharacterized tRNA/rRNA methyltransferase MG252 homolog >gi|1674172|gb|AAB96129.1| tRNA/rRNA methyltransferase-like protein [Mycoplasma pneumoniae M129] (242 aa)
Score = 342, Expect = 1.4e-30, Identities = 72/142 (50%), Positives = 101/142 (71%)
  Q:    91 ILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++L EIQDP NFGAI RT  + +V GIIFKK+NQ  IN TVI+TS+GTV Y N ++V NLS  +  L+K  +WTV T LDE+  P    + D +K +++VGNE+KG++ L+ K++D  VKI M+  + SLNVSV+  IIL+
  S:    97 LVMLHEIQDPHNFGAILRTCMAAEVDGIIFKKHNQAPINSTVIRTSMGTVFYQNLVQVTNLSYAITTLQKHGFWTVATTLDERLKPKDYRQVDFDKRILLVGNEDKGLNALLLKNADLKVKIPMNPKLNSLNVSVAVGIILF 238
>gi|188524104|ref|ZP_03004184.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530861|ref|ZP_03005154.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867706|ref|ZP_03079707.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195659743|gb|EDX53123.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660561|gb|EDX53817.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (239 aa)
Score = 341, Expect = 1.9e-30, Identities = 102/231 (44%), Positives = 148/231 (64%)
  Q:     1 MKKFFGKKAVIEAFKQNEL-SEVYYVSYFDELKEFKSKN-IKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTD-INKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           M   FGKKA+++A    ++ S+VY +    EL    +KN I    VN+++F +++  + HQNI     + S    T  +SF++ I     +  +IL+LDEI+DP NFGAI RT+ +F V GII+KK +Q  IN+ VIKTS+G +NY++ ++V+NLS  +  L+ E +W   T+L +     S  K D  NK V IVGNE+KGVS LI K++D  V+I+M   VQSLNV V+T IIL
  S:     1 MNYNFGKKALLDAINNKQIISKVYLLEKNYELINLINKNQISYEVVNERWFKQFDHSLNHQNIAFKLVKKSFQ-KTSLESFLKLIKK--QENALILMLDEIEDPRNFGAIIRTANAFGVDGIIYKKYHQASINDLVIKTSMGAINYIHMIEVSNLSNAIKNLQNEGFWVYATSLLKSQ---SYEKVDYANKSVFIVGNESKGVSPLILKNADQSVRIDMFGDVQSLNVGVATGIIL 230
>gi|186701914|ref|ZP_02971563.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700651|gb|EDU18933.1| RNA methyltransferase, TrmH family, group 3 [Ureaplasma parvum serovar 6 str. ATCC 27818] (239 aa)
Score = 339, Expect = 3.6e-30, Identities = 101/231 (43%), Positives = 146/231 (63%)
  Q:     1 MKKFFGKKAVIEAF-KQNELSEVYYVSYFDELKEFKSKN-IKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTD-INKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           M   FGKKA+++A   +  +S+VY +S   EL    +KN I    VN+ +F +++  + HQNI     + +    T  +SF++ I +      ++L+LDEI+DP NFGAI RT+  F V  II+KK++Q  IN+ VIKTS+G +NY+  ++VNNLS  +  L+ E +W   T+L +     S  K D  NK V IVGNENKGVS LI K++D  ++I+M   VQSLNV V+T IIL
  S:     1 MNYNFGKKALLDAIGNKQSISKVYLLSKNYELINLINKNKITYEIVNEAWFKQFDHSLNHQNIAFKLVKKNFQ-KTSLESFLKLIKD--KKNALVLILDEIEDPRNFGAIIRTANGFGVDAIIYKKHHQASINDLVIKTSMGAINYIYMIEVNNLSNTIKNLQDEGFWVYATSLLKSQ---SYEKVDYANKTVFIVGNENKGVSPLILKNADQSIRIDMFGDVQSLNVGVATGIIL 230
>gi|31544882|ref|NP_853460.1| hypothetical protein MGA_0532 [Mycoplasma gallisepticum R] >gi|31541729|gb|AAP57028.1| SpoU [Mycoplasma gallisepticum R] (260 aa)
Score = 317, Expect = 1.3e-27, Identities = 98/229 (42%), Positives = 137/229 (59%)
  Q:     4 FFGKKAVIEAFKQNELSEVYYVSYFDE--LKEFKSKNIKLNKVNKKFFD-KYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLK-KENYWTVCTALDEKSIPLSKFKTD-INKLVVIVGNENKGVSELIKKDSDFIVKIEM-DSSVQSLNVSVSTAIILY 232
            FG   V E    N   +  Y+   D   LK  K K I+      K+FD +Y  +  HQ  +     SSLTI   F+ F EKI N    + I++VLD+I DPGNFG I R+  +  V G+IFKK+NQ+ IN TVIKTSLG   YLN ++V NLS  +  L+ K  +W+  + L +++     +  D  NK ++IVGNE KGVS  + K++D+ +KI M    +QSLNVSV+T I+L+
  S:    24 LFGYNGVYEGLINNLKIKKVYLHKEDHPLLKLIKQKGIEYELHTIKWFDNQYRDLPNHQGFVAEIDGSSLTI--SFNQFCEKIKN--EQQGIVVVLDQIHDPGNFGGILRSCLAANVLGVIFKKDNQVSINNTVIKTSLGACFYLNLIEVANLSYAIKDLQEKYGFWSYVSNLSDQA---QDYNVDYANKSILIVGNEQKGVSSQLIKNADYQIKIPMYTDKIQSLNVSVATGIMLF 253
>gi|188584816|ref|YP_001916361.1| RNA methyltransferase, TrmH family, group 3 [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349503|gb|ACB83773.1| RNA methyltransferase, TrmH family, group 3 [Natranaerobius thermophilus JW/NM-WN-LF] (247 aa)
Score = 308, Expect = 1.4e-26, Identities = 86/227 (37%), Positives = 131/227 (57%)
  Q:     6 GKKAVIEAFKQNELSEVYYVS------YFDE-LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK  V+EA + N      Y+S      + DE LK  +  NI L+KV     DK      HQ   GI  E+    ++  D+ ++  +  N     +L+LD + DP NFGAI RT+ +  V G+I  K   + +N TV+K S G   ++  +KV+NL + ++KLK++  W + T +D ++ I    F+ + N  L ++VGNE  G+S L+KK+ DFI  I M   V SLN SV+TA++LY
  S:     9 GKNPVVEAIRGNRKVFRIYISKDSNKNFQDEMLKLAQQHNINLDKVPLDRLDKMVPTTEHQ---GIVAETEPFKYSQLDTVLKGFDYNNQKPLTLLILDHLTDPQNFGAIIRTADAVGVDGVIIPKRRSVDVNPTVMKASSGAAEHVPIIKVSNLRQTISKLKEQWIWILGTDIDGDRGI----FEENYNIPLALVVGNEASGMSPLVKKECDFIANIPMIGRVNSLNASVATAVVLY 239
>gi|171778431|ref|ZP_02919589.1| hypothetical protein STRINF_00440 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282832|gb|EDT48256.1| hypothetical protein STRINF_00440 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (249 aa)
Score = 300, Expect = 9.5e-26, Identities = 83/228 (36%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA + N  +++Y     D+L+      IK+    KK    +             VHQ   G     S   + + DS +EK   +  +  +IL+LDE+ DP NFG+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK++ +W   T  D    P  K+ T   KL +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ A+++Y
  S:    14 YGVHAVTEALQANTGNKLYIQ---DDLRGKNVDKIKMLATEKKVSISWTPKKTLSDMTNGAVHQ---GFVLRVSEFAYAELDSILEKA--VQEENPLILILDELNDPHNFGSILRTADATNVTGVIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQTLDKLKEQGFWVFGT--DMNGTPSHKWNT-AGKLALIIGNEGKGISPNIKKQVDEMITIPMNGHVQSLNASVAAAVLMY 241
>gi|24378679|ref|NP_720634.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans UA159] >gi|24376542|gb|AAN57940.1|AE014868_2 putative tRNA/rRNA methyltransferase [Streptococcus mutans UA159] (248 aa)
Score = 300, Expect = 1.1e-25, Identities = 81/228 (35%), Positives = 127/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AVIE+ + N   ++Y  +       D++K+  + K + ++   KK         VHQ   G     S   +T+F+  ++K      D  ++L+LDE+ DP NFG+I RT+ +  V GII  K+  + +   V KTS G V ++   +V NL + L+KLK   +W   T  D    P +++ T   KL +I+GNE +G+S  IKK  D +V I M+  VQSLN SV+ AI++Y
  S:    14 YGVHAVIESLQANTGHKLYIQNDLRGKNVDKIKDLAAEKKVPISWTPKKTLSDMTKGAVHQ---GFILHVSAFAYTEFEMLLKKAER--EDNPLLLILDELNDPHNFGSILRTADATNVTGIIITKHRAVGVTPVVAKTSTGAVEHIPIARVTNLGQALDKLKAAGFWIFGT--DMNGTPSTQWNTS-GKLALIIGNEGRGISHNIKKQVDEMVTIPMNGHVQSLNASVAAAILMY 241
>gi|19704851|ref|NP_602346.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19712732|gb|AAL93645.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (234 aa)
Score = 300, Expect = 1.1e-25, Identities = 84/202 (41%), Positives = 129/202 (63%)
  Q:    30 ELKEFKSK-NIKLNKVNKKFFDKYEVVHQNILGIAKE-SSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           +LK+  SK NIK+    KK         +N  G+A   S+   + DFD   E++  +  DK ++L+LDEIQDP NFGAI R+++ F+V  II  + N ++INETV+KTS G + Y+N  KV NLS+ +NKLKK +YW V  A  E +I  ++ +   NK+V+++GNE  G+ + +++  D ++KI M   + SLNVSV++ I+L
  S:    37 KLKDLASKRNIKIFYTGKKI--------ENSQGVAVYISNYDYYKDFDEAYEEL--VGKDKSLVLILDEIQDPRNFGAIIRSAEVFKVDLIIIPERNSVRINETVVKTSTGAIEYVNISKVTNLSDTINKLKKLDYW-VYGAAGEANISYNE-EDYSNKVVLVLGNEGSGIRKKVREHCDKLIKIPMYGQINSLNVSVASGILL 228
>gi|125718827|ref|YP_001035960.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis SK36] >gi|125498744|gb|ABN45410.1| tRNA (Guanosine-2'-O-)-methyltransferase, TrmH family, putative [Streptococcus sanguinis SK36] (242 aa)
Score = 300, Expect = 1.2e-25, Identities = 81/228 (35%), Positives = 131/228 (57%)
  Q:     5 FGKKAVIEAFKQNELSEVYYV-----SYFDELKEFKS-KNIKLNKVNKKFFDKYE--VVHQN-ILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          D++K+  + K + ++   KK   +     VHQ  +L +A+ +    +TDF+  ++K      D  ++L+LD + DP N G+I RT+ +  VAG+I  K+  + +   V KTS G + ++   +V NLS+ L+KLK+  +W   T  D +  P  K+ T   KL +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALAANTGNKLYIQDDLCGKKVDKIKDLAAEKKVSISWTPKKTLQEMTDGAVHQGFVLRVAEFA----YTDFEVLLKKAEQ--EDNPLLLILDGLTDPHNLGSILRTADATNVAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGT--DMQGTPSHKWNT-AGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235
>gi|146319556|ref|YP_001199268.1| tRNA/rRNA methyltransferase [Streptococcus suis 05ZYH33] >gi|146321750|ref|YP_001201461.1| tRNA/rRNA methyltransferase [Streptococcus suis 98HAH33] >gi|145690362|gb|ABP90868.1| tRNA/rRNA methyltransferase [Streptococcus suis 05ZYH33] >gi|145692556|gb|ABP93061.1| tRNA/rRNA methyltransferase [Streptococcus suis 98HAH33] (242 aa)
Score = 299, Expect = 1.3e-25, Identities = 86/228 (37%), Positives = 124/228 (54%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKK----------FFDKYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV+E+ + N  +++Y     D+L+    + IK     KK            D  E  VHQ   G     S   + D    +EK      D  +IL+LD + DP NFG+I RT+ + QVAGII  K+  + +   V KTS G V ++   +V NLS+ L+KLK+  +W   T  D    P  K+ T   KL +I+GNE KG+S  IKK  D ++ I M   VQSLN SV+ A+++Y
  S:     8 YGVHAVVESLEANTGNKLYIQ---DDLRGKNVEKIKALAAEKKVSISWTPKKTLSDMTEGAVHQ---GFVLRVSEFAYADLSVILEKAEQ--EDNPLILILDGLTDPHNFGSILRTADATQVAGIIIPKHRAVGVTPVVAKTSTGAVAHVPIARVTNLSQTLDKLKEAGFWVFGT--DMNGTPSHKWNT-AGKLALIIGNEGKGISSNIKKQVDEMITIPMKGHVQSLNASVAAAVLMY 235
>gi|148322280|gb|EDK87530.1| rRNA methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (234 aa)
Score = 299, Expect = 1.5e-25, Identities = 85/202 (42%), Positives = 129/202 (63%)
  Q:    30 ELKEFKSK-NIKLNKVNKKFFDKYEVVHQNILGIAKE-SSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           +LK+  SK NIK+    KK         +N  G+A   S+   + DFD   E++     DK ++L+LDEIQDP NFGAI R+++ F+V  II  + N ++INETV+KTS G + Y+N  KV NLS+ +NKLKK +YW V  A+ E +I  ++ +   NK+V+++GNE  G+ + +++  D +VKI M   + SLNVSV++ I+L
  S:    37 KLKDLASKRNIKIFYTGKKI--------ENSQGVAVYISNYDYYKDFDEAYEEL--AGKDKSLVLILDEIQDPRNFGAIIRSAEVFKVDLIIIPERNSVRINETVVKTSTGAIEYVNISKVTNLSDTINKLKKLDYW-VYGAVGEANINYNE-EDYPNKVVLVLGNEGSGIRKKVREHCDKLVKIPMYGQINSLNVSVASGILL 228
>gi|157150299|ref|YP_001449674.1| RNA methyltransferase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075093|gb|ABV09776.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus gordonii str. Challis substr. CH1] (243 aa)
Score = 299, Expect = 1.5e-25, Identities = 81/228 (35%), Positives = 132/228 (57%)
  Q:     5 FGKKAVIEAFKQNELSEVYYV-----SYFDELKEFKS-KNIKLNKVNKKFFDKYE--VVHQN-ILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          D++K+  + K + ++   KK   +     VHQ  +L +A+ +    +TDF+  ++K      D  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KTS G + ++   +V NLS+ L+KLK+  +W   T  D +  P  K+ T   KLV+I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMTDGAVHQGFVLRVAEFA----YTDFEVLLKKAEQ--EDNPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGT--DMQGTPSHKWNTG-GKLVLIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235
>gi|34763276|ref|ZP_00144235.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887047|gb|EAA24159.1| 23S rRNA methyltransferase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (234 aa)
Score = 297, Expect = 2.1e-25, Identities = 85/231 (36%), Positives = 137/231 (59%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIK--LNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           M++  G   V EA    E   +  + +++ LK    + +K   +K N K F   + +  +       S+   + DFD   E++     DK ++L+LDEIQDP NFGAI R+++ F+V  II  + N ++INETV+KTS G + Y+N  KV NLS+ +NKLKK +YW V  A  E SI  ++ +   NK+++++GNE  G+ + +++  D ++KI M   + SLNVSV++ I+L
  S:     1 MERIIGINPVTEALLNKE-KNIEKLEFYNGLKGETVQKLKDLASKRNIKIFYTGKKIDNSQGVAVYISNYDYYKDFDEAYEEL--AEKDKSLVLILDEIQDPRNFGAIIRSAEVFKVDLIIIPERNSVRINETVVKTSTGAIEYVNISKVTNLSDTINKLKKLDYW-VYGAAGEASINYNE-ENYSNKIILVLGNEGSGIRKKVREHCDKLIKIPMYGQINSLNVSVASGILL 228
>gi|15896402|ref|NP_349751.1| rRNA methylase [Clostridium acetobutylicum ATCC 824] >gi|15026220|gb|AAK81091.1|AE007810_10 RRNA methylase, YACO B.subtilis ortholog [Clostridium acetobutylicum ATCC 824] (252 aa)
Score = 297, Expect = 2.7e-25, Identities = 85/227 (37%), Positives = 125/227 (55%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA K +   E   VS           L + K K I +  V++K  DK     VHQ ++ I+   +   + D D  I      N D   ILVLDEI+DP N G+I RT++   V GII  K   + +  TV KTS G V Y+   KV+N++  ++KLKKE  W     +D ++   ++  T    L +++G+E +G+S+L K+  D +VKI M   V SLN SV+  I++Y
  S:    12 GRNAVIEALKSDSTIEQVLVSSGKSEGSINVILAKAKEKGIPVKYVDRKKLDKISNGGVHQGVIAISTPYN---YCDVDDIILNAKEKNEDP-FILVLDEIEDPHNLGSIIRTAELCGVHGIIIPKRRNVGVTPTVYKTSAGAVKYVKIAKVSNINLAIDKLKKEGIWVYGAEIDGENYCYNQNMT--GALALVIGSEGRGISKLTKQKCDVLVKIPMVGKVNSLNASVAAGIVMY 241
>gi|154485051|ref|ZP_02027499.1| hypothetical protein EUBVEN_02772 [Eubacterium ventriosum ATCC 27560] >gi|149734004|gb|EDM50123.1| hypothetical protein EUBVEN_02772 [Eubacterium ventriosum ATCC 27560] (247 aa)
Score = 294, Expect = 4.8e-25, Identities = 77/227 (33%), Positives = 124/227 (54%)
  Q:     6 GKKAVIEAFKQNE-LSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA++  + + +++ + +  E      L+E K  +  +N V K+  D+      HQ ++G +A     T+    D   EK      +   +++LD+I+DP N GAI RT+      G+I  K+    +  TV KTS G +NY    KV N+S+ + +LKKE  W VC  +   ++     K  I    +++GNE KGVS L+K+  DF+  I M   + SLN SV+T ++ Y
  S:    10 GRNAVIEAYRAGKTIDKLFVLEHCKEGSMNTVLREAKKHDTVINYVKKERLDQMSETGKHQGVIGYLAAYEYATVDEILDKAREK-----GESPFVILLDDIEDPHNLGAIIRTANLAGAHGVIIPKHRASGLTATVAKTSAGALNYTPVAKVTNISKTIEELKKEGMWFVCADMGGTTMYDLDLKGSIG---LVIGNEGKGVSRLVKEKCDFVASIPMFGDIDSLNASVATGVLAY 238
>gi|188159024|ref|ZP_02512031.2| rRNA Methylase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (244 aa)
Score = 294, Expect = 5.5e-25, Identities = 92/234 (39%), Positives = 138/234 (58%)
  Q:     5 FGKKAVIEAFK--QNELSEVYYVSYFDELKEFKSKN--IKLNKVNKKFFDKY---EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNT-DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
           +GK  V E  K  QN + E++ V     L EF  KN  IK+N V++   D+    +  HQ I+   K+ + T       F + IN+LNT +K ++L+LD+I DP NFGAI R+     V GII     Q+Q+N TV+KTS G+   +   K NNL+  +  LK  ++W   T L++ S  ++K     NK  VI+GNE KGVSEL+ K+SDF V +  + ++ S N SV+ +II +++ + L
  S:     7 YGKHVVFELLKKHQNMVKEIW-VKDLKILNEFDLKNTKIKVNVVSENKLDQLLETQTQHQGIIAQIKDYNYT------PFNQLINDLNTKEKSLVLILDQIHDPYNFGAIIRSCSLLNVDGIIILDKKQVQVNSTVLKTSSGSAFDIKICKTNNLNNAIKILKNNDFWIYATNLNQNSTDMTKIDF-ANKTAVIIGNEQKGVSELLTKNSDFNVYVPSNKNIDSFNASVACSIICFWIANYL 240
>gi|83319473|ref|YP_424103.1| RNA methyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283359|gb|ABC01291.1| RNA methyltransferase, TrmH family, group 3 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (244 aa)
Score = 291, Expect = 1.3e-24, Identities = 90/234 (38%), Positives = 139/234 (59%)
  Q:     5 FGKKAVIEAFKQNE-LSEVYYVSYFDELKEFKSKN--IKLNKVNKKFFD---KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNT-DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
           +GK  + E  K+++ + +  +V     L EF  KN  IK+N V++   D   K   +HQ I+   K+ + T       F E +N+LNT +K ++LVLD+I DP NFGAI R+     V GII     Q+Q+N TV+KTS G+   +   K NNL+  +  LK   +W   T L++ S  ++K +   NK VVI+GNE KGVSEL+ K+SDF + +  + ++ S N SV+ +II +++ + L
  S:     7 YGKHVIYELLKKHKNMVKEIWVKNLKLLDEFDLKNTKIKINVVSENKLDQLLKTNELHQGIIAQIKDFNYT------PFDELLNDLNTKEKSLVLVLDQIHDPYNFGAIIRSCSLLNVDGIIILDKKQVQVNSTVLKTSSGSAFDIKISKTNNLNNAIKILKNNGFWIYATNLNQNSTDMTKTQF-ANKSVVIIGNEQKGVSELLTKNSDFNIYVPSNKNIDSFNASVACSIICFWIANYL 240
>gi|169190367|ref|ZP_02850339.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp. JDR-2] >gi|169002974|gb|EDS49849.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp. JDR-2] (251 aa)
Score = 286, Expect = 5.2e-24, Identities = 70/227 (30%), Positives = 128/227 (56%)
  Q:     6 GKKAVIEAFKQN-ELSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK  V+EA +   ++++++      +      + E K   + +  V+K+  D     V HQ   G+  +++   + + +  + +   LN +   +L+LDEI+DP N G+I RT++   V G+I  K   + +  TV+KTS G   ++   +V NL++ +++LK+E  W   T   + S P   +KT  +  L +++GNE KG+  LIK+  DF+VK+ M   + SLN SV+  +++Y
  S:    13 GKHPVMEALRSGRDINKIWIAEGAQKSLTQPIVAEAKQHGVIVQFVDKRKLDTMVEGVQHQ---GVVAQAAAFAYAEIEDLLARARELN-ETPFLLILDEIEDPHNLGSILRTAECTGVHGVIIPKRRSVGLTATVLKTSAGAAEHVPVARVTNLAQTIDRLKEEGVWVAGT---DVSAPQDVYKTKFDLPLAIVIGNEGKGMGRLIKEKCDFLVKLPMHGRLNSLNASVAAGVLMY 242
>gi|15828649|ref|NP_326009.1| tRNA/rRNA methyltransferase [Mycoplasma pulmonis UAB CTIP] >gi|14089591|emb|CAC13351.1| TRNA/RRNA METHYLTRANSFERASE [Mycoplasma pulmonis] (229 aa)
Score = 285, Expect = 5.2e-24, Identities = 83/230 (36%), Positives = 129/230 (56%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDELKEFKS-KNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           GK +V++A + N   E+ YV    ++ EFK  KNIK+   +K+F D   +  HQ  + + K  +             ++ +   K+ IL+LD ++DP NFGAI R++ +F +  II+     + IN TV+K S G    L F K N++S  ++KLKK+ YW   ++LD  S  ++K   + N  V+++GNE KG+S+  KK SD +  I+   SVQSLN SV+  II    T
  S:     8 GKNSVLDALENNVKIEMLYV-LASKVHEFKHIKNIKIEVKDKQFLDSLVKENHQGYVAVLKSLNFV----------SLDQMIKSKETILILDHLEDPYNFGAILRSANAFGIKNIIYPIKRAVDINSTVLKVSSGGFVNLRFYKSNSISATIDKLKKQGYWIYSSSLDPTSEDINKISFN-NPSVLVIGNEKKGISQTTKKQSDQLFYIKTKGSVQSLNASVAAGIIFNLFT 227
>gi|110004177|emb|CAK98515.1| putative trna/rrna methyltransferase protein [Spiroplasma citri] (244 aa)
Score = 285, Expect = 5.3e-24, Identities = 65/151 (43%), Positives = 92/151 (60%)
  Q:    84 LNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           L      +LVLD+I DP NFGAI RT   F V G+I     Q+ IN TV KTS G  NY+   +VNNL+  +  LKK+ +W   T+L+ K+  +S+ K DI  + +IVGNE  G+S  + K +DF + I     + SLNVSV++AI++Y +
  S:    90 LQNKHPFLLVLDQISDPHNFGAILRTCDLFNVDGVIILDKRQVDINATVAKTSAGAFNYVPVCRVNNLTNAIEYLKKQGFWIYATSLNTKAQNVSELKYDI-PICLIVGNEGTGISAKLLKHADFNIYIPTAGHLDSLNVSVASAILIYQI 239
>gi|15903354|ref|NP_358904.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus pneumoniae R6] >gi|15458955|gb|AAL00115.1| tRNA (guanosine-2'-O-)-methyltransferase, TrmH family [Streptococcus pneumoniae R6] (253 aa)
Score = 285, Expect = 6.1e-24, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    19 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 246
>gi|182684414|ref|YP_001836161.1| spoU rRNA methylase family protein [Streptococcus pneumoniae CGSP14] >gi|182629748|gb|ACB90696.1| spoU rRNA methylase family protein [Streptococcus pneumoniae CGSP14] (253 aa)
Score = 285, Expect = 6.2e-24, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    19 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 246
>gi|167464999|ref|ZP_02330088.1| 23S rRNA methyltransferase [Paenibacillus larvae subsp. larvae BRL-230010] (245 aa)
Score = 282, Expect = 1.2e-23, Identities = 74/232 (31%), Positives = 128/232 (55%)
  Q:     1 MKKFFG-KKAVIEAFKQNE-LSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDE-KSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M++F G K +V+EA +    +++++      +      L E K   I +  V+++  D+    + HQ   GI  + +   +   +  + K      D   IL+LDEI+DP N G+I RT+    V G+I  K     +  TV KTS G V Y+   +V NL++ + +LK++  W   T +++ + +  S F+  I    +++GNENKGV  L+K+  DF+VK+ M   + SLN SV+  +++Y
  S:     1 MEEFIGGKHSVLEALRSGRTINKIWIAENAGKQQAGSVLSEAKKHGIIVQTVDRRKLDQMAEGIQHQ---GIVAQVAAYEYASVEDILNKATQKGEDP-FILILDEIEDPHNLGSILRTADCTGVHGVIIPKRRSAGLTATVSKTSAGAVEYVPVARVTNLAQTIEQLKEKGIWVAGTDVNQAEDVYRSNFRMPI---ALVIGNENKGVGRLVKEKCDFLVKLPMHGQINSLNASVAAGVLMY 236
>gi|149002852|ref|ZP_01827778.1| spoU rRNA methylase family protein [Streptococcus pneumoniae SP14-BS69] >gi|168493358|ref|ZP_02717501.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC3059-06] >gi|194397072|ref|YP_002038090.1| RNA methyltransferase, TrmH family [Streptococcus pneumoniae G54] >gi|147759146|gb|EDK66140.1| spoU rRNA methylase family protein [Streptococcus pneumoniae SP14-BS69] >gi|183576562|gb|EDT97090.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC3059-06] >gi|194356739|gb|ACF55187.1| RNA methyltransferase, TrmH family [Streptococcus pneumoniae G54] (242 aa)
Score = 282, Expect = 1.3e-23, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|116516815|ref|YP_816752.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae D39] >gi|148992659|ref|ZP_01822327.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP9-BS68] >gi|148997484|ref|ZP_01825089.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP11-BS70] >gi|168483931|ref|ZP_02708883.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC1873-00] >gi|168489618|ref|ZP_02713817.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae SP195] >gi|168575914|ref|ZP_02721829.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae MLV-016] >gi|169833851|ref|YP_001694873.1| RNA methyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|116077391|gb|ABJ55111.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae D39] >gi|147756539|gb|EDK63580.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP11-BS70] >gi|147928676|gb|EDK79690.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP9-BS68] >gi|168996353|gb|ACA36965.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae Hungary19A-6] >gi|172042719|gb|EDT50765.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC1873-00] >gi|183571884|gb|EDT92412.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae SP195] >gi|183578281|gb|EDT98809.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae MLV-016] (242 aa)
Score = 282, Expect = 1.3e-23, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|149011685|ref|ZP_01832881.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP19-BS75] >gi|147764116|gb|EDK71048.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP19-BS75] (242 aa)
Score = 282, Expect = 1.3e-23, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|160947201|ref|ZP_02094368.1| hypothetical protein PEPMIC_01134 [Peptostreptococcus micros ATCC 33270] >gi|158446335|gb|EDP23330.1| hypothetical protein PEPMIC_01134 [Peptostreptococcus micros ATCC 33270] (254 aa)
Score = 282, Expect = 1.4e-23, Identities = 79/228 (34%), Positives = 130/228 (57%)
  Q:     5 FGKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG+ AV+EA + +   E  Y+       S    + + K+  I +++++K   +     VVHQ +  +        ++  +  ++   + N D   +++LDEI+DP NFGAI RT ++  V GII  K NQ  +   V K+S G VN++   KV N+++ + KL+KEN W V  A  E      K  TD++    + +++GNE KG+ +LI+K  DF+ K+ M   V SLN S + AI++Y
  S:    15 FGRNAVLEALESDRKVEKIYILKGDLKGSINKIIGKAKANGILISEIDKHKLENMAEGVVHQGVCALISSFE---YSTVEEILQSAKDKNEDL-FLVILDEIEDPHNFGAIIRTCEAVGVHGIIVSKRNQAPVTSIVQKSSAGAVNHIKIAKVANIADTILKLQKENVW-VYGACGEA----EKIYTDMDFKGNIAIVIGNEGKGIGQLIRKRCDFLTKLPMKGKVSSLNASNACAILVY 245
>gi|168491355|ref|ZP_02715498.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC0288-04] >gi|183574511|gb|EDT95039.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC0288-04] (242 aa)
Score = 282, Expect = 1.4e-23, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENSLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|148984799|ref|ZP_01818052.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP3-BS71] >gi|148990265|ref|ZP_01821476.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP6-BS73] >gi|168486152|ref|ZP_02710660.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC1087-00] >gi|147922821|gb|EDK73937.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP3-BS71] >gi|147924404|gb|EDK75494.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP6-BS73] >gi|183570789|gb|EDT91317.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae CDC1087-00] (242 aa)
Score = 282, Expect = 1.5e-23, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEITEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|55820190|ref|YP_138632.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus LMG 18311] >gi|55822078|ref|YP_140519.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus CNRZ1066] >gi|116627048|ref|YP_819667.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus LMD-9] >gi|55736175|gb|AAV59817.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus LMG 18311] >gi|55738063|gb|AAV61704.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus CNRZ1066] >gi|116100325|gb|ABJ65471.1| rRNA methylase [Streptococcus thermophilus LMD-9] (247 aa)
Score = 281, Expect = 1.5e-23, Identities = 78/228 (34%), Positives = 123/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y          D +K   + K + ++   KK         VHQ   G     S   ++D    ++K      +  +IL+LD + DP NFG+I RT+ + QV G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK+  +W   T +D  +    K+ T   KL +I+GNE KG+S  IKK  D ++ I M   VQSLN SV+ A+++Y
  S:    13 YGVHAVTESLEANTGNKLYIQDDLRGKNVDAIKALAAEKKVSISWTPKKTLSDMTGGAVHQ---GFVLRVSEFAYSDLSVIMDKAEQ--EENPLILILDGLNDPHNFGSILRTADATQVTGVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKEAGFWVFGTDMDGTAS--HKWNT-AGKLALIIGNEGKGISANIKKQVDEMITIPMGGHVQSLNASVAAAVLMY 240
>gi|167036782|ref|YP_001664360.1| RNA methyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855616|gb|ABY94024.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacter pseudethanolicus ATCC 33223] (247 aa)
Score = 281, Expect = 1.7e-23, Identities = 80/228 (35%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSY-----FDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG+  VIEA K  +  E  YVS        ++  F K   I ++  +     K     QN  G+   S++  + + D  +E       +K  +L+LDEI DP N GAI R++++F V GII  K   + +N TV+KTS G V ++   KV+N++  +  LK+   W V T ++ EKS     +   +     ++GNE KGVS+L+ ++ DF+VKI M   + SLN SV+ +I++Y
  S:     8 FGRNPVIEAIKSGKEIEKIYVSKTAGGNISKIINFAKEAGIVVSTTDNDTLSKL-AGSQNHQGVVALSAVYKYFEVDDLLEYAEQ-KKEKPFLLILDEITDPHNLGAIIRSAEAFGVHGIIIPKRRAVGVNATVVKTSAGAVEHMRIAKVSNINNTIRDLKERGLWIVGTDVNAEKSFEELNYDFPV---AFVIGNEGKGVSKLVLQNCDFVVKIPMKGKINSLNASVAASILIY 237
>gi|15901307|ref|NP_345911.1| spoU rRNA methylase family protein [Streptococcus pneumoniae TIGR4] >gi|111657374|ref|ZP_01408131.1| hypothetical protein SpneT_02001428 [Streptococcus pneumoniae TIGR4] >gi|14972946|gb|AAK75551.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus pneumoniae TIGR4] (242 aa)
Score = 281, Expect = 1.8e-23, Identities = 77/228 (33%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEITEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|530425|emb|CAA83745.1| rRNA methylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (223 aa)
Score = 281, Expect = 1.8e-23, Identities = 86/215 (40%), Positives = 128/215 (59%)
  Q:    24 YVSYFDELKEFKSKN--IKLNKVNKKFFD---KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNT-DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
           +V     L EF  KN  IK+N V++   D   K   +HQ I+   K+ + T       F E +N+LNT +K ++LVLD+I DP NFGAI R+     V GII     Q+Q+N TV+KTS G+   +   K NNL+  +  LK   +W   T L++ S  ++K +   NK VVI+GNE KGVSEL+ K+SDF + +  + ++ S N SV+ +II +++ + L
  S:     6 WVKNLKLLDEFDLKNTKIKINVVSENKLDQLLKTNELHQGIIAQIKDFNYT------PFDELLNDLNTKEKSLVLVLDQIHDPYNFGAIIRSCSLLNVDGIIILDKKQVQVNSTVLKTSSGSAFDIKISKTNNLNNAIKILKNNGFWIYATNLNQNSTDMTKTQF-ANKSVVIIGNEQKGVSELLTKNSDFNIYVPSNKNIDSFNSSVACSIICFWIANYL 219
>gi|148377309|ref|YP_001256185.1| tRNA/rRNA methyltransferase [Mycoplasma agalactiae PG2] >gi|148291355|emb|CAL58738.1| tRNA/rRNA methyltransferase [Mycoplasma agalactiae PG2] (233 aa)
Score = 280, Expect = 2.0e-23, Identities = 89/236 (37%), Positives = 134/236 (56%)
  Q:     1 MKKFF--GKKAVIEAFKQNELSEVYYV---SYFDELKEFKSKNIKLNKVNKKFFDKYEVV-HQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           MKK +  GK +VI+A K     E  YV   S+ D+LKEF   NIK+   +  FF +Y    HQ  L   K        DF+ +  +I+ +  D  K +L+LD I DP NFGAI RT+ +  +  II  K+    +  TV+K S G    +  +KV+N++  + KLKK  +W   + LDE ++P +K +   N   ++VGNE KG+S+ +   +D  V I    +VQS+NVSV+T I+L+ L +
  S:     1 MKKLYMCGKNSVIDAIKAKLPIEAVYVLSKSHADKLKEFS--NIKIVVKDASFFKEYNSENHQGYLLFLK--------DFNYY--EIDVIKKDNPKTVLILDHIHDPHNFGAIIRTANAAGIKHIIIPKDRSTDVTSTVLKVSSGGFVGVKIIKVSNIASSIEKLKKWGFWIYSSLLDENAVPYNKVQYAGN-CALVVGNEEKGISKPVVNATDVKVYIPQFGTVQSMNVSVATGILLFELVN 230
>gi|149019402|ref|ZP_01834764.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP23-BS72] >gi|147931272|gb|EDK82251.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae SP23-BS72] (169 aa)
Score = 280, Expect = 2.0e-23, Identities = 58/146 (39%), Positives = 90/146 (61%)
  Q:    87 DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NLS+ L+KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    20 ENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 162
>gi|50915006|ref|YP_060978.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS10394] >gi|50904080|gb|AAT87795.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS10394] (257 aa)
Score = 280, Expect = 2.2e-23, Identities = 80/228 (35%), Positives = 121/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y     ++L+  K  NIK     KK    +             VHQ   G     S   +TD D  +E          +IL+LD + DP N G+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS++L+KLK   +W   T  D    P   + T+  KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    23 YGVHAVTESLQANTGNKLYIQ---EDLRGKKVDNIKSLATQKKVAISWTPKKTLSQMTDGAVHQ---GFVLRVSAFAYTDVDEILEIAEQ--EANPLILILDGLTDPHNLGSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQILDKLKARGFWIFGT--DMNGTPSDCWNTN-GKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 250
>gi|150392179|ref|YP_001322228.1| RNA methyltransferase [Alkaliphilus metalliredigens QYMF] >gi|149952041|gb|ABR50569.1| RNA methyltransferase, TrmH family, group 3 [Alkaliphilus metalliredigens QYMF] (248 aa)
Score = 279, Expect = 3.0e-23, Identities = 76/230 (33%), Positives = 128/230 (55%)
  Q:     3 KFFGKKAVIEAFKQN-ELSEVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK----IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  G+  V+EA K   E+ ++      +E  +K+     K +NI +  V ++  D+    H +  G+  + +   ++D ++ +E     N  KK     IL+LDEI DP N G+I RT+ +  V GII  K   + +   V KTS G + Y+   KV+N+S+ ++KLK++  W     +  K +    F+ D    L +++G E  G+S L+K+  DF+VK+ M   V SLN SV+ A+++Y
  S:     5 KIEGRNPVLEALKAGREIDKLLIAKGAEEGSMKKIIGMAKDQNIIVQYVERQKLDQISESHAH-QGVIAQVAAYEYSDVETILE-----NAQKKGKSPFILILDEIMDPHNLGSIIRTADAVGVDGIIIPKRRAVGLTAVVAKTSAGAIEYVPVAKVSNISQTIDKLKEKGVWVAGADMKGKQL---HFEADFKGALALVIGGEGSGISRLVKEKCDFLVKLPMAGQVSSLNASVAAAVLMY 237
>gi|50364903|ref|YP_053328.1| rRNA methylase [Mesoplasma florum L1] >gi|50363459|gb|AAT75444.1| rRNA methylase [Mesoplasma florum L1] (242 aa)
Score = 278, Expect = 4.1e-23, Identities = 85/232 (36%), Positives = 135/232 (58%)
  Q:     5 FGKKAVIEAFKQ--NELSEVYYVSYFDELK---EFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           +GK AV E  K+  N + ++Y  S F   K   EF+   + L K+     +  E  HQ I+   KE       ++  F E +N +  D+ K++L+LD+IQDP NFGAI R+S    V  I+   + Q+ +N TV+KTS GTV  +N  KV NLS  +  L+K  +W   T L+ +S  + K     N+  +++GNE+ GVS+L+ K+SD  V I   +++ S N +V+T++ILY++ +
  S:     8 YGKHAVNEFIKKHPNLIKKIYISSDFKIDKSNNEFQILKVDLKKIENLVGN--EANHQGIVAEVKE------FNYKPFGEALNQMKDDEPKLVLILDQIQDPYNFGAIIRSSSLLGVDQIVILDHKQVFVNSTVVKTSAGTVYDMNISKVTNLSNAIKDLQKNGFWIYSTHLNSESNDMRKVDF-ANRTAIVIGNEHNGVSDLVMKNSDMNVFIPSTNTIDSYNANVATSLILYHVAN 236
>gi|15675741|ref|NP_269915.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes M1 GAS] >gi|19746851|ref|NP_607987.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes MGAS8232] >gi|71911465|ref|YP_283015.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS5005] >gi|139474428|ref|YP_001129144.1| SpoU rRNA methylase family protein [Streptococcus pyogenes str. Manfredo] >gi|13622961|gb|AAK34636.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes M1 GAS] >gi|19749091|gb|AAL98486.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes MGAS8232] >gi|71854247|gb|AAZ52270.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS5005] >gi|134272675|emb|CAM30946.1| SpoU rRNA methylase family protein [Streptococcus pyogenes str. Manfredo] (248 aa)
Score = 278, Expect = 4.2e-23, Identities = 80/228 (35%), Positives = 120/228 (52%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y     ++L+  K  NIK     KK    +             VHQ   G     S   +TD D  +E          +IL+LD + DP N G+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK   +W   T  D    P   + T+  KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    14 YGVHAVTESLQANTGNKLYIQ---EDLRGKKVDNIKSLATQKKVAISWTPKKTLSQMTDGAVHQ---GFVLRVSAFAYTDVDEILEIAEQ--EANPLILILDGLTDPHNLGSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGFWIFGT--DMNGTPSDCWNTN-GKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 241
>gi|42561476|ref|NP_975927.1| rRNA methylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492975|emb|CAE77569.1| rRNA Methylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (244 aa)
Score = 278, Expect = 4.2e-23, Identities = 85/234 (36%), Positives = 129/234 (55%)
  Q:     5 FGKKAVIEAFK--QNELSEVYYVSYFDELKEF--KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
           +GK  V E  K  QN + E++ V     L EF  K   IK+N V++   D+         GI  +     +T F+  I  +N    +K ++L+LD+I D  NFGAI R+     V GII     Q+Q+N TV+KTS G+   +   K NNL+  +  LK  N+W   T L++ S  ++K     NK  VI+GNE KGVSEL+ K+SDF + +  + ++ S N SV+ +II +++ + L
  S:     7 YGKHVVFELLKKHQNMVKEIW-VKDLKILNEFDLKKTKIKVNVVSENKLDQLLETQTQHQGIIAQIKDFNYTPFNELISDLNK--KEKSLVLILDQIHDSYNFGAIIRSCSLLNVDGIIILDKKQVQVNSTVLKTSSGSAFDIKICKTNNLNNAIKILKNNNFWIYATNLNQNSTDMTKIDF-ANKTAVIIGNEQKGVSELLTKNSDFNIYVPSNKNIDSFNASVACSIICFWIANYL 240
>gi|56807805|ref|ZP_00365654.1| COG0566: rRNA methylases [Streptococcus pyogenes M49 591] (248 aa)
Score = 278, Expect = 4.2e-23, Identities = 80/228 (35%), Positives = 120/228 (52%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y     ++L+  K  NIK     KK    +             VHQ   G     S   +TD D  +E          +IL+LD + DP N G+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK   +W   T  D    P   + T+  KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    14 YGVHAVTESLQANTGNKLYIQ---EDLRGKKVDNIKSLATQKKVAISWTPKKTLSQMTDGAVHQ---GFVLRVSAFAYTDVDEILEIAEQ--EANPLILILDGLTDPHNLGSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGFWIFGT--DMNGTPSDCWNTN-GKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 241
>gi|196163325|ref|ZP_03123856.1| putative tRNA/rRNA methyltransferase [Clostridium difficile QCD-23m63] (245 aa)
Score = 278, Expect = 4.4e-23, Identities = 78/232 (33%), Positives = 125/232 (53%)
  Q:     1 MKKFFGKKAVIEAFKQN-ELSEVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKYEVVH--QNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M    G+  VIEA K + E+ ++   +   E  +K+     K KNI +  V+K   D+    H  Q ++  A E     + + D  I+ + N + D    ++LDEI DP N G+I RT+ +    G+I  K   + I   V K S G V Y+   KV N+   + +LK+E  W     +D ++     +K ++   L V++G+E  G+S L+K++ DFIVK+ M  +V SLN SV+  I+LY
  S:     1 MANIEGRNPVIEAIKSDREIDKILIANSAKEGSIKKIIGMAKDKNIIIQYVDKHKLDEVSTSHSHQGVIAYASEHK---YYELDELIDLVKNKDEDP-FFIILDEITDPHNLGSIIRTADAVGAHGVIIPKRRSVHITPVVAKASAGAVEYMPVCKVTNIVNTIKRLKEEGLWIAAADMDGETF----YKQNLTGPLGVVIGSEGFGISRLVKQNCDFIVKMPMIGNVTSLNASVAGGILLY 234
>gi|71904302|ref|YP_281105.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS6180] >gi|94991229|ref|YP_599329.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS10270] >gi|94995142|ref|YP_603240.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS10750] >gi|71803397|gb|AAX72750.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS6180] >gi|94544737|gb|ABF34785.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS10270] >gi|94548650|gb|ABF38696.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS10750] (257 aa)
Score = 277, Expect = 4.5e-23, Identities = 80/228 (35%), Positives = 120/228 (52%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y     ++L+  K  NIK     KK    +             VHQ   G     S   +TD D  +E          +IL+LD + DP N G+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK   +W   T  D    P   + T+  KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    23 YGVHAVTESLQANTGNKLYIQ---EDLRGKKVDNIKSLATQKKVAISWTPKKTLSQMTDGAVHQ---GFVLRVSAFAYTDVDEILEIAEQ--EANPLILILDGLTDPHNLGSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGFWIFGT--DMNGTPSDCWNTN-GKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 250
>gi|167756030|ref|ZP_02428157.1| hypothetical protein CLORAM_01550 [Clostridium ramosum DSM 1402] >gi|167704022|gb|EDS18601.1| hypothetical protein CLORAM_01550 [Clostridium ramosum DSM 1402] (241 aa)
Score = 277, Expect = 4.9e-23, Identities = 82/232 (35%), Positives = 129/232 (55%)
  Q:     1 MKKF-FGKKAVIEAFKQNELSEVYYVSYFDE----LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK-IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           MK++ +GK  ++EA K ++     YV    +    +++ K K I    V+K  F K    V HQ ++   +E        + S  E IN +   K+ ++L+LD ++DP N GAI RT  +  V G+I  KN  + +N TV K S G ++++   +V NL+  L  LKK ++W V   LD+        + D N  LV+++G+E  G+S L+KK  D  V + M   + SLN SV+TA+ILY
  S:     1 MKQYIYGKNTILEALKGDKSVYTVYVQNNAKDNGIIEQCKRKKIPFKIVDKSEFIKKLGNVSHQGVMAEIEEYR------YYSIDEIINTIPDGKQPLLLMLDGLEDPHNLGAILRTCDAIGVDGVIIGKNRSVGLNGTVAKVSTGAIDHVKVAQVTNLTRTLEDLKKRSFWVVGCDLDKSQ---DYRQVDYNMPLVIVIGSEGFGISRLVKKSCDINVVLPMVGHINSLNASVATAVILY 232
>gi|94989283|ref|YP_597384.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94993172|ref|YP_601271.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS2096] >gi|94542791|gb|ABF32840.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94546680|gb|ABF36727.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS2096] (257 aa)
Score = 277, Expect = 5.2e-23, Identities = 80/228 (35%), Positives = 120/228 (52%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y     ++L+  K  NIK     KK    +             VHQ   G     S   +TD D  +E          +IL+LD + DP N G+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK   +W   T  D    P   + T+  KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    23 YGVHAVTESLQANTGNKLYIQ---EDLRGKKVDNIKSLATQKKVAISWTPKKTLSQMTDGAVHQ---GFVLRVSAFAYTDVDEILEIAEQ--EANPLILILDGLTDPHNLGSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKSRGFWIFGT--DMNGTPSDCWNTN-GKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 250
>gi|195978847|ref|YP_002124091.1| tRNA/rRNA methyltransferase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975552|gb|ACG63078.1| tRNA/rRNA methyltransferase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (248 aa)
Score = 277, Expect = 5.7e-23, Identities = 79/228 (34%), Positives = 120/228 (52%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEF-KSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+   N  +++Y          D +K+   SK + ++   KK   +     VHQ   G     S   +T+ D  +E          ++L+LD + DP NFG+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L++LK   +W   T  D    P  K+ T   KL +I+GNE KG+S  IKK  D ++ I M   VQSLN SV+ AI++Y
  S:    14 YGVHAVTESLLANTGNKLYIQEDLRGKNVDHIKDLATSKKVSISWTKKKALSEMTAGAVHQ---GFVLRVSAFAYTELDELLELAQQ--EANPLLLILDGLTDPHNFGSILRTADATGVCGVIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQALDQLKANGFWVFGT--DVTGTPSYKWNTS-GKLALIIGNEGKGISANIKKQVDEMITIPMMGHVQSLNASVAAAILMY 241
>gi|21911205|ref|NP_665473.1| SpoU family tRNA/rRNA methyltransferase [Streptococcus pyogenes MGAS315] >gi|28896582|ref|NP_802932.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes SSI-1] >gi|21905417|gb|AAM80276.1| putative tRNA/rRNA methyltransferase, spoU family [Streptococcus pyogenes MGAS315] >gi|28811836|dbj|BAC64765.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes SSI-1] (248 aa)
Score = 276, Expect = 6.2e-23, Identities = 80/228 (35%), Positives = 120/228 (52%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE-----------VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y     ++L+  K  NIK     KK    +             VHQ   G     S   +TD D  +E          +IL+LD + DP N G+I RT+ +  V G+I  K+  + +   V KTS G V ++   +V NLS+ L+KLK   +W   T  D    P   + T+  KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    14 YGVHAVTESLQANTGNKLYIQ---EDLRGKKVDNIKSLATQKKVAISWTPKKTLSQMTDGAVHQ---GFVLRVSAFAYTDVDEILEIAEQ--EANPLILILDGLTDPHNLGSILRTADATNVCGVIIPKHRSVCVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGFWIFGT--DMNGTPSDCWNTN-GKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 241
>gi|149007272|ref|ZP_01830930.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP18-BS74] >gi|147761076|gb|EDK68044.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP18-BS74] (242 aa)
Score = 275, Expect = 8.3e-23, Identities = 76/228 (33%), Positives = 125/228 (54%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   N  +++Y          +++KE  + K + ++  +KK   +     VHQ   G     S   +++ D  + K      +  ++L+LD + DP N G+I RT+ +  V+G+I  K+  + +   V KT+ G + ++   +V NL++ L KLK E +WT  T  D    P  K+ T   K+ +I+GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:     8 YGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTEGAVHQ---GFVLRVSEFAYSELDYILAKTRQ--EENPLLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLNQTLYKLKDEGFWTFGT--DMNGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235
>gi|167039502|ref|YP_001662487.1| RNA methyltransferase [Thermoanaerobacter sp. X514] >gi|166853742|gb|ABY92151.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacter sp. X514] (247 aa)
Score = 274, Expect = 1.0e-22, Identities = 78/228 (34%), Positives = 126/228 (55%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSY-----FDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG+  VIEA K  +  E  YVS        ++  F K   I ++  +     +     +N  G+   S++  + + D  +E       +K  +L+LDEI DP N GAI R++++F V GII  K   + +N TV+KTS G V ++   KV+N++  +  LK+   W V T ++ EKS     +   +     ++GNE KGVS+L+ ++ DF+VKI M   + SLN SV+ +I++Y
  S:     8 FGRNPVIEAIKSGKEIEKIYVSKTAGGNISKIINFAKEAGIVVSTTDNDTLSEL-AGSRNHQGVVALSAVYKYFEVDDLLEYAEQ-KKEKPFLLILDEITDPHNLGAIIRSAEAFGVHGIIIPKRRAVGVNATVVKTSAGAVEHMRIAKVSNINNTIRDLKERGLWIVGTDVNAEKSFEELNYDFPV---AFVIGNEGKGVSKLVLQNCDFVVKIPMKGKINSLNASVAASILIY 237
>gi|56961913|ref|YP_173635.1| tRNA/rRNA methyltransferase [Bacillus clausii KSM-K16] >gi|56908147|dbj|BAD62674.1| tRNA/rRNA methyltransferase [Bacillus clausii KSM-K16] (263 aa)
Score = 274, Expect = 1.1e-22, Identities = 74/231 (32%), Positives = 122/231 (52%)
  Q:     6 GKKAVIEAFKQN---------ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           GK  VIEA K           + S+   ++   +L   K +N+ +    K+  D+  V H N  G+    +   + D D+ +        +    LVLDEI+DP N G+I RT+ +    GII  K   + + +TV K S G + Y+  ++V NL+  +++LKK+  W   T   + +      + D N  L +++G+E KG+S LIK+  DF+V I M   V SLN SV+ ++++Y + H
  S:    25 GKNPVIEAIKSGHPIHKIWIGDQSQKGQMTKLTQLA--KEQNVLVQTAPKRKLDQL-VGHSNHQGVVASVAAYEYADMDA-LFAKAAAAHEAPFFLVLDEIEDPHNLGSIMRTADAVGAHGIIIPKRRSVGLTQTVAKASTGAIEYIPVVRVTNLARTMDELKKQGLWFAGT---DAAAEGDYREADYNLPLCLVIGSEGKGISRLIKEKCDFLVSIPMKGRVTSLNASVAASLLMYEVFH 258
>gi|145956366|ref|ZP_01805362.1| hypothetical protein CdifQ_04000062 [Clostridium difficile QCD-32g58] >gi|168696128|ref|ZP_02728405.1| putative tRNA/rRNA methyltransferase [Clostridium difficile QCD-37x79] >gi|168716316|ref|ZP_02748593.1| putative tRNA/rRNA methyltransferase [Clostridium difficile QCD-63q42] >gi|168725885|ref|ZP_02758162.1| putative tRNA/rRNA methyltransferase [Clostridium difficile QCD-76w55] >gi|168730330|ref|ZP_02762607.1| putative tRNA/rRNA methyltransferase [Clostridium difficile QCD-97b34] >gi|196126509|ref|ZP_03118258.1| putative tRNA/rRNA methyltransferase [Clostridium difficile ATCC 43255] >gi|196161009|ref|ZP_03121570.1| putative tRNA/rRNA methyltransferase [Clostridium difficile CIP 107932] (245 aa)
Score = 273, Expect = 1.4e-22, Identities = 77/232 (33%), Positives = 124/232 (53%)
  Q:     1 MKKFFGKKAVIEAFKQN-ELSEVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M    G+  VIEA K + E+ ++   +   E  +K+     K KNI +  V+K   D+    H +  G+   +S   + + D  I+   N + D    ++LDEI DP N G+I RT+ +    G+I  K   + I   V K S G V Y+   KV N+   + +LK+E  W     +D ++     +K ++   L V++G+E  G+S L+K++ DFIVK+ M  +V SLN SV+  I+LY
  S:     1 MASIEGRNPVIEAIKSDREIDKILIANSAKEGSIKKIIGMAKDKNIIIQYVDKHKLDEVSTSHSH-QGVIAYASEYKYYELDELIDLAKNKDEDP-FFIILDEITDPHNLGSIIRTADAVGAHGVIIPKRRSVHITPVVAKASAGAVEYMPVCKVTNIVNTIKRLKEEGLWIAAADMDGETF----YKQNLTGPLGVVIGSEGFGISRLVKQNCDFIVKMPMIGNVTSLNASVAGGILLY 234
>gi|154502841|ref|ZP_02039901.1| hypothetical protein RUMGNA_00656 [Ruminococcus gnavus ATCC 29149] >gi|153796724|gb|EDN79144.1| hypothetical protein RUMGNA_00656 [Ruminococcus gnavus ATCC 29149] (255 aa)
Score = 271, Expect = 2.8e-22, Identities = 69/227 (30%), Positives = 118/227 (51%)
  Q:     6 GKKAVIEAFKQNE-LSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  + + +V+ +    +      ++E K  +  +N V K+   +  V   HQ ++  A     +   D     E+      +   +++LD I+DP N GAI RT+      G+I  K   + +  TV KTS G +NY    KV NL++ + +LK++  W VC  +  +S+     K  I    +++GNE +GV  L+K+  DF+  I M   + SLN SV+  ++ Y
  S:    19 GRNAVLEAFRSGKPIDKVFVLDGCQDGPVRTIVREAKKHDTIINFVGKERLSQISVTGKHQGVIAYAAAYEYSEVEDMLKLAEE----RGEDPFLILLDNIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLAKTMEELKEKGLWFVCADMGGESMYRLNLKGPIG---LVIGNEGEGVGRLVKEKCDFVASIPMKGEIDSLNASVAAGVLAY 247
>gi|126697621|ref|YP_001086518.1| putative tRNA/rRNA methyltransferase [Clostridium difficile 630] >gi|115249058|emb|CAJ66869.1| putative tRNA/rRNA methyltransferase [Clostridium difficile 630] (248 aa)
Score = 270, Expect = 3.3e-22, Identities = 76/227 (33%), Positives = 123/227 (54%)
  Q:     6 GKKAVIEAFKQN-ELSEVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+  VIEA K + E+ ++   +   E  +K+     K KNI +  V+K   D+    H +  G+   +S   + + D  I+   N + D    ++LDEI DP N G+I RT+ +    G+I  K   + I   V K S G V Y+   KV N+   + +LK+E  W     +D ++     +K ++   L V++G+E  G+S L+K++ DFIVK+ M  +V SLN SV+  I+LY
  S:     9 GRNPVIEAIKSDREIDKILIANSAKEGSIKKIIGMAKDKNIIIQYVDKHKLDEVSTSHSH-QGVIAYASEYKYYELDELIDLAKNKDEDP-FFIILDEITDPHNLGSIIRTADAVGAHGVIIPKRRSVHITPVVAKASAGAVEYMPVCKVTNIVNTIKRLKEEGLWIAAADMDGETF----YKQNLTGPLGVVIGSEGFGISRLVKQNCDFIVKMPMIGNVTSLNASVAGGILLY 237
>gi|114567860|ref|YP_755014.1| putative tRNA/rRNA methyltransferase YacO [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338795|gb|ABI69643.1| conserved hypothetical tRNA/rRNA methyltransferase yacO [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (248 aa)
Score = 270, Expect = 3.4e-22, Identities = 76/228 (33%), Positives = 123/228 (53%)
  Q:     5 FGKKAVIEAFK-QNELSEVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG  AV EA K Q  + ++Y      +  L+E     + K +KL  + KK  D+  E  HQ   GI  E     + D    +EK+         +L+LD I+DP N GAI RT++   V GII   +   ++N TV + S G V ++  ++ NNL   +  LK+E +W +    D K+   S F T I +   +++G E +G+  L++++ D +V+I M   + SLN SV+ A+++Y
  S:     6 FGINAVSEALKGQRRVYKIYAQRERQDKRLEEILTLAREKQLKLQYLEKKKMDELCEGKHQ---GIIAEVERYPYADLGQVLEKLQAQKEKPPFLLLLDGIEDPQNLGAIIRTAECAGVDGIIIPSHKSAEVNPTVSRVSAGAVEHMAIIRENNLVNTIKYLKQEGFWVL--GADAKA-RQSYFNTSIPSPTALVIGGEGQGIRRLVRENCDILVRIPMFGQLNSLNASVAAALLIY 236
>gi|77409659|ref|ZP_00786329.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae COH1] >gi|77413808|ref|ZP_00789988.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae 515] >gi|77160170|gb|EAO71301.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae 515] >gi|77171728|gb|EAO74927.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae COH1] (251 aa)
Score = 270, Expect = 3.6e-22, Identities = 78/228 (34%), Positives = 122/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y          D++K   + K + ++   KK         VHQ   G   + S   + D    + K  N   +  +IL+LD + DP N G+I RT+ +  V GII  K+  + +   V KTS G V ++   +V NLS+ L+ LK +++W   T  D    P  K+ T   KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    17 YGLHAVTESLRANTGNKLYLQDDLRGKNVDKVKALATEKKVSISWTPKKILSDMTNGGVHQ---GFVLKVSEFAYADLSEIMTKAEN--EENPLILILDGLTDPHNLGSILRTADATNVTGIIIPKHRSVGVTPVVSKTSTGAVEHVPIARVTNLSQTLDTLKDKDFWIFGT--DMNGTPSHKWNTK-GKLALVIGNEGKGISHNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 244
>gi|160893354|ref|ZP_02074141.1| hypothetical protein CLOL250_00904 [Clostridium sp. L2-50] >gi|156865046|gb|EDO58477.1| hypothetical protein CLOL250_00904 [Clostridium sp. L2-50] (251 aa)
Score = 270, Expect = 3.6e-22, Identities = 71/227 (31%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  Y+       S    ++E K +   +N V+K+  ++      HQ ++  +A      I   F    EK          I +LDEI+DP N GAI RT+      G+I  K   + I  TV+K S G + Y   +KV NL++ +++LKK   W  C  +D + +    ++ ++   + +++GNE  GVS L+K+  D++V I M   + SLN SV+  ++ Y
  S:    13 GRNAVMEAFRSGKTVDKLYLQDGCHDGSINSIVREAKKQETIINYVSKEKLNQMSSTGKHQGVIAHVAAYEYSAIDEIFAKAEEK-----GQPPFIFILDEIEDPHNLGAIVRTANLCGAHGVIIPKRRAVGITATVVKASAGAIAYTPVVKVTNLAKTIDELKKRGMWFACADMDGELM----YRCNLTGPMGLVIGNEGTGVSRLVKEKCDYVVSIPMSGDIDSLNASVAAGVLGY 241
>gi|25010279|ref|NP_734674.1| hypothetical protein gbs0204 [Streptococcus agalactiae NEM316] >gi|23094631|emb|CAD45849.1| Unknown [Streptococcus agalactiae NEM316] (249 aa)
Score = 270, Expect = 3.6e-22, Identities = 78/228 (34%), Positives = 122/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y          D++K   + K + ++   KK         VHQ   G   + S   + D    + K  N   +  +IL+LD + DP N G+I RT+ +  V GII  K+  + +   V KTS G V ++   +V NLS+ L+ LK +++W   T  D    P  K+ T   KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    15 YGLHAVTESLRANTGNKLYLQDDLRGKNVDKVKALATEKKVSISWTPKKILSDMTNGGVHQ---GFVLKVSEFAYADLSEIMTKAEN--EENPLILILDGLTDPHNLGSILRTADATNVTGIIIPKHRSVGVTPVVSKTSTGAVEHVPIARVTNLSQTLDTLKDKDFWIFGT--DMNGTPSHKWNTK-GKLALVIGNEGKGISHNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 242
>gi|52078591|ref|YP_077382.1| putative tRNA/rRNA methyltransferase YacO [Bacillus licheniformis ATCC 14580] >gi|52783952|ref|YP_089781.1| YacO [Bacillus licheniformis ATCC 14580] >gi|52001802|gb|AAU21744.1| putative tRNA/rRNA methyltransferase YacO [Bacillus licheniformis ATCC 14580] >gi|52346454|gb|AAU39088.1| YacO [Bacillus licheniformis DSM 13] (249 aa)
Score = 269, Expect = 4.4e-22, Identities = 70/227 (30%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEFKSKN-IKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK AVIE  K         ++E        ++ +  +KN + ++ V +K  D  ++V     G+  + +   + + D   +K  + N ++  ILVLDEI+DP N G+I RT+ +    GI+  K   + +  TV K S G + ++  +KV NLS  L ++K    W V T   + S        D N  L +++G+E KG+  L+K+  DF++++ M   V SLN SV+  +++Y
  S:    10 GKNAVIETLKSGRELYKLWMAENTVKGQAQQVVDLAAKNGVTIHYVPRKKLD--QMVSGQHQGVVAQVAAYEYAELDDLFQKAEDRN-EQPFILVLDEIEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVVKVTNLSRTLEEMKGRGIWVVGT---DASGQQDYRSLDGNMPLALVIGSEGKGMGRLVKEKCDFLIRLPMAGKVTSLNASVAAGLLMY 238
>gi|15612676|ref|NP_240979.1| tRNA/rRNA methyltransferase [Bacillus halodurans C-125] >gi|10172725|dbj|BAB03832.1| tRNA/rRNA methyltransferase [Bacillus halodurans C-125] (249 aa)
Score = 269, Expect = 4.5e-22, Identities = 64/227 (28%), Positives = 119/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK  +IEA +        ++    +       L+  K + + +  V K+  D+  + H+N  G+    +   + + D   ++      ++   +VLDE++DP N G+I RT+ +  V G+I  K   + + +TV K S G + Y+  ++V NL+  +  LKK   W + T  D K     +       + +++G+E KG+S L+++  DF+V+I M   V SLN SV+T++++Y
  S:     8 GKNPIIEALRSGRPMNKIWIGEGSQKGQMQKVLELAKEQGVLVQHVPKRKLDQL-IGHENHQGVVASVAAYEYAEMDDLFQRAAE-KGEEPFFIVLDEVEDPHNLGSILRTADAAGVHGVIIPKRRAVGLTQTVAKASTGAIEYVPVVRVTNLARTMEDLKKRGLWFIGT--DAKGSEDYRGAAYDMPIALVIGSEGKGLSRLVREKCDFLVRIPMVGQVTSLNASVATSLLMY 237
>gi|167745715|ref|ZP_02417842.1| hypothetical protein ANACAC_00408 [Anaerostipes caccae DSM 14662] >gi|167655027|gb|EDR99156.1| hypothetical protein ANACAC_00408 [Anaerostipes caccae DSM 14662] (246 aa)
Score = 268, Expect = 4.9e-22, Identities = 69/227 (30%), Positives = 113/227 (49%)
  Q:     6 GKKAVIEAFKQNE-LSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EA +  + + ++Y +    +      ++E K  +  LN V K+  D+    H    G+   ++   +   +    +      D   IL LD I+DP N GAI RT+      G+I  K   + +  TV KTS G +NY   +KV NLS+ + +LK+   W VC  +D   +        I    +++GNE  GVS L+K+  D+   I M+  + SLN SV+  ++ Y
  S:    10 GRNAVLEALRAGKPIDKIYILDGCQDGPVRTIVREAKKTDAVLNFVEKERLDQLTKEHHQ--GVVAMAAAYEYGQMEDLFARAEEKKEDPFFIL-LDGIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTPTVAKTSAGALNYTPVVKVTNLSKTMEELKERGLWFVCADMDGDMMYRQNLTGPIG---LVIGNEGSGVSRLVKERCDYTASIPMNGDIDSLNASVAAGVLAY 237
>gi|167575510|ref|ZP_02368384.1| rRNA methylase [Borrelia valaisiana VS116] (246 aa)
Score = 268, Expect = 5.0e-22, Identities = 81/224 (36%), Positives = 133/224 (59%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSL-------TIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ ++N    DK  + +++  G A +  L       T   DF+  +E       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LKK  +W    A D K   ++K K +  K+ +I+GNE +GV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEKLAKAQNIKIRRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFEHLLETFKK--KENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKITVANINNTINFLKKNGFWIY--AGDVKGQDINKIKINDRKIALILGNEGRGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|134298074|ref|YP_001111570.1| RNA methyltransferase [Desulfotomaculum reducens MI-1] >gi|134050774|gb|ABO48745.1| RNA methyltransferase, TrmH family, group 3 [Desulfotomaculum reducens MI-1] (243 aa)
Score = 268, Expect = 5.1e-22, Identities = 66/202 (32%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K  K  NI L  V +   DK    V HQ ++  A       + + +  +E I         I++LDEI DP N GAI RT+ +    G+I  +   + +  TV K S G V Y+   +V NL + + +LK E  W V   +D   I      T    L++++G E KG+  LIK+  D +V++ M   V SLN SV+ A+++Y
  S:    39 VKLAKQNNIPLQMVERSHLDKMNPGVPHQGVIAYAAAKQ---YVELEELLE-IARAKGQDPFIIMLDEINDPHNLGAIMRTADAAGAHGVIIPQRRSVALTSTVAKASAGAVEYVPVARVTNLDQTIRQLKDEGLWVVGADMDGSEIYWDAKLT--GPLLLVIGGEGKGLGRLIKERCDMLVRLPMAGRVGSLNASVAAALLVY 236
>gi|20808679|ref|NP_623850.1| rRNA methylase [Thermoanaerobacter tengcongensis MB4] >gi|20517315|gb|AAM25454.1| rRNA methylase [Thermoanaerobacter tengcongensis MB4] (247 aa)
Score = 267, Expect = 7.4e-22, Identities = 63/177 (35%), Positives = 102/177 (57%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCT-ALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++ +         TD  ++ E+      +K  +L+LDEI DP N GAI R++++F V G+I  K     IN TV+K S G V Y+   KV+N++  +  LK++  W + T A  EKS    +   D   L +++G+E KG+S L+ ++ DF++KI M   + SLN SV+ +I++Y
  S:    67 HQGVVAVGALYKYFDVTDILNYAEE----KKEKPFLLILDEITDPHNMGAIIRSAEAFGVHGVIIPKRRSAGINATVVKASAGAVEYIKVAKVSNINSTIRDLKEKGLWIIGTDAKAEKS--FEELDYDF-PLALVIGSEGKGISRLVLENCDFVIKIPMKGKINSLNASVAASILMY 237
>gi|104774468|ref|YP_619448.1| tRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423549|emb|CAI98467.1| tRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (255 aa)
Score = 266, Expect = 8.3e-22, Identities = 72/228 (31%), Positives = 123/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKE---------FKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG+ A I+  K  +  ++  V   + ++E          K K++ + +V K   DK     +N  G+    +   + DFD  ++K++    +  ++L+LD I+DP N G+I R++ +  V+G+I  K     +   V KTS G ++++   +VNNL +    LK   YW   TA++       K+  +  K V+++GNE KG+S L+ K  D  + I M   VQSLN SV+T ++LY
  S:    16 FGRHAGIDFLKTQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKNKLDKL-TGGENHQGLVLAVASFEYADFDQLLDKLDQ--EEAPLLLMLDNIEDPHNLGSILRSADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTAMEGDD--YRKWNAN-GKTVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLLY 246
>gi|15673854|ref|NP_268029.1| tRNA-guanosine methyltransferase [Lactococcus lactis subsp. lactis Il1403] >gi|12724905|gb|AAK05970.1|AE006417_2 tRNA-guanosine methyltransferase (EC 2.1.1.34) [Lactococcus lactis subsp. lactis Il1403] (242 aa)
Score = 266, Expect = 8.6e-22, Identities = 75/228 (32%), Positives = 124/228 (54%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNI-------KLNKVNKKFFDKYEV-------VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   + ++++Y        ++ + KN+       +L KVN  +  K E+       VHQ  +    E +   + D +  +  +         IL+LDE+ DP N G+I RT+ +  V  II  K+  + I  T +K S G + ++  ++V NLS+ L+KLK  N+W   T +D      SK+ T   K+ +I+GNE  G+ + +KK  D ++ I M   VQSLN SV+ +I++Y
  S:     8 YGLHAVTEALNGDLVNKLYV------QEDLRGKNVEKIKELARLKKVNISWTPKTELNKLTENGVHQGFMARVSEFA---YADLEKILPAL--AEKSDATILILDELTDPHNLGSIARTADATGVDAIIIPKHRAVGITSTAVKASTGALQHVPIVRVTNLSQTLDKLKAANFWVFGTDMD--GTVYSKWNTK-GKVALIIGNEGHGIGQNLKKQVDEMITIPMTGHVQSLNASVAASILMY 235
>gi|22536393|ref|NP_687244.1| RNA methyltransferase [Streptococcus agalactiae 2603V/R] >gi|76787268|ref|YP_328940.1| RNA methyltransferase [Streptococcus agalactiae A909] >gi|76799582|ref|ZP_00781707.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae 18RS21] >gi|77405353|ref|ZP_00782448.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae H36B] >gi|77410962|ref|ZP_00787318.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae CJB111] >gi|22533220|gb|AAM99116.1|AE014201_14 RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae 2603V/R] >gi|76562325|gb|ABA44909.1| RNA methyltransferase, TrmH family [Streptococcus agalactiae A909] >gi|76585065|gb|EAO61698.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae 18RS21] >gi|77163017|gb|EAO73972.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae CJB111] >gi|77176031|gb|EAO78805.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus agalactiae H36B] (251 aa)
Score = 266, Expect = 8.6e-22, Identities = 78/228 (34%), Positives = 121/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF-----DELKEFKS-KNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV E+ + N  +++Y          D++K   + K + ++   KK         VHQ   G   + S   + D    + K  N   +  +IL+LD + DP N G+I RT+ +  V GII  K+  + +   V KTS G V ++   +V NLS+ L+ LK + +W   T  D    P  K+ T   KL +++GNE KG+S  IKK  D ++ I M+  VQSLN SV+ AI++Y
  S:    17 YGLHAVTESLRANTGNKLYLQDDLRGKNVDKVKALATEKKVSISWTPKKTLSDMTNGGVHQ---GFVLKVSEFAYADLSEIMTKAEN--EENPLILILDGLTDPHNLGSILRTADATNVTGIIIPKHRSVGVTPVVSKTSTGAVEHVPIARVTNLSQTLDTLKDKEFWIFGT--DMNGTPSHKWNTK-GKLALVIGNEGKGISHNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 244
>gi|157690879|ref|YP_001485341.1| tRNA/rRNA methyltransferase [Bacillus pumilus SAFR-032] >gi|194017547|ref|ZP_03056158.1| RNA methyltransferase, TrmH family, group 3 [Bacillus pumilus ATCC 7061] >gi|157679637|gb|ABV60781.1| tRNA/rRNA methyltransferase [Bacillus pumilus SAFR-032] >gi|194010819|gb|EDW20390.1| RNA methyltransferase, TrmH family, group 3 [Bacillus pumilus ATCC 7061] (249 aa)
Score = 266, Expect = 1.0e-21, Identities = 70/227 (30%), Positives = 118/227 (51%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK AVIE  K +       ++E        ++ E  K +NI +  V +K  D  ++V     GI  + +   + + D   + I     ++   L+LDEI+DP N G+I RT+ +    GI+  K   + +  TV K S G + ++   KV NLS  L+++K+   W   T    K     +F   +  L +++G+E KG+  LIK+  DF++K+ M   V SLN SV+ ++++Y
  S:    10 GKNAVIETLKSDRELYKLWMAENTVKGQAQQVIELAKKQNITIQYVPRKKLD--QMVTGQHQGIVAQVAAYEYAELDDLYQ-IAEQRNEQPFFLILDEIEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVAKVTNLSRALDEMKERGIWVAGTDASAKQ-DYRQFDGTM-PLALVIGSEGKGIGRLIKEKCDFLIKLPMAGKVTSLNASVAASLLMY 238
>gi|116514573|ref|YP_813479.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093888|gb|ABJ59041.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (249 aa)
Score = 265, Expect = 1.3e-21, Identities = 72/228 (31%), Positives = 122/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKE---------FKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG+ A I+  K  +  ++  V   + ++E          K K++ + +V K   DK     +N  G+    +   + DFD  ++K++    +   +L+LD I+DP N G+I R++ +  V+G+I  K     +   V KTS G ++++   +VNNL +    LK   YW   TA++       K+  +  K V+++GNE KG+S L+ K  D  + I M   VQSLN SV+T ++LY
  S:    10 FGRHAGIDFLKTQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKNKLDKL-TGGENHQGLVLAVASFEYADFDQLLDKLDQ--EEAPFLLMLDNIEDPHNLGSILRSADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTAMEGDD--YRKWNAN-GKTVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLLY 240
>gi|166031081|ref|ZP_02233910.1| hypothetical protein DORFOR_00763 [Dorea formicigenerans ATCC 27755] >gi|166028928|gb|EDR47685.1| hypothetical protein DORFOR_00763 [Dorea formicigenerans ATCC 27755] (252 aa)
Score = 265, Expect = 1.4e-21, Identities = 68/227 (29%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNI----KLNKVNKKFFDKYEVV-------HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  +V   D  ++   + I    K +    +F DK  +        HQ ++            D  +  ++      +   +++LD+I+DP N GAI RT+      G+I  K   + +  TV KTS G +NY    KV NL++ + +LK++  W VC  +  +S+    +K ++   + +++GNE +GVS L+K+  DF+  I M   + SLN SV+T ++ Y
  S:    16 GRNAVLEAFRSGKPVDKLFV--LDGCQDGPVRTIVREAKKHDTLVQFVDKERLTQLSQTGRHQGVIAYTAAYEYAQVEDMLALAKE----RGEDPFLILLDDIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTATVAKTSAGAINYTPVAKVTNLTKTMKELKEKGLWFVCADMGGESM----YKLNLTGPIGLVIGNEGEGVSRLVKETCDFVASIPMKGDIDSLNASVATGVLAY 244
>gi|192813614|ref|ZP_03042274.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y412MC10] >gi|192797589|gb|EDV74109.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y412MC10] (164 aa)
Score = 265, Expect = 1.4e-21, Identities = 53/142 (37%), Positives = 84/142 (59%)
  Q:    91 ILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI--NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +L+LDEI+DP N G+I RT+      G+I  K    QI  TV KTS G V Y+   +V NL + +++LK+   W V T +D        + T++    + +++GNENKG+  LI++  D +VK+ M   + SLN SV+  +++Y
  S:    14 LLLLDEIEDPHNLGSILRTADCTGAHGVILPKRRSAQITATVSKTSAGAVEYVPVARVTNLGQTIDQLKEMGVWVVGTVVDAVQ---ELYDTEVFDGPVAIVIGNENKGMGRLIREKCDVLVKLPMAGKINSLNASVAAGVVMY 154
>gi|153814446|ref|ZP_01967114.1| hypothetical protein RUMTOR_00658 [Ruminococcus torques ATCC 27756] >gi|145848842|gb|EDK25760.1| hypothetical protein RUMTOR_00658 [Ruminococcus torques ATCC 27756] (258 aa)
Score = 264, Expect = 1.8e-21, Identities = 73/227 (32%), Positives = 118/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+     +  +V            ++E K     LN V K+   +      HQ   G+   ++   + + D  + K+     +   ++VLD I+DP N GAI RT+      G+I  K   + +  TV KTS G +NY    KV NL + + +LK++  W VC  +D +S+       D+N    + ++VGNE  GVS L+K++ DF+  I M   + SLN SV+  ++ Y
  S:    21 GRNAVLEAFRSGRTIDKLFVLDGCQDGPVRTIVREAKKHGTILNFVGKERLSQLTQTGRHQ---GVIAYAAAYDYAEIDDML-KLAEKRGEDPFLIVLDGIEDPHNLGAIIRTANIAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLVKTMEELKEKGIWFVCADMDGQSM------YDMNLTGPIGLVVGNEGDGVSRLVKENCDFVASIPMKGEITSLNASVAGGVLAY 249
>gi|116629012|ref|YP_814184.1| rRNA methylase [Lactobacillus gasseri ATCC 33323] >gi|116094594|gb|ABJ59746.1| rRNA methylase [Lactobacillus gasseri ATCC 33323] (251 aa)
Score = 263, Expect = 2.0e-21, Identities = 68/198 (34%), Positives = 104/198 (52%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + KN+ +    K   D+  V H+N  G+    +   + D D  ++K +    D   IL+LD I+DP N G+I RT  +  V  +I  K     +   V KTS G ++Y+   +VNNL +    LKK  YW   TA++ +     K+  +  K V+++GNE KG+S L+ K  D  + I M   VQSLN SV+T ++LY
  S:    49 RKKNLVVQNAPKNKLDQM-VNHENHQGLVLTVAPFEYADLDELLDKFDQDGKDP-FILMLDSIEDPHNLGSILRTCDATGVDAVIIPKRRATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKLLKKRGYWIFGTAMEGED--YRKWNAN-GKTVLVIGNEGKGISPLLLKQMDQTLTIPMVGHVQSLNASVATGVLLY 241
>gi|95930701|ref|ZP_01313434.1| RNA methyltransferase TrmH, group 3 [Desulfuromonas acetoxidans DSM 684] >gi|95133181|gb|EAT14847.1| RNA methyltransferase TrmH, group 3 [Desulfuromonas acetoxidans DSM 684] (244 aa)
Score = 262, Expect = 2.4e-21, Identities = 71/229 (31%), Positives = 118/229 (51%)
  Q:     4 FFGKKAVIEAFKQNELSEVYYVS-----YFDEL-KEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            FG  AV EA  Q       YV        +E+  +   +++ + +  ++  DK   +V HQ ++   K        DF S  + +   +  ++  L+LD I DP NFGA+ R++ +    G+IF K+    +   V KT+ GT+ Y+   +V NL   + +LKK   W    A +E     S F+  ++  + +V G+E +G+  LI+K  D ++ I M   V+SLNVSV+T I L+
  S:     5 LFGLNAVFEALGQGRKVVALYVEAQRNPRLEEIVAQATERHVAVKQCERRQLDKMVGDVRHQGVVAQVKAQ------DFVSLAQLLAQSSQSERFFLILDGITDPHNFGALIRSAAAAGCQGVIFAKDRSCPVTGIVEKTAAGTLGYVQLCQVTNLGRAIEELKKAGVWVYGLAGEEGQ---SLFEAPLSAPIALVAGSEGRGIRPLIRKLCDGLIAIPMPGRVESLNVSVATGIALF 233
>gi|195959193|ref|ZP_03095402.1| rRNA methylase [Borrelia sp. SV1] (246 aa)
Score = 262, Expect = 2.6e-21, Identities = 79/224 (35%), Positives = 132/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W    A D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSPKTKEIEQLAKTQNIKIIRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIY--AGDIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|153952842|ref|YP_001393607.1| methyltransferase [Clostridium kluyveri DSM 555] >gi|146345723|gb|EDK32259.1| Predicted methyltransferase [Clostridium kluyveri DSM 555] (280 aa)
Score = 262, Expect = 2.8e-21, Identities = 72/198 (36%), Positives = 109/198 (55%)
  Q:    35 KSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K K+I + KV+K+  D+     VHQ ++            D   +  +      +   I++LDEIQDP NFGAI RT++   V GII  K   + I  TV K+S G V Y+   KV NL+ ++ KLKKEN W     +  ++     F  D N  + +I+G+E KG+S+L K+  D +VKI M  ++ SLN SV+  +++Y
  S:    75 KEKHIVVKKVDKRKLDRISQTGVHQGVIAKVIPYKYCELEDILDYASE----RGESPFIIILDEIQDPHNFGAIIRTAEVSGVHGIIIPKRRNVGITPTVYKSSAGAVEYMKICKVTNLNTIIEKLKKENIWIYGADMTGENYC---FDVDFNSSIALIIGSEGKGISKLTKQKCDKLVKIPMMGNISSLNASVAAGMLMY 268
>gi|169350897|ref|ZP_02867835.1| hypothetical protein CLOSPI_01671 [Clostridium spiroforme DSM 1552] >gi|169292483|gb|EDS74616.1| hypothetical protein CLOSPI_01671 [Clostridium spiroforme DSM 1552] (244 aa)
Score = 262, Expect = 2.8e-21, Identities = 80/232 (34%), Positives = 126/232 (54%)
  Q:     1 MKKF-FGKKAVIEAFKQNELSEVYYVSYFDELKEFK-------SKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           MK++ +GK  ++EA K  +   +Y V   D +K+ +        K         +F  K   V HQ ++   +E        + S  E + ++ + K  ++L+LD ++DP N GAI RT  +  V G+I  KN  + +N TV K S G ++++   +V NL+  L  LKK ++W V   LD         + D N  LV+++G+E  G+S L+KK  DF V + M   V SLN SV+TA+ILY
  S:     4 MKQYIYGKNTILEALKGEK--SIYTVYIQDSIKDNRIIELCKKKKIRIKIIDKSEFIKKLGNVRHQGVMAEVEEYR------YYSVDEILASIPSGKMPLLLMLDGLEDPHNLGAILRTCDAIGVDGVIIGKNRSVGLNGTVAKVSTGAIDHVKVAQVTNLTRTLEDLKKHSFWVVGCDLDNAQ---DYRQIDYNMPLVIVIGSEGFGISRLVKKTCDFNVVLPMMGHVTSLNASVATAVILY 235
>gi|193216018|ref|YP_001997217.1| RNA methyltransferase, TrmH family, group 3 [Chloroherpeton thalassium ATCC 35110] >gi|193089495|gb|ACF14770.1| RNA methyltransferase, TrmH family, group 3 [Chloroherpeton thalassium ATCC 35110] (243 aa)
Score = 262, Expect = 2.9e-21, Identities = 70/228 (30%), Positives = 129/228 (56%)
  Q:     5 FGKKAVIEAFKQ--NELSEVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+ AV+E  +    E+ ++Y+    ++  LKE     K  NI + K       +      HQ +  +  +     + + D  + +  N    K++I++LD ++DP N GAI RT+++  V  +I   ++   IN TV KTS G ++++   KV NLS+ + +LKK  +W     +D +    + ++ D N    ++VG+E KG+ +L++K+ D ++++ +  +V+SLN SVS AI LY
  S:     6 YGRNAVLELIRTRPEEVEKIYFQFNTEQSKLKEILVTAKRHNISIGKARNNRLVELSGTDKHQGVCALVGKVK---YFELDEILARPRN---SKQLIVILDGLEDPHNVGAIIRTAEAAAVDAVIIPHDSGCPINATVAKTSAGALSHIRLCKVVNLSQTIERLKKHGFWVYGLDMDGEK---NYYEIDFNDHCAIVVGSEGKGIRQLVRKNCDALIRLPIAGNVESLNASVSAAIPLY 235
>gi|23097556|ref|NP_691022.1| tRNA:rRNA methyltransferase [Oceanobacillus iheyensis HTE831] >gi|22775779|dbj|BAC12057.1| tRNA:rRNA methyltransferase [Oceanobacillus iheyensis HTE831] (248 aa)
Score = 262, Expect = 3.0e-21, Identities = 70/227 (30%), Positives = 123/227 (54%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKYEV-VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD--------EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+  V+EA K         ++E    S F ++ +  +     + KV +   D+ E+  HQ +  +A  +S T +   D   ++ N    D   IL LDE++DP N G+I R++ +  V G+I  K   + +  TV KT+ G + ++  ++V N+S  +++LK+ N W V T  +        + S+P+           +++GNE KG+S L++K  D+ V + M   V SLN SV+  ++LY
  S:     8 GRNPVMEALKSGRSVNKVMVTEQIQGSTFQKINQLAREAGTIVQKVPRSKLDQMELGNHQGV--VAYVASYT-YASLDDLFDRANERGEDPFFIL-LDELEDPHNLGSILRSADATGVHGVIIPKRRSVGLTATVAKTAAGAIEHIPVVRVTNMSNTIDELKERNVWIVGTEAEADQDYRQLDGSLPIG----------IVIGNEGKGMSRLVRKKCDWTVGLPMVGQVSSLNASVACGLLLY 236
>gi|163816511|ref|ZP_02207875.1| hypothetical protein COPEUT_02700 [Coprococcus eutactus ATCC 27759] >gi|158448211|gb|EDP25206.1| hypothetical protein COPEUT_02700 [Coprococcus eutactus ATCC 27759] (264 aa)
Score = 261, Expect = 3.4e-21, Identities = 68/227 (29%), Positives = 116/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  YV            ++E K ++  +N ++K   ++      HQ ++  A         D  +  E       +     +LDEI+DP N GAI RT+      G+I  K   + I  TV+K S G +NY    KV N+S+ + +LK+   W  C  +D + +    +K ++   L +++GNE  GVS L+K+  D++V + M   + SLN SV+  ++ Y
  S:    27 GRNAVLEAFRSGKTIDKLYVLDGCRDGVVNSIVREAKKQDTVINYLSKDKLNQMSQAGKHQGVIAHAAAYKYAEIEDMFALAES----RGEDPFFFILDEIEDPHNLGAIIRTANLCGAHGVIIPKRRAVGITATVVKASAGAINYTPVAKVTNISKTIEELKERGMWFACADMDGELM----YKCNLTGSLGLVIGNEGNGVSRLVKEKCDYVVSVPMKGDIDSLNASVAAGVLAY 255
>gi|163764761|ref|ZP_02171815.1| ribosomal protein S11 [Bacillus selenitireducens MLS10] >gi|160354787|gb|EDP81446.1| ribosomal protein S11 [Bacillus selenitireducens MLS10] (255 aa)
Score = 260, Expect = 4.1e-21, Identities = 69/228 (30%), Positives = 122/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKE--------FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK  VIE  +  +     +++  D +K          K  N+++  V +K  D+    + HQ   G+  +++   + + D    +      D    LVLDE++DP N G+I RT+ +    G+I  K   + +  TV KTS G + ++   +V NL+  +++LKK+  W V T  D K  +       D+  L +++G+E KG+S L+K+  DF+V I +   V SLN SV+ ++++Y
  S:    10 YGKNPVIEVLRSGQTVHKVWIAE-DSMKGQMNQVLGLCKKMNVQVQTVPRKRLDQMADGIAHQ---GVIAQAAAYEYAEIDDLFARAKERGEDP-FFLVLDELEDPHNLGSILRTADASGAHGVIIPKRRSVGLTSTVAKTSAGAIAHVPVARVTNLARTMDELKKQGLWFVGT--DAKGDVSYEGMTVDL-PLALVIGSEGKGMSRLVKEKCDFLVSIPLMGKVTSLNASVAASLLMY 240
>gi|90962219|ref|YP_536135.1| tRNA/rRNA methyltransferase [Lactobacillus salivarius UCC118] >gi|90821413|gb|ABE00052.1| TRNA/rRNA methyltransferase [Lactobacillus salivarius UCC118] (248 aa)
Score = 260, Expect = 4.2e-21, Identities = 71/226 (31%), Positives = 116/226 (51%)
  Q:     7 KKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  V E  K + + E+Y ++        K++ + +++V K   D   V  QN  G+    +   +   D   EK  + N D    L+LD I+DP N G+I RT+ +  V GII  K   +Q+   V KTS G + ++  ++V NL + + +LK++  W   T  D K     K+        +++GNE KG+S L+KK  D ++ I M   VQSLN SV+ ++++Y
  S:    28 KVFVQEGLKADAIQEIYTLA--------KARKLVVSRVPKTKLDNL-VNGQNHQGVVIAIASYSYATIDDLFEKARSKNEDP-FFLILDGIEDPHNLGSIMRTADAAGVHGIIIPKRRAVQLTSVVAKTSTGAIEHVPVVRVTNLVQTVKELKEQGVWIFGT--DMKGTDFRKWSAK-GATALVIGNEGKGISPLLKKTCDEMLTIPMVGHVQSLNASVAASLLIY 240
>gi|51894250|ref|YP_076941.1| rRNA methyltransferase [Symbiobacterium thermophilum IAM 14863] >gi|51857939|dbj|BAD42097.1| rRNA methyltransferase [Symbiobacterium thermophilum IAM 14863] (246 aa)
Score = 260, Expect = 4.3e-21, Identities = 59/177 (33%), Positives = 95/177 (53%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++ +A       + D D  +E+      D  ++LVLD I+DP N G++ RT+ +  V G+I  +   + + ETV K S G V Y+   +V N++  L  LK+  YW V T  +   +      T    L V++G+E +G+S L+ +  DF V++ M   V SLN +V+ AI+LY
  S:    66 HQGVIALAAAHR---YYDLDEVLERAAASGEDG-LLLVLDGIEDPQNLGSLLRTADAAGVHGVIIPERRAVGLTETVAKVSAGAVEYVPVARVTNIARTLEMLKERGYWVVGTHQEADELYYEARLT--GPLAVVIGSEGRGMSRLVAETCDFTVRLPMRGHVTSLNAAVAGAILLY 236
>gi|28212189|ref|NP_783133.1| 23S rRNA methyltransferase [Clostridium tetani E88] >gi|28204633|gb|AAO37070.1| 23S rRNA methyltransferase [Clostridium tetani E88] (245 aa)
Score = 260, Expect = 4.4e-21, Identities = 78/230 (33%), Positives = 124/230 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           G+ AV+EA + ++  E   +S  +        +   K   I +  V+KK  D+     +N  G+A   + T    + S  E + +       IL+LDEIQDP NFGAI RT++ F V GII  K   + I   V K+S+G V ++   KVNN++  ++ LK+ N W     +  ++ I     K  I    ++VG+E KG+S+L K+  D +VKI M   + SLN SV+  I++Y ++
  S:     8 GRNAVVEALESHKTLESILISKGNNKGTINKIISLAKENRIPIKNVDKKKLDEISE-GENHQGVA---AYTTPYKYYSVEEILESSKGKAPFILILDEIQDPHNFGAIIRTAEVFGVDGIIIPKRRSVGITPIVYKSSVGAVEHVKIAKVNNINSTIDFLKENNIWIYGADMATDRYIYSENLKGPI---ALVVGSEGKGISKLTKEKCDILVKIPMSGQINSLNASVAGGIVMYEIS 238
>gi|195941652|ref|ZP_03087034.1| rRNA methylase [Borrelia burgdorferi 80a] (246 aa)
Score = 259, Expect = 5.6e-21, Identities = 78/224 (34%), Positives = 131/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEQLAKTQNIKIIRINANELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|159900290|ref|YP_001546537.1| RNA methyltransferase [Herpetosiphon aurantiacus ATCC 23779] >gi|159893329|gb|ABX06409.1| RNA methyltransferase, TrmH family, group 3 [Herpetosiphon aurantiacus ATCC 23779] (246 aa)
Score = 259, Expect = 5.6e-21, Identities = 67/233 (28%), Positives = 120/233 (51%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKS----------KNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYY 233
           M+  +G+ AV+EA + N   ++  +   D +KE +S          + +++ KV +   DK      N  GIA E     + + D  IE +     ++ +IL+ D +QDP N G + RT++     GIIF       I   VI  S G V +L   ++ N+++ +  L++ N W      DE+++   K       L +++G E  G++ L ++  D +V++ M  +V SLN + + +IILY+
  S:     1 MELLYGRNAVLEALRANR-RKLGRLLIADGIKEGESMQAINTIARERRMQVAKVQRSELDK-RTAGANHQGIALECGAYPYVEVDDIIE-LARERGEQPLILIFDHLQDPQNIGTLMRTAEIVGAHGIIFPDRRSASITPAVINASAGAVEHLYVAQITNIAQTIKHLQEYNIWVAGVEDDERAVDFDKANLR-GALALVIGAEGPGLARLTRERCDLLVRLPMRGNVASLNAATAGSIILYH 239
>gi|42518495|ref|NP_964425.1| hypothetical protein LJ0402 [Lactobacillus johnsonii NCC 533] >gi|41582780|gb|AAS08391.1| hypothetical protein LJ_0402 [Lactobacillus johnsonii NCC 533] (251 aa)
Score = 259, Expect = 5.9e-21, Identities = 67/198 (33%), Positives = 102/198 (51%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + KN+ +    K   D+  V H+N  G+    +   + D D  ++K +     +  IL+LD I+DP N G+I RT  +  V  +I  K     +   V KTS G ++Y+   +VNNL +    LKK  YW   TA++ +       K    K V+++GNE KG+S L+ K  D  + I M   VQSLN SV+T ++LY
  S:    49 RKKNLVVQNAPKNKLDQM-VNHENHQGLVLTVAPFEYADLDELLDKFDQ-EGKEPFILMLDSIEDPHNLGSILRTCDATGVDAVIIPKRRASGLTSVVAKTSTGAIDYVPVARVNNLVQTTKMLKKRGYWIFGTAMEGEDYRKWNAK---GKTVLVIGNEGKGISPLLLKQMDQTLTIPMVGHVQSLNASVATGVLLY 241
>gi|167931489|ref|ZP_02518576.1| rRNA methylase [Borrelia burgdorferi 156a] >gi|168692153|ref|ZP_02724945.1| rRNA methylase [Borrelia burgdorferi 94a] >gi|195951127|ref|ZP_03092224.1| rRNA methylase [Borrelia burgdorferi 29805] >gi|195954981|ref|ZP_03093674.1| rRNA methylase [Borrelia burgdorferi CA-11.2a] >gi|195960061|ref|ZP_03096266.1| rRNA methylase [Borrelia burgdorferi 64b] (246 aa)
Score = 259, Expect = 6.2e-21, Identities = 78/224 (34%), Positives = 131/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSPKTKEIEQLAKTQNIKIIRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|153813242|ref|ZP_01965910.1| hypothetical protein RUMOBE_03658 [Ruminococcus obeum ATCC 29174] >gi|149830655|gb|EDM85746.1| hypothetical protein RUMOBE_03658 [Ruminococcus obeum ATCC 29174] (247 aa)
Score = 259, Expect = 6.4e-21, Identities = 61/227 (26%), Positives = 117/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  ++             +E +  +  +N V+K+  D+    H +  G+  + +   ++  D  + +      +   +++LD ++DP N GAI RT+      G+I  K   + +  TV KTS G +NY    KV N+   + +LK++  W VC  +  +++    +  D+   + +++GNE +GVS L+++  DF   I M   + SLN SV+  ++ Y
  S:     7 GRNAVLEAFRSGKCVDKLFILDGCQDGPVRTIAREARKTDTIINYVSKERLDQLSETHAH-QGVIAQVAAYDYSTVDEILARAEE-KGEAPFLIILDNVEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTSTVAKTSAGAINYTPVAKVTNIVRTIEELKEKGIWFVCADMGGETM----YDLDLTGPMGLVIGNEGEGVSRLVREACDFTASIPMKGDIDSLNASVAAGVLAY 235
>gi|167629448|ref|YP_001679947.1| RNA methyltransferase [Heliobacterium modesticaldum Ice1] >gi|167592188|gb|ABZ83936.1| RNA methyltransferase, trmh family [Heliobacterium modesticaldum Ice1] (256 aa)
Score = 259, Expect = 6.9e-21, Identities = 71/227 (31%), Positives = 116/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G++ V+EA K         V       S  + L   + + I + ++ +   D+ EV H    GI    +   + + +  +EK      +   +L+LD ++DP N GA+ RT++     G+I  K     I  TV K S G V Y+   +V NL + + +LKK   W + +A+D    P   F+ D    V +IVG+E KG+S L+++  D +V I M   V SLN SV+ A+++Y
  S:    15 GRQPVMEALKSGRAINKLVVAKGAREGSIREILGMARDRGIPITELERTVLDR-EVRHHQ--GIIAHVAPVAYVEVEEILEKAK-AKGEPPFVLLLDGLEDPHNIGALLRTAEGAGAHGVIIPKRRGGAITSTVAKASAGAVEYVPIARVTNLVQTVGQLKKAGLWIIGSAMDA---PRPYFRQDFRGPVGLIVGSEGKGISPLLREHCDHLVSIPMGGKVDSLNASVAGALLMY 242
>gi|114770938|ref|ZP_01448406.1| hypothetical protein OM2255_16034 [alpha proteobacterium HTCC2255] (247 aa)
Score = 258, Expect = 7.2e-21, Identities = 62/198 (31%), Positives = 107/198 (54%)
  Q:    35 KSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + I +   NKK  D       HQ ++  A  + +   TD D+ I +     + K  +LVLD + DP N GA+ R++ +  V  +I  K+    +N TV K + G  + +  ++V NL+  L++L+++  W V TA + +    S F  D+   + +++G E KG+  L ++  D ++K+ M  +V SLNVSV+T I LY
  S:    47 RKEGISIQFCNKKVLDDKSKGESHQGVVARAYPAKVLTETDLDTIISQ-----SAKPFLLVLDGVTDPHNLGAVLRSADAAGVDAVIVPKDKSASLNATVRKVACGAADVIPLIQVTNLARTLSELQEQQIWVVGTAGEARQ---SVFDCDMAGPVALVMGAEGKGMRRLTRERCDELIKLPMLGTVSSLNVSVATGICLY 239
>gi|167933822|ref|ZP_02520897.1| rRNA methylase [Borrelia burgdorferi ZS7] >gi|167943954|ref|ZP_02531028.1| rRNA methylase [Borrelia burgdorferi Bol26] (246 aa)
Score = 258, Expect = 8.4e-21, Identities = 78/224 (34%), Positives = 131/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSPKTKEIEQLAKTQNIKIIRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQNINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|118443866|ref|YP_877180.1| RNA methyltransferase [Clostridium novyi NT] >gi|118134322|gb|ABK61366.1| RNA methyltransferase, TrmH family, group 3 [Clostridium novyi NT] (265 aa)
Score = 258, Expect = 9.1e-21, Identities = 79/227 (34%), Positives = 123/227 (54%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFD-SFIEKINNLNTDK---KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA + +   E   V       S    L   K K I + +V++K  D   +   HQ ++ I         T F  S IE I N   +K     ILVLDEI+DP N G+I RT++   V GI+  K   + +  TV KTS G   Y+   KV N++  ++++K+   W     +D ++     F+T+    V +++G+E KG+S+L K+  D ++KI M   + SLN SV+  I++Y
  S:    28 GRNAVIEALRSDRTIEYVMVAKGNVSGSINKVLGIAKDKGIIIKEVDRKKLDSMSITGAHQGVMAIV--------TPFKYSQIEDIFNYAKEKGEEPFILVLDEIEDPHNLGSIMRTAEICGVHGIVIPKRRNVGVTPTVYKTSAGAAEYVKVAKVANINRAIDEIKERGIWVYGADMDGENYC---FQTNFKGAVALVIGSEGKGISKLTKQKCDVLIKIPMVGKITSLNASVAAGIMMY 257
>gi|187776558|ref|ZP_02993031.1| hypothetical protein CLOSPO_00070 [Clostridium sporogenes ATCC 15579] >gi|187775217|gb|EDU39019.1| hypothetical protein CLOSPO_00070 [Clostridium sporogenes ATCC 15579] (257 aa)
Score = 257, Expect = 9.3e-21, Identities = 74/227 (32%), Positives = 122/227 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWT----VCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA K N+  E   V+  D        +   K K I +N+V++K  D       HQ ++            D   + ++      ++  I++LDEI+DP NFG+I RT++   V G+I  K   + +  TV KTS G V Y+   KV N++ V++KLK++  W     +C       + LS        + +++G+E +G+S+L K   D +VKI M  ++ SLN SV+  +++Y
  S:    18 GRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVINEVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQ----KEEEPFIVILDEIEDPHNFGSILRTAEVCGVHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIWIYGADMCGNDYCFDVSLS------GPIALVIGSEGRGISKLTKSKCDVLVKIPMLGNITSLNASVAGGMLMY 247
>gi|70727476|ref|YP_254392.1| hypothetical protein SH2477 [Staphylococcus haemolyticus JCSC1435] >gi|90110723|sp|Q4L3J1|TRMHL_STAHJ Putative trmH family tRNA/rRNA methyltransferase >gi|68448202|dbj|BAE05786.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (249 aa)
Score = 257, Expect = 9.3e-21, Identities = 64/204 (31%), Positives = 112/204 (54%)
  Q:    29 DELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK---IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           D L+  K + + +  V K   D      HQ   G+A   +   + DFD FI+       DK+    +++LD ++DP N G+I RT+ +  V G+I  K   + + +TV K S G + ++  ++V NL++ +++LK+  YW V  A  + +        D+  L +++G+E +G+S L+K   DF +KI M   V SLN SV+ ++++Y
  S:    38 DILQNAKEQKLIVQTVPKSKLDNLANAPHQ---GVAALIAPYEYADFDQFIQS----QKDKEGLSTVVILDGLEDPHNLGSILRTADASGVDGVIIPKRRSVALTQTVAKASTGAIQHVPVMRVTNLAKTIDELKEHGYW-VAGAEADNATDYRDMAADM-PLAIVIGSEGQGMSRLVKDKCDFYIKIPMVGHVNSLNASVAASLMMY 236
>gi|78485830|ref|YP_391755.1| RNA methyltransferase TrmH, group 3 [Thiomicrospira crunogena XCL-2] >gi|78364116|gb|ABB42081.1| RNA methyltransferase TrmH, group 3 [Thiomicrospira crunogena XCL-2] (244 aa)
Score = 257, Expect = 9.9e-21, Identities = 62/187 (33%), Positives = 105/187 (56%)
  Q:    46 KKFFDKYEVVHQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K FF+K E VHQ ++  +AKE+ L   TD  + +E  +N      + L LDE+QDP N GAI RT+ +  V  ++  K+N + +N TV K + G    +  + V+NL   + +L++   W    A +  +   + ++ D    V +++G E  G+ +L ++  D +  I M  S++SLNVSV+T ++LY
  S:    56 KSFFNKLEGVHQGVVATVAKEADLN-ETDLKALLEAESN-----PLFLFLDEVQDPHNLGAILRTADATGVTAVVIPKHNSVGVNATVRKVACGAAETVKVVVVSNLVRTIKELQQAGLWVTGLAGETNT---TLYQLDFKGAVGLVMGAEGSGLRKLTRETCDHLAAIPMAGSIESLNVSVATGVVLY 235
>gi|195948996|ref|ZP_03090096.1| rRNA methylase [Borrelia burgdorferi WI91-23] (246 aa)
Score = 257, Expect = 1.0e-20, Identities = 78/224 (34%), Positives = 130/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K +NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEKLAKIQNIKITRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|195947531|ref|ZP_03088717.1| rRNA methylase [Borrelia garinii PBr] (246 aa)
Score = 256, Expect = 1.2e-20, Identities = 79/224 (35%), Positives = 132/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSL-------TIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ +++    DK  +  ++  G A +  L       T   DF++ +E       +   IL+LDEI+DP NFGAI RT++ F +  ++  +    + N TV++TS G   Y+  + V N++  +  LKK  +W    A D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIERLAKTQNIKIIRISTNELDKI-LKSKDHRGFALKLKLEKNKNEKTQTKDFENLLETFKK--KEHAFILLLDEIEDPQNFGAILRTAEQFSIDLVVTTQKRSAKDNLTVLRTSSGASQYVKKITVTNINNTIYSLKKHGFWIY--AGDIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|158319524|ref|YP_001512031.1| RNA methyltransferase [Alkaliphilus oremlandii OhILAs] >gi|158139723|gb|ABW18035.1| RNA methyltransferase, TrmH family, group 3 [Alkaliphilus oremlandii OhILAs] (250 aa)
Score = 256, Expect = 1.3e-20, Identities = 69/232 (29%), Positives = 122/232 (52%)
  Q:     1 MKKFFGKKAVIEAFKQN-ELSEVYYV------SYFDELKEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M    G+  V+EA K   E+ ++         S    + + K + I +  V ++  ++     VHQ I+          + + +  +E   +   D   +L+LDEI DP N G++ RT+ +  V GII  K   + +  TV K+S G + Y+   KV+N+++ ++K+K    W    A  + S     +  D+   L +++GNE +G+S LIK+  DF++K+ M   V SLN SV+ A+++Y
  S:     3 MDNIAGRNPVMEALKSGREIDKILIAKGTEGGSLIKIIGKAKDRGIPIQYVERQKLNEMSSSDVHQGIIATVAAYE---YCEVEDILENAKSKGRDP-FLLILDEIMDPHNLGSMMRTADAVGVDGIIIPKRRSVGLTSTVAKSSAGAIEYVPVAKVSNIAQTIDKIKDMGIW---VAGADMSGSKEHYNMDLKGPLALVIGNEGEGISRLIKEKCDFLIKLPMVGQVSSLNASVAAAVLMY 237
>gi|24214562|ref|NP_712043.1| tRNA/rRNA methyltransferase [Leptospira interrogans serovar Lai str. 56601] >gi|24195527|gb|AAN49061.1|AE011360_7 tRNA/rRNA methyltransferase [Leptospira interrogans serovar Lai str. 56601] (220 aa)
Score = 256, Expect = 1.4e-20, Identities = 64/176 (36%), Positives = 100/176 (56%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK-IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           HQ I+ +   S     T FD   + +    ++K    L+LD IQDPGN G I RT++ F V  II  +     I   V K + G +++L    V NL+  L  LK+  YW V T+ D  +   SK   D+N+LV+++GNE +G+  ++ + SDF+++I M  ++ SLNV+V+T I+L
  S:    42 HQGIVALKAPSK---QTTFDK--KNLEEFLSEKPGAFLILDRIQDPGNLGNILRTAECFGVTNIILPERESAGITPVVEKVASGALSFLKIFTVKNLANTLELLKENGYWIVSTS-DRGTEDWSKLP-DLNELVILMGNEGEGIKRILMEKSDFVLRIPMHGNLSSLNVTVATGIVL 211
>gi|154684614|ref|YP_001419775.1| YacO [Bacillus amyloliquefaciens FZB42] >gi|154350465|gb|ABS72544.1| YacO [Bacillus amyloliquefaciens FZB42] (249 aa)
Score = 256, Expect = 1.4e-20, Identities = 65/227 (28%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK--LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK AVIE  K +       ++E        ++ E  K + + +  V +K  D+  E  HQ   G+  + +   +   D   ++    N ++   L+LDE++DP N G+I RT+ +    GI+  K   + +  TV K S G + ++  +KV NL+  L+++K+   W V T    +      +++   K  L +++G+E +G+  L+K+  DF++K+ M   V SLN SV+  +++Y
  S:    10 GKNAVIETLKSDRKLYKLWMAENTVKGQAQQVMELAKKRGVTIQFVPRKKLDQMVEGQHQ---GVVAQVAAYEYAQLDELYKRAEERN-EQPFFLILDELEDPHNLGSIMRTADAVGAHGIMIPKRRAVGLTSTVAKASTGAIEHIPVVKVTNLARTLDEMKERGIWVVGTDASAR----EDYRSMDGKMPLALVIGSEGRGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238
>gi|153938342|ref|YP_001392853.1| RNA methyltransferase [Clostridium botulinum F str. Langeland] >gi|152934238|gb|ABS39736.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum F str. Langeland] (257 aa)
Score = 256, Expect = 1.5e-20, Identities = 72/227 (31%), Positives = 121/227 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA K N+  E   V+  D        +   K K I +N+V++K  D       HQ ++            D   + ++      +   I++LDEI+DP NFG+I RT++     G+I  K   + +  TV KTS G V Y+   KV N++ V++KLK++  W     +       + +  D+N    + +++G+E +G+S+L K   D +VKI M  ++ SLN SV+  +++Y
  S:    18 GRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVINEVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQ----KEEDPFIIILDEIEDPHNFGSILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIWIYGADMCG-----NDYCFDVNLSGPIALVIGSEGRGISKLTKSKCDVLVKIPMLGNITSLNASVAGGMLMY 247
>gi|125624835|ref|YP_001033318.1| tRNA/rRNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363] >gi|124493643|emb|CAL98630.1| tRNA/rRNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363] (242 aa)
Score = 255, Expect = 1.6e-20, Identities = 72/228 (31%), Positives = 125/228 (54%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNI-------KLNKVNKKFFDKYEV-------VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   + ++++Y        ++ + KN+       ++ KVN  +  K E+       VHQ  +    E +   + D  + + ++      +  IL+LDE+ DP N G+I RT+ +  V  II  K+  + I  T +K S G + ++  ++V NLS+ L+KLK   +W   T +D      +K+ T   K+ +I+GNE  G+ + +KK  D ++ I M   VQSLN SV+ +I++Y
  S:     8 YGLHAVTEALNGDLVNKLYV------QEDLRGKNVEKIKELARIKKVNISWTPKTELNKLTENGVHQGFMARVSEFA---YADLATLLPEL--AEKAEATILILDELTDPHNLGSIARTADATGVDAIIIPKHRAVGITPTAVKASTGALQHVPVVRVTNLSQTLDKLKSAGFWIFGTDMD--GTVYNKWNTK-GKIALIIGNEGHGIGQNLKKQVDEMITIPMVGHVQSLNASVAASILMY 235
>gi|118586220|ref|ZP_01543685.1| tRNA/rRNA methyltransferase [Oenococcus oeni ATCC BAA-1163] >gi|118433349|gb|EAV40050.1| tRNA/rRNA methyltransferase [Oenococcus oeni ATCC BAA-1163] (254 aa)
Score = 255, Expect = 1.7e-20, Identities = 71/228 (31%), Positives = 121/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYF---DELKEFKS----KNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  A +E  + N+     Y+S     +  ++F+       I + +V+ +  D+    H N  GIA   +   +   D  +   N +      +++LDEI+DP N G+I RT+ +  V GII  K   +Q+ + V KTS G + ++   +V N++  ++KLKK N+W   T  D K    + +  D   + +++GNE KG+S   KK  D ++ I M   VQSLN SV+ A+++Y
  S:    16 YGVHASMETLENNQTINKLYLSKSLAKNRAQQFRQTAEQNKIVVQEVDNQRLDEL-TNHGNHQGIALSIAAYEYVPLDDIL---NGIKGHDPFLVILDEIEDPHNLGSILRTADATGVDGIIIPKRRAVQLTQVVAKTSTGAIEHVPVARVVNINNTIDKLKKANFWIFGT--DMKGADYTDWNAD-GPVAIVIGNEGKGISAQTKKKVDQMLTIPMIGHVQSLNASVAAALLIY 243
>gi|193216530|ref|YP_001999772.1| SpoU class tRNA/rRNA methyltransferase [Mycoplasma arthritidis 158L3-1] >gi|193001853|gb|ACF07068.1| SpoU class tRNA/rRNA methyltransferase [Mycoplasma arthritidis 158L3-1] (229 aa)
Score = 255, Expect = 1.8e-20, Identities = 60/146 (41%), Positives = 87/146 (59%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           ++L+LD IQDP NFGAI R +  F +  II  KN   ++  TV+K S G    +  ++V +L + L +L+K  +W   + LD+K+  L K K       +IVGNE  GVS  + K SD +V IE   +VQSLNV+ +TA++LY  T
  S:    82 LVLMLDHIQDPHNFGAIIRNANGFGIKHIIIPKNRACEVTPTVLKISSGAFTEIKIIRVGSLFDTLKELQKNGFWIYSSTLDDKATKLHKTKF-ATPTCLIVGNEESGVSHTLIKHSDALVYIEQKGTVQSLNVASATAVLLYEAT 226
>gi|148381440|ref|YP_001255981.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum A str. ATCC 3502] >gi|153932755|ref|YP_001385815.1| RNA methyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153937009|ref|YP_001389222.1| RNA methyltransferase [Clostridium botulinum A str. Hall] >gi|168178813|ref|ZP_02613477.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum NCTC 2916] >gi|170759212|ref|YP_001788840.1| RNA methyltransferase [Clostridium botulinum A3 str. Loch Maree] >gi|148290924|emb|CAL85060.1| putative tRNA/rRNA methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152928799|gb|ABS34299.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum A str. ATCC 19397] >gi|152932923|gb|ABS38422.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum A str. Hall] >gi|169406201|gb|ACA54612.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum A3 str. Loch Maree] >gi|182670049|gb|EDT82025.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum NCTC 2916] (257 aa)
Score = 255, Expect = 1.9e-20, Identities = 72/227 (31%), Positives = 121/227 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA K N+  E   V+  D        +   K K I +N+V++K  D       HQ ++            D   + ++      +   I++LDEI+DP NFG+I RT++     G+I  K   + +  TV KTS G V Y+   KV N++ V++KLK++  W     +       + +  D+N    + +++G+E +G+S+L K   D +VKI M  ++ SLN SV+  +++Y
  S:    18 GRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVINEVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQ----KEEDPFIIILDEIEDPHNFGSILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIWIYGADMCG-----NDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDVLVKIPMLGNITSLNASVAGGMLMY 247
>gi|168525701|ref|ZP_02719340.1| rRNA methylase [Borrelia burgdorferi 118a] (246 aa)
Score = 255, Expect = 2.0e-20, Identities = 78/224 (34%), Positives = 130/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K +NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEKLAKIQNIKIIRINANELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|168579537|ref|ZP_02723555.1| rRNA methylase [Borrelia burgdorferi 72a] (246 aa)
Score = 254, Expect = 2.2e-20, Identities = 78/224 (34%), Positives = 130/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K +NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEKLAKIQNIKIIRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|170757788|ref|YP_001783140.1| RNA methyltransferase [Clostridium botulinum B1 str. Okra] >gi|169123000|gb|ACA46836.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum B1 str. Okra] (257 aa)
Score = 254, Expect = 2.3e-20, Identities = 72/227 (31%), Positives = 121/227 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA K N+  E   V+  D        +   K K I +N+V++K  D       HQ ++            D   + ++      +   I++LDEI+DP NFG+I RT++     G+I  K   + +  TV KTS G V Y+   KV N++ V++KLK++  W     +       + +  D+N    + +++G+E +G+S+L K   D +VKI M  ++ SLN SV+  +++Y
  S:    18 GRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVINEVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQ----KEEDPFIIILDEIEDPHNFGSILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIWIYGADMCG-----NDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDALVKIPMFGNITSLNASVAGGMLMY 247
>gi|160916266|ref|ZP_02078473.1| hypothetical protein EUBDOL_02293 [Eubacterium dolichum DSM 3991] >gi|158431990|gb|EDP10279.1| hypothetical protein EUBDOL_02293 [Eubacterium dolichum DSM 3991] (241 aa)
Score = 254, Expect = 2.4e-20, Identities = 56/145 (38%), Positives = 87/145 (60%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           + ++LDE++DP N GAI RT     V G+I  K+  +++  TV K S G ++ +    V NL++ L  LKKE +W      D  S    +   D+  LV++VG+E  G+S L+KK+ DF V++ M+ SV SLN SV+ A++LY +
  S:    92 LFVMLDELEDPHNLGAILRTCDCVGVDGVIIGKHRGVKLTPTVAKVSTGAIDTVKVAVVTNLAQTLKGLKKEGFWVAGADFD-NSQDYRQASYDM-PLVLVVGSEGFGISPLVKKNCDFFVRLPMEGSVSSLNASVACAVLLYQI 234
>gi|167765723|ref|ZP_02437776.1| hypothetical protein CLOSS21_00211 [Clostridium sp. SS2/1] >gi|167712596|gb|EDS23175.1| hypothetical protein CLOSS21_00211 [Clostridium sp. SS2/1] (246 aa)
Score = 254, Expect = 2.6e-20, Identities = 71/227 (31%), Positives = 117/227 (51%)
  Q:     6 GKKAVIEAFK-QNELSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGI-AKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA + +  + +++ +    +      ++E K  +  L  V+K+  ++     HQ ++ I A     TI   F    EK      +    ++LD I+DP N GAI RT+      G+I  K+  + I  TV KTS G +NY   +KV N+ + +++LK+   W  C  +D + I        I    +++GNE  GVS L+K+  DFI  I M   + SLN SV+  ++ +
  S:    10 GRNAVIEALRAKKPIDKIFVLDGCQDGPIRTIVREAKKTDAILKFVDKERLNQLTNEHHQGVVAIVAAYEYGTIEDLFKRAEEK-----GEDPFFILLDGIEDPHNLGAIIRTANLAGAHGVIIPKHRAVGITPTVAKTSAGAINYTPVVKVTNIGKTMDELKERGMWFACADMDGEVIYRQNLTGSIG---LVIGNEGSGVSRLVKEKCDFISSIPMKGDIDSLNASVAAGVLAF 237
>gi|45657881|ref|YP_001967.1| tRNA/rRNA methyltransferase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|45601122|gb|AAS70604.1| tRNA/rRNA methyltransferase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (220 aa)
Score = 254, Expect = 2.6e-20, Identities = 64/176 (36%), Positives = 100/176 (56%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK-IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           HQ I+ +   S     T FD   + +    ++K    L+LD IQDPGN G I RT++ F V  II  +     I   V K + G +++L    V NL+  L  LK+  YW V T+ D  +   SK   D+N+LV+++GNE +G+  ++ + SDF+++I M  ++ SLNV+V+T I+L
  S:    42 HQGIVALKAPSK---QTTFDK--KNLEEFLSEKPGAFLILDRIQDPGNLGNILRTAECFGVTNIILPERESAGITPVVEKVASGALSFLKIFTVKNLANTLELLKENGYWIVSTS-DRGTEDWSKLP-DLNELVILMGNEGEGIKRILMEKSDFVLRIPMYGNLSSLNVTVATGIVL 211
>gi|160937869|ref|ZP_02085227.1| hypothetical protein CLOBOL_02761 [Clostridium bolteae ATCC BAA-613] >gi|158439095|gb|EDP16849.1| hypothetical protein CLOBOL_02761 [Clostridium bolteae ATCC BAA-613] (247 aa)
Score = 254, Expect = 2.6e-20, Identities = 68/227 (29%), Positives = 111/227 (48%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  +V            L+E +  +  +N V K+  D+      HQ ++  A         D     E+      +   +++LD I+DP N GAI RT+      G+I  K   + +  TV KTS G +NY    KV NL+  +  LKK+  W VC  +  + +     K  I    ++VGNE +GV +L+++  D +  I M   + SLN SV+  ++ Y
  S:    10 GRNAVLEAFRSGKTIDKLFVLDGCQDGPVRTILREARKYDTIINYVPKERLDQISETGKHQGVIAYAAAYEYAEVEDMLKAAEE----KGEPPFLILLDGIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLTATMEDLKKKGMWFVCADMGGELMYKMNLKGSIG---LVVGNEGEGVGKLVREHCDMVASIPMKGDIDSLNASVAAGVLAY 238
>gi|164686508|ref|ZP_02210536.1| hypothetical protein CLOBAR_00073 [Clostridium bartlettii DSM 16795] >gi|164604519|gb|EDQ97984.1| hypothetical protein CLOBAR_00073 [Clostridium bartlettii DSM 16795] (248 aa)
Score = 253, Expect = 2.9e-20, Identities = 65/198 (32%), Positives = 100/198 (50%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K KN+ +  V+K   D+    H +   IA  S    +   D  +  I     +    ++LDEI DP N G I RT+ +    G+I  K   + I   V K S G V Y+   KV N++  + +LKKE  W     +D        ++ D+   L +++G+E  GVS L+K++ DF+VK+ M  +V SLN SV+  I+LY
  S:    46 KEKNVVIQYVDKHKLDEISTSHSHQGVIAVVSDYKYYELED--LLAIARERGEDPFFIILDEITDPHNLGTIIRTADAVGAHGVIIPKRRSVHITSVVAKASAGAVEYVPVCKVTNIANTIKQLKKEGLWIAAADMDGGVF----YEQDLTGPLALVIGSEGFGVSRLVKQNCDFVVKMPMIGNVSSLNASVAGGILLY 238
>gi|150010995|gb|ABR57153.1| SpoU rRNA methylase family protein [Staphylococcus xylosus] (249 aa)
Score = 253, Expect = 3.0e-20, Identities = 65/202 (32%), Positives = 108/202 (53%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           LK+  S+ I +  V K   D   +  HQ   GIA   +   + DFD+F+EK          +L+LD ++DP N G+I RT+ +  V G+I  K   + + +TV K S G + ++  ++V NL+  +  LK   YW V T  +  +      + D+   L +++G+E +G+S L+K   DF + I M   V SLN SV+ ++++Y
  S:    40 LKKANSRKIIVQSVPKSKIDGLSDSPHQ---GIAAYIAPYEYADFDAFLEK-QKAQDKLSTVLILDGLEDPHNLGSILRTADASGVDGVIIPKRRSVALTQTVAKASTGAIEHIPVMRVTNLANTIETLKDNGYWVVGTEANNST---DYREMDVAMPLAIVIGSEGQGMSRLVKDKCDFYINIPMVGHVNSLNASVAASLMMY 236
>gi|187935194|ref|YP_001884456.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum B str. Eklund 17B] >gi|187723347|gb|ACD24568.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum B str. Eklund 17B] (286 aa)
Score = 253, Expect = 3.1e-20, Identities = 73/227 (32%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EA K     E  Y+S           + + K K I + +V+K+  D      VHQ ++        +  +D     EK      +   I++LDE++DP N G+I RT++ F V GII  K     +   V K+S+G + ++   +V NL+ V+++LK++  W   T +  +      ++TD      +I+GNE KG+S+L  K  D ++KI M   + SLN SV+  II+Y
  S:    49 GRNAVLEALKAERTIETLYISNSKLEGSINAIISKAKDKKILIKEVDKRKLDSMCNNAVHQGVIARVTPYEYSEVSDILELAEK----KGENPFIVILDEVEDPHNLGSIIRTAELFGVHGIIIPKRRSASVTTMVYKSSVGAIEHVKVARVTNLNSVIDELKEKGIWVYGTDIRAEEY---SYQTDFGGACAIIIGNEGKGISKLTLKKCDKLIKIPMVGKINSLNASVAGGIIMY 278
>gi|153855859|ref|ZP_01996834.1| hypothetical protein DORLON_02856 [Dorea longicatena DSM 13814] >gi|149751827|gb|EDM61758.1| hypothetical protein DORLON_02856 [Dorea longicatena DSM 13814] (265 aa)
Score = 253, Expect = 3.2e-20, Identities = 68/227 (29%), Positives = 109/227 (48%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  YV       +    ++E +  +  LN V K   ++      HQ ++            D     E+      +   +++LD I+DP N GAI RT+      G+I  K   + +  TV +TS G +NY    KV NL + +  LKK+  W VC  +D   +     K  I    +++GNE +GV  L+K   DF  +I M   + SLN SV+  ++ Y
  S:    29 GRNAVMEAFRSGKPVDKLYVLDGCQDGAVRSIIREARKHDTILNFVEKDRLNQLSETGKHQGVIASVAAYEYAEVEDMLKLAEE----KGEDPFLIILDNIEDPHNLGAIIRTANQAGAHGVIIPKRRAVGLTATVARTSAGALNYTPVAKVTNLVKTMEDLKKKGLWFVCADMDGDVMYDVNMKGPIG---LVIGNEGEGVGRLVKDTCDFTARIPMKGDIDSLNASVAAGVLAY 257
>gi|111115344|ref|YP_709962.1| rRNA methylase [Borrelia afzelii PKo] >gi|167942232|ref|ZP_02529306.1| rRNA methylase [Borrelia afzelii ACA-1] >gi|110890618|gb|ABH01786.1| rRNA methylase [Borrelia afzelii PKo] (246 aa)
Score = 252, Expect = 3.6e-20, Identities = 79/224 (35%), Positives = 131/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKY--EVVHQNI---LGIAKESSLTIHT-DFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ K++    DK      H+     L + K  ++   T DF++ +E       +   IL+LDEI+DP NFGAI RT++ F +  +I  + +  + N TV++TS G   Y+  + V N++  +N LKK  +W      D K   ++K K +  K+ +I+GNE KGV +L K++SDF+++I     + SLNVSVS  I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEKLAKTQNIKITKISINELDKILKNKDHRGFALKLKVEKNKNVKTQTKDFENLLETFKK--KENVFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKHSAKDNSTVLRTSSGASQYVKKITVTNINNTINFLKKHGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLTKQNSDFLIRIPTSGKIDSLNVSVSAGILIF 237
>gi|187605167|ref|ZP_02991368.1| RNA methyltransferase, TrmH family, group 3 [Exiguobacterium sp. AT1b] >gi|187482736|gb|EDU20739.1| RNA methyltransferase, TrmH family, group 3 [Exiguobacterium sp. AT1b] (306 aa)
Score = 252, Expect = 3.7e-20, Identities = 53/143 (37%), Positives = 85/143 (59%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + ++LDE++DP N G+I RT+ +    GII  K   + + +TV K S G + ++   +V NL+  L +LK++  W V T   E        + D N  LVV++G+E KG+S L+++  DF+V + M   V SLN SV+ A++LY
  S:   156 LFILLDELEDPHNLGSILRTADAVGAHGIIIPKRRSVGLTQTVAKASTGAIEHIPVARVTNLTRTLEELKEKGLWVVGTDAKESQ---DYRRLDGNMPLVVVIGSEGKGMSRLVRESCDFLVHLPMVGHVTSLNASVAAALLLY 296
>gi|69245491|ref|ZP_00603455.1| RNA methyltransferase TrmH, group 3 [Enterococcus faecium DO] >gi|68195742|gb|EAN10179.1| RNA methyltransferase TrmH, group 3 [Enterococcus faecium DO] (286 aa)
Score = 252, Expect = 3.8e-20, Identities = 75/228 (32%), Positives = 118/228 (51%)
  Q:     5 FGKKAVIEAFKQNE-----LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKY--EVVHQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG  A +EA +Q       L E       +ELKE  + + + +  V K+  +      VHQ + L I     L++    D  IE+      D    L+LD I+DP NFG+I RT+ +  V G+I  K+  + I   V KTS G V ++   +V NL + + +LK+  +W   T  D       K+      + +++GNE KG+S  +KK+ D ++ I M   VQSLN SV+  +++Y
  S:    49 FGHHAAVEALQQGRGNKLFLQEDSRGEKVEELKEIAREQAVPVKWVPKQKLETLSDHGVHQGVVLAITPYEYLSL----DQLIERTKEKKEDP-FFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEHVPVARVTNLVQAVQQLKETGFWVFGT--DMTGTNFQKWNAK-GSIALVIGNEGKGMSPGLKKEMDELLTIPMTGHVQSLNASVAAGLLMY 277
>gi|116512750|ref|YP_811657.1| rRNA methylase [Lactococcus lactis subsp. cremoris SK11] >gi|116108404|gb|ABJ73544.1| rRNA methylase [Lactococcus lactis subsp. cremoris SK11] (242 aa)
Score = 252, Expect = 3.9e-20, Identities = 72/228 (31%), Positives = 123/228 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNI-------KLNKVNKKFFDKYEV-------VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G  AV EA   + ++++Y        ++ + KN+       ++ KVN  +  K E+       VHQ  +    E +   + D  + + ++      +  IL+LDE+ DP N G+I RT+ +  V  II  K+  + I    +K S G + ++  ++V NLS+ L+KLK   +W   T +D      SK+ T   K+ +I+GNE  G+   +KK  D ++ I M   VQSLN SV+ +I++Y
  S:     8 YGLHAVTEALNGDLVNKLYV------QEDLRGKNVEKIKELARIKKVNISWTPKTELNKLTENGVHQGFMARVSEFA---YADLATLLPEL--AEKAEATILILDELTDPHNLGSIARTADATGVDAIIIPKHRAVGITPIAVKASTGALQHVPVVRVTNLSQTLDKLKSAGFWIFGTDMD--GTVYSKWNTK-GKIALIIGNEGHGIGHNLKKQVDEMITIPMVGHVQSLNASVAASILMY 235
>gi|121535684|ref|ZP_01667488.1| RNA methyltransferase, TrmH family, group 3 [Thermosinus carboxydivorans Nor1] >gi|121305715|gb|EAX46653.1| RNA methyltransferase, TrmH family, group 3 [Thermosinus carboxydivorans Nor1] (248 aa)
Score = 252, Expect = 3.9e-20, Identities = 57/179 (31%), Positives = 99/179 (55%)
  Q:    54 VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           V HQ ++ +    +   + D D  + +      +   +++LDE++DP N GAI RT+ +  V G++  K     ++ TV KTS G + Y+   ++ N+ + L KLKK   W V   +       + ++TD+   LVV+VG+E +G+  L ++  DF+V+I M   + SLN SV+ ++ILY
  S:    65 VRHQGVVAMVAPVA---YVDVDEILVQAQT-KGEAPFLVLLDELEDPHNVGAILRTADATGVHGVLLPKRRSCPLSATVAKTSAGAIEYVPVARIGNIVQTLEKLKKAGLWVVGADMAGDK---AYYETDLTGPLVVVVGSEGRGMGRLTREACDFLVRIPMRGRLSSLNASVACSLILY 237
>gi|119953304|ref|YP_945513.1| 23S rRNA methyltransferase [Borrelia turicatae 91E135] >gi|119862075|gb|AAX17843.1| 23S rRNA methyltransferase [Borrelia turicatae 91E135] (244 aa)
Score = 252, Expect = 4.1e-20, Identities = 78/224 (34%), Positives = 129/224 (57%)
  Q:     9 AVIEAFKQNELSEVYY-------VSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIH-TDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y        ++     +E+ ++ IK+N + K   +         L I+K ++      + + F+EK    N     IL+LD I+DP NFGAI RTS+ F +  +I  +    + N T ++TS G   Y+N L V N++ V+  LKK  +W   + +  K+I  +  K +  K+ +I+GNE KG+ +LIK++SDF+VKI     + SLNVSVST I+++
  S:     8 SIIESIKNNKGLELYISKISPKSINIEKIAREYNTQIIKVNDLAKIIGNNNHRGFALKLKISKSNNTNKQDKNLEEFLEKFQYKNN--VFILILDGIEDPQNFGAILRTSEQFNIDLVITSQRRSAKDNATTLRTSSGASQYVNKLIVPNINNVIKDLKKNGFWIYASDIKGKAI--NTIKINDTKIALIMGNEGKGIHKLIKENSDFLVKIPTTGKIDSLNVSVSTGILIF 235
>gi|94265268|ref|ZP_01289027.1| RNA methyltransferase TrmH, group 3 [delta proteobacterium MLMS-1] >gi|93454249|gb|EAT04565.1| RNA methyltransferase TrmH, group 3 [delta proteobacterium MLMS-1] (302 aa)
Score = 251, Expect = 4.6e-20, Identities = 55/142 (38%), Positives = 87/142 (61%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           ++LVLD +QDP N GA+ R++ +F V G+I  K+    ++ TV+K + GT   L+  +  NL+  L  LKK  +W +  A  E S  L  ++TD      +++GNE KG+  L+KK  DF++ I + + V+SLNVSV+  I+L
  S:   147 LLLVLDSLQDPHNLGAVLRSAAAFGVDGVILPKDRSAPLSGTVLKAAAGTAALLDICRTTNLAGALGTLKKHGFW-IYGASGEASGNL--YETDFTGPTCLVLGNEQKGIRPLLKKHCDFLLAIPLAAGVESLNVSVAAGIML 286
>gi|168187716|ref|ZP_02622351.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum C str. Eklund] >gi|169294429|gb|EDS76562.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum C str. Eklund] (263 aa)
Score = 251, Expect = 4.7e-20, Identities = 71/227 (31%), Positives = 122/227 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA + +   E   V       S    L   K K I + +V++K  D   +   HQ ++ I      +   D  ++ ++      ++  IL+LDEI+DP N G+I RT++   V GI+  K   + +  TV KTS G   Y+   KV N++  ++++K+   W     +D ++     F+T+    V +++G+E +G+S+L K+  D +VKI M   + SLN SV+  I++Y
  S:    26 GRNAVIEALRSDRTIEYVMVAKGNMTGSINKVLGIAKDKGIIIKEVDRKKLDSMSITGSHQGVMAIVTPYKYSEVEDIFNYAKE----KGEEPFILILDEIEDPHNLGSIMRTAEICGVHGIVIPKRRNVGVTPTVYKTSAGAAEYVKVAKVANINRAIDEIKERGTWVYGADMDGENYC---FQTNFKGAVALVIGSEGRGISKLTKQKCDVLVKIPMIGKITSLNASVAAGIMMY 255
>gi|58336688|ref|YP_193273.1| tRNA-rRNA methyltransferase [Lactobacillus acidophilus NCFM] >gi|58254005|gb|AAV42242.1| tRNA-rRNA methyltransferase [Lactobacillus acidophilus NCFM] (250 aa)
Score = 251, Expect = 5.1e-20, Identities = 66/198 (33%), Positives = 104/198 (52%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K K + +  V K   D+  V   N  G+    S   + D    ++K +  +  +  +L+LD I+DP N G+I RT+ +  V G+I  K +   +   V KTS G ++Y+   +VNNL +   +LKK  YW   T  D   +   ++     K V+I+GNE KG++ L+KK  D  + + M   VQSLN SV+T ++LY
  S:    48 KKKRLVVQSVPKNKLDRL-VDGGNHQGLVLAISSFDYADLGKMLDKFDE-DGKEPFLLMLDSIEDPHNLGSILRTADATGVDGVIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKRGYWFFGT--DMAGVDYREWNAK-GKTVLIIGNEGKGIAPLLKKQMDQTITLPMIGHVQSLNASVATGVLLY 240
>gi|118602547|ref|YP_903762.1| RNA methyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567486|gb|ABL02291.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (247 aa)
Score = 251, Expect = 5.3e-20, Identities = 70/200 (35%), Positives = 105/200 (52%)
  Q:    33 EFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           EF +  I + +  K   DK    HQ   G+A E  L    D    I  ++ L+ +   IL+LD IQDP N GA  R++ +  V  ++  KN    IN  V KTS G +N L   +V NLS  +  L+++N W +   LD  S+ +S ++ D+     +I+G E  G+  L K+  D + KI M   V+SLNVSV+T + L+
  S:    44 EFNNFGISVQRCTKIQLDKLSN-HQTHQGVAAEILLPTLPDQGELISYVSKLD-NAGFILILDSIQDPRNLGACLRSANAAGVHCVVINKNGSAPINSLVHKTSAGALNQLKIFQVTNLSRTIKALQQKNIWVI--GLD-GSVNISIYQIDLTIPNAIIMGAEGSGLRRLTKQSCDQLAKIPMQGKVESLNVSVATGVTLF 239
>gi|29374705|ref|NP_813857.1| RNA methyltransferase [Enterococcus faecalis V583] >gi|29342163|gb|AAO79929.1| RNA methyltransferase, TrmH family [Enterococcus faecalis V583] (282 aa)
Score = 250, Expect = 6.0e-20, Identities = 73/228 (32%), Positives = 116/228 (50%)
  Q:     5 FGKKAVIEAFKQNE-----LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKY--EVVHQN-ILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG  A +EA +Q       L E       ++LK+  K + + +  V K   D      VHQ  +L I     LT+    +   EK     T     L+LD ++DP NFG+I RT+ +  V GII  K+  + I  TV K S G V ++   +V NL++ +  LK+  +W   T  D       ++ T    + +I+GNE +G+S+ + K+ D ++ I M   VQSLN  V+  +++Y
  S:    45 FGFHATVEALQQGRGNKLFLQEDARGEKIEQLKQAAKEQAVPVKWVPKAKLDTMSDHGVHQGMVLAITAYQYLTLEELLEQTKEK-----TATPFFLILDSLEDPHNFGSILRTADATGVDGIIIPKHRAVGITPTVTKASTGAVEHIPVARVTNLAQSIATLKENQFWIFGT--DMSGTDYRRWNTQ-GAIALIIGNEGRGMSQGLHKEVDELLTIPMTGHVQSLNAGVAAGLLMY 273
>gi|189485694|ref|YP_001956635.1| 23S rRNA methyltransferase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287653|dbj|BAG14174.1| 23S rRNA methyltransferase [uncultured Termite group 1 bacterium phylotype Rs-D17] (251 aa)
Score = 250, Expect = 6.1e-20, Identities = 66/198 (33%), Positives = 109/198 (55%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTA-----LDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K K I L+ V  +  DK+    Q   GI  E S   +T+    IE+  +  + K ++++LD ++DP N GAI R   +F   G+I  K     +NETV K+S G V +++  +V N ++ +  LK+ ++W V        L++  +P          L VI+G+E  G+  L KK+SDF++ I  ++ + SLN S ++A+ILY
  S:    53 KQKGIALHSVPPEKLDKFSESSQ---GIVAEVSPVQYTELSDLIER--SKKSLKPLLVILDGLEDPHNLGAIIRNCVAFGADGVIIPKWRAAGVNETVSKSSAGAVEHISISRVENTNQAIGLLKENSFWIVGAENGGRILEKIDLPFP--------LAVIIGSEGFGLHSLTKKNSDFLISIPQENIISSLNASCASAVILY 242
>gi|113475949|ref|YP_722010.1| RNA methyltransferase [Trichodesmium erythraeum IMS101] >gi|110166997|gb|ABG51537.1| RNA methyltransferase, TrmH family, group 3 [Trichodesmium erythraeum IMS101] (288 aa)
Score = 250, Expect = 6.3e-20, Identities = 67/202 (33%), Positives = 109/202 (53%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCT-ALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E K+K   +++V+ +  D+     ++  GI  +     + +    I +  +  TD+ ++LV D I DP N GAI RT ++  + G++  +   + I  TV K + G +      +V NL+  L +LKKE +W   T A D + I   KF   I   V++VG+E +G+S LI+K+ D +V I M  S  SLNVSV+T + +Y
  S:    78 LNEAKTKGTIIDEVDDRRLDQI-TRRKHHQGIVAQICPYEYKELHELISQAKS-KTDRSVLLVADGINDPHNLGAIIRTGEALGIQGLVIPQRRAVGITSTVTKVAAGALENFPVARVINLNSALEELKKEGFWIYGTVAKDGEPIHTVKFTGAI---VLVVGSEGEGLSLLIQKNCDALVSIPMSGSTPSLNVSVATGMAIY 275
>gi|168181845|ref|ZP_02616509.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum Bf] >gi|182674742|gb|EDT86703.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum Bf] (257 aa)
Score = 250, Expect = 6.8e-20, Identities = 70/227 (30%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA K N+  E   ++  D        +   K K I +N+V++K  D       HQ ++            D   + ++      +   I++LDEI+DP NFG+I RT++     G+I  K   + +  TV KTS G   Y+   KV N++ V++KLK++  W     +       + +  D+N    + +++G+E +G+S+L K   D +VKI M  ++ SLN SV+  +++Y
  S:    18 GRNAVIEALKSNKTIEKVMIAKGDLEGSIKIIISLAKEKGIVINEVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQ----KEEDPFIIILDEIEDPHNFGSILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAAEYMKISKVTNINNVIDKLKEKGIWIYGADMCG-----NDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDVLVKIPMLGNITSLNASVAGGMLMY 247
>gi|94968032|ref|YP_590080.1| RNA methyltransferase TrmH, group 3 [Acidobacteria bacterium Ellin345] >gi|94550082|gb|ABF40006.1| RNA methyltransferase TrmH, group 3 [Acidobacteria bacterium Ellin345] (261 aa)
Score = 250, Expect = 6.8e-20, Identities = 71/235 (30%), Positives = 120/235 (51%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDEL--------KEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLK-KENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           M   +G   V EA K    S  Y     D +        ++ +   I +  + + F D+     +HQ ++ +  +     + D D  IEK      +   ++VLD I+DP N GA+ R++    V G++  +   + +  T +K S G   Y+   +V N++  +  LK K N WTV   LDE+    +  + D N  L +++G E KG+ +L++K  D +VKI M   V SLNVSV+  I++Y ++
  S:     1 MDVIYGIHPVSEALKSRGRSFQYVAIAKDRMDPRVQRIVEDARESGITVRFLPRDFLDRTANTNMHQGVIAVTSKKE---YLDLDDIIEKKRG---EHAFVVVLDGIEDPHNLGALIRSADGAGVDGVVIPERRAVGVTGTAMKASAGAAEYVPIARVTNIARSIEDLKDKYNVWTV--GLDERGTQ-NYDEIDYNMSLALVLGAEGKGLHDLVRKKCDLLVKIPMAGEVSSLNVSVAGGIVMYEVS 238
>gi|169824090|ref|YP_001691701.1| putative tRNA/rRNA methyltransferase [Finegoldia magna ATCC 29328] >gi|167830895|dbj|BAG07811.1| putative tRNA/rRNA methyltransferase [Finegoldia magna ATCC 29328] (244 aa)
Score = 250, Expect = 7.7e-20, Identities = 75/232 (32%), Positives = 126/232 (54%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSK--------NIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M+   G+  V+EA + +      Y+    ELK F  K         IK+  V+KK+ +K+     HQ ++  AK  S   +++ D  I      N D   +++LDEI DP N G+I RT++     G+I  K+   ++N T IKTS G V  +   +V N++  +N LK+ N W +  A  E S   ++       + +++GNE KG+S L++++ D ++KI M    +SLN S + +I++Y
  S:     1 MQYLVGRNPVMEALEMDMGVTNLYIQK-GELKGFIKKIEKKAYDMGIKVEYVDKKYIEKFAENTAHQGVM--AKMPSFG-YSNVDEMIIYAKKRNEDP-FLIILDEITDPHNLGSIIRTAEVAGCHGVIIPKHRACEVNATAIKTSAGAVFNIKIARVTNITTTINYLKEHNIW-IYGACGEASQTHTQANLK-GPIGLVIGNEGKGISRLVRENCDQLIKIPMYGKTESLNASNAASILIY 235
>gi|167758883|ref|ZP_02431010.1| hypothetical protein CLOSCI_01228 [Clostridium scindens ATCC 35704] >gi|167663623|gb|EDS07753.1| hypothetical protein CLOSCI_01228 [Clostridium scindens ATCC 35704] (250 aa)
Score = 249, Expect = 8.5e-20, Identities = 70/227 (30%), Positives = 121/227 (53%)
  Q:     6 GKKAVIEAFKQNE-LSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  + + +++ +    +      ++E K  +  L  V K+   +      HQ   G+   ++   + D +  ++   +   D  +IL LD I+DP N GAI RT+      G+I  K   + +  TV KTS G +NY    KV NL++ +  LK++  W VC  +  + +       D+N    + +I+GNE +GVS L+K+  DF  +I M+  + SLN SV+  ++ Y
  S:    14 GRNAVLEAFRSGKPIDKLFVLDGCQDGPIRTIVREAKKHDTILQFVTKERLSQISETGRHQ---GVIAYAAAYEYADVEDMLKLAESKGEDPFLIL-LDNIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLAKTMESLKEKGLWFVCADMGGEEM------YDLNLTGPIGLIIGNEGEGVSRLVKETCDFTARIPMNGDIDSLNASVAAGVLAY 242
>gi|195962260|ref|ZP_03098465.1| rRNA methylase [Borrelia spielmanii A14S] (246 aa)
Score = 249, Expect = 8.6e-20, Identities = 78/224 (34%), Positives = 130/224 (58%)
  Q:     9 AVIEAFKQNELSEVYYVSYFDELKEF----KSKNIKLNKVNKKFFDKYEVVHQN-----ILGIAKESSLTIHT-DFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++IE+ K N+  E+Y      + KE     K++NIK+ +++    DK      +      L + K  ++   T DF++ +E       +   IL+LDEI+DP N GAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +  LKK  +W    A D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:     8 SIIESIKNNKGFELYISKKSSKTKEIEKLAKTQNIKILRISINELDKILKTKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKK--KENAFILLLDEIEDPQNLGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKITVANINNTIIFLKKHGFWIY--ASDIKGQDINKIKINDKKIALILGNEGKGVHKLIKQNSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|116491407|ref|YP_810951.1| rRNA methylase [Oenococcus oeni PSU-1] >gi|116092132|gb|ABJ57286.1| rRNA methylase [Oenococcus oeni PSU-1] (233 aa)
Score = 249, Expect = 8.6e-20, Identities = 61/177 (34%), Positives = 97/177 (54%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           H N  GIA   +   +   D  +   N +      +++LDEI+DP N G+I RT+ +  V GII  K   +Q+ + V KTS G + ++   +V N++  ++KLKK N+W   T  D K    + +  D   + +++GNE KG+S   KK  D ++ I M   VQSLN SV+ A+++Y
  S:    52 HGNHQGIALSIAAYEYVPLDDIL---NGIKDHDPFLVILDEIEDPHNLGSILRTADATGVDGIIIPKRRAVQLTQVVAKTSTGAIEHVPVARVVNVNNTIDKLKKANFWIFGT--DMKGTDYTDWNAD-GPVAIVIGNEGKGISAQTKKKVDQMLTIPMIGHVQSLNASVAAALLIY 222
>gi|188995957|ref|YP_001930208.1| RNA methyltransferase, TrmH family, group 3 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931024|gb|ACD65654.1| RNA methyltransferase, TrmH family, group 3 [Sulfurihydrogenibium sp. YO3AOP1] (250 aa)
Score = 249, Expect = 1.0e-19, Identities = 80/230 (34%), Positives = 123/230 (53%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFD----ELKEFKS-KNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           +G+  VIEA K     E   +++      EL E  + K +K+ KV+++  ++     +   G+    S   + D +  I+K      +K I+L+LD I DP N G+I RT++ F V+G+I  K     INE V+K S G V +L   KV +L  V+ K KK+  W V      ++I    F   I    +IVG+E KGVS+ I +++D I  I M   + SLNVS +T+I L+ L
  S:    12 WGRNPVIEALKAGRSLEKILIAHDSHPPRELLELANEKKVKVQKVSRQKIEELANTKKT-QGVVALVSPIKYYDENEIIDKTIK---EKGIMLILDHITDPQNVGSILRTAEIFGVSGVIIPKERSSPINEVVVKASTGAVFHLPIAKVGSLRNVIEKFKKKGGWVVAIEKGGRNIAEIDFPYPI---ALIVGSEGKGVSKSILEEADIIATIPMVGKITSLNVSNATSIALWEL 239
>gi|188588931|ref|YP_001919654.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum E3 str. Alaska E43] >gi|188499212|gb|ACD52348.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum E3 str. Alaska E43] (290 aa)
Score = 248, Expect = 1.0e-19, Identities = 72/227 (31%), Positives = 120/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EA K     E  Y+S           + + K K I + +V+K+  D      VHQ ++        +  +D     +K      +   I++LDE++DP N G+I RT++ F V GII  K     +   V K+S+G + ++   +V NL+ V+++LK++  W   T +  +      ++TD      +I+GNE KG+S+L  K  D ++KI M   + SLN SV+  II+Y
  S:    53 GRNAVLEALKTERTIETLYISNSKLEGSINAIISKAKDKKILIKEVDKRKLDSMCNNAVHQGVIARVTPYEYSEVSDILELAKK----KGENPFIVILDEVEDPHNLGSIIRTAELFGVHGIIIPKRRSASVTTMVYKSSVGAIEHVKVARVTNLNSVIDELKEKGIWVYGTDIRAEEY---SYQTDFGGPCAIIIGNEGKGISKLTLKKCDKLIKIPMVGKINSLNASVAGGIIMY 282
>gi|78779235|ref|YP_397347.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9312] >gi|78712734|gb|ABB49911.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9312] (336 aa)
Score = 248, Expect = 1.2e-19, Identities = 83/232 (35%), Positives = 129/232 (55%)
  Q:     5 FGKKAVIEAF-KQNELSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDK--YEVVHQNI---LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           +GK +V EA   Q  ++ ++  S       ++  LKE KSK + + +V+     +  +   HQ +   L  +K  SL    DF       +  NT   IIL LD I DP N GAI R++++F   GII  +     +  TV K + G + +L   +V NL+  L +LKK  +  +  + D + + +SKF  +   LVVIVG E+KG+S L +K  DF++KI +     SLN SV+ AI L++LT+
  S:   100 WGKHSVFEALINQRAINRIWCTSEIFSSEKFYILLKELKSKGVLIEEVSWNRLSQLTFGASHQGVALQLACSKTISLEKLIDF-------SKRNTSNPIILALDGITDPHNVGAIIRSAEAFDCKGIIIPQRRSAGLTGTVAKVAAGALEHLPVSRVVNLNRALEELKKNGFMVIGLSGDGQ-LSISKFH-EKTPLVVIVGAEDKGISLLTQKKCDFLLKIPLKGKTSSLNASVAAAISLFHLTN 335
>gi|160881446|ref|YP_001560414.1| RNA methyltransferase [Clostridium phytofermentans ISDg] >gi|160430112|gb|ABX43675.1| RNA methyltransferase, TrmH family, group 3 [Clostridium phytofermentans ISDg] (248 aa)
Score = 248, Expect = 1.3e-19, Identities = 67/227 (29%), Positives = 114/227 (50%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EAF+  +  +  ++            L+E K  +  +  V K+  D+   E  HQ   G+   ++   + + D  +E       +   +++LD I+DP N GA+ RT+      GII  K   + +  TV K S G +NY    KV NL   + +LK++  W VC  +  + +        I    +++G+E +GVS L+K+  DF+ KI M   + SLN SV+  ++ Y
  S:    10 GRNAVLEAFRAGKTIDRLFILDGCQDGPIKSILREAKKYDTIITFVKKERLDQMSEEGKHQ---GVIAYAAAYEYAEVDDLLEAAK-AKGEAPFLIILDGIEDPHNLGAMLRTANQAGAHGIIIPKRRAVGLTATVAKVSAGAINYTPVAKVTNLVATMEELKQKGLWFVCADMSGEVMYRQNLTGPIG---LVIGSEGEGVSRLVKEKCDFVTKIPMVGDIDSLNASVAMGVLTY 238
>gi|15594861|ref|NP_212650.1| rRNA methylase (yacO) [Borrelia burgdorferi B31] >gi|3915369|sp|O51468|Y516_BORBU Uncharacterized tRNA/rRNA methyltransferase BB_0516 >gi|2688440|gb|AAC66889.1| rRNA methylase (yacO) [Borrelia burgdorferi B31] (228 aa)
Score = 247, Expect = 1.5e-19, Identities = 70/198 (35%), Positives = 117/198 (59%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNL-----NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K++NIK+ ++N    DK  + +++  G A +  L  + +  +  +   NL       +   IL+LDEI+DP NFGAI RT++ F +  +I  +    + N TV++TS G   Y+  + V N++  +N LK   +W      D K   ++K K +  K+ +I+GNE KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:    20 KTQNIKIIRINTNELDKI-LKNKDHRGFALKLKLEKNKNVKTQTKDFENLLETFKKKENAFILLLDEIEDPQNFGAILRTAEQFSIDLVITTQKRSAKDNSTVLRTSSGASQYVKKMTVTNINNTINLLKNYGFWIYTG--DIKGQDINKIKINDKKIALILGNEGKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 219
>gi|187918381|ref|YP_001883944.1| 23S rRNA methyltransferase [Borrelia hermsii DAH] >gi|119861229|gb|AAX17024.1| 23S rRNA methyltransferase [Borrelia hermsii DAH] (244 aa)
Score = 247, Expect = 1.6e-19, Identities = 61/160 (38%), Positives = 98/160 (61%)
  Q:    73 DFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + F+E+  + N     IL+LD I+DP NFGAI RTS+ F +  +I  +    + N T+++TS G   Y+N L V N++ V+  LKK  +W   + +  K+I  +       K+ +I+GNE KG+ +LIK++SDF+V+I     + SLNVSVST I+++
  S:    80 NLEEFLEEFQHQNN--VFILILDGIEDPQNFGAILRTSEQFNIDLVITSQRRSAKDNATILRTSSGASQYVNKLVVPNINNVIKYLKKNGFWIYASDIKGKAINTTPIND--TKIALIMGNEGKGIHKLIKENSDFLVRIPTKGKIDSLNVSVSTGILIF 235
>gi|85057748|ref|YP_456664.1| 23S rRNA methyltransferase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789853|gb|ABC65585.1| 23S rRNA methyltransferase [Aster yellows witches'-broom phytoplasma AYWB] (235 aa)
Score = 247, Expect = 1.7e-19, Identities = 79/228 (34%), Positives = 118/228 (51%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKE------FKSKNIKLNKVNKKFFDKYEVVHQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK  + EA K     ++Y +   +++K+       +  NI    V+KKF   Y++  Q    GIA         D D++++     +T  +  L+LD I DP N GAI RT ++  + G+I  K NQ+ +N TV K S G + Y     V NL + + KLKK     V T  D  S          + L +IVGNE  G+  L+KK  D +VKI M   + SLNVSV+ A+++Y
  S:     4 YGKNPIKEAIKAQR--KIYQLYLDEKIKDHLFIMFLQKHNIAYQLVDKKFL--YDLTKQKTHQGIAANVCDYTFYDLDTYLD-----STKFQKFLILDAINDPHNLGAILRTVEACALDGVIMSKKNQVPLNSTVAKISCGALEYTKVFLVTNLHQTILKLKKNQVLIVGT--DSNSSQSFHQIPKNSSLGIIVGNEGTGIRHLLKKQCDLLVKIPMYGKINSLNVSVAAALMIY 227
>gi|89893196|ref|YP_516683.1| hypothetical protein DSY0450 [Desulfitobacterium hafniense Y51] >gi|109647490|ref|ZP_01371393.1| RNA methyltransferase, TrmH family, group 3 [Desulfitobacterium hafniense DCB-2] >gi|89332644|dbj|BAE82239.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109640580|gb|EAT50135.1| RNA methyltransferase, TrmH family, group 3 [Desulfitobacterium hafniense DCB-2] (246 aa)
Score = 246, Expect = 1.9e-19, Identities = 62/204 (30%), Positives = 104/204 (50%)
  Q:    29 DELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           D +   +++ I    V+K   D+   +  HQ IL          + + D  +        D   ILVLDE++DP N GA+ RT+ +  V G+I  K   + +  TV KTS G V ++   +V NL + L  L+K   W      +   +    +++D+    V+++G+E KG+S L+K+  D IV + M   + SLN SV+ +I++Y
  S:    38 DIVSHARAQKIPFQFVDKAALDRLTEKAKHQGILAYVAPRE---YAEVDDILALAGEKGEDP-FILVLDEVEDPHNLGALIRTADAAGVHGVIIPKRRSVSLTATVAKTSAGAVEHVLVARVGNLVQTLKDLQKAGCWVSGAEAEGTEV----YRSDLTGARVIVIGSEGKGLSRLVKETCDEIVSLPMKGRINSLNASVAGSILMY 236
>gi|16077164|ref|NP_387977.1| hypothetical protein BSU00960 [Bacillus subtilis subsp. subtilis str. 168] >gi|586908|sp|Q06753|YACO_BACSU Putative trmH family tRNA/rRNA methyltransferase yacO >gi|467483|dbj|BAA05329.1| unknown [Bacillus subtilis] >gi|2632363|emb|CAB11872.1| yacO [Bacillus subtilis subsp. subtilis str. 168] (249 aa)
Score = 246, Expect = 2.3e-19, Identities = 66/227 (29%), Positives = 117/227 (51%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK AVIE  K +       ++E        ++ E  K + I +  V +K  D  ++V     G+  + +   + + D   +     N ++   L+LDE++DP N G+I RT+ +    GI+  K   + +  TV K S G + ++   +V NL+  L ++K+   W V T    +      F+  D N  L +++G+E KG+  L+K+  DF++K+ M   V SLN SV+  +++Y
  S:    10 GKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKLD--QMVTGQHQGVVAQVAAYEYAELDDLYKAAEEKN-EQPFFLILDELEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASAR----EDFRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238
>gi|37523750|ref|NP_927127.1| tRNA/rRNA methyltransferase [Gloeobacter violaceus PCC 7421] >gi|35214755|dbj|BAC92122.1| tRNA/rRNA methyltransferase [Gloeobacter violaceus PCC 7421] (338 aa)
Score = 245, Expect = 2.4e-19, Identities = 67/229 (29%), Positives = 121/229 (52%)
  Q:     4 FFGKKAVIEAFKQNE-LSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +GK++V+ A + +  L+ V+          +   L   K+    ++ V  +  D+      N  G+A +++   + +F+  I  +  +     ++L  D I+DP N GA+ R++++F   GII  +   + +  TV K + G V +L   +V NL++ + +LK+  Y  V T  ++ S  L + K D   LVV+VG+E KG+S L ++  D +V I +     SLN SV+  I+LY
  S:    93 LYGKQSVLAALQNSRPLNRVWLTEKLRYDPRFLRLLDAAKAGGAVIDIVEPRRLDQL-TAGGNHQGVAAQAAAHPYVEFEELIASL--VERPDPVLLAADGIEDPHNLGALIRSAEAFGFQGIILPQRRAVGVTATVAKVAAGAVEHLPIARVTNLNQAIERLKEAGYQVVGTQ-EKASQALYELKLD-GPLVVVVGSEGKGISLLTQRHCDHMVSIPLAGKTTSLNASVAGGIMLY 324
>gi|33861505|ref|NP_893066.1| tRNA/rRNA methyltransferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33634082|emb|CAE19407.1| tRNA/rRNA methyltransferase [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (428 aa)
Score = 245, Expect = 2.5e-19, Identities = 70/206 (33%), Positives = 119/206 (57%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           LK+ KSK + + +V      +     VHQ   G+A + + T     +  I+ I+   +   II+ LD + DP NFGAI R++++F   GII  +     +  TV K + G + ++   +V NL+  +++LKK+ +  +  + D + +P+S+FK +   +VVIVG ENKG+S L++K  D+++KI +     SLN SV+ AI L YL++
  S:   226 LKDLKSKGVLIEEVPWSRLSQLTSGAVHQ---GVALQHASTESISLEKLID-ISKSKSSNPIIVALDGVTDPHNFGAIIRSAEAFDCKGIIVPQRRSAGLTGTVAKVAAGALEHIPVSRVVNLNRAIDELKKKGFIIIGLSGDGQ-VPISEFK-EKAPVVVIVGAENKGISLLVQKKCDYLLKIPLKGKTSSLNASVAAAISLCYLSN 427
>gi|161506928|ref|YP_001576882.1| putative tRNA/rRNA methyltransferase [Lactobacillus helveticus DPC 4571] >gi|160347917|gb|ABX26591.1| putative tRNA/rRNA methyltransferase [Lactobacillus helveticus DPC 4571] (250 aa)
Score = 245, Expect = 2.7e-19, Identities = 64/198 (32%), Positives = 103/198 (52%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K K + +  V K   D+  V   N  G+    S   + D    +++ ++    +  +L+LD I+DP N G+I R++ +  V GII  K +   +   V KTS G ++Y+   +VNNL +   +LKK  YW   T  D       ++     K V+++GNE KG++ L+KK  D  + + M   VQSLN SV+T ++LY
  S:    48 KKKRLVIQNVPKNKLDRL-VDGGNHQGLVLAISSFEYADLSKLLDQFDD-EGKEPFLLMLDSIEDPHNLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKRGYWIFGT--DMAGTDYREWNAK-GKTVLVIGNEGKGIAPLLKKQMDQTITLPMIGHVQSLNASVATGVLLY 240
>gi|15923521|ref|NP_371055.1| putative tRNA/rRNA methyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926209|ref|NP_373742.1| hypothetical protein SA0490 [Staphylococcus aureus subsp. aureus N315] >gi|21282216|ref|NP_645304.1| hypothetical protein MW0487 [Staphylococcus aureus subsp. aureus MW2] >gi|49482761|ref|YP_039985.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485396|ref|YP_042617.1| SpoU rRNA methylase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82750239|ref|YP_415980.1| tRNA/rRNA methyltransferase [Staphylococcus aureus RF122] >gi|148266991|ref|YP_001245934.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150393038|ref|YP_001315713.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|156978860|ref|YP_001441119.1| hypothetical protein SAHV_0529 [Staphylococcus aureus subsp. aureus Mu3] >gi|81649904|sp|Q6GBV6|TRMHL_STAAS Putative trmH family tRNA/rRNA methyltransferase >gi|81651699|sp|Q6GJD7|TRMHL_STAAR Putative trmH family tRNA/rRNA methyltransferase >gi|81704678|sp|Q7A1Q9|TRMHL_STAAW Putative trmH family tRNA/rRNA methyltransferase >gi|81706174|sp|Q7A794|TRMHL_STAAN Putative trmH family tRNA/rRNA methyltransferase >gi|81782082|sp|Q99W72|TRMHL_STAAM Putative trmH family tRNA/rRNA methyltransferase >gi|13700422|dbj|BAB41720.1| SA0490 [Staphylococcus aureus subsp. aureus N315] >gi|14246299|dbj|BAB56693.1| putative tRNA/rRNA methyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|21203652|dbj|BAB94352.1| MW0487 [Staphylococcus aureus subsp. aureus MW2] >gi|49240890|emb|CAG39557.1| SpoU rRNA Methylase family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243839|emb|CAG42264.1| SpoU rRNA Methylase family protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82655770|emb|CAI80170.1| probable tRNA/rRNA methyltransferase [Staphylococcus aureus RF122] >gi|147740060|gb|ABQ48358.1| RNA methyltransferase, TrmH family, group 3 [Staphylococcus aureus subsp. aureus JH9] >gi|149945490|gb|ABR51426.1| RNA methyltransferase, TrmH family, group 3 [Staphylococcus aureus subsp. aureus JH1] >gi|156720995|dbj|BAF77412.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (248 aa)
Score = 245, Expect = 2.7e-19, Identities = 64/226 (28%), Positives = 118/226 (52%)
  Q:     7 KKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  + E  K+ +++E+        LK  K + I +  V K   D      HQ   G+A   +   + DFD F+++          +L+LD ++DP N G+I RT+ +  V G+I  K   + + +TV K S G + ++  ++V NL++ +++LK   +W   T  +  +      + D++ L +++G+E +G+S L+    DF +KI M   V SLN SV+ ++++Y
  S:    24 KILIQEGIKKQQINEI--------LKNAKDQKIIVQTVPKSKLDFLANAPHQ---GVAALIAPYEYADFDQFLKQ-QKEKEGLSTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT-DYRNLEADMS-LAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMY 236
>gi|74316627|ref|YP_314367.1| RNA methyltransferase TrmH [Thiobacillus denitrificans ATCC 25259] >gi|74056122|gb|AAZ96562.1| RNA methyltransferase TrmH [Thiobacillus denitrificans ATCC 25259] (254 aa)
Score = 244, Expect = 3.0e-19, Identities = 59/177 (33%), Positives = 99/177 (55%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVV-IVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   K  +LT H+  D  +E I        ++++LD + DP N GAI R++ +F    +I  K+N + IN TV K + G  + + +L V NL+  + +LK+ + W +   +D +  PLS    D+   V  ++G E  G+  L+K+  D + +I +  +V+SLNVSVS A+ LY
  S:    73 HQGVVARVKPVALT-HS-LDEVLESIEG----PPLLVILDGVTDPHNLGAILRSADAFGAHAVIAPKDNAVGINATVEKVASGAADTVPYLMVTNLARTIEELKEHDIWVIAADMDGEQ-PLSGI--DVRSGVAWVLGAEGAGIRRLVKQRCDQVARIPIGGTVESLNVSVSAALCLY 241
>gi|183221112|ref|YP_001839108.1| TrmH family tRNA/rRNA methyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|167779534|gb|ABZ97832.1| Putative tRNA/rRNA methyltransferase, trmH family [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (233 aa)
Score = 244, Expect = 3.1e-19, Identities = 59/206 (28%), Positives = 110/206 (53%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           +K +   ++K   V+ +  D+   +  HQ  + I  +    +   F+ F +   N+  ++  +L+LD IQDPGN G + RT++   V  ++    +   I   V K S G ++++   +V NL   ++ LKK  YW + T  +E    + +   D++++ VI+GNE +GV  ++ +D+D++ +I +  +V SLNV V+  I L  L H
  S:    27 IKAYLPNSVKFTTVSARELDRIAQDKNHQGYVIIRTKQKSYLSLGFEQFKQ---NIKPNEGPVLILDRIQDPGNLGNLLRTAECMGVKHVLMSDRDTSPITPVVEKVSAGAIHHIQIYRVANLKHGIDFLKKNEYWILATD-EEGEEGIWETLPDVSQMAVIMGNEGEGVKRILLEDADYVARIPLYGAVTSLNVVVACGITLDRLHH 230
>gi|82779438|ref|YP_405787.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella dysenteriae Sd197] >gi|81243586|gb|ABB64296.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (243 aa)
Score = 244, Expect = 3.1e-19, Identities = 60/199 (30%), Positives = 101/199 (50%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I  +     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA  E    L + K    +L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASL-----DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTA-GEADHTLCQSKM-TGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|94268732|ref|ZP_01291270.1| RNA methyltransferase TrmH, group 3 [delta proteobacterium MLMS-1] >gi|93451488|gb|EAT02319.1| RNA methyltransferase TrmH, group 3 [delta proteobacterium MLMS-1] (302 aa)
Score = 244, Expect = 3.4e-19, Identities = 54/139 (38%), Positives = 84/139 (60%)
  Q:    93 VLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           VLD +QDP N GA+ R++ +F V G+I  K+    ++ TV+K + GT   L+  +  NL+  L  LKK  +W +  A  E S  L  ++TD      +++GNE KG+  L+KK  DF++ I + + V+SLNVSV+  I+L
  S:   150 VLDSLQDPHNLGAVLRSAAAFGVDGVILPKDRSAPLSGTVLKAAAGTAALLDICRTTNLAGALGTLKKHGFW-IYGASGEASGNL--YETDFTGPTCLVLGNEQKGIRPLLKKHCDFLLAIPLAAGVESLNVSVAAGIML 286
>gi|15804769|ref|NP_290810.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli O157:H7 EDL933] >gi|15834410|ref|NP_313183.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli O157:H7 str. Sakai] >gi|16132002|ref|NP_418601.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|24115535|ref|NP_710045.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 2a str. 301] >gi|26251072|ref|NP_757112.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli CFT073] >gi|30065552|ref|NP_839723.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 2a str. 2457T] >gi|74314665|ref|YP_313084.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella sonnei Ss046] >gi|89110900|ref|AP_004680.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli W3110] >gi|91213729|ref|YP_543715.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli UTI89] >gi|110644537|ref|YP_672267.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli 536] >gi|110808098|ref|YP_691618.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 5 str. 8401] >gi|117626526|ref|YP_859849.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli APEC O1] >gi|157158474|ref|YP_001465680.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli E24377A] >gi|157163645|ref|YP_001460963.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli HS] >gi|168707494|ref|ZP_02739771.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4045] >gi|168718633|ref|ZP_02750910.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4206] >gi|168736492|ref|ZP_02768769.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4115] >gi|168751468|ref|ZP_02776490.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4113] >gi|168754751|ref|ZP_02779758.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4401] >gi|168760422|ref|ZP_02785429.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4501] >gi|168766459|ref|ZP_02791466.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4486] >gi|168774107|ref|ZP_02799114.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4196] >gi|168780612|ref|ZP_02805619.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4076] >gi|168784817|ref|ZP_02809824.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC869] >gi|168792145|ref|ZP_02817152.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4042] >gi|168801835|ref|ZP_02826842.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC508] >gi|170021810|ref|YP_001726764.1| RNA methyltransferase [Escherichia coli ATCC 8739] >gi|170083626|ref|YP_001732946.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|170679577|ref|YP_001746575.1| RNA methyltransferase [Escherichia coli SMS-3-5] >gi|188494408|ref|ZP_03001678.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli 53638] >gi|191165658|ref|ZP_03027498.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B7A] >gi|191170707|ref|ZP_03032259.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11] >gi|191174517|ref|ZP_03036015.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11] >gi|193066002|ref|ZP_03047060.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E22] >gi|193070849|ref|ZP_03051781.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E110019] >gi|194426679|ref|ZP_03059233.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B171] >gi|194434585|ref|ZP_03066842.1| RNA methyltransferase, TrmH family, group 3 [Shigella dysenteriae 1012] >gi|194439536|ref|ZP_03071610.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli 101-1] >gi|195935970|ref|ZP_03081352.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli O157:H7 str. EC4024] >gi|52783780|sp|P63177|RLMB_ECOLI 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|52783781|sp|P63179|RLMB_ECO57 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|52783782|sp|P63180|RLMB_SHIFL 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|54039247|sp|P63178|RLMB_ECOL6 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|12519168|gb|AAG59376.1|AE005651_5 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|26111504|gb|AAN83686.1|AE016771_197 Hypothetical tRNA/rRNA methyltransferase yjfH [Escherichia coli CFT073] >gi|537021|gb|AAA97076.1| ORF_o243 [Escherichia coli] >gi|1790623|gb|AAC77137.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|13364633|dbj|BAB38579.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|24054863|gb|AAN45752.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30043816|gb|AAP19535.1| hypothetical protein S4603 [Shigella flexneri 2a str. 2457T] >gi|73858142|gb|AAZ90849.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|85676931|dbj|BAE78181.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli W3110] >gi|91075303|gb|ABE10184.1| hypothetical tRNA/rRNA methyltransferase YjfH [Escherichia coli UTI89] >gi|110346129|gb|ABG72366.1| hypothetical tRNA/rRNA methyltransferase YjfH [Escherichia coli 536] >gi|110617646|gb|ABF06313.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] >gi|115515650|gb|ABJ03725.1| conserved hypothetical protein [Escherichia coli APEC O1] >gi|157069325|gb|ABV08580.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli HS] >gi|157080504|gb|ABV20212.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E24377A] >gi|169756738|gb|ACA79437.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli ATCC 8739] >gi|169891461|gb|ACB05168.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|170517295|gb|ACB15473.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli SMS-3-5] >gi|187770173|gb|EDU34017.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4196] >gi|188014500|gb|EDU52622.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4113] >gi|188489607|gb|EDU64710.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli 53638] >gi|189001755|gb|EDU70741.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4076] >gi|189357886|gb|EDU76305.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4401] >gi|189364243|gb|EDU82662.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4486] >gi|189368907|gb|EDU87323.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC4501] >gi|189374953|gb|EDU93369.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC869] >gi|189376090|gb|EDU94506.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli O157:H7 str. EC508] >gi|190904353|gb|EDV64062.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B7A] >gi|190905197|gb|EDV64838.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11] >gi|190908931|gb|EDV68518.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11] >gi|192926325|gb|EDV80961.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E22] >gi|192955795|gb|EDV86266.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E110019] >gi|194415418|gb|EDX31686.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B171] >gi|194417170|gb|EDX33282.1| RNA methyltransferase, TrmH family, group 3 [Shigella dysenteriae 1012] >gi|194421535|gb|EDX37548.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli 101-1] (243 aa)
Score = 243, Expect = 3.9e-19, Identities = 60/199 (30%), Positives = 101/199 (50%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I  +     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA  E    L + K    +L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASL-----DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTA-GEADHTLYQSKM-TGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|120611681|ref|YP_971359.1| RNA methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590145|gb|ABM33585.1| RNA methyltransferase, TrmH family, group 3 [Acidovorax avenae subsp. citrulli AAC00-1] (250 aa)
Score = 243, Expect = 4.8e-19, Identities = 55/168 (32%), Positives = 92/168 (54%)
  Q:    65 ESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           E+   +H+  D  +E++     +K ++LVLD + DP N GA  R +       +I  K++ + IN TV K + G    + +  V NL+  L +LK+ N W + T+ D    P + ++ D+   V +V G E  G+ +L +K  D +V I M  +V+SLNVSV++ + LY
  S:    78 EAVAQVHS-LDELLEQLEADGVEKPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGINATVAKVASGAAETMPYFMVTNLARTLGELKERNIWCIGTSDDA---PRTLYEVDLKGPVALVLGAEGAGMRQLTRKTCDELVSIPMRGAVESLNVSVASGVCLY 242
>gi|57651408|ref|YP_185464.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|87162210|ref|YP_493220.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300] >gi|88194294|ref|YP_499086.1| hypothetical protein SAOUHSC_00513 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220706|ref|YP_001331528.1| hypothetical protein NWMN_0494 [Staphylococcus aureus subsp. aureus str. Newman] >gi|161508771|ref|YP_001574430.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728914|ref|ZP_02761191.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|75410372|sp|Q9AGT0|TRMHL_STAAE Putative trmH family tRNA/rRNA methyltransferase >gi|81695161|sp|Q5HIE3|TRMHL_STAAC Putative trmH family tRNA/rRNA methyltransferase >gi|13183698|gb|AAK15305.1|AF327733_2 YacO [Staphylococcus aureus] >gi|57285594|gb|AAW37688.1| RNA methyltransferase, TrmH family [Staphylococcus aureus subsp. aureus COL] >gi|87128184|gb|ABD22698.1| RNA methyltransferase, TrmH family, group 3 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201852|gb|ABD29662.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373506|dbj|BAF66766.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|160367580|gb|ABX28551.1| RNA methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (248 aa)
Score = 243, Expect = 4.9e-19, Identities = 65/226 (28%), Positives = 121/226 (53%)
  Q:     7 KKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK---IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  + E  K+ +++E+        LK  K + I +  V K   D      HQ   G+A   +   + DFD F+++      +K+    +L+LD ++DP N G+I RT+ +  V G+I  K   + + +TV K S G + ++  ++V NL++ +++LK   +W   T  +  +      + D++ L +++G+E +G+S L+    DF +KI M   V SLN SV+ ++++Y
  S:    24 KILIQEGIKKQQINEI--------LKNAKDQKIIVQTVPKSKLDFLANAPHQ---GVAALIAPYEYADFDQFLKQ----QKEKEGLLTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT-DYRNLEADMS-LAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMY 236
>gi|146310028|ref|YP_001175102.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Enterobacter sp. 638] >gi|145316904|gb|ABP59051.1| RNA methyltransferase, TrmH family, group 3 [Enterobacter sp. 638] (244 aa)
Score = 243, Expect = 4.9e-19, Identities = 58/199 (29%), Positives = 105/199 (52%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   +++F D+     VHQ I+  AK        D    I +++N        L+LD + DP N GA  R++ +  V  +I  ++   Q+N T  K + G    +  ++V NL+  + +L++EN W V TA + + ++  SK      +L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVVIQLASRQFLDEKSEGAVHQGIIARAKPGRQYQENDLPDLIAQLDN-----PFFLILDGVTDPHNLGACLRSADAAGVHAVIVPRDRAAQLNATAKKVACGAAENVPLIRVTNLARTMRQLQEENIWIVGTAGEADHTVYQSKMT---GRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|108761000|ref|YP_631271.1| RNA methyltransferase [Myxococcus xanthus DK 1622] >gi|108464880|gb|ABF90065.1| RNA methyltransferase, TrmH family, group 3 [Myxococcus xanthus DK 1622] (282 aa)
Score = 242, Expect = 5.3e-19, Identities = 60/178 (33%), Positives = 91/178 (51%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ   G+  E     + + +  +E    L     +++VLD IQDP N GAI R++ +    G++  K+  +Q+  TV K S G V +    +V N+S  L +LK+   W     +D K  P+   + D   L ++VG E  GV + + K  DF ++I M   V SLN SVS  I+LY
  S:    99 VHQ---GVVVELRGFKYAELEDLLEAAKALG-QPPLVVVLDGIQDPHNLGAIIRSADALGAHGVVIAKDRAVQVTGTVAKASAGAVEHSRIARVVNISRALEELKEAGLWVAAADVDAKE-PMWSARLD-GPLALVVGAEGAGVRDGVLKHCDFRLRIPMAGQVGSLNASVSAGILLY 270
>gi|51598770|ref|YP_072958.1| rRNA methylase [Borrelia garinii PBi] >gi|51573341|gb|AAU07366.1| rRNA methylase [Borrelia garinii PBi] (246 aa)
Score = 242, Expect = 5.9e-19, Identities = 61/160 (38%), Positives = 99/160 (61%)
  Q:    73 DFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           DF++ +E       +   IL+LDEI+DP NFGAI RT++ F +  ++  +    + N TV++TS G   Y+  + V N++  +  LKK  +W    A D K   ++K K +  K+ +I+GNE+KGV +LIK++SDF+++I     + SLNVSVST I+++
  S:    82 DFENLLETFKK--KEHAFILLLDEIEDPQNFGAILRTAEQFSIDLVVTTQKRSAKDNLTVLRTSSGASQYVKKITVTNINNTIYFLKKHGFWIY--AGDIKGQDINKIKINDKKIALILGNESKGVHKLIKENSDFLIRIPTSGKIDSLNVSVSTGILIF 237
>gi|189911203|ref|YP_001962758.1| tRNA (guanosine-2'-O-)-methyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775879|gb|ABZ94180.1| tRNA (guanosine-2'-O-)-methyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] (257 aa)
Score = 242, Expect = 6.2e-19, Identities = 59/206 (28%), Positives = 110/206 (53%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           +K +   ++K   V+ +  D+   +  HQ  + I  +    +   F+ F +   N+  ++  +L+LD IQDPGN G + RT++   V  ++    +   I   V K S G ++++   +V NL   ++ LKK  YW + T  +E    + +   D++++ VI+GNE +GV  ++ +D+D++ +I +  +V SLNV V+  I L  L H
  S:    51 IKAYLPNSVKFTTVSARELDRIAQDKNHQGYVIIRTKQKSYLSLGFEQFKQ---NIKPNEGPVLILDRIQDPGNLGNLLRTAECMGVKHVLMSDRDTSPITPVVEKVSAGAIHHIQIYRVANLKHGIDFLKKNEYWILATD-EEGEEGIWETLPDVSQMAVIMGNEGEGVKRILLEDADYVARIPLYGAVTSLNVVVACGITLDRLHH 254
>gi|116328523|ref|YP_798243.1| tRNA (guanosine-2'-O-)-methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331251|ref|YP_800969.1| tRNA (guanosine-2'-O-)-methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121267|gb|ABJ79310.1| tRNA (guanosine-2'-O-)-methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124940|gb|ABJ76211.1| tRNA (guanosine-2'-O-)-methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (253 aa)
Score = 242, Expect = 6.3e-19, Identities = 55/140 (39%), Positives = 84/140 (60%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           LVLD IQDPGN G I RT++ F V  II  +     I   V K S G +++L    V NL+  L  LK+  YW V T+ D  +   SK   ++ +L +++GNE +GV  ++ + SDF+++I +  ++ SLNV+V+T I+L
  S:   109 LVLDRIQDPGNLGNILRTAECFGVTNIILPERESAGITPVVEKVSSGALSFLKIFTVKNLANTLELLKENGYWIVSTS-DRGTENWSKLP-ELKELAILMGNEGEGVKRILLEKSDFVLRIPIHGNLSSLNVTVATGIVL 246
>gi|94500543|ref|ZP_01307074.1| RNA methyltransferase, TrmH family, group 3 [Oceanobacter sp. RED65] >gi|94427333|gb|EAT12312.1| RNA methyltransferase, TrmH family, group 3 [Oceanobacter sp. RED65] (246 aa)
Score = 241, Expect = 6.8e-19, Identities = 62/203 (30%), Positives = 109/203 (53%)
  Q:    30 ELKEFKSKN-IKLNKVNKKFFD-KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +  +KN I L  V K   D + +  HQ ++  AK        D +  ++++++L+ +   +LVLD + DP N GA  RT+ +  V G+I  K+  + +  TV K + G    + F +V NL+  + +L++   W   TA +      S FKTD+   + +++G E KG+  L ++  D ++ I M   V SLNVSV+T + L+
  S:    39 DIVQLANKNSINLQAVKKTVLDDRAQGNHQGVIARAKPVQ---SKDENQLLQQLDSLD-EPAFLLVLDSVTDPHNLGACLRTADAAGVHGVIAPKDKAVGLTATVSKVACGAAESVPFYQVTNLARTMKELQERGIWLYGTAGEASE---SVFKTDLKGPIAIVMGAEGKGLRRLTREACDHLINIPMAGDVSSLNVSVATGVCLF 237
>gi|184154739|ref|YP_001843079.1| RNA methyltransferase [Lactobacillus fermentum IFO 3956] >gi|183226083|dbj|BAG26599.1| RNA methyltransferase [Lactobacillus fermentum IFO 3956] (251 aa)
Score = 241, Expect = 6.9e-19, Identities = 63/202 (31%), Positives = 105/202 (51%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK-IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K  K +++ ++ V K   D+     QN  G+A   +   +   D   E  N    D++   L+LDE+ DP N G+I RT+ +  V GII  K   + +   V KTS G + ++   +V NL +V  +L+K   W   T  D +     ++      + +++GNE KG+S L+KK  D ++ I M   VQSLN SV+ ++++Y
  S:    45 VKSAKERHLVISNVPKTKLDQM-TAGQNHQGVALAVAAYQYATVDDLFE--NAAQKDEEPFFLILDELADPHNLGSILRTADAAGVHGIIIPKRRSVGLTSVVAKTSTGAIEHVPVARVTNLVQVAKELQKRGVWLFGT--DMQGTDCRRWDAK-GAVALVIGNEGKGISPLLKKTCDEMLTIPMIGHVQSLNASVAASLLIY 241
>gi|94986121|ref|YP_605485.1| RNA methyltransferase TrmH, group 3 [Deinococcus geothermalis DSM 11300] >gi|94556402|gb|ABF46316.1| RNA methyltransferase TrmH, group 3 [Deinococcus geothermalis DSM 11300] (246 aa)
Score = 241, Expect = 6.9e-19, Identities = 64/229 (27%), Positives = 122/229 (53%)
  Q:     4 FFGKKAVIEAFKQNELSEVYYVSYFDE--LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +G+  V+EA +   ++EV      +E  ++  K+ +++L    +   D+     Q+   IA+   L   T  D  +++      D  I+L LD I DP NFGAI R+++     G++ ++     ++  V+KT+ G  +YL   +  NL  +++ LK++  W +  A  E +  +   +TD++ K+ +++G E +G+  L+++  D +V+I     VQSLN SV+  I+LY
  S:     3 LYGRNPVLEALRDGRVTEVLVARGVEEAFVRSLKAFDVRLRFAPRIELDQLAGTTQHQGVIAEVEDLAWAT-VDDILDRAEARGEDLLIVL-LDGITDPRNFGAIIRSAEVLGAHGVVVEERRSAPLSPVVVKTAAGATSYLPVAQTKNLPRLIDALKEDGVW-IYGAAGEAAQDIG--RTDLSGKVALVIGAEGEGLRRLVREKCDALVRIPTRGQVQSLNASVAAGILLY 229
>gi|116618911|ref|YP_819282.1| rRNA methylase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097758|gb|ABJ62909.1| rRNA methylase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (249 aa)
Score = 241, Expect = 7.3e-19, Identities = 58/146 (39%), Positives = 86/146 (58%)
  Q:    87 DKK----IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           DKK      ++LD I+DP N G+I RT+ +  V GII  K   +Q+  TV KTS G + ++   +V NL  ++ +LKK N W   T +          + D N  V +I+GNE +G+S L+KK  D +V I M   VQSLN SV+ ++++Y
  S:    94 DKKGEAPFFVILDGIEDPHNLGSILRTADAAGVHGIIIPKRRAVQLTATVAKTSTGAIEHVPVARVTNLVNIVEELKKRNVWVFGTDMAGDDYR----RWDANGAVALIIGNEGRGISPLLKKKVDGMVTIPMVGHVQSLNASVAASLLIY 240
>gi|73663533|ref|YP_302314.1| SpoU rRNA methylase family protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90110724|sp|Q49V41|TRMHL_STAS1 Putative trmH family tRNA/rRNA methyltransferase >gi|72496048|dbj|BAE19369.1| SpoU rRNA Methylase family protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (249 aa)
Score = 241, Expect = 7.4e-19, Identities = 66/226 (29%), Positives = 115/226 (50%)
  Q:     7 KKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  + +  K+ +++E+        LK   S  I +  V K   D   +  HQ   G+A   +   + DFD+F+ +          +L+LD ++DP N G+I RT+ +  V G+I  K   + + +TV K S G + ++  ++V NL+  +  LK   YW V T   E S    +    +  L +++G+E +G+S L+K+  DF + I M   V SLN SV+ ++++Y
  S:    24 KILIQDTIKKGQINEI--------LKLANSNKIIVQSVPKSKIDGLSDSPHQ---GVAAYIAPYEYADFDAFVAQ-QKAQDKLSTVLILDGLEDPHNLGSILRTADASGVDGVIIPKRRSVALTQTVAKASTGAIQHIPVMRVTNLANTIETLKDNGYWIVGTEA-ENSTDYREMDAGM-PLGIVIGSEGQGMSRLVKEKCDFYINIPMVGHVNSLNASVAASLMMY 236
>gi|71282118|ref|YP_271263.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Colwellia psychrerythraea 34H] >gi|71147858|gb|AAZ28331.1| RNA methyltransferase, TrmH family, group 3 [Colwellia psychrerythraea 34H] (251 aa)
Score = 241, Expect = 8.0e-19, Identities = 62/177 (35%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKII----LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   +        D D  I     L  +KK I    L+LD + DP N GA  R + +  V  II  K+N  QI  TV K ++G V  +  ++V NLS  + +L+K+  W V TA  E    L   K     + +++G E KG+  L +++ D +VK+ M  +V SLNVSV+T I L+
  S:    70 HQGVIARVRPGKSYTENDIDDII-----LAAEKKSIAPFFLILDGVTDPHNLGACLRNADAAGVQAIIVPKDNAAQITPTVRKVAVGAVESVPLVQVTNLSRTMKQLQKQGVWIVGTA-GETDTCLYDVKLS-GPMALVMGAEGKGMRRLTRENCDQLVKLPMAGTVSSLNVSVATGICLF 243
>gi|37913005|gb|AAR05334.1| predicted tRNA/rRNA methyltransferase [uncultured marine alpha proteobacterium HOT2C01] (257 aa)
Score = 241, Expect = 8.1e-19, Identities = 82/232 (35%), Positives = 133/232 (57%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKN-IKLNKVN----KKFFDKYEVV------HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           +G  AV+ A   NE + V Y  YF    E K KN IKL  +N    KK  D+ +++      HQ I    ++      +DF      INNLN ++ II +LD++ DP N GAI R++ +F + GII    N +  N  + KT+   ++ + F+K+ N+S  +  LK   YW     +  E+SI  + F     K+V I+G+E+KG+ ++     D  +KI+M  +++SLNVS + AII++Y+++
  S:    20 YGHHAVVGAL-MNE-NRVKYEVYFTSEAEKKLKNEIKLENINVISIKKTRDEIDLLLKGISNHQGICMRVEKLQTPKLSDF------INNLNEERSIIFLLDQLDDPQNVGAIFRSALAFNIDGIILTNTNSVTENSFLAKTASSALDKVPFIKIQNISSCIKILKDSGYWIYGLDMKAERSITETTFP---KKIVFILGSESKGMRKITDSLCDEGLKIKMSDNLESLNVSNTAAIIMFYVSN 252
>gi|90416564|ref|ZP_01224495.1| RNA methyltransferase, TrmH family, group 3 [marine gamma proteobacterium HTCC2207] >gi|90331763|gb|EAS46991.1| RNA methyltransferase, TrmH family, group 3 [marine gamma proteobacterium HTCC2207] (231 aa)
Score = 241, Expect = 8.5e-19, Identities = 57/187 (30%), Positives = 98/187 (52%)
  Q:    46 KKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN---KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K   DK    HQ ++ + +E      T  ++F+ +    + +K + LVLD + DP N GA  R++    V  ++  K+N + +   V K + G    +  + V NL+  L KL++   W V  A + +     +F  DI+    LV+++G E KG+ +L +K  D++ K+ M   V SLNVSV+T + L+
  S:    43 KNLDDKVNARHQGVIALCEEG----QTHDEAFLLESMEKHGNKALFLVLDGVTDPHNLGACLRSADGAGVHAVVVPKDNSVGLTPVVQKVACGAAESVPLVMVTNLTRTLEKLQQAGAWVVGAAGEAE-----QFIYDIDLTGPLVLVMGAEGKGIRQLTRKQCDYLAKLPMAGEVSSLNVSVATGVCLF 223
>gi|50083619|ref|YP_045129.1| putative tRNA/rRNA methyltransferase [Acinetobacter sp. ADP1] >gi|52783290|sp|Q6FF50|RLMB_ACIAD 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|49529595|emb|CAG67307.1| putative tRNA/rRNA methyltransferase [Acinetobacter sp. ADP1] (248 aa)
Score = 240, Expect = 9.5e-19, Identities = 52/177 (29%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVC-TALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   +   +    D D  ++     N D+ ++L LD++ DP N GA  RT+ +  +A +I  ++    +  T  K + G    + F++V NL+  L  +K   +  V  T LDEK++P+ K+    N + +++G E+ G+  + +   D  V I M  ++QSLNVSV+  + LY
  S:    69 HQGVVAAVRPHPVLNEKDLDQLLQ-----NNDQALLLALDQVTDPHNLGACIRTAAAMGIAAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTLAHIKAHFFVKVVGTMLDEKALPIQKYDFSGN-VAIVMGAEDTGLRPITQSQCDQTVYIPMSGNLQSLNVSVAAGMALY 240
>gi|157147848|ref|YP_001455167.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Citrobacter koseri ATCC BAA-895] >gi|157085053|gb|ABV14731.1| hypothetical protein CKO_03652 [Citrobacter koseri ATCC BAA-895] (243 aa)
Score = 240, Expect = 9.7e-19, Identities = 57/199 (28%), Positives = 99/199 (49%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   N+++ D+     VHQ I+   K        D    I K +N       +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA +          T   ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVVIQLANRQYLDEKSEGAVHQGIIARVKPGRQYQENDLPDLIAKFDN-----PFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENIWIVGTAGEADHTLFQSKMT--GRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|152973939|ref|YP_001373456.1| RNA methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022691|gb|ABS20461.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus subsp. cytotoxis NVH 391-98] (247 aa)
Score = 240, Expect = 1.1e-18, Identities = 61/198 (30%), Positives = 103/198 (52%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKL------VVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K   I L    KK  D  ++V  N  G+  + +   + + +    K+     ++   L+LDEI+DP N G+I RT+ +    GII  K   + +  +V K S G + Y+  ++V NLS  +++LK+   W   T         +K KTD   L       +++G+E KG+S +I +  DF+V + M   V SLN SV+ ++++Y
  S:    44 KENKILLQYAPKKKLD--QLVEGNHQGVIAQVAAYQYAELEDLF-KVAAKRNEEPFFLILDEIEDPHNLGSIMRTADATGAHGIIIPKRRSVGLTASVAKASTGAIEYIPVVRVTNLSRTIDELKERGLWIAGTD--------AKGKTDYRNLDGNMPIGLVIGSEGKGMSRIIGQKCDFLVHLPMVGKVTSLNASVAASLLMY 236
>gi|157413277|ref|YP_001484143.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9215] >gi|157387852|gb|ABV50557.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9215] (326 aa)
Score = 240, Expect = 1.1e-18, Identities = 81/231 (35%), Positives = 128/231 (55%)
  Q:     5 FGKKAVIEAF-KQNELSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           +GK +V EA   Q  ++ ++  S       ++  LKE K K + + +V+     +  Y   HQ   G+A + + +     +  I+ I+  N    IIL LD I DP N GAI R++++F   GII  +     +  TV K + G + +L   +V NL+  L  LKK  +  V  + D + + LS F ++I  LVVIVG+E+KG+S L +K  DF++ I +     SLN SV+ AI L++LT
  S:    90 WGKHSVYEALISQRAINRIWCTSEIFSSDKFYILLKELKLKGVLIEEVSWNRLSQLTYGASHQ---GVALQLACSKTISLEKLID-ISKHNCANPIILALDGITDPHNVGAIIRSAEAFDCKGIIIPQRRSAGLTGTVAKVAAGALEHLQVSRVVNLNRALEVLKKNGFLIVGLSGDGQ-LSLSNF-SEIVPLVVIVGSEDKGISLLTQKKCDFLLSIPLKGKTSSLNASVAAAISLFHLT 324
>gi|156744301|ref|YP_001434430.1| RNA methyltransferase [Roseiflexus castenholzii DSM 13941] >gi|156235629|gb|ABU60412.1| RNA methyltransferase, TrmH family, group 3 [Roseiflexus castenholzii DSM 13941] (248 aa)
Score = 240, Expect = 1.1e-18, Identities = 53/195 (27%), Positives = 104/195 (53%)
  Q:    39 IKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYY 233
           + + +++++  D+  ++  N  G+A E     + D D  +      N +  ++L+LD IQDP N G + RT++   V G+I       +I   V+  S G V +L  + V+NL+  + +++    W V    DE++    +   D+  L +++G E  G++ L ++  DF+V++ M   + SLNV+V+ +I+LY+
  S:    49 VPVERIDRRELDR-RLLDANHQGVALECGDYPYVDLDDCLTLAEERN-EPALLLMLDHIQDPQNVGTLLRTAEVVGVHGVIIPGRRAAEITPAVVNASAGAVEHLRIVVVSNLAATIERVQHAGVWVVGVEDDERARVFDEVDLDL-PLTLVLGAEGSGLARLTRERCDFLVRLPMRGRIASLNVAVAGSIVLYH 240
>gi|89100738|ref|ZP_01173593.1| tRNA/rRNA methyltransferase [Bacillus sp. NRRL B-14911] >gi|89084555|gb|EAR63701.1| tRNA/rRNA methyltransferase [Bacillus sp. NRRL B-14911] (247 aa)
Score = 239, Expect = 1.1e-18, Identities = 66/227 (29%), Positives = 119/227 (52%)
  Q:     6 GKKAVIEAFK-QNELSEVYYV--SYFDELKEF----KSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK  V+EA + + ++++++    S   ++++     K+  + +  V KK  D+  E +HQ ++            D  +  EK N    +    L+LDEI+DP N G+I RT+ +    GII  K   + +  TV K S G + ++   +V NL+  +++LK++  W   T  D K     +       L +++G+E KG+  LI+   DF++ + M   V SLN SV+ A+++Y
  S:     8 GKNPVLEALRAERDINKIFIAEGSQGGQMQQVIGLAKTNGVLVQFVPKKKLDQMAEGIHQGVVAAVAAYEYAEVDDLFAAAEKKN----EAPFFLLLDEIEDPHNLGSIMRTADAVGAHGIIIPKRRAVGLTATVAKASTGAIEHIPVARVTNLARTIDELKEKGVWIAGT--DAKGSEDYRRFDGTMPLGLVIGSEGKGMGRLIRDKCDFLIHLPMAGHVTSLNASVAAALLMY 236
>gi|51246711|ref|YP_066595.1| tRNA/rRNA methyltransferase [Desulfotalea psychrophila LSv54] >gi|50877748|emb|CAG37588.1| related to tRNA/rRNA methyltransferase [Desulfotalea psychrophila LSv54] (295 aa)
Score = 239, Expect = 1.2e-18, Identities = 68/228 (29%), Positives = 119/228 (52%)
  Q:     5 FGKKAVIEAFK--QNELSEVYYV-----SYFDELKEFKSKNIKLNKVNKKFFDKYEVV--------HQNILGIAKESSLTIHTDFDSFIEKINNL--NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G   ++EA K   N +SE+        + FDE+ E      +  KV   F D   +         HQ ++    ++ L    DF  F++K  +     +K  I+V D +QDP N GAI R++ +    G++  +     +  T  K+S G +++++  +V NL + L +LKK   W      D  ++ L  F  D+N    ++VG+E  G+  L++++ D  + I M   + SLN SV+ A+IL+
  S:    50 WGIHPIVEALKYEPNRISEIIAQKDRRGAKFDEIVELA----RAAKVKVTFIDSISLQGDGAASARHQGVIAKVTQADLM---DFADFLQKFKDAVDRGEKPRIIVCDSLQDPHNLGAIVRSALASGAIGVLLTRERSAPLGGTAAKSSAGAISHMDICQVTNLVKSLAELKKVGAWVFGAIKDADAVSL--FDADLNVPACIVVGSEGTGIRPLVRRECDIQLSIPMVGELDSLNSSVAAAVILF 286
>gi|126654404|ref|ZP_01726149.1| 23S rRNA methyltransferase [Bacillus sp. B14905] >gi|126589154|gb|EAZ83338.1| 23S rRNA methyltransferase [Bacillus sp. B14905] (250 aa)
Score = 239, Expect = 1.2e-18, Identities = 69/227 (30%), Positives = 122/227 (53%)
  Q:     6 GKKAVIEAFKQN-ELSEVYYV-----SYFDELKEF-KSKNIKLNKVNKKFFDKYEVV-HQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK  V+EA +   ++++V+       S  +EL +  + + + +  V KK  D+     HQ I+  +A      +   F +  +K      +    L+LDE++DP N G+I RT+ +    GII  K   + +   V K S G + ++  ++VNNL++ +++LK+   W   T  D K S+   K    +  L +I+G+E KG+  L+K+  DF+  + M   V SLN SV+ A+++Y
  S:    11 GKNPVLEALRSGRDMNKVWIAEGVKKSGVNELLDLARERGVIVQFVPKKKVDQLSSANHQGIVASVAAYQYAELEDLFAAAAKK-----QEDPFFLILDELEDPHNLGSIMRTADAIGAHGIIIPKRRSVSLTAVVAKASTGAIEHVPVVRVNNLAQTVDELKERGVWIAGT--DAKGSVDYRKMDATL-PLAIIIGSEGKGMGRLLKEKCDFLYHLPMVGHVTSLNASVAAALLMY 239
>gi|167855195|ref|ZP_02477965.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus parasuis 29755] >gi|167853648|gb|EDS24892.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus parasuis 29755] (244 aa)
Score = 239, Expect = 1.2e-18, Identities = 60/202 (29%), Positives = 103/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E +   I++ +VN++  D      VHQ I+    ++     +D D  +++  N       +L+LD + DP N GA  RT+ +  V  +I  K+   Q+  T  K + G    +  ++V NL+  + +L++ N W V TA  E +  L + K     + +++G E  G+  L ++  D +V I M  SV SLNVSV+T + L+
  S:    40 LNELQRLGIRVQQVNRQALDNKAQGEVHQGIIAKIIQAKELNESDLDQILDRKAN-----PFLLILDGVTDPHNLGACLRTADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQERNIWIVGTA-GEATESLYQVKL-TGSIALVMGAEGDGMRRLTREHCDQLVSIPMAGSVSSLNVSVATGVCLF 236
>gi|154484294|ref|ZP_02026742.1| hypothetical protein EUBVEN_02007 [Eubacterium ventriosum ATCC 27560] >gi|149734771|gb|EDM50688.1| hypothetical protein EUBVEN_02007 [Eubacterium ventriosum ATCC 27560] (255 aa)
Score = 239, Expect = 1.4e-18, Identities = 76/227 (33%), Positives = 121/227 (53%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYF----DELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GKK  +E     +L  VY    F     EL + K   I  ++V KK  D   V  Q I+ + K+ S +I    D  IEK    N +K  I+VLD +QDPGN G I RT ++  ++GII  K++    N  VI++++G++  + F  V++L+  ++ LK     T    L  +         D     +++GNE +G+SE I   +D ++KI M   V+SLN +++TAI++Y
  S:    34 GKKMFVE-IPAEDLVSVYVSETFLKENGELVKEKKYQIVSDQVFKKISDT--VTPQGIVAVVKQKSYSI----DYIIEK---RNKEKSCIVVLDRLQDPGNMGTIVRTGEAAGISGIIMSKDSADIYNPKVIRSTMGSIFRVPFAIVDDLAAAVDTLKDNGITTYAAHLKGELYNSGSLTKDC---ALLIGNEARGLSEEISAKADKLIKIPMHGKVESLNAAIATAILMY 251
>gi|78044128|ref|YP_361140.1| RNA methyltransferase [Carboxydothermus hydrogenoformans Z-2901] >gi|77996243|gb|ABB15142.1| RNA methyltransferase, TrmH family, group 3 [Carboxydothermus hydrogenoformans Z-2901] (237 aa)
Score = 239, Expect = 1.4e-18, Identities = 71/231 (30%), Positives = 120/231 (51%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIK----LNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           M++ +G   V EA  +  ++++Y        +E K KNI+    L + NK    +   E +H    G+  + S   + + D  +  I     +   ILVL+ ++DP N GAI R++++F V G+I  K   +Q+   V K S G    +   +  N++E L  LK++  W V    D KS   S + TD    L +++G EN G++  I ++ DF V I M  ++ SLN SV+ A+++
  S:     1 MERIYGVNPVREALMKGIVNKLYLS------RETKDKNIRELLLLARENKVPVVEVPREKLHAKSQGVEADISPVKYVEIDDIL-AIAERKAEPLFILVLNHLEDPQNLGAILRSAEAFGVHGVIIPKRRAVQVTGAVAKASAGAYLKVPVARCTNVAETLRYLKEKGAWVV--GADAKS-KASLWDTDFKLPLALVIGGENVGLTSHILRECDFTVSIPMVGTINSLNASVAAALLM 228
>gi|149115218|ref|ZP_01841964.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica OS223] >gi|146865031|gb|EDK50390.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica OS223] (246 aa)
Score = 239, Expect = 1.4e-18, Identities = 58/177 (32%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    D D  +      NT++  +L+LD + DP N GA  R + +  V GII  K+N + +  TV K + G    +   +V NL+  +  L+ +  W V TA  E    L  ++ D+   L + +G E+KG+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    69 HQGIVARVKAAKVLNEQDLDVLLA-----NTEQPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTA-GEADCEL--YQADLKGSLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGICLF 238
>gi|170767082|ref|ZP_02901535.1| RNA methyltransferase, TrmH family, group 3 [Escherichia albertii TW07627] >gi|170124520|gb|EDS93451.1| RNA methyltransferase, TrmH family, group 3 [Escherichia albertii TW07627] (243 aa)
Score = 239, Expect = 1.4e-18, Identities = 60/199 (30%), Positives = 100/199 (50%)
  Q:    34 FKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S  + +   N+++ D+     VHQ I+   K        D    I  +     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA  E    L + K    +L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESHGVVIQLANRQYLDEKSDGGVHQGIIARVKPGRQYQENDLPDLIASL-----DQSFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATARKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTA-GEADHTLYQSKM-TGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|30018362|ref|NP_829993.1| 23S rRNA methyltransferase [Bacillus cereus ATCC 14579] >gi|167940337|ref|ZP_02527412.1| 23S rRNA methyltransferase [Bacillus cereus AH1134] >gi|168138633|ref|ZP_02581862.1| 23S rRNA methyltransferase [Bacillus cereus B4264] >gi|29893902|gb|AAP07194.1| 23S rRNA methyltransferase [Bacillus cereus ATCC 14579] (247 aa)
Score = 239, Expect = 1.4e-18, Identities = 61/198 (30%), Positives = 101/198 (51%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKL------VVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K   I L    KK  D  ++V  N  G+  + +   + + +   +     N D    L+LDEI+DP N G+I RT+ +    GII  K   + +  +V K S G + Y+   +V NLS  +++LK+   W   T         +K KTD   L       +++G+E KG+S +I +  DF++ + M   V SLN SV+ ++++Y
  S:    44 KENKIILQHAPKKKLD--QLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDP-FFLILDEIEDPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDELKERGLWIAGTD--------AKGKTDYRNLDGTMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKVTSLNASVAASLLMY 236
>gi|169830056|ref|YP_001700214.1| trmH family tRNA/rRNA methyltransferase yacO [Lysinibacillus sphaericus C3-41] >gi|168994544|gb|ACA42084.1| Putative trmH family tRNA/rRNA methyltransferase yacO [Lysinibacillus sphaericus C3-41] (250 aa)
Score = 238, Expect = 1.5e-18, Identities = 69/227 (30%), Positives = 123/227 (54%)
  Q:     6 GKKAVIEAFKQN-ELSEVYYV-----SYFDELKEF-KSKNIKLNKVNKKFFDKYEVV-HQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK  V+EA +   ++++V+       S  +EL +  + + + +  V KK  D+     HQ I+  +A      +   F +  +K      +    L+LDE++DP N G+I RT+ +    GII  K   + +   V K+S G + ++  ++VNNL++ +++LK+   W   T  D K S+   K    +  L +I+G+E KG+  L+K+  DF+  + M   V SLN SV+ A+++Y
  S:    11 GKNPVLEALRSGRDMNKVWIAEGVKKSGVNELLDLARERGVIVQFVPKKKVDQLSSANHQGIVASVAAYKYAELEDLFAAAAKK-----QEDPFFLILDELEDPHNLGSIMRTADAIGAHGIIIPKRRSVSLTAVVAKSSTGAIEHVPVVRVNNLAQTVDELKERGIWIAGT--DAKGSVDYRKMDATL-PLAIIIGSEGKGMGRLLKEKCDFLYHLPMVGHVTSLNASVAAALLMY 239
>gi|168474061|ref|ZP_02703084.1| hypothetical protein Salmoentericaenterica_05319 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (243 aa)
Score = 238, Expect = 1.6e-18, Identities = 58/199 (29%), Positives = 102/199 (51%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I        D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA + + ++  SK      ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIAL-----HDRPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMP---GRMALVMGAEGEGIRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|146305679|ref|YP_001186144.1| RNA methyltransferase [Pseudomonas mendocina ymp] >gi|145573880|gb|ABP83412.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas mendocina ymp] (250 aa)
Score = 238, Expect = 1.7e-18, Identities = 57/180 (31%), Positives = 94/180 (52%)
  Q:    53 EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           E VHQ ++     S +      D  +E+   +     ++LVLD + DP N GA  RT+ +     +I  K+    +N TV K + G    +  + V NL+  L KL+K+  W V TA + +      ++ D+    V+++G E KG+  L ++  D++VK+ M  SV SLNVSV+T + L+
  S:    65 EGVHQGVVAEVSPSQVWGENMLDELLERSEGV----PLLLVLDGVTDPHNLGACLRTADAAGAQAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQKKGLWVVGTAGEAEQ---ELYQLDMTGPTVLVMGAEGKGMRRLTREHCDYLVKLPMGGSVSSLNVSVATGVCLF 238
>gi|152999247|ref|YP_001364928.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella baltica OS185] >gi|160873860|ref|YP_001553176.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella baltica OS195] >gi|151363865|gb|ABS06865.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica OS185] >gi|160859382|gb|ABX47916.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica OS195] (246 aa)
Score = 238, Expect = 1.8e-18, Identities = 58/177 (32%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    D D  +      NT++  +L+LD + DP N GA  R + +  V GII  K+N + +  TV K + G    +   +V NL+  +  L+ +  W V TA  E    L  ++ D+   L + +G E+KG+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    69 HQGIVARVKAAKVLNEQDLDVLLA-----NTEQPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGICLF 238
>gi|15603818|ref|NP_246892.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pasteurella multocida subsp. multocida str. Pm70] >gi|52783323|sp|Q9CJP3|RLMB_PASMU 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|12722390|gb|AAK04037.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] (245 aa)
Score = 238, Expect = 1.8e-18, Identities = 69/222 (31%), Positives = 114/222 (51%)
  Q:    11 IEAFKQN---ELSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKL-KKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + AF  N    L EVY +   D+      L E     I +  VN++  DK     VHQ I+   + +      D D+ ++     N    ++LVLD + DP N GA  RT+ +  V  +I  K+   Q+     K + G    +  ++V NL+  L +L +K N W V TA +  +   + ++T +   L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    11 VSAFLNNAPERLIEVYALKGRDDKRLQPLLNELHRLGITIQFVNRQTLDKKAEGEVHQGIMARVQPAKELNEADLDTLLQ-----NQSNPLLLVLDGVTDPHNLGACLRTADAAGVCAVIVPKDKSAQLTAIARKVACGAAEVVPLIRVTNLARTLRELQQKHNIWVVGTAGEATN---TLYQTQLTGGLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|150015025|ref|YP_001307279.1| RNA methyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149901490|gb|ABR32323.1| RNA methyltransferase, TrmH family, group 3 [Clostridium beijerinckii NCIMB 8052] (300 aa)
Score = 238, Expect = 1.8e-18, Identities = 74/227 (32%), Positives = 119/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNI----KLNKVNKKFFDKYEV-------VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIEA +     E  Y+S  +   E   K I    K NK+  K  DK ++       VHQ ++        +  +D     EK      +   I++LDE++DP N G+I RT++ F V GII  K     ++ TV K+S+G + ++   KV NL+  + +LK++  W     +  +      ++ D      VI+GNE +G+S+L  +  D ++KI M   + SLN SV+  II+Y
  S:    63 GRNAVIEALRGERTIEALYIS--NSKLEGSIKTIVGLAKENKILIKEVDKRKLDSMCGGEVHQGVIAKVTPYKYSEVSDILDLAEK----RGEAPFIVILDEVEDPHNLGSIVRTAELFGVHGIILPKRRSASVSTTVYKSSVGAIEHVKIAKVTNLNSTIEELKEKGIWIYGADIRAEEY---SYQVDFGGPCAVIIGNEGRGISKLTVEKCDKLIKIPMVGKINSLNASVAGGIIMY 292
>gi|82546579|ref|YP_410526.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella boydii Sb227] >gi|81247990|gb|ABB68698.1| conserved hypothetical protein [Shigella boydii Sb227] (243 aa)
Score = 237, Expect = 2.0e-18, Identities = 59/199 (29%), Positives = 100/199 (50%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   N+++ D+     VHQ I+   K        D    I  +     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL   +  L++EN W V TA  E    L + K    +L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASL-----DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTA-GEADHTLYQSKM-TGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|187730319|ref|YP_001882871.1| RNA methyltransferase, TrmH family, group 3 [Shigella boydii CDC 3083-94] >gi|187427311|gb|ACD06585.1| RNA methyltransferase, TrmH family, group 3 [Shigella boydii CDC 3083-94] (243 aa)
Score = 237, Expect = 2.0e-18, Identities = 59/199 (29%), Positives = 100/199 (50%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   N+++ D+     VHQ I+   K        D    I  +     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL   +  L++EN W V TA  E    L + K    +L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASL-----DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTA-GEADHTLYQSKM-TGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|57239339|ref|YP_180475.1| putative RNA methyltransferase [Ehrlichia ruminantium str. Welgevonden] >gi|57161418|emb|CAH58342.1| putative tRNA/rRNA methyltransferase [Ehrlichia ruminantium str. Welgevonden] (249 aa)
Score = 237, Expect = 2.0e-18, Identities = 72/198 (36%), Positives = 107/198 (54%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKS-IPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K KNI   +VN    +     + N  GIA + S+    D  S  + ++N+ T+   I++LD++ D  N G+I R++  F V  +I    N    N  + KTS G ++ +  + V N+S  ++ LKK  YW  C   D K   PL K K D NK +VI G+ENKG+  L K++ DF++KI     + SLNVS + AI LY
  S:    49 KQKNIYPKQVNLNTINSVLPPNSNHQGIALQVSIV---DTVSIEDVLSNIPTEISTIILLDQVTDVYNVGSIIRSAVCFNVHAVILPYYNSPSENCGMSKTSSGAIDMIPIVYVVNISNAIHTLKKAGYW--CYGFDAKQGEPLHKIKLD-NKRLVIFGSENKGLRTLTKENCDFLLKIATSERIDSLNVSNAAAIALY 241
>gi|126175841|ref|YP_001051990.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica OS155] >gi|125999046|gb|ABN63121.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica OS155] (246 aa)
Score = 237, Expect = 2.0e-18, Identities = 58/177 (32%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    D D  +      NT++  +L+LD + DP N GA  R + +  V GII  K+N + +  TV K + G    +   +V NL+  +  L+ +  W V TA  E    L  ++ D+   L + +G E+KG+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    69 HQGIVARVKAAKVLNERDLDVLLA-----NTEQPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGICLF 238
>gi|170728541|ref|YP_001762567.1| RNA methyltransferase [Shewanella woodyi ATCC 51908] >gi|169813888|gb|ACA88472.1| RNA methyltransferase, TrmH family, group 3 [Shewanella woodyi ATCC 51908] (245 aa)
Score = 237, Expect = 2.0e-18, Identities = 58/177 (32%), Positives = 89/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +L   K        D  S +EK     T+    L+LD + DP N GA  R + +  V G+I  ++N + +  TV K + G    +   +V NL+  +  L+++  W V  A +  S     +KTD+   L + +G E+KG+  L ++  D I  I M  SV SLNVSV+T I L+
  S:    69 HQGVLARVKAVKQLNDNDLLSLVEK-----TETPFFLILDGVTDPHNLGACLRNADAAGVHGVIVPRDNSVGLTPTVSKVACGAAEVVPLFQVTNLARTMKSLQEKGVWIVGAAGEADS---DLYKTDLKGPLAIAMGAEDKGLRRLTRESCDSIASIPMAGSVSSLNVSVATGICLF 238
>gi|110835053|ref|YP_693912.1| RNA methyltransferase [Alcanivorax borkumensis SK2] >gi|110648164|emb|CAL17640.1| RNA methyltransferase, TrmH family, group 3 [Alcanivorax borkumensis SK2] (251 aa)
Score = 237, Expect = 2.0e-18, Identities = 48/145 (33%), Positives = 83/145 (57%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K ++LVL+ + DP N GA  R++ +  V  +I  + N   +     +T++G    L + ++ NL+ +L++L+    W V TAL+E+S  L  F+     L V++G E  G+  L +   D +++I M   VQSLNVSV+T ++L+
  S:    99 KPLLLVLENVTDPHNLGACLRSADAAGVQAVIVPRRNAAGLTPVACRTAVGAAESLAYYEIGNLASLLDQLRDRGVWVVGTALEERSESLFTFQAP-ESLAVVMGAEGSGLKRLTRDKCDQLLEIPMAGEVQSLNVSVATGVMLF 242
>gi|56418622|ref|YP_145940.1| tRNA/rRNA methyltransferase [Geobacillus kaustophilus HTA426] >gi|56378464|dbj|BAD74372.1| tRNA/rRNA methyltransferase [Geobacillus kaustophilus HTA426] (245 aa)
Score = 237, Expect = 2.1e-18, Identities = 63/232 (27%), Positives = 118/232 (50%)
  Q:     1 MKKFFGKKAVIEAFKQN-ELSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M    GK  VIEA K   ++++++             L+  K + + +  V K+  D+  E  HQ   G+  +++   + + D    +      +    L+LDE++DP N GAI RT+ +    G+I  K   + + +TV K S G + ++   +V NL+  +++LK+   W   T  D  +    +       L +++G+E KG+S L+ +  DF+ ++ M   V SLN SV+ ++++Y
  S:     1 MDYIIGKNPVIEALKAGRDINKIWIAEGAQRHTVEPVLEWAKRRGVLVQYVPKRKLDQMAEGAHQ---GVIAQAAAYRYYEIDDLFARAAE-RGEAPFFLILDELEDPHNLGAIMRTADAVGAHGLIIPKRRSVGLTQTVAKASTGAIEHVPVARVTNLARTIDELKERGVWVAGT--DASAQDDYRSLDGTMPLALVIGSEGKGISRLVLEKCDFLFRLPMRGHVTSLNASVAASLLMY 234
>gi|168219612|ref|ZP_02644844.1| hypothetical protein Senterenterica_04421 [Salmonella enterica subsp. enterica serovar Agona str. SL483] (243 aa)
Score = 237, Expect = 2.2e-18, Identities = 58/199 (29%), Positives = 102/199 (51%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I        D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA + + ++  SK      ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIAL-----HDRPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLREENIWIVGTAGEADHTLYQSKMP---GRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|58579305|ref|YP_197517.1| putative RNA methyltransferase [Ehrlichia ruminantium str. Welgevonden] >gi|58417931|emb|CAI27135.1| Hypothetical tRNA/rRNA methyltransferase [Ehrlichia ruminantium str. Welgevonden] (249 aa)
Score = 237, Expect = 2.2e-18, Identities = 72/198 (36%), Positives = 107/198 (54%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKS-IPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K KNI   +VN    +     + N  GIA + S+    D  S  + ++N+ T+   I++LD++ D  N G+I R++  F V  +I    N    N  + KTS G ++ +  + V N+S  ++ LKK  YW  C   D K   PL K K D NK +VI G+ENKG+  L K++ DF++KI     + SLNVS + AI LY
  S:    49 KQKNIYPKQVNLNTINSVLPPNSNHQGIALQVSIV---DTVSIEDVLSNIPTEISTIILLDQVTDVYNVGSIIRSAVCFNVHAVILPYYNSPSENCGMSKTSSGAIDMIPIVYVVNISNAIHTLKKAGYW--CYGFDAKQGEPLHKIKLD-NKRLVIFGSENKGLRTLTKENCDFLLKIATSERIDSLNVSNAAAIALY 241
>gi|125974550|ref|YP_001038460.1| RNA methyltransferase [Clostridium thermocellum ATCC 27405] >gi|196251913|ref|ZP_03150578.1| RNA methyltransferase, TrmH family, group 3 [Clostridium thermocellum DSM 4150] >gi|125714775|gb|ABN53267.1| RNA methyltransferase, TrmH family, group 3 [Clostridium thermocellum ATCC 27405] >gi|196198671|gb|EDX93503.1| RNA methyltransferase, TrmH family, group 3 [Clostridium thermocellum DSM 4150] (277 aa)
Score = 237, Expect = 2.2e-18, Identities = 60/198 (30%), Positives = 103/198 (52%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + I + + ++   DK    H +  G+    +   + + D  + KI     +   I++LD I D  N G+I RT+ +    G++  K   I +N  V K S G + Y+   +V N+S+ +  LKK+N W V T L  EK      F+ D+   + +++G+E +G+  L+ +  DFIV I M   + SLN +V+ AII+Y
  S:    76 RERGIVVQETDRSNLDKISTTHAH-QGVIAYVAFKDYVEVDDIL-KIAQDKGEDPYIIILDGITDAYNLGSILRTADAVGAHGVVIPKRRAIGLNAAVSKASAGAIEYVPVARVTNISQTIEYLKKKNIWIVGTDLSGEKPF----FEADLKGPVALVIGSEGEGMGRLVSEKCDFIVNIPMQGKISSLNAAVAAAIIMY 269
>gi|85858124|ref|YP_460326.1| 23S rRNA Gm2251 methyltransferase [Syntrophus aciditrophicus SB] >gi|85721215|gb|ABC76158.1| 23S rRNA Gm2251 methyltransferase [Syntrophus aciditrophicus SB] (249 aa)
Score = 237, Expect = 2.4e-18, Identities = 61/198 (30%), Positives = 102/198 (51%)
  Q:    35 KSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTV-CTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K + I +    + F D       HQ +LG+        + D D+ I    + +    ++L+LD I DP N GA+ R++  F   GII  +     +  TVIKTS G   ++   +V NL+  L++LK + +W     A  ++S+    ++  +    +++G E+KG+  LI+K  D ++ I M   + SLNVSVS  IIL+
  S:    43 KQRGIPVEIRERSFLDDLAGHASHQGVLGVCTAYR---YQDLDAVIAN-RHPSCPYDLVLILDGILDPHNLGALIRSAHCFGANGIILPERRAASVTGTVIKTSAGAARHIPIARVANLARALDELKTKGFWIFGADARADQSVSDPDYQGAVG---LVMGGESKGLRPLIRKKCDDLISIPMLGKIDSLNVSVSGGIILH 236
>gi|58617359|ref|YP_196558.1| putative RNA methyltransferase [Ehrlichia ruminantium str. Gardel] >gi|58416971|emb|CAI28084.1| Hypothetical tRNA/rRNA methyltransferase [Ehrlichia ruminantium str. Gardel] (249 aa)
Score = 237, Expect = 2.4e-18, Identities = 72/198 (36%), Positives = 107/198 (54%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKS-IPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K KNI   +VN    +     + N  GIA + S+    D  S  + ++N+ T+   I++LD++ D  N G+I R++  F V  +I    N    N  + KTS G ++ +  + V N+S  ++ LKK  YW  C   D K   PL K K D NK +VI G+ENKG+  L K++ DF++KI     + SLNVS + AI LY
  S:    49 KQKNIYPKQVNINTINSVLPPNSNHQGIALQVSIV---DTVSIEDVLSNIPTEISTIILLDQVTDVYNVGSIIRSAVCFNVHAVILPYYNSPSENCGMSKTSSGAIDMIPIVYVVNISNAIHTLKKAGYW--CYGFDAKQGEPLHKIKLD-NKRLVIFGSENKGLRTLTKENCDFLLKIATSERIDSLNVSNAAAIALY 241
>gi|85713280|ref|ZP_01044303.1| RRNA methylase, SpoU family protein [Idiomarina baltica OS145] >gi|85692898|gb|EAQ30873.1| RRNA methylase, SpoU family protein [Idiomarina baltica OS145] (248 aa)
Score = 237, Expect = 2.4e-18, Identities = 59/177 (33%), Positives = 90/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   K        DF + IEK         + LVLD + DP N GA  RT+ +     ++  K+   QI  TV K + G V+ +  + V NL+  L  L+  N W V TA + +KS+    FK     L +++G E KG+  L ++  D +  I +D SV SLNVSV++ + L+
  S:    69 HQGVVATIKALPPLNENDFSTLIEKAQG----APLFLVLDNVTDPHNLGACMRTADAAGATAVVVPKDKSAQITPTVRKVACGAVDNIPLVVVTNLARALRTLQDLNVWVVGTAGEADKSLYQIDFK---GPLALVMGAEGKGMRRLTRETCDELASIPLDGSVSSLNVSVASGVCLF 239
>gi|113971595|ref|YP_735388.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. MR-4] >gi|113886279|gb|ABI40331.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. MR-4] (246 aa)
Score = 237, Expect = 2.4e-18, Identities = 65/202 (32%), Positives = 102/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYEVV-HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++ KS    +   ++K  D K E   HQ I+   K + +    D D  + K     TD   +L+LD + DP N GA  R + +  V GII  K+N + +   V K + G    +   +V NL+  +  L+++  W V TA  E    L  ++ D+   L + +G E KG+  L ++  D +V I M  SV SLNVSV+T I L+
  S:    42 IRQAKSFGTSIQVTSRKVLDDKAESTQHQGIVARVKAAKILAEHDLDELLAK-----TDLPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMAGSVSSLNVSVATGICLF 238
>gi|124547924|ref|ZP_01706731.1| RNA methyltransferase, TrmH family, group 3 [Shewanella putrefaciens 200] >gi|124508900|gb|EAY52988.1| RNA methyltransferase, TrmH family, group 3 [Shewanella putrefaciens 200] (246 aa)
Score = 236, Expect = 2.7e-18, Identities = 57/177 (32%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    D D  +      NT++  +L+LD + DP N GA  R + +  V GII  K+N + +  TV K + G    +   +V NL+  +  L+ +  W V TA  E    L  ++ D+   L + +G E+KG+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    69 HQGIVARVKAAKVLNEQDLDVLLA-----NTEQPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGVCLF 238
>gi|120600217|ref|YP_964791.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. W3-18-1] >gi|146291855|ref|YP_001182279.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella putrefaciens CN-32] >gi|120560310|gb|ABM26237.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. W3-18-1] >gi|145563545|gb|ABP74480.1| RNA methyltransferase, TrmH family, group 3 [Shewanella putrefaciens CN-32] (246 aa)
Score = 236, Expect = 2.7e-18, Identities = 57/177 (32%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    D D  +      NT++  +L+LD + DP N GA  R + +  V GII  K+N + +  TV K + G    +   +V NL+  +  L+ +  W V TA  E    L  ++ D+   L + +G E+KG+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    69 HQGIVARVKAAKVLNEQDLDVLLA-----NTEQPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGVCLF 238
>gi|16767615|ref|NP_463230.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella typhimurium LT2] >gi|56416160|ref|YP_153235.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182815|ref|YP_219232.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161617640|ref|YP_001591605.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167546468|ref|ZP_02342032.1| hypothetical protein Sentent_24466 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167994986|ref|ZP_02576076.1| hypothetical protein Sententer_01000055_0100026294 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168226736|ref|ZP_02651967.1| hypothetical protein Sententeric_13253 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168231407|ref|ZP_02656465.1| hypothetical protein Sententerica_10527 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239664|ref|ZP_02664722.1| hypothetical protein Senteenterica_26034 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168245157|ref|ZP_02670089.1| hypothetical protein Senterienterica_26179 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168822505|ref|ZP_02834505.1| hypothetical protein Salentericaenterica_24177 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194444737|ref|YP_002043624.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449058|ref|YP_002048412.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469123|ref|ZP_03075107.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734163|ref|YP_002117310.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|52783321|sp|Q8ZKA2|RLMB_SALTY 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|16422930|gb|AAL23189.1| putative tRNA/rRNA methyltransferase [Salmonella typhimurium LT2] >gi|56130417|gb|AAV79923.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62130448|gb|AAX68151.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161367004|gb|ABX70772.1| hypothetical protein SPAB_05503 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403400|gb|ACF63622.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407362|gb|ACF67581.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455487|gb|EDX44326.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194709665|gb|ACF88886.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (243 aa)
Score = 236, Expect = 2.8e-18, Identities = 58/199 (29%), Positives = 102/199 (51%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I        D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA + + ++  SK      ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIAL-----HDRPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMP---GRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|16763188|ref|NP_458805.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144667|ref|NP_808009.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|52783319|sp|Q8Z182|RLMB_SALTI 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|25316741|pir||AI1049 probable tRNA/rRNA methyltransferase (EC 2.1.1.-) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505496|emb|CAD06846.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140306|gb|AAO71869.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (243 aa)
Score = 236, Expect = 2.8e-18, Identities = 58/199 (29%), Positives = 102/199 (51%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I        D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA + + ++  SK      ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIAL-----HDRPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMP---GRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|172056121|ref|YP_001812581.1| RNA methyltransferase [Exiguobacterium sibiricum 255-15] >gi|171988642|gb|ACB59564.1| RNA methyltransferase, TrmH family, group 3 [Exiguobacterium sibiricum 255-15] (254 aa)
Score = 236, Expect = 2.8e-18, Identities = 48/143 (33%), Positives = 84/143 (58%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT--DINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++++LDE++DP N G+I RT+ +    GII  K   + + + V K S G + ++  ++V NL+  +  LKK+  W V T   E       ++T      L +++G+E KG+S L+++  DF+V + M   V SLN SV+ +++LY
  S:   103 LMILLDELEDPHNLGSILRTADAVGAHGIIIPKRRSVGLTQVVAKASTGAIEHIPVVRVTNLTRTMEDLKKKGIWFVGTDARES----DDYRTLDGTMPLGIVIGSEGKGMSRLVREKCDFLVHLPMAGHVTSLNASVAASLLLY 243
>gi|114046193|ref|YP_736743.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. MR-7] >gi|113887635|gb|ABI41686.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. MR-7] (246 aa)
Score = 236, Expect = 2.9e-18, Identities = 65/202 (32%), Positives = 102/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYEVV-HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++ KS    +   ++K  D K E   HQ I+   K + +    D D  + K     TD   +L+LD + DP N GA  R + +  V GII  K+N + +   V K + G    +   +V NL+  +  L+++  W V TA  E    L  ++ D+   L + +G E KG+  L ++  D +V I M  SV SLNVSV+T I L+
  S:    42 IRQAKSFGTSIQVTSRKVLDDKAESSQHQGIVARVKAAKILAEHDLDELLAK-----TDLPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGVTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMAGSVSSLNVSVATGICLF 238
>gi|30260282|ref|NP_842659.1| RNA methyltransferase [Bacillus anthracis str. Ames] >gi|42779172|ref|NP_976419.1| RNA methyltransferase [Bacillus cereus ATCC 10987] >gi|47525346|ref|YP_016695.1| RNA methyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|47569826|ref|ZP_00240496.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus G9241] >gi|49183125|ref|YP_026377.1| RNA methyltransferase [Bacillus anthracis str. Sterne] >gi|49476710|ref|YP_034444.1| tRNA/rRNA methyltransferase SpoU [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145126|ref|YP_081703.1| TrmH family tRNA methyltransferase [Bacillus cereus E33L] >gi|65317552|ref|ZP_00390511.1| COG0566: rRNA methylases [Bacillus anthracis str. A2012] >gi|118475862|ref|YP_893013.1| tRNA/rRNA methyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|165873145|ref|ZP_02217761.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0488] >gi|166985490|ref|ZP_02256773.1| tRNA/rRNA methyltransferase [Bacillus cereus AH187] >gi|166996983|ref|ZP_02263442.1| tRNA/rRNA methyltransferase [Bacillus cereus AH820] >gi|167635112|ref|ZP_02393429.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0442] >gi|167641947|ref|ZP_02400182.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0193] >gi|170689565|ref|ZP_02880751.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0465] >gi|170707589|ref|ZP_02898042.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0389] >gi|177655588|ref|ZP_02936969.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0174] >gi|190568999|ref|ZP_03021900.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis Tsiankovskii-I] >gi|196036983|ref|ZP_03104350.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus W] >gi|30253603|gb|AAP24145.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. Ames] >gi|42735087|gb|AAS39027.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus ATCC 10987] >gi|47500494|gb|AAT29170.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. 'Ames Ancestor'] >gi|47553519|gb|EAL11900.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus G9241] >gi|49177052|gb|AAT52428.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. Sterne] >gi|49328266|gb|AAT58912.1| tRNA/rRNA methyltransferase (SpoU); probable TrmH family [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978595|gb|AAU20145.1| tRNA/rRNA SpoU-like methyltransferase; probable TrmH family [Bacillus cereus E33L] >gi|118415087|gb|ABK83506.1| tRNA/rRNA methyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|164711125|gb|EDR16686.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0488] >gi|167510078|gb|EDR85489.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0193] >gi|167529586|gb|EDR92336.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0442] >gi|170127585|gb|EDS96459.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0389] >gi|170666478|gb|EDT17255.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0465] >gi|172080052|gb|EDT65150.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis str. A0174] >gi|190559923|gb|EDV13907.1| RNA methyltransferase, TrmH family, group 3 [Bacillus anthracis Tsiankovskii-I] >gi|195990406|gb|EDX54407.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus W] (247 aa)
Score = 236, Expect = 2.9e-18, Identities = 61/198 (30%), Positives = 101/198 (51%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKL------VVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K   I L    KK  D  ++V  N  G+  + +   + + +   +     N D    L+LDEI+DP N G+I RT+ +    GII  K   + +  +V K S G + Y+   +V NLS  +++LK+   W   T         +K KTD   L       +++G+E KG+S +I +  DF++ + M   V SLN SV+ ++++Y
  S:    44 KENKIILQHAPKKKLD--QLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDP-FFLILDEIEDPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDELKERGLWIAGTD--------AKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKVTSLNASVAASLLMY 236
>gi|24375422|ref|NP_719465.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella oneidensis MR-1] >gi|52783315|sp|Q8EAG8|RLMB_SHEON 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|24350263|gb|AAN56909.1|AE015825_8 RNA methyltransferase, TrmH family, group 3 [Shewanella oneidensis MR-1] (246 aa)
Score = 236, Expect = 2.9e-18, Identities = 62/202 (30%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++ K+    +   ++K  D+      HQ I+   K + +    D D  + K     TD   +L+LD + DP N GA  R + +  V GII  K+N + +   V K + G    +   +V NL+  +  L+++  W V TA  E    L  ++ D+   L + +G E KG+  L ++  D +V I M  SV SLNVSV+T I L+
  S:    42 IRQAKAFGTSIQVTSRKVLDEKAESTQHQGIVARVKAAKILAEHDLDELLAK-----TDLPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMSGSVSSLNVSVATGICLF 238
>gi|160902072|ref|YP_001567653.1| RNA methyltransferase [Petrotoga mobilis SJ95] >gi|160359716|gb|ABX31330.1| RNA methyltransferase, TrmH family, group 3 [Petrotoga mobilis SJ95] (240 aa)
Score = 236, Expect = 3.3e-18, Identities = 58/146 (39%), Positives = 88/146 (60%)
  Q:    87 DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K  +++LD+IQDP NFGAI RTS +  V  II  K+N +++   VIK S G +  +  +KV NLS  +  LKKEN W     ++ K      ++    K+ ++ GNE  G+ + +K   D +V I M ++V+SLNVSVS+ IIL+
  S:    88 EKLFLVILDQIQDPHNFGAIVRTSVAAGVDAIIIPKDNAVEVTPVVIKVSSGQIFKIPIIKVTNLSNTIETLKKENVWVYGADVEGKPYYEIDWQ---GKICLVFGNEGNGIRKNVKNHCDELVSIPMFNNVESLNVSVSSGIILF 230
>gi|152973051|ref|YP_001338197.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957900|gb|ABR79930.1| Gm2251 methyltransferase of 23S rRNA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (243 aa)
Score = 235, Expect = 3.3e-18, Identities = 56/199 (28%), Positives = 99/199 (49%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   N++F D+     VHQ I+   K        D    + ++     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA +          T    + +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVVIQLANRQFLDEKSEGAVHQGIIARVKPGRQYQENDLPDLLAQL-----DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENVWIVGTAGEADHTLFQSKMT--GPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|114327047|ref|YP_744204.1| 23S rRNA Gm2251 methyltransferase [Granulibacter bethesdensis CGDNIH1] >gi|114315221|gb|ABI61281.1| 23S rRNA Gm2251 methyltransferase [Granulibacter bethesdensis CGDNIH1] (441 aa)
Score = 235, Expect = 3.4e-18, Identities = 51/145 (35%), Positives = 84/145 (57%)
  Q:    91 ILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           +LVLD++ DP N GAI R++ +FQ   +I +  N  + + T+ K + G ++ L  L+V N++  L  LK  + W V   LD +  PLS       ++ +++G E  G+  L ++  D IV + M   ++SLNVSV+TAI LY ++
  S:   296 VLVLDQVSDPRNVGAILRSAAAFQACCVIVQDRNAPEESGTMAKAASGALDRLPMLRVVNIARTLAALKAADLWVV--GLDAEGAPLSGPALGKRRVALVMGAEGDGLRRLTRESCDEIVSLAMAEGMESLNVSVATAIALYEIS 438
>gi|149183933|ref|ZP_01862318.1| tRNA/rRNA methyltransferase [Bacillus sp. SG-1] >gi|148848356|gb|EDL62621.1| tRNA/rRNA methyltransferase [Bacillus sp. SG-1] (247 aa)
Score = 235, Expect = 3.4e-18, Identities = 57/193 (29%), Positives = 100/193 (51%)
  Q:    40 KLNKVNKKFFDKYEV---VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  KV  +F  K ++   V  N  G+  + +   + + D    +      +    L+LDE++DP N G+I RT+ +  V GII  K   + +  TV K S G + ++   +V NL++ +++LK+   W   T  D K     +       + +++G+E KG+  LI+   DF++K+ M   V SLN SV+ +I++Y
  S:    44 KEKKVLVQFVPKQKIEGMVRDNHQGVVAQVAAYQYAEMDELYARAEQ-KGEIPFFLMLDELEDPHNLGSIMRTADASGVHGIIIPKRRAVGLTATVAKASTGAIEHIPVARVTNLAQTIDELKERGVWVAGT--DAKGADDYRRLDGTLPICLVIGSEGKGIGRLIRDKCDFLIKMPMVGHVTSLNASVAASILMY 236
>gi|157368686|ref|YP_001476675.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Serratia proteamaculans 568] >gi|157320450|gb|ABV39547.1| RNA methyltransferase, TrmH family, group 3 [Serratia proteamaculans 568] (243 aa)
Score = 235, Expect = 3.4e-18, Identities = 59/202 (29%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + E ++  I +   N+++ D K E  VHQ I+   +E       D  + +E +     D   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N T  K + G    +  ++V NL+  L  L++ N W V TA +          T    + +++G E +G+  L ++  D ++ I M  +V SLNVSV+T I L+
  S:    40 IAELEATGIVIQVANRQWLDEKVEGAVHQGIIARVREGRQYQENDLPALLESV-----DTPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEMNVWVVGTAGEADHTLFQSKMT--GPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGICLF 236
>gi|163749298|ref|ZP_02156547.1| RNA methyltransferase, TrmH family, group 3 [Shewanella benthica KT99] >gi|161331017|gb|EDQ01943.1| RNA methyltransferase, TrmH family, group 3 [Shewanella benthica KT99] (251 aa)
Score = 235, Expect = 3.5e-18, Identities = 53/177 (29%), Positives = 90/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   K        D    ++KI    T+   +L+LD + DP N GA  R + +  V G+I  ++N + +  TV K + G    +   +V NL+  +  L+ +  W V  A + +      +K D+   L + +G+E+KG+  L ++  D +V I M  SV SLNVSV+T + L+
  S:    69 HQGVIARVKAVKQLNDKDLAVLLDKIEVEKTETPFLLILDGVTDPHNLGACLRNADAAGVHGVIVPRDNSVGLTPTVSKVACGAAEVVPLFQVTNLARTMKSLQDKGIWIVGAAGEAEQ---DLYKADLKGSLAIAMGSEDKGLRRLTRESCDSLVSIPMTGSVSSLNVSVATGVCLF 243
>gi|50122542|ref|YP_051709.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pectobacterium atrosepticum SCRI1043] >gi|52783288|sp|Q6D127|RLMB_ERWCT 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|49613068|emb|CAG76519.1| probable tRNA/rRNA methyltransferase [Erwinia carotovora subsp. atroseptica SCRI1043] (244 aa)
Score = 235, Expect = 3.5e-18, Identities = 66/225 (29%), Positives = 117/225 (52%)
  Q:     8 KAVIEAFKQNELSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           KA++E   Q  L EV+ +   D+      + E +++ I +   ++++ DK   + VHQ I+   KE       D  + ++     N +   +L+LD + DP N GA  R +    V  +I  ++   Q+N TV K + G    +  + V NL+  +  L++ N W V TA + + ++  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    12 KALLERDPQRFL-EVFILKGRDDRRLQPVIAELEAQGIVIQVASRQWLDKQAEDAVHQGIVAKVKEGRKYQENDLPAMLD-----NLEMPFLLILDGVTDPHNLGACLRNADGAGVHAVIVPRDRSAQLNATVKKVACGAAETIPVISVTNLARTMRLLQERNIWIVGTAGEADHTLYQSKLT---GPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236
>gi|196047744|ref|ZP_03114943.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus 03BB108] >gi|196021422|gb|EDX60130.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cereus 03BB108] (247 aa)
Score = 235, Expect = 3.7e-18, Identities = 61/198 (30%), Positives = 100/198 (50%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKL------VVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K   I L    KK  D  ++V  N  G+  + +   + + +   +     N D    L+LDEI+DP N G+I RT+ +    GII  K   + +  +V K S G + Y+   +V NLS  +++LK    W   T         +K KTD   L       +++G+E KG+S +I +  DF++ + M   V SLN SV+ ++++Y
  S:    44 KENKIILQHAPKKKLD--QLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDP-FFLILDEIEDPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDELKGRGLWIAGTD--------AKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKVTSLNASVAASLLMY 236
>gi|167052408|ref|ZP_02278806.1| hypothetical protein LmonF_02636 [Listeria monocytogenes FSL F2-515] (159 aa)
Score = 235, Expect = 3.7e-18, Identities = 50/141 (35%), Positives = 85/141 (60%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LDE++DP N G+I RT+ S    GII  K   + + +TV K S G + Y+  ++V N+   + +L+K   W   T  D K    S ++T D++  L +++G+E  G+S L+++  DF+V + M   V SLN SV+ +++LY
  S:    10 IILDELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT--DAKGS--SDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLLLY 148
>gi|123966264|ref|YP_001011345.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9515] >gi|123200630|gb|ABM72238.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9515] (349 aa)
Score = 235, Expect = 3.8e-18, Identities = 71/210 (33%), Positives = 115/210 (54%)
  Q:    27 YFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           +F  LK+ KSK + + +V+     +     VHQ   G+A + + +     D  I  I    ++  I + LD I DP N GAI R++++F   GII  +     +  TV K + G + ++   +V NL+  +++LKK  +  V  + D + IP+SKF      +VV+VG ENKG+S L +K  D+++KI +     SLN SV+ AI L YL++
  S:   143 FFLLLKDLKSKGVLVEEVSWSRLSQLTSGAVHQ---GVALQLATSQTLSLDKLI-GITKSKSNNPIFVALDGITDPHNLGAIIRSAEAFDCKGIIIPQRRSAGLTGTVAKVAAGALEHIPVSRVVNLNRAIDELKKNGFLIVGLSGDGQ-IPISKFDQKA-PIVVVVGAENKGISLLTQKKCDYLLKIPLRGKTSSLNASVAAAISLCYLSN 348
>gi|53803949|ref|YP_114407.1| RNA methyltransferase [Methylococcus capsulatus str. Bath] >gi|53757710|gb|AAU92001.1| RNA methyltransferase, TrmH family, group 3 [Methylococcus capsulatus str. Bath] (250 aa)
Score = 235, Expect = 3.8e-18, Identities = 50/143 (34%), Positives = 83/143 (58%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + LVLD +QDP N GA  RT  +  V G++  K+  + +  TV K + G    +   +V NL+  L++ K+  YW V  A + +    + ++ D+   LVV++G E  G+  L ++  DF+++I M   V+SLN+SV+T I+LY
  S:    99 LYLVLDHVQDPHNLGACLRTCDAAGVKGLVVTKDQSVGLTPTVAKVASGAAETVPVYRVTNLARCLDRFKQRGYWVVGAAGEAER---TLYELDLRLPLVVVMGAEGVGLRRLTRERCDFLLRIPMVGGVESLNLSVATGIVLY 239
>gi|42526951|ref|NP_972049.1| RNA methyltransferase [Treponema denticola ATCC 35405] >gi|41817266|gb|AAS11960.1| RNA methyltransferase, TrmH family, group 3 [Treponema denticola ATCC 35405] (258 aa)
Score = 235, Expect = 4.2e-18, Identities = 67/229 (29%), Positives = 115/229 (50%)
  Q:     7 KKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVV-------HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           +K  +E F   E   V  +     L+  +  N+K+ K + +F D            H+ I+ + +  +       D F  K+    +    +++LD + DP N G+I R++  F + GII  +N      E + K S G + ++ F++V NL   + +LKKE +W        K++P   F     K V+I+GNE +G+S L+++  D IV I     + SLNVSV+  I+LY ++
  S:    28 RKPSLEIFYSKEGPRVKKI-----LEAARKLNLKIEKKDNQFLDSLTKTLPEQLRDHRGIVLVTEAENQKKGMSVDEFFAKLAEKGS--AFVVILDSVTDPHNTGSIIRSADQFGIDGIIVPENKSAGGFEIISKVSAGALAWVPFVEVTNLVRTVERLKKEGFWIYGADAGGKALPNLTFP---KKTVLIMGNEGRGMSRLVEETCDEIVSIPTKGKLDSLNVSVAAGILLYEIS 253
>gi|183600321|ref|ZP_02961814.1| hypothetical protein PROSTU_03883 [Providencia stuartii ATCC 25827] >gi|188020111|gb|EDU58151.1| hypothetical protein PROSTU_03883 [Providencia stuartii ATCC 25827] (249 aa)
Score = 235, Expect = 4.2e-18, Identities = 62/202 (30%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + E +S  I +   N+++ D      VHQ I+            D   F+E     +TD   +LVLD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +   +V NL+  L  LK+ N W V TA + + ++  SK       + +++G E +G+  L ++  D ++ I M  +V SLNVSV+T I L+
  S:    40 IHEIESLGIVVQVANRQWMDAQTEGAVHQGIIAKVLPGKQYQEGDLPDFLE-----STDTPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPKDKSAQLNATAKKVACGAAESVPLFRVTNLARTLRLLKEYNVWIVGTAGEADHTLYQSKLT---GPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGICLF 236
>gi|42520767|ref|NP_966682.1| RNA methyltransferase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410507|gb|AAS14616.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont of Drosophila melanogaster] (254 aa)
Score = 234, Expect = 4.4e-18, Identities = 69/229 (30%), Positives = 122/229 (53%)
  Q:     4 FFGKKAVIEAFKQNE-------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +GK   + A K          ++E +Y  +  E+K++  SK IK+  V  K  +       N  GIA  ++  +   ++  IE++   + D   I++LD++ D  N G+I RTS  F V  ++   N+    N ++ K + G ++ +  + V N+ + +  LKK  YW  C   D      + + K+   K V+I G+E KG+  L+K++ D+++KI M +++ SLNVS + AI LY
  S:    12 LYGKHTCMSALKNKNRRCIELLVTENFYREHEKEIKQYANSKGIKVRLVENKILNDVLPKGANHQGIALNAAPIL---YNLSIEEVAESSNDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPHNHSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYW--CYGFDCNAKENIDEIKSFEKKRVIIFGSEEKGMRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 244
>gi|162447016|ref|YP_001620148.1| RNA methyltransferase [Acholeplasma laidlawii PG-8A] >gi|161985123|gb|ABX80772.1| RNA methyltransferase, TrmH family [Acholeplasma laidlawii PG-8A] (230 aa)
Score = 234, Expect = 4.4e-18, Identities = 59/147 (40%), Positives = 91/147 (61%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           T ++  L+LDE+QDP N GAI R+ ++    G+I  K +Q+ +   V KTS G + ++  + V+NL + + KL+KE++  V TA  E +    +   + N L++I+GNE  G+  LIKK  D +V I M   V SLNVSV+TA++LY
  S:    83 TRRQRFLMLDEVQDPHNLGAILRSVEATNYDGVIISKKHQVPLTGVVAKTSSGAIEHVKLILVSNLYQTILKLQKEDFLVVGTA-GEATASYKEIPKNQN-LLIIMGNEGFGLRPLIKKGCDLLVSIPMLGKVNSLNVSVATALLLY 227
>gi|71893988|ref|YP_279434.1| putative tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae J] >gi|71852115|gb|AAZ44723.1| putative tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae J] (233 aa)
Score = 234, Expect = 4.4e-18, Identities = 77/234 (32%), Positives = 126/234 (53%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           +K   G+ ++ +A K   + +  Y+      + F  + +K+  V++ F DK   + HQ  +G+ +        +F  F  +I+ L  DK KIIL+LD IQD  N G I RT+  F +  II  K    ++NET +K S G    L F+ VN++   +NKLK+ ++W   T L EKS  + + + +     +I+GNE  G+ +     SD    I ++ +V SLNV+V+T IIL++L
  S:     2 VKYICGRNSLADAIKNGFIFKEIYLLKPTNDQIFLKQKVKI--VSRDFLDKLVRLNHQGFVGVLE--------NFKFF--EIDTLVKDKPKIILILDHIQDQNNLGNIIRTANCFGIKHIILPKRRAAKLNETTMKVSSGGFVGLKFILVNSIVSAINKLKEMDFWIYATDLKEKSRKIQEIQFNY-PCAIILGNEGTGIKKSSLNASDQTFFIPLEGTVNSLNVTVATGIILFFL 224
>gi|163938099|ref|YP_001642983.1| RNA methyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163860296|gb|ABY41355.1| RNA methyltransferase, TrmH family, group 3 [Bacillus weihenstephanensis KBAB4] (247 aa)
Score = 234, Expect = 4.6e-18, Identities = 59/198 (29%), Positives = 101/198 (51%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKL------VVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K   + L    KK  D  ++V  N  G+  + +   + + +   +     N D    L+LDEI+DP N G+I RT+ +    G+I  K   + +  +V K S G + Y+   +V NLS  +++LK+   W   T         +K KTD   L       +++G+E KG+S +I +  DF++ + M   V SLN SV+ ++++Y
  S:    44 KENKVILQHAPKKKLD--QLVEGNHQGVIAQVAAYQYAELEDLFKLAEKRNEDP-FFLILDEIEDPHNLGSIMRTADATGAHGVIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDELKERGLWIAGTD--------AKGKTDYRNLDGNMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKVTSLNASVAASLLMY 236
>gi|39938738|ref|NP_950504.1| cation transport ATPase [Onion yellows phytoplasma OY-M] >gi|39721847|dbj|BAD04337.1| cation transport ATPase [Onion yellows phytoplasma OY-M] (1056 aa)
Score = 234, Expect = 4.7e-18, Identities = 75/228 (32%), Positives = 117/228 (51%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKE------FKSKNIKLNKVNKKFFDKYEVVHQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK  + EA K     ++Y +   +++K+       +  NI    V+KKF   Y++  Q    G+A         D D++++     +   +  L+LD I DP N GAI RT ++  + G+I  K +Q+ +N TV K S G + Y     V NL + + KLKK     V T  D  S          + L +IVGNE  G+  L+K+  D +VKI M   + SLNVSV+ A+++Y
  S:   825 YGKNPIKEAIKAQR--KIYQLYLDEKIKDHLFIMFLQKHNIAYQLVDKKFL--YDLTKQKTHQGVAANVCDYTFYDLDTYLD-----SAKFQKFLILDAINDPHNLGAILRTVEACALDGVIMSKKHQVPLNSTVAKISCGALEYTKVFLVTNLHQTILKLKKNQVLIVGT--DSNSSQSFHQIPKNSSLAIIVGNEGIGIRHLLKQQCDLLVKIPMYGKINSLNVSVAAALMIY 1048
>gi|146296390|ref|YP_001180161.1| RNA methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409966|gb|ABP66970.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor saccharolyticus DSM 8903] (253 aa)
Score = 234, Expect = 4.9e-18, Identities = 76/232 (32%), Positives = 120/232 (51%)
  Q:     1 MKKFFGKKAVIEAFKQN-ELSEVYYV------SYFDELKEFKSKNIKLNKVNKKFFDKYEVVH--QNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M+   GK  V EA   + +++EVY        S  + +   K K I +  V+K   DK       Q ++ IA+E     + D D  + +  N   +K  +++LDEI DP NFG+I R++      GII +  N   I  TV K S G + ++   +V NL   ++ LK++  W      + EK +    FK  I    +I+G+E KG+S L+K+ +DF+VKI     + S N SV+  II +
  S:     1 MRTIEGKNPVKEALNSSTQITEVYISNTTKDKSISEIINLCKQKGIVVKFVDKSKIDKMSKTKNPQGVIAIAQEYK---YWDIDDLLLEAAN-KGEKPFLVLLDEITDPHNFGSIIRSAHLCGAHGIITEARNSCPITPTVEKASAGAIEHIKVARVVNLRRTIDSLKEKGVWVYAADNNAEKFVYDCDFKIPI---CIIIGSEGKGISRLVKEGADFLVKIPQKGKINSYNASVAAGIIFF 235
>gi|169335511|ref|ZP_02862704.1| hypothetical protein ANASTE_01925 [Anaerofustis stercorihominis DSM 17244] >gi|169258249|gb|EDS72215.1| hypothetical protein ANASTE_01925 [Anaerofustis stercorihominis DSM 17244] (242 aa)
Score = 234, Expect = 4.9e-18, Identities = 73/231 (31%), Positives = 114/231 (49%)
  Q:     2 KKFFGKKAVIEAFKQNELSEVYYVSYFDE------LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K  G+ AV E  K        Y+S   +      +K  KSK I + K N    D       HQ +L +    S          IEK+N   T K ++++LD I DP N GAI R++      G+I +      I E + K+S G + +++  +V+N+++ ++ LKKE  + V   LD           D+  L ++VG E KG+  LIK+  DFI  I + +   SLN SV+  I+L+
  S:     5 EKVIGRNAVRETLKAGRNVNKLYISENHDSGLVSIIKMAKSKGISIQKTNNHKLDSMSGSTHHQGVLALC---SPVETISLRELIEKMNEKVT-KPLVVILDNITDPHNAGAIIRSAYCAGADGVIMQTRRSASIGEGMYKSSAGAIEHIDLCEVSNIAQTIDTLKKEGLFVV--GLDMNGENYYDMDYDM-PLALVVGAEGKGLGRLIKEKCDFISSIPLKNDFDSLNASVAAGIVLF 236
>gi|47094582|ref|ZP_00232234.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes str. 4b H7858] >gi|153165271|ref|ZP_01926222.1| hypothetical protein LMHG_01120 [Listeria monocytogenes FSL N1-017] >gi|47017042|gb|EAL07923.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes str. 4b H7858] >gi|133728304|gb|EBA30002.1| hypothetical protein LMHG_01120 [Listeria monocytogenes FSL N1-017] (251 aa)
Score = 234, Expect = 5.0e-18, Identities = 50/141 (35%), Positives = 85/141 (60%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LDE++DP N G+I RT+ S    GII  K   + + +TV K S G + Y+  ++V N+   + +L+K   W   T  D K    S ++T D++  L +++G+E  G+S L+++  DF+V + M   V SLN SV+ +++LY
  S:   102 IILDELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT--DAKGS--SDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLLLY 240
>gi|54020641|ref|YP_116168.1| hypothetical protein mhp660 [Mycoplasma hyopneumoniae 232] >gi|53987814|gb|AAV28015.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (233 aa)
Score = 234, Expect = 5.2e-18, Identities = 77/234 (32%), Positives = 126/234 (53%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           +K   G+ ++ +A K   + +  Y+      + F  + +K+  V++ F DK   + HQ  +G+ +        +F  F  +I+ L  DK KIIL+LD IQD  N G I RT+  F +  II  K    ++NET +K S G    L F+ VN++   +NKLK+ ++W   T L EKS  + + + +     +I+GNE  G+ +     SD    I ++ +V SLNV+V+T IIL++L
  S:     2 VKYICGRNSLADAIKNGFIFKEIYLLRPTNDQIFLKQKVKI--VSRDFLDKLVSLNHQGFVGVLE--------NFKFF--EIDTLVKDKPKIILILDHIQDQNNLGNIIRTANCFGIKHIILPKKRAAKLNETTMKVSSGGFVGLKFILVNSIVSAINKLKEMDFWIYATDLKEKSRKIQEIQFNY-PCAIILGNEGTGIKKSSLNASDQTFFIPLEGTVNSLNVTVATGIILFFL 224
>gi|160899466|ref|YP_001565048.1| RNA methyltransferase [Delftia acidovorans SPH-1] >gi|160365050|gb|ABX36663.1| RNA methyltransferase, TrmH family, group 3 [Delftia acidovorans SPH-1] (263 aa)
Score = 234, Expect = 5.4e-18, Identities = 70/231 (30%), Positives = 122/231 (52%)
  Q:     2 KKFFGKKAVIEAFKQNELS--EVYYVSYFDE--LKEF----KSKNIKLNKVNKKFFDKYEVVHQNILGIAK--ESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K  FG  AV    K    S  EVYY +   +  +++F    KS  ++L + + +   K    H +  G+A   E+   +H+  D  +E++      K ++LVLD + DP N GA  R +       +I  K++ + +N TV K + G    + +  V NL+  LN+LK+ + W + T+ D    P + ++ D+     +++G E  G+ +L +K  D ++ I M  +V SLNVSV++ + LY
  S:     5 KVLFGFHAVGVRMKTAPQSIIEVYYEATRRDARMRQFLDRAKSAGVRLIEADGERLAKLAGSHGH-QGVAARVEAVAQVHS-LDELLEQLEADGISKPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGVNATVAKVASGAAETVPYFMVTNLARTLNELKERDIWIIGTSDDA---PKTLYEVDLTGPTALVLGAEGDGMRQLTRKTCDELIGIPMMGAVSSLNVSVASGVCLY 241
>gi|121594611|ref|YP_986507.1| RNA methyltransferase [Acidovorax sp. JS42] >gi|120606691|gb|ABM42431.1| RNA methyltransferase, TrmH family, group 3 [Acidovorax sp. JS42] (248 aa)
Score = 233, Expect = 5.7e-18, Identities = 52/159 (32%), Positives = 86/159 (54%)
  Q:    74 FDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            D  ++++        ++LVLD + DP N GA  R +       +I  K++ + IN TV K + G    + +  V NL+  LN+LK+ N W + T+ D      + ++ D+   V +V G E  G+ +L +K  D +V I M  +V+SLNVSV++A+ LY
  S:    85 LDELLDELEARGVKNPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGINATVAKVASGAAETVPYFMVTNLARTLNELKERNIWVIGTSGDADK---TLYQVDLKGPVALVLGAEGPGMRQLTRKTCDELVGIPMQGAVESLNVSVASAVCLY 241
>gi|58584746|ref|YP_198319.1| rRNA methylase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419062|gb|AAW71077.1| rRNA methylases [Wolbachia endosymbiont strain TRS of Brugia malayi] (258 aa)
Score = 233, Expect = 5.8e-18, Identities = 71/229 (31%), Positives = 123/229 (53%)
  Q:     4 FFGKKAVIEAFKQNE-------LSEVYYVSYFDELKE-FKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIP-LSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +GK   + A K          ++E  Y  Y  E+++   SK IK+  V  K   +      N  GIA + +  +H+     I++I   ++D   I++LD++ D  N G+I RTS  F V  ++   N+    N ++ K + GT++ +  + V N+ + +  LKK  YW  C   D  +   + + K+   K+V+I G+E KG+  L+K++ D+++KI M + + SLNVS + AI LY
  S:    12 LYGKHTCMLALKNKNRLCIELLVTENSYREYEKEIRQCVDSKGIKVQLVKNKILSEVLSKSANHQGIALKVAPILHS---LSIKEIAESSSDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPYNHSPSENASIAKAASGTLDIVPLIHVTNVVKTMEYLKKVGYW--CYGFDSNAKENIDEIKSFGKKIVIIFGSEGKGMRRLVKENCDYLLKIPMSNVIDSLNVSNAAAIGLY 244
>gi|67157138|ref|ZP_00418500.1| RNA methyltransferase TrmH, group 3 [Azotobacter vinelandii AvOP] >gi|67085815|gb|EAM05287.1| RNA methyltransferase TrmH, group 3 [Azotobacter vinelandii AvOP] (247 aa)
Score = 233, Expect = 5.8e-18, Identities = 58/198 (29%), Positives = 100/198 (50%)
  Q:    35 KSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +   I + +  ++  D++ E VHQ ++     S +      D  +++         ++LVLD + DP N GA  RT+ +     +I  K+    +N TV K + G    +  + V NL+  L KL++   WTV TA     +    +  D+    V+I+G E KG+  L ++  D++V++ M  SV SLNVSV+T + L+
  S:    46 RQARIAVGQRERRELDEWAEGVHQGVVAEVSPSQVWGEAMLDELLDRCEG----PPLLLVLDGVTDPHNLGACLRTADAAGAQAVIVPKDKSATLNATVRKVACGAAEVVPLVAVTNLARTLEKLRQRGLWTVGTA---GEVEQELYGVDLRGPTVLIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238
>gi|138893766|ref|YP_001124219.1| 23S rRNA methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196251123|ref|ZP_03149802.1| RNA methyltransferase, TrmH family, group 3 [Geobacillus sp. G11MC16] >gi|134265279|gb|ABO65474.1| 23S rRNA methyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|196209364|gb|EDY04144.1| RNA methyltransferase, TrmH family, group 3 [Geobacillus sp. G11MC16] (246 aa)
Score = 233, Expect = 6.0e-18, Identities = 67/232 (28%), Positives = 118/232 (50%)
  Q:     1 MKKFFGKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           M+   G+  VIEA K         ++E  +    + + ++ K + + +  V K+  D+  E  HQ +  IA+ ++   +   D F         +    LVLDE++DP N GAI RT+ +    G+I  K   + +  TV K S G + ++   +V NL+  +++LK+   W   T    K    S   T    L +++G+E KG+S L+ +  DF+ ++ M   V SLN SV+ ++++Y
  S:     2 MEYIIGRNPVIEALKSGRDINKIWIAEGAHRHAVEPVLDWAKRRGVIVQYVPKRKLDQMAEGAHQGV--IAQVAAYRYYEVDDLFARAAER--GEAPFFLVLDELEDPHNLGAIMRTADAVGAHGVIIPKRRSVGLTPTVAKASTGAIEHIPVARVTNLARTIDELKERGVWVAGTDAAAKDDYRSLDGT--MPLALVIGSEGKGISRLVLEKCDFLFRLPMRGHVTSLNASVAASLLMY 235
>gi|88774150|gb|EAR05408.1| Gm2251 methyltransferase of 23S rRNA [Alteromonas macleodii 'Deep ecotype'] (246 aa)
Score = 233, Expect = 6.0e-18, Identities = 56/177 (31%), Positives = 91/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++  AK + +    D D  +E     +  + +ILVLD + DP N GA  RT+    V  ++  K+    +N TV K + G    +  +++ NL+  L  L+ +  W V TA +      + +  D+     +++G E KG+  L K+  D +VK+ M  SV SLNVSV+T + LY
  S:    69 HQGVVARAKPARVLDEADLDKILE-----SEAQPLILVLDGVTDPHNLGACLRTADGAGVHAVVVPKDKSASLNGTVRKVACGAAEVVPLIQITNLARTLKHLQDKGLWIVGTAGETDK---TLYDVDLKGSTALVMGAEGKGMRRLTKETCDELVKLPMAGSVTSLNVSVATGVCLY 238
>gi|57866117|ref|YP_187768.1| RNA methyltransferase [Staphylococcus epidermidis RP62A] >gi|81675394|sp|Q5HRM1|TRMHL_STAEQ Putative trmH family tRNA/rRNA methyltransferase >gi|90110722|sp|Q8CTT9|TRMHL_STAES Putative trmH family tRNA/rRNA methyltransferase >gi|57636775|gb|AAW53563.1| RNA methyltransferase, TrmH family, group 3 [Staphylococcus epidermidis RP62A] (249 aa)
Score = 233, Expect = 6.0e-18, Identities = 60/204 (29%), Positives = 109/204 (53%)
  Q:    29 DELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           D LK  KS+ + +  V K   D      HQ   G+A   +   + +FD F++K          +++LD ++DP N G+I RT+ +  V  +I  K   + + +TV K S G + ++  ++V NLS+ +++LK   +W   T  +  +      + D++ L +++G+E +G+S L+    DF +KI M   V SLN SV+ ++++Y
  S:    38 DILKNAKSQKLIVQTVPKSKLDFLANAPHQ---GVAALVAPYEYANFDEFLQK-QKKKARYSTVIILDGLEDPHNLGSILRTADASGVDAVIIPKRRSVALTQTVAKASTGAIQHVPVIRVTNLSKTIDELKDNGFWIAGTEANNAT-DYRDLQADMS-LGIVIGSEGQGMSRLVSDKCDFHIKIPMVGHVNSLNASVAASLMMY 236
>gi|16799350|ref|NP_469618.1| hypothetical protein lin0273 [Listeria innocua Clip11262] >gi|16802287|ref|NP_463772.1| hypothetical protein lmo0241 [Listeria monocytogenes EGD-e] >gi|47097641|ref|ZP_00235161.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes str. 1/2a F6854] >gi|153172928|ref|ZP_01928863.1| hypothetical protein LMIG_01785 [Listeria monocytogenes FSL N3-165] >gi|153177968|ref|ZP_01931660.1| hypothetical protein LMMG_02795 [Listeria monocytogenes F6900] >gi|153186389|ref|ZP_01936707.1| hypothetical protein LMOG_02668 [Listeria monocytogenes J0161] >gi|153189496|ref|ZP_01937080.1| hypothetical protein LMPG_01664 [Listeria monocytogenes J2818] >gi|153198265|ref|ZP_01942370.1| hypothetical protein LMRG_02665 [Listeria monocytogenes 10403S] >gi|153200701|ref|ZP_01942782.1| hypothetical protein LMSG_01504 [Listeria monocytogenes HPB2262] >gi|167342587|ref|ZP_02288517.1| hypothetical protein LmonocyFSL_01883 [Listeria monocytogenes FSL J1-208] >gi|167452946|ref|ZP_02319169.1| hypothetical protein LmonocytoFSL_01486 [Listeria monocytogenes FSL J2-064] >gi|168264878|ref|ZP_02686843.1| hypothetical protein LmonFSL_00442 [Listeria monocytogenes FSL J2-071] >gi|16409606|emb|CAD00768.1| lmo0241 [Listeria monocytogenes] >gi|16412702|emb|CAC95506.1| lin0273 [Listeria innocua] >gi|47013985|gb|EAL04998.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes str. 1/2a F6854] >gi|126941157|gb|EBA19050.1| hypothetical protein LMOG_02668 [Listeria monocytogenes J0161] >gi|127632096|gb|EBA21809.1| hypothetical protein LMRG_02665 [Listeria monocytogenes 10403S] >gi|127766671|gb|EBA27001.1| hypothetical protein LMPG_01664 [Listeria monocytogenes J2818] >gi|133731235|gb|EBA32933.1| hypothetical protein LMIG_01785 [Listeria monocytogenes FSL N3-165] >gi|133733873|gb|EBA35571.1| hypothetical protein LMMG_02795 [Listeria monocytogenes F6900] >gi|133736443|gb|EBA38141.1| hypothetical protein LMSG_01504 [Listeria monocytogenes HPB2262] (251 aa)
Score = 233, Expect = 6.2e-18, Identities = 50/141 (35%), Positives = 85/141 (60%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LDE++DP N G+I RT+ S    GII  K   + + +TV K S G + Y+  ++V N+   + +L+K   W   T  D K    S ++T D++  L +++G+E  G+S L+++  DF+V + M   V SLN SV+ +++LY
  S:   102 IILDELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT--DAKGS--SDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLLLY 240
>gi|171854033|emb|CAM12006.1| tRNA/rRNA methyltransferase [Candidatus Phytoplasma australiense] (233 aa)
Score = 233, Expect = 6.6e-18, Identities = 75/228 (32%), Positives = 121/228 (53%)
  Q:     5 FGKKAVIEAFK-QNELSEVYYVSYFDE---LKEFKSKNIKLNKVNKK-FFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK  + EA K + ++ ++Y  + F +   +   K  N     V+KK  FD   V  +N  G+  +       D DSF+         K+  L+LD I DP N GAI RT ++    G+I  K +Q+ +N TV K + G + Y+    V+NL + + KL+K+    + T  +     L+K   +   L +IVGNE  G+  L+K+  D +VKI M   + SLNVSV++A+++Y
  S:     4 YGKNTIKEAIKAKRKIYQLYLDANFKDNSFISFLKLSNQPYQLVDKKKLFDL--VKQKNHQGVVAQVESYQFYDLDSFLS-----FEKKQRFLILDAIHDPHNLGAILRTVEACGFDGVIMSKKHQVPLNATVSKIACGALEYVKVFLVSNLHQTILKLQKQQVLIIGTDSNATQT-LTKIPCN-QSLAIIVGNEGDGIRYLLKQKCDLLVKIPMKGKINSLNVSVASALMMY 227
>gi|170017894|ref|YP_001728813.1| rRNA methylase [Leuconostoc citreum KM20] >gi|169804751|gb|ACA83369.1| rRNA methylase [Leuconostoc citreum KM20] (253 aa)
Score = 233, Expect = 7.0e-18, Identities = 58/177 (32%), Positives = 91/177 (51%)
  Q:    56 HQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ + L +A  +  T+   FD       + + +    L+LD I+DP N G+I RT+ +  V GII  K   +Q+  TV K S G + ++   +V NL  V+ +LK    W   T +          K       +++GNE KG+S L+KK  D ++ I M   VQSLN SV+ ++++Y
  S:    75 HQGVVLSVAAFAYATVDDLFD-----FADAHHEAPFFLILDGIEDPHNLGSILRTADAAGVHGIIIPKRRAVQLTATVAKISTGAIEHVPVARVTNLVNVVGELKDRGVWVFGTDMSGDDYRRWDAK---GPTALVIGNEGKGISPLLKKKVDSMLTIPMVGHVQSLNASVAASLLIY 244
>gi|90020702|ref|YP_526529.1| tyrosyl-tRNA synthetase, class Ib [Saccharophagus degradans 2-40] >gi|89950302|gb|ABD80317.1| RNA methyltransferase TrmH, group 3 [Saccharophagus degradans 2-40] (248 aa)
Score = 233, Expect = 7.0e-18, Identities = 64/202 (31%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L   ++  IK+   +KK  D       HQ +L  AKE       D    IE I        +I+VLD + DP N GA  R++ +     +I  K+N + + E   K + G  + +  + V NL+  L K++++  W   T  D +KSI    +  D+    V+++G E  G+  L  +  D +VKI M  SV SLNVSV+T ++L+
  S:    42 LSAAQAAGIKVLPQDKKSMDSVSADGNHQGVLAYAKEGQSYTENDLYPLIEAIEG----DPLIVVLDGVTDPHNLGACLRSADAAGAHALIVPKDNSVGLTEVARKVACGAADNVPLIVVTNLARCLKKMQEQGLWVAGTTGDTDKSI----YDVDLTGPRVIVMGAEGTGMRRLTTETCDDLVKIPMLGSVTSLNVSVATGVVLF 239
>gi|109897320|ref|YP_660575.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pseudoalteromonas atlantica T6c] >gi|109699601|gb|ABG39521.1| RNA methyltransferase, TrmH family, group 3 [Pseudoalteromonas atlantica T6c] (246 aa)
Score = 233, Expect = 7.0e-18, Identities = 57/177 (32%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++  AK        D D  I+K     +    +L+LD + DP N GA  RT+ +  +  I+  K+N + +   V K + G  + +  ++V NL+  L ++K    W V TA +  +SI   K +  I    +++G E KG+  L ++  D ++K+ M  SV SLNVSV+T I LY
  S:    69 HQGVVAKAKPGKQFNENDLDEIIKK-----SATPFLLILDGVTDPHNLGACLRTADAAGIDAIVVPKDNSVALTPVVRKVACGAADLIPLIQVTNLARTLREIKDAGVWVVGTAGEATQSIYDCKMQGPI---ALVMGAEGKGMRRLTREHCDELIKLPMAGSVSSLNVSVATGICLY 238
>gi|116871624|ref|YP_848405.1| RNA methyltransferase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740502|emb|CAK19622.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (251 aa)
Score = 233, Expect = 7.1e-18, Identities = 50/141 (35%), Positives = 85/141 (60%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LDE++DP N G+I RT+ S    GII  K   + + +TV K S G + Y+  ++V N+   + +L+K   W   T  D K    S ++T D++  L +++G+E  G+S L+++  DF+V + M   V SLN SV+ +++LY
  S:   102 IILDELEDPHNLGSIMRTADSVGAHGIIIPKRRAVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT--DAKGS--SDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLLLY 240
>gi|148284217|ref|YP_001248307.1| tRNA/rRNA methyltransferase [Orientia tsutsugamushi str. Boryong] >gi|146739656|emb|CAM79445.1| tRNA/rRNA methyltransferase [Orientia tsutsugamushi Boryong] (242 aa)
Score = 233, Expect = 7.2e-18, Identities = 55/150 (36%), Positives = 92/150 (61%)
  Q:    83 NLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +LNT    I +LD++ D  N GAI R++ +F ++ II  +NN I+ N T+ K ++G +  +N +KV NL   +N LKK  +W +   L++ S  L++ +T  +K   ++G+ENKG+  L ++  DF++KI M    +SLNV+ +  II Y
  S:    85 DLNTPNYKIAILDQLLDHNNLGAIIRSAAAFDISTIILPENNSIEENGTIAKIAVGALEKINLVKVKNLYNTINYLKKHEFWIIGLDLND-SNQLTE-QTFHSKTAFVLGSENKGLRNLTRQQCDFLIKIPMSHKTESLNVAGAATIIFY 232
>gi|27467212|ref|NP_763849.1| putative tRNA/rRNA methyltransferase [Staphylococcus epidermidis ATCC 12228] >gi|27314754|gb|AAO03891.1|AE016744_294 putative tRNA/rRNA methyltransferase [Staphylococcus epidermidis ATCC 12228] (255 aa)
Score = 232, Expect = 7.5e-18, Identities = 60/204 (29%), Positives = 109/204 (53%)
  Q:    29 DELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           D LK  KS+ + +  V K   D      HQ   G+A   +   + +FD F++K          +++LD ++DP N G+I RT+ +  V  +I  K   + + +TV K S G + ++  ++V NLS+ +++LK   +W   T  +  +      + D++ L +++G+E +G+S L+    DF +KI M   V SLN SV+ ++++Y
  S:    44 DILKNAKSQKLIVQTVPKSKLDFLANAPHQ---GVAALVAPYEYANFDEFLQK-QKKKARYSTVIILDGLEDPHNLGSILRTADASGVDAVIIPKRRSVALTQTVAKASTGAIQHVPVIRVTNLSKTIDELKDNGFWIAGTEANNAT-DYRDLQADMS-LGIVIGSEGQGMSRLVSDKCDFHIKIPMVGHVNSLNASVAASLMMY 242
>gi|86610253|ref|YP_479015.1| RNA methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86558795|gb|ABD03752.1| RNA methyltransferase, TrmH family, group 3 [Synechococcus sp. JA-2-3B'a(2-13)] (378 aa)
Score = 232, Expect = 7.7e-18, Identities = 63/228 (27%), Positives = 122/228 (53%)
  Q:     5 FGKKAVIEAFK-QNELSEV-------YYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK-LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G++ V+ A K Q  L+ V       Y   +   L+E K++   +++V+ K  +       N  GIA +++   +   +  +E+      +  +++VLD IQDP N GAI R+ ++F + G++  +     +  TV+K + G ++ L   +V NL+  L  LK++ +W   T     + P+  +  D  + + ++VG+E +G+S L ++  D ++ I +    +SLN SV+  I LY
  S:   109 YGRQTVLAALKSQATLNRVWILPKLRYSPQFLSLLEEAKARGTVIDEVSPKRLNAL-TAGANHQGIAAQATPYQYVALEDLVERSRQAGPNP-VLVVLDGIQDPHNLGAIARSVEAFGMQGMVIPQRRAAGVTSTVMKVAAGALSTLPVARVVNLNRALEYLKEQGFWVYGTT-SRGADPI--YSADFQRPIALVVGSEGEGISLLTQRHCDQLLSIPLAGRTESLNASVAAGIALY 340
>gi|99034724|ref|ZP_01314656.1| hypothetical protein Wendoof_01000527 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (254 aa)
Score = 232, Expect = 8.0e-18, Identities = 69/229 (30%), Positives = 121/229 (52%)
  Q:     4 FFGKKAVIEAFKQNE-------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +GK   + A K          ++E +Y  +  E+K++  SK IK+  V  K  +       N  GIA   +  +   ++  IE++   + D   I++LD++ D  N G+I RTS  F V  ++   N+    N ++ K + G ++ +  + V N+ + +  LKK  YW  C   D      + + K+   K V+I G+E KG+  L+K++ D+++KI M +++ SLNVS + AI LY
  S:    12 LYGKHTCMSALKNKNRRCIELLVTENFYREHEKEIKQYANSKGIKVRLVENKILNDVLPKGANHQGIALNVAPIL---YNLSIEEVAESSNDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPHNHSPSENASIAKAASGALDIIPLIYVTNIVKTMQYLKKVGYW--CYGFDCNAKENIDEIKSFEKKRVIIFGSEEKGMRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 244
>gi|29654301|ref|NP_819993.1| RNA methyltransferase [Coxiella burnetii RSA 493] >gi|52783308|sp|Q83CW6|RLMB_COXBU 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|29541568|gb|AAO90507.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA 493] (250 aa)
Score = 232, Expect = 8.0e-18, Identities = 51/143 (35%), Positives = 82/143 (57%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++L+LD ++DP N GA  R++ +F V  +I  K+  + +   V K + G      F++V NLS  ++ L+KE  W V TA++ E  I       DI    +++G+E  G+  L K+  DF+ +I +  SV+SLNVSV+  I LY
  S:    98 LLLILDGVKDPHNLGACLRSANAFGVRAVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQEIDLTGDI---AIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLY 238
>gi|167751286|ref|ZP_02423413.1| hypothetical protein EUBSIR_02272 [Eubacterium siraeum DSM 15702] >gi|167655793|gb|EDR99922.1| hypothetical protein EUBSIR_02272 [Eubacterium siraeum DSM 15702] (254 aa)
Score = 232, Expect = 8.8e-18, Identities = 50/142 (35%), Positives = 79/142 (55%)
  Q:    91 ILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           I++ DEIQDP N GAI RT+++    G+I  K     +N TV KTS G   ++   +V+NL + +  LKK   W      D   I     K D++  L +++G+E  G+ +L+K++ D ++ + M   V SLN SV   I++Y
  S:   110 IIICDEIQDPHNLGAIIRTAEAAGADGVIIPKRRSATVNPTVFKTSAGAAAWIKIARVSNLVDTIKTLKKHGVWVYGAEADGTPID----KADLSGALALVIGSEGFGLGKLVKENCDVVLSLPMFGKVNSLNASVCAGILMY 248
>gi|161505128|ref|YP_001572240.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866475|gb|ABX23098.1| hypothetical protein SARI_03262 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (243 aa)
Score = 232, Expect = 8.9e-18, Identities = 57/199 (28%), Positives = 102/199 (51%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   N++F D+     VHQ I+   K        D    I        ++  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA + + ++  SK      ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVVIQLANRQFLDEKSEGAVHQGIIARVKPGRQYQENDLPDLIAL-----HERPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMP---GRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|157373892|ref|YP_001472492.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sediminis HAW-EB3] >gi|157316266|gb|ABV35364.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sediminis HAW-EB3] (246 aa)
Score = 232, Expect = 9.2e-18, Identities = 56/177 (31%), Positives = 88/177 (49%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +L   K        D  + +EK     T+    L+LD + DP N GA  R + +  V G+I  ++N + +  TV K + G    +   +V NL+  +  L+ +  W V  A +  S     +KTD+   L + +G E+KG+  L ++  D I  I M  SV SLNVSV++ I L+
  S:    69 HQGVLARVKAVKQLNDNDLLALVEK-----TETPFFLILDGVTDPHNLGACLRNADAAGVHGVIVPRDNSVGLTPTVSKVACGAAEVVPLFQVTNLARTMKSLQDKGVWIVGAAGEADS---DLYKTDLKGSLAIAMGAEDKGLRRLTRESCDSIASIPMSGSVSSLNVSVASGICLF 238
>gi|167553783|ref|ZP_02347529.1| hypothetical protein Sentente_25051 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167560457|ref|ZP_02353460.1| hypothetical protein Sententeri_26827 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168263278|ref|ZP_02685251.1| hypothetical protein Salmentericaenterica_19540 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464747|ref|ZP_02698650.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195632589|gb|EDX51043.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (243 aa)
Score = 231, Expect = 9.7e-18, Identities = 57/199 (28%), Positives = 102/199 (51%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I        ++  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA + + ++  SK      ++ +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIAL-----HERPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMP---GRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|170077013|ref|YP_001733651.1| rRNA methyltransferase [Synechococcus sp. PCC 7002] >gi|169884682|gb|ACA98395.1| rRNA methyltransferase, TrmH family, group 3 [Synechococcus sp. PCC 7002] (388 aa)
Score = 231, Expect = 9.9e-18, Identities = 67/228 (29%), Positives = 119/228 (52%)
  Q:     5 FGKKAVIEAFK-QNELSEVYYVSYFDELKEF-------KSKNIKLNKVNKKFFD--KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK AV+   + +  L+ ++  S       F       K++   +++V+    D      VHQ   GIA +++   + +    IE+     T+  ++++ D I DP N GAI RT+++    G+I  +   + +  TV+K + G + +    +V NLS  + +LK+  +W   TA    K++   KF+  I    +++G+E +G+S L +K  D +V I M     SLN SV+ AI LY
  S:   138 YGKHAVLSVLESERPLNRIWVTSRLRHANRFHTLLQAAKNQGTVIDEVSMSRLDYLTNRGVHQ---GIAVQTAPYEYMELPDLIEQAK-AKTESPVVVIADGITDPHNLGAIIRTAEAIGAQGMIIPQRRAVGVTSTVMKVAAGALEHFPVARVVNLSRAMEELKEAGFWIYGTAAGTSKALHNIKFEGAIG---LVIGSEGQGLSLLTQKHCDELVAIPMTGKTPSLNASVAAAIALY 369
>gi|161830029|ref|YP_001596726.1| RNA methyltransferase [Coxiella burnetii RSA 331] >gi|161761896|gb|ABX77538.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA 331] (270 aa)
Score = 231, Expect = 9.9e-18, Identities = 51/143 (35%), Positives = 82/143 (57%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++L+LD ++DP N GA  R++ +F V  +I  K+  + +   V K + G      F++V NLS  ++ L+KE  W V TA++ E  I       DI    +++G+E  G+  L K+  DF+ +I +  SV+SLNVSV+  I LY
  S:   118 LLLILDGVKDPHNLGACLRSANAFGVRAVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQEIDLTGDI---AIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLY 258
>gi|154706093|ref|YP_001424432.1| RNA methyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|164685717|ref|ZP_01945643.2| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii 'MSU Goat Q177'] >gi|165918586|ref|ZP_02218672.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA 334] >gi|154355379|gb|ABS76841.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii Dugway 5J108-111] >gi|164601225|gb|EAX33789.2| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii 'MSU Goat Q177'] >gi|165917714|gb|EDR36318.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA 334] (270 aa)
Score = 231, Expect = 1.0e-17, Identities = 51/143 (35%), Positives = 82/143 (57%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++L+LD ++DP N GA  R++ +F V  +I  K+  + +   V K + G      F++V NLS  ++ L+KE  W V TA++ E  I       DI    +++G+E  G+  L K+  DF+ +I +  SV+SLNVSV+  I LY
  S:   118 LLLILDGVKDPHNLGACLRSANAFGVRAVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQEIDLTGDI---AIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLY 258
>gi|153886733|ref|ZP_02007887.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii 12D] >gi|151576907|gb|EDN41309.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii 12D] (250 aa)
Score = 231, Expect = 1.1e-17, Identities = 55/177 (31%), Positives = 96/177 (54%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK  SL++  + D  ++ I        ++LVLD + DP N GA  R + +     +I  K+  + IN TV K + G    + ++ V NL+  L +L++   W + TA + E+ +  + FK  I    +++G E +G+  L ++  D +V I M  SV+SLNVSV++ + L+
  S:    69 HQGV--VAKAESLSLALNLDELLDGIEG----TPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLYQADFKGPI---AIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLF 237
>gi|71894373|ref|YP_278481.1| putative tRNA/rRNA methyltransferase [Mycoplasma synoviae 53] >gi|71851161|gb|AAZ43770.1| putative tRNA/rRNA methyltransferase [Mycoplasma synoviae 53] (233 aa)
Score = 231, Expect = 1.1e-17, Identities = 79/236 (33%), Positives = 121/236 (51%)
  Q:     1 MKKFF--GKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           M K F  GK + ++A +     +  Y+S  + LK FK+ N K+  ++     K    + N  G   E   T ++D +   E      +  KI+LVLD I D  N GAI R++ +  +  I+  K N   I   V+K S G    +NF KV++L+  LNKLKK +YW   + LD+ S      K +   +  I+GNE KG+S+    + D  + I    SV+SLNVSV+  I+L+ + H
  S:     1 MAKLFIGGKNSTLDAIESKLNLKRIYLSKKENLKYFKNTNFKVEILSNLELSKL-TNNANHQGFVAELDFT-YSDINKIYE------SKPKIVLVLDHIMDTYNLGAIIRSANAAGIKDIVMPKENCADITSNVLKVSSGGFIGINFYKVSSLNAFLNKLKKHSYWIYGSMLDKNSTSYYSAKYNF-PMAFILGNEEKGISKSALVEVDEKIHIPQSGSVESLNVSVAAGILLFDIKH 229
>gi|121604792|ref|YP_982121.1| RNA methyltransferase [Polaromonas naphthalenivorans CJ2] >gi|120593761|gb|ABM37200.1| RNA methyltransferase, TrmH family, group 3 [Polaromonas naphthalenivorans CJ2] (253 aa)
Score = 231, Expect = 1.1e-17, Identities = 53/147 (36%), Positives = 85/147 (57%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           T + ++LVLD + DP N GA  R +       +I  K++   IN TV K + G    + +  V NL+  LN+LK+ N W + T+ D EK+I    +  D+   + +I+G E +G+ +L +K  D +V I M  +V+SLNVSV++ + LY
  S:    98 TAQPLLLVLDGVTDPHNLGACLRVADGAGAQAVIAPKDHAAGINATVAKVASGAAETVPYFMVTNLARTLNELKERNIWCIGTSDDAEKTI----YDVDLTGPVALILGAEGEGMRQLTRKTCDELVSIPMQGAVESLNVSVASGVCLY 242
>gi|81429291|ref|YP_396292.1| putative tRNA/rRNA methyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|78610934|emb|CAI55986.1| Putative tRNA/rRNA methyltransferase [Lactobacillus sakei subsp. sakei 23K] (295 aa)
Score = 231, Expect = 1.1e-17, Identities = 71/227 (31%), Positives = 117/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDELK-EFKSKNIKLNKVNKKFF-----DKYEVV--HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           GK A +E  K ++  ++  +   D LK +F    +KL K  +        +K +++   QN  GI    +   +   D    K      ++  IL+LD ++DP N G+I RT+ +  V GII  K+  + +  TV KTS G + ++   +V NL++ + KLK    W   T  D       K+      + +I+GNE KG+S ++KK+ D  + I M   VQSLN SV+  +++Y
  S:    55 GKHASLETLKTSDAKKINKIFLQDGLKADFVHDVVKLAKEKRLIIQNVPKNKLDLLSDRQNHQGIILAIAPFEYASVDDIFAKAK-AQEEEPFILILDNLEDPHNLGSIMRTADAVGVHGIIIPKHRAVGLTSTVAKTSTGAIEHIPVARVTNLTQEIKKLKDRGLWIFGT--DMAGTDYRKWDAK-GPIGLIIGNEGKGLSPIVKKEVDQTLTIPMVGHVQSLNASVAAGVLMY 285
>gi|24987276|pdb|1GZ0|A Chain A, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987277|pdb|1GZ0|B Chain B, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987278|pdb|1GZ0|C Chain C, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987279|pdb|1GZ0|D Chain D, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987280|pdb|1GZ0|E Chain E, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987281|pdb|1GZ0|F Chain F, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987282|pdb|1GZ0|G Chain G, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb >gi|24987283|pdb|1GZ0|H Chain H, 23s Ribosomal Rna G2251 2'o-Methyltransferase Rlmb (253 aa)
Score = 231, Expect = 1.2e-17, Identities = 59/199 (29%), Positives = 97/199 (48%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S+ + +   N+++ D+     VHQ I+   K        D    I  +     D+  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+     L++EN W V TA  E    L + K    +L ++ G E +G   L ++  D ++ I    SV SLNVSV+T I L+
  S:    53 LESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASL-----DQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTXRXLQEENIWIVGTA-GEADHTLYQSKX-TGRLALVXGAEGEGXRRLTREHCDELISIPXAGSVSSLNVSVATGICLF 246
>gi|16331014|ref|NP_441742.1| hypothetical protein slr0955 [Synechocystis sp. PCC 6803] >gi|3915411|sp|P74328|Y955_SYNY3 Uncharacterized tRNA/rRNA methyltransferase slr0955 >gi|1653509|dbj|BAA18422.1| slr0955 [Synechocystis sp. PCC 6803] (384 aa)
Score = 231, Expect = 1.2e-17, Identities = 63/229 (27%), Positives = 122/229 (53%)
  Q:     4 FFGKKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY------EVVHQ-NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK-LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +G  AV+ A   + +L+ ++  S+      +++K I+  K N    D+       ++ H  N  GIA + +   + +    I+K  + +T   +++++D I DP N GAI RT+++F   G++  +     I  TV+K + G + +    +V NLS  L  LK+  +W   T   +++   +  + D+ + + +++G+E +G+S L +K  D ++ I +     SLN SV+ AI LY
  S:   126 LYGHHAVLAALDGDRQLNRIWITSHLRHDIRYRTK-IQTAKANGTVVDEVDNFRLNQITHNANHQGIAAQVAPYHYWELGDLIDKAKSQST-APVLIIIDSITDPHNLGAIIRTAEAFGAQGMVLPQRRVAGITSTVMKVAAGALEHFPVARVVNLSRALETLKESGFWIYGTVAGKQT---ALHQADLREPMGLVIGSEGEGLSLLTQKHCDHLITIPLAGKTPSLNASVAAAISLY 358
>gi|30248368|ref|NP_840438.1| putative tRNA/rRNA methyltransferase [Nitrosomonas europaea ATCC 19718] >gi|52783307|sp|Q82XD1|RLMB_NITEU 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|30138254|emb|CAD84262.1| putative tRNA/rRNA methyltransferase [Nitrosomonas europaea ATCC 19718] (260 aa)
Score = 231, Expect = 1.2e-17, Identities = 52/147 (35%), Positives = 84/147 (57%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDE----KSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           T+  ++LVLD ++DP N GA  R + +F V  ++  K+  + ++ TV K + G V+ + F  V NL+  L +LK+   W V TA D      S+ L++       L  ++G E+ G+  L ++  D +V I M  S++SLNVSVS  I L+
  S:    93 TEPALLLVLDGVKDPHNLGACLRVADAFGVHAVVVPKDRAVGLSATVHKVASGAVDTVPFFAVTNLARTLRELKEMGLWIVGTAADAPDTLDSVTLTR------PLAWVLGAEDGGMRRLTREACDLLVSIPMSGSIESLNVSVSAGICLF 237
>gi|72080967|ref|YP_288025.1| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae 7448] >gi|71914091|gb|AAZ54002.1| tRNA/rRNA methyltransferase [Mycoplasma hyopneumoniae 7448] (233 aa)
Score = 231, Expect = 1.2e-17, Identities = 77/234 (32%), Positives = 126/234 (53%)
  Q:     1 MKKFFGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           +K   G+ ++ +A K   + +  Y+      + F  + +K+  V++ F DK   + HQ  +G+ +        +F  F  +I+ L  DK KIIL+LD IQD  N G I RT+  F +  II  K    ++NET +K S G    L F+ VN++   +NKLK+ ++W   T L EKS  + + + +     +I+GNE  G+ +     SD    I ++ +V SLNV+V+T IIL++L
  S:     2 VKYICGRNSLADAIKNGFIFKEIYLLKPTNDQIFLKQKVKI--VSRDFLDKLVSLNHQGFVGVLE--------NFKFF--EIDTLVKDKPKIILILDHIQDQNNLGNIIRTANCFGIKHIILPKKRAAKLNETTMKVSSGGFVGLKFILVNSIVSAINKLKEMDFWIYATDLKEKSRKIQEIQFNY-PCAIILGNEATGIKKSSLNASDQTFFIPLEGTVNSLNVTVATGIILFFL 224
>gi|194365073|ref|YP_002027683.1| RNA methyltransferase, TrmH family, group 3 [Stenotrophomonas maltophilia R551-3] >gi|194347877|gb|ACF51000.1| RNA methyltransferase, TrmH family, group 3 [Stenotrophomonas maltophilia R551-3] (247 aa)
Score = 230, Expect = 1.3e-17, Identities = 58/198 (29%), Positives = 99/198 (50%)
  Q:    35 KSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + K I + KVN +  D     V HQ +      +      + +  +         K ++LVLDE+QDP N GA  R++ +     +I  K+    +N TV KTS G  + +  + V NLS  L  L+K+  W    A +  +   S ++ D+   + +++G E  G+  L +++ D +VKI M   ++SLNVSV+  + L+
  S:    47 RRKGIDVRKVNSQALDGVGGSVRHQGVAARYAAARTYSENELEGLVTAAEG----KALLLVLDEVQDPHNLGACLRSAAAAGATAVIIPKDKSASVNATVRKTSAGAADLIPVVAVTNLSRCLKDLQKQGVWIYGLAGEATA---SLYQLDLKGNIALVLGGEADGLRRLTRENCDGLVKIPMPGEIESLNVSVAAGVSLF 240
>gi|33594398|ref|NP_882042.1| putative tRNA/rRNA methyltransferase [Bordetella pertussis Tohama I] >gi|33597117|ref|NP_884760.1| putative tRNA/rRNA methyltransferase [Bordetella parapertussis 12822] >gi|33600961|ref|NP_888521.1| putative tRNA/rRNA methyltransferase [Bordetella bronchiseptica RB50] >gi|52783303|sp|Q7VTK4|RLMB_BORPE 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|52783304|sp|Q7W7I7|RLMB_BORPA 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|52783305|sp|Q7WKX5|RLMB_BORBR 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|33564473|emb|CAE43786.1| putative tRNA/rRNA methyltransferase [Bordetella pertussis Tohama I] >gi|33566568|emb|CAE37825.1| putative tRNA/rRNA methyltransferase [Bordetella parapertussis] >gi|33575396|emb|CAE32473.1| putative tRNA/rRNA methyltransferase [Bordetella bronchiseptica RB50] (245 aa)
Score = 230, Expect = 1.3e-17, Identities = 54/177 (30%), Positives = 103/177 (58%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK-LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++ +A+E SL +       I+++ ++     ++L+LD + DP N GA  RT+ +  V  +I  ++  + +N TV + + G  + + +L V NL+  + +LK+ + W V T  D+++   S  + D  + +  ++G E +G+  L ++  D +V+I M  SV+SLNVSV++A+ LY
  S:    69 HQGVVAVAEERSLAVG------IDEVLDVIEGPALLLILDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLNATVQRVACGAADTVPYLTVTNLARTMRELKERDVWLVGT--DDQAGE-SMHQVDARRSMAWVMGAEGEGMRRLTRETCDQLVRIPMLGSVESLNVSVASAVCLY 237
>gi|114331604|ref|YP_747826.1| RNA methyltransferase [Nitrosomonas eutropha C91] >gi|114308618|gb|ABI59861.1| RNA methyltransferase, TrmH family, group 3 [Nitrosomonas eutropha C91] (260 aa)
Score = 230, Expect = 1.3e-17, Identities = 53/147 (36%), Positives = 83/147 (56%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK----SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           T+   +LVLD ++DP N GA  R + +F V  +I  K+  + ++ TV K + G V+ + F  V NL+  L +LK+E  W V T  D      SI L++       +  ++G E +G+  L ++  D +V I M  S++SLNVSVS  I L+
  S:    93 TEPAFLLVLDGVKDPHNLGACLRVADAFGVHAVIVPKDRAVGLSATVHKVASGAVDTVPFFAVTNLARTLRELKEEGIWIVGTTADASDTLDSITLTR------PIAWVLGAEGEGMRRLTRETCDQLVSIPMSGSIESLNVSVSAGICLF 237
>gi|86605012|ref|YP_473775.1| RNA methyltransferase [Synechococcus sp. JA-3-3Ab] >gi|86553554|gb|ABC98512.1| RNA methyltransferase, TrmH family, group 3 [Synechococcus sp. JA-3-3Ab] (354 aa)
Score = 230, Expect = 1.4e-17, Identities = 62/228 (27%), Positives = 125/228 (54%)
  Q:     5 FGKKAVIEAFK-QNELSEV-------YYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK-LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G++ V+ A + Q  L+ V       Y   ++  L+E K++   +++V+ +  +       N  GIA +++   + D +  +E+ +  +    +++VLD IQDP N GAI R+ ++F + G++  +     +  TV+K + G ++ L   +V NL+  L  LK + +W   T   + + P+  +  D  + + ++VG+E +G+S L ++  D ++ I +    +SLN SV+  I LY
  S:    98 YGRQTVLAALRSQATLNRVWVLPRLRYSPQFWSLLEEAKARGTVIDEVSLQRLNLL-TAGANHQGIAAQATPYRYVDLEELVEQ-SRQSGPHPVLVVLDGIQDPHNLGAIARSVEAFGMQGMVIPQRRAAGVTATVMKVAAGALSTLPVARVVNLNRALEYLKGQGFWVYGTT-SQGAAPI--YSADFRRPIALVVGSEGEGISLLTQRHCDQLLSIPLAGRTESLNASVAAGIALY 329
>gi|89901014|ref|YP_523485.1| RNA methyltransferase TrmH, group 3 [Rhodoferax ferrireducens T118] >gi|89345751|gb|ABD69954.1| RNA methyltransferase TrmH, group 3 [Rhodoferax ferrireducens T118] (256 aa)
Score = 230, Expect = 1.4e-17, Identities = 60/177 (33%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDK-------KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +   A+   L      D  +E++    TD+        +ILVLD + DP N GA  R +    V  +I  K++   IN TV K + G    + +  V NL+  LN+LK+ N W + T+      P + ++ D+   V +V G E  G+  L  K  D +V I M  +V+SLNVSV++ + LY
  S:    69 HQGV--AARVHELAQVKSLDELLEQLEAAQTDRPPTEREEALILVLDGVTDPHNLGACLRVADGAGVHAVIAPKDHAAGINATVAKVASGAAETVPYFMVTNLARTLNELKERNIWIIGTS---DVAPKTIYQADLKGPVALVLGAEGDGMRALTAKTCDELVSIPMRGAVESLNVSVASGVCLY 248
>gi|148828043|ref|YP_001292796.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus influenzae PittGG] >gi|148719285|gb|ABR00413.1| hypothetical protein CGSHiGG_07820 [Haemophilus influenzae PittGG] (246 aa)
Score = 230, Expect = 1.4e-17, Identities = 64/202 (31%), Positives = 100/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ I+   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+   V K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGIIARVQAAKELNENDLDEILS-----NKQNPLVLVLDGVTDPHNLGACLRTADAAGAEAVIVPKDKSAQLTSIVRKVACGAAETVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|146283972|ref|YP_001174125.1| RNA methyltransferase [Pseudomonas stutzeri A1501] >gi|145572177|gb|ABP81283.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas stutzeri A1501] (251 aa)
Score = 230, Expect = 1.4e-17, Identities = 55/194 (28%), Positives = 101/194 (52%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + +  ++  D + E VHQ ++     S +      D  +++         ++LVLD + DP N GA  RT+ +     +I  K+    +N TV K + G    +  + V NL+  L KL+++  W V TA + +    S +  D+   +V+++G E +G+  L ++  D++V++ M  SV SLNVSV+T + L+
  S:    50 VSVGQCERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDRAEG----PPLLLVLDGVTDPHNLGACLRTADAAGALAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQKGLWVVGTAGEAEQ---SLYAQDLTGPIVLVMGAEGRGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238
>gi|117919150|ref|YP_868342.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. ANA-3] >gi|117611482|gb|ABK46936.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. ANA-3] (246 aa)
Score = 230, Expect = 1.4e-17, Identities = 62/183 (33%), Positives = 93/183 (50%)
  Q:    50 DKYEVV-HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           DK E   HQ I+   K + +    D D  + K     TD   +L+LD + DP N GA  R + +  V GII  K+N + +   V K + G    +   +V NL+  +  L+++  W V TA  E    L  ++ D+   L + +G E KG+  L ++  D +V I M  SV SLNVSV+T I L+
  S:    62 DKAESAQHQGIVARVKAAKILGEHDLDELLGK-----TDLPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTA-GEADCEL--YQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMAGSVSSLNVSVATGICLF 238
>gi|167035924|ref|YP_001671155.1| RNA methyltransferase [Pseudomonas putida GB-1] >gi|166862412|gb|ABZ00820.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida GB-1] (248 aa)
Score = 230, Expect = 1.4e-17, Identities = 54/143 (37%), Positives = 81/143 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +ILVLD + DP N GA  RT+ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA + E+ I    ++ D+   LVVI+G E KG+  L ++  DF+VK+ M  SV SLNVSV+T + L+
  S:    98 LILVLDGVTDPHNLGACLRTADAAGATAVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI----YQQDLTGPLVVIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238
>gi|78222568|ref|YP_384315.1| RNA methyltransferase TrmH, group 3 [Geobacter metallireducens GS-15] >gi|78193823|gb|ABB31590.1| RNA methyltransferase TrmH, group 3 [Geobacter metallireducens GS-15] (250 aa)
Score = 230, Expect = 1.5e-17, Identities = 48/146 (32%), Positives = 85/146 (58%)
  Q:    87 DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IL LD +QDP N GA+ R++      G+I  K+   ++  TV K++ G    +   +V NL++ L++LK+  +W    A    S   S +  D++  +V+++G+E +GV  L++K  DF+V I +   V SLN SV+  +IL+
  S:    94 ERGLILALDGVQDPHNLGALIRSAACAGAHGVIIPKDRAARVTATVEKSAAGAAETIPVAQVTNLAQALDELKEAGFWIYGAA---DSAASSLYDQDLSGNVVIVIGSEGEGVRPLVRKKCDFLVAIPLRGGVSSLNASVAGGVILF 237
>gi|124267007|ref|YP_001021011.1| putative tRNA/rRNA methyltransferase protein [Methylibium petroleiphilum PM1] >gi|124259782|gb|ABM94776.1| putative tRNA/rRNA methyltransferase protein [Methylibium petroleiphilum PM1] (247 aa)
Score = 230, Expect = 1.5e-17, Identities = 56/177 (31%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK ++       D  ++ +        ++LVLD + DP N GA  R +       +I  K++ + IN TV K + G    + +  V NL+  L +LK+ N W + TA D    P + +  D+ + V +V G E +G+ +L +K  D +V + M  +V+SLNVSV++ I LY
  S:    70 HQGV--VAKVTAAPATKSLDDLLDTVEG----PPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGINATVAKVASGAAETVPYFMVTNLARTLGELKERNIWVIGTADDA---PRTLYAADLRQAVALVLGAEGQGMRQLTRKTCDELVSLPMAGAVESLNVSVASGIGLY 238
>gi|190573530|ref|YP_001971375.1| putative tRNA/rRNA methyltransferase [Stenotrophomonas maltophilia K279a] >gi|190011452|emb|CAQ45070.1| putative tRNA/rRNA methyltransferase [Stenotrophomonas maltophilia K279a] (247 aa)
Score = 230, Expect = 1.5e-17, Identities = 58/198 (29%), Positives = 99/198 (50%)
  Q:    35 KSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + K I + KVN +  D     V HQ +      +      + +  +         K ++LVLDE+QDP N GA  R++ +     +I  K+    +N TV KTS G  + +  + V NLS  L  L+K+  W    A +  +   S ++ D+   + +++G E  G+  L +++ D +VKI M   ++SLNVSV+  + L+
  S:    47 RRKGIDVRKVNSQALDGVGGSVRHQGVAARYAAARTYSENELEGLVTAAEG----KALLLVLDEVQDPHNLGACLRSAAAAGATAVIIPKDKSATVNATVRKTSAGAADLIPVVAVTNLSRCLKDLQKQGVWIYGLAGEATA---SLYQLDLKGNIALVLGGEADGLRRLTRENCDGLVKIPMPGEIESLNVSVAAGVSLF 240
>gi|104783862|ref|YP_610360.1| RNA methyltransferase [Pseudomonas entomophila L48] >gi|95112849|emb|CAK17577.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas entomophila L48] (247 aa)
Score = 230, Expect = 1.5e-17, Identities = 53/143 (37%), Positives = 81/143 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +ILVLD + DP N GA  RT+ +     ++  K+    +   V K + G    +  + V NLS  L KL++   W V TA + E+ I    ++ D+   LV+I+G E KG+  L ++  DF+VK+ M  SV SLNVSV+T + L+
  S:    98 LILVLDGVTDPHNLGACLRTADAAGATAVVIPKDKSASLTAVVRKVACGAAEVIPLVAVTNLSRTLEKLQQRGLWVVGTAGEAEQEI----YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238
>gi|116333232|ref|YP_794759.1| rRNA methylase [Lactobacillus brevis ATCC 367] >gi|116098579|gb|ABJ63728.1| rRNA methylase [Lactobacillus brevis ATCC 367] (255 aa)
Score = 230, Expect = 1.6e-17, Identities = 67/227 (29%), Positives = 113/227 (49%)
  Q:     6 GKKAVIEAFK-QNELSEVYYVS-----YFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+   + A + Q  +++V+  S       DE+++  K +++ +++V K+  D     HQN  G+A   S   +   D   ++      +    LVLD ++DP N G+I RT+ +  V GII  K   + +   V KTS G +  +   +V NL   + +LK    W   T  D        +        +I+GNE KG+S L+K+  D ++ I M   VQSLN SV+  +++Y
  S:    16 GRHPAVAALRSQQTINKVFLQSGLKAEALDEIRQLAKKRHLVISEVPKQKLDLL-TDHQNHQGVALGVSAFAYATIDDLFDRAAAAG-EAPFFLVLDGVEDPHNLGSILRTADASGVHGIIIPKRRAVGLTSVVAKTSTGAIERVPVARVTNLVNTVRELKDRGVWVFGT--DMAGTDYRDWDAK-GASALIIGNEGKGISRLLKETVDQMLTIPMVGEVQSLNASVAAGLLMY 244
>gi|115378458|ref|ZP_01465617.1| RNA methyltransferase, TrmH family, group 3 [Stigmatella aurantiaca DW4/3-1] >gi|115364520|gb|EAU63596.1| RNA methyltransferase, TrmH family, group 3 [Stigmatella aurantiaca DW4/3-1] (273 aa)
Score = 230, Expect = 1.6e-17, Identities = 62/178 (34%), Positives = 88/178 (49%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ   G+A E     + D    +E     +    +++VLD IQDP N GAI R++ +    GI+  K+  +Q+   V K S G V +    +V N+S  L +LK+   W        K  PL   + D   L ++VG E  GV E + K  DF + I M   V SLN SVS A++LY
  S:    81 VHQ---GVAAELRGFEYVDVPDLLEAAK-ASGRAPLVVVLDGIQDPHNLGAIIRSAHALGAHGIVIGKDRAVQVTGVVAKASAGAVEHCPIARVVNISRALEELKEAGLWVAAADTHSKE-PLWGARLD-GPLALVVGAEGAGVREGVLKHCDFRLGIPMVGQVGSLNASVSAAVLLY 252
>gi|46906474|ref|YP_012863.1| RNA methyltransferase [Listeria monocytogenes str. 4b F2365] >gi|46879738|gb|AAT03040.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes str. 4b F2365] (251 aa)
Score = 230, Expect = 1.6e-17, Identities = 50/141 (35%), Positives = 85/141 (60%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LDE++DP N G+I RT+ S    GII  K   + + +TV K S G + Y+  ++V N+   + +L+K   W   T  D K    S ++T D++  L +++G+E  G+S L+++  DF+V + M   V SLN SV+ +++LY
  S:   102 IILDELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT--DAKGS--SDYRTMDVDMPLAIVIGSEGFGMSCLVREKCDFLVHLPMRGKVTSLNASVAASLLLY 240
>gi|194684672|emb|CAR46614.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Proteus mirabilis HI4320] (247 aa)
Score = 229, Expect = 1.7e-17, Identities = 59/199 (29%), Positives = 100/199 (50%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            + + I +   N+++ D      VHQ I+   K S      D    + ++         +LVLD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  L  L++EN W V TA + + ++  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    44 LEEQGILVQVANRQWLDNQTEGAVHQGIIAKVKPSRQYQEQDLPDLLAEVGT-----PFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRLLQEENIWIVGTAGEADHTLYQSKLT---GPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 237
>gi|157364334|ref|YP_001471101.1| RNA methyltransferase [Thermotoga lettingae TMO] >gi|157314938|gb|ABV34037.1| RNA methyltransferase, TrmH family, group 3 [Thermotoga lettingae TMO] (233 aa)
Score = 229, Expect = 1.7e-17, Identities = 68/208 (32%), Positives = 105/208 (50%)
  Q:    28 FDELKEFKSKN-IKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           F E++E   KN     K + K  +K       + G  K   + I  DF+   E       D   I++LD I DP N GAI RT     V+ I+  K+   +I   V+K S GTV  +  + V N+   + KLK + YW     ++ K++    F   I+ + ++ GNE +G+S L+K+  D ++ I M S + SLNVSVS  IIL+ ++
  S:    32 FQEIEEILKKNGYHYIKTSAKHLEK-------LCGEEKNQGIVIDLDFNYADETY----LDGDFIVLLDHIVDPHNLGAIIRTCVGAGVSAIVITKDRSAKITPAVVKVSAGTVFRIPVVIVTNIVYTIEKLKNKGYWVYGADMNGKNLYEEGF---ISPVAIVFGNEGEGLSRLVKERCDQLISIPMRSKIDSLNVSVSAGIILFEIS 226
>gi|182420073|ref|ZP_02951307.1| RNA methyltransferase, TrmH family, group 3 [Clostridium butyricum 5521] >gi|182376110|gb|EDT73697.1| RNA methyltransferase, TrmH family, group 3 [Clostridium butyricum 5521] (277 aa)
Score = 229, Expect = 1.8e-17, Identities = 70/227 (30%), Positives = 118/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYVSYFDE-------LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AV+EA K +   E  YVS           +   K + I + +V+K+  D       HQ +  IAK +        D F  ++     +   I++LDE++DP N G+I RT++ F V GII  K     +  TV K+S+G + ++   KVNN++  + +LK++  W      D ++   S          +++GNE +G+S+L  +  D ++KI M   + SLN SV+  I++Y
  S:    40 GRNAVMEALKGDRTIEAIYVSNNKLEGSINAIMGMAKDQKILIKEVDKRKLDSMCDGETHQGV--IAKVTPFKYSEVSDIF--ELAEQKGEAPFIVILDEVEDPHNLGSIARTAELFGVHGIIIPKRRSASVTATVYKSSVGAIEHVKVAKVNNINSTIEELKEKGVWIY--GADIRAEEYSHEVDYSGPCALVIGNEGRGMSKLTVQKCDKLIKIPMVGKINSLNASVAGGIMMY 269
>gi|91205880|ref|YP_538235.1| tRNA/rRNA methyltransferase [Rickettsia bellii RML369-C] >gi|157826761|ref|YP_001495825.1| tRNA/rRNA methyltransferase [Rickettsia bellii OSU 85-389] >gi|91069424|gb|ABE05146.1| tRNA/rRNA methyltransferase [Rickettsia bellii RML369-C] >gi|157802065|gb|ABV78788.1| tRNA/rRNA methyltransferase [Rickettsia bellii OSU 85-389] (241 aa)
Score = 229, Expect = 1.8e-17, Identities = 64/190 (33%), Positives = 106/190 (55%)
  Q:    45 NKKFFDK--YEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           NKK      Y++V+ ++L    E+      +  +   F   IE IN  N   KI  +LD+I DP N GAI R++ +F +  II   +N    N T+ K + GT+  +  +KV NL+  +N LKK  +W +    +       K  +D  K+ +I G+E+KG+  L++++ D++ KI +   V+SLNVS + +II + L
  S:    44 NKKLISSKPYKIVNNDVLSKLLENQTHQGIAAKVKPIFSHNIEDINIKNPKCKIA-ILDQITDPQNIGAIIRSAAAFNIDAIILPLDNSPNENGTIAKAACGTLELIKIIKVTNLNSCINYLKKHGFWVIGLTGEANDYFTDKLISD--KIALIFGSEDKGMRRLVQENCDYLAKIPISDKVESLNVSNAASIIFHSL 238
>gi|83747961|ref|ZP_00944992.1| 23S rRNA Gm2251 methyltransferase [Ralstonia solanacearum UW551] >gi|83725379|gb|EAP72526.1| 23S rRNA Gm2251 methyltransferase [Ralstonia solanacearum UW551] (249 aa)
Score = 229, Expect = 1.9e-17, Identities = 54/177 (30%), Positives = 98/177 (55%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK  +L++  + D  ++ I+       ++LVLD + DP N GA  R + +     +I  K+  + IN TV K + G    + ++ V NL+  L +L++   W + TA + E+++  + FK  I    +++G E +G+  L ++  D +V I M  SV+SLNVSV++ + L+
  S:    69 HQGV--VAKAEALSLALNLDELLDGIDG----PPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAPKDRSVGINATVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQNLYQADFKGPI---ALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLF 237
>gi|58697096|ref|ZP_00372541.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont of Drosophila simulans] >gi|58536620|gb|EAL59943.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont of Drosophila simulans] (236 aa)
Score = 229, Expect = 2.1e-17, Identities = 66/212 (31%), Positives = 113/212 (53%)
  Q:    21 EVYYVSYFDELKE-FKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIP-LSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           E +Y  +  E+++   SK IK+  V  K  +       N  GIA   +  +   ++  IE+I   + D   I++LD++ D  N G+I RTS  F V  ++   N+    N ++ K + G ++ +  + V N+ + +  LKK  YW  C   D  +   + + K+   K V+I G+E KGV  L+K++ D+++KI M +++ SLNVS + AI LY
  S:    18 ENFYREHKKEIRQCVDSKGIKVRLVESKILNDVLPKGANHQGIALNVAPIL---YNLSIEEIAESSNDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPHNHSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYW--CYGFDCNTKENIDEIKSFEKKRVIIFGSEEKGVRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 226
>gi|123968445|ref|YP_001009303.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. AS9601] >gi|123198555|gb|ABM70196.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. AS9601] (335 aa)
Score = 228, Expect = 2.2e-17, Identities = 78/231 (33%), Positives = 124/231 (53%)
  Q:     5 FGKKAVIEAFKQNE-------LSEVYYV-SYFDELKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           +GK +V EA             SE++    ++  LK+ KSK + + +V+     +  Y   HQ   GIA + + +     +  I+  +  N    IIL LD I DP N GAI R++++F   GII  +     +  TV K + G + ++   +V NL+  L +LKK  +  V  + D + + +S F  +   LVVIVG+E KG+S L +K  DF++ I +     SLN SV+ AI L++LT
  S:    99 WGKHSVYEALSSERAINRIWCTSEIFSSDKFYILLKDLKSKGVLIEEVSWNRLSQLTYGASHQ---GIALQLACSRTISLEQLID-FSRHNCANPIILALDGITDPHNVGAIIRSAEAFDCKGIIIPQRRSAGLTGTVAKVAAGALEHVQVSRVVNLNRALEELKKNGFIVVGLSGDGQ-LSISNF-LEKAPLVVIVGSEEKGISLLTQKKCDFLLSIPLRGKTSSLNASVAAAISLFHLT 333
>gi|187735575|ref|YP_001877687.1| RNA methyltransferase, TrmH family, group 3 [Akkermansia muciniphila ATCC BAA-835] >gi|187425627|gb|ACD04906.1| RNA methyltransferase, TrmH family, group 3 [Akkermansia muciniphila ATCC BAA-835] (193 aa)
Score = 228, Expect = 2.3e-17, Identities = 51/159 (32%), Positives = 91/159 (57%)
  Q:    74 FDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            D  ++K +N      ++L+LD +QDP N GAI RT+    V  +I  ++  + I ETV++ S+G    + F++V NL+  + +L+    W   T+ D+    L  ++TD      +++G E +G+  L +++ DF+++I M  S+  LNVSV+T + LY
  S:    35 LDGILDKSSN-----PLLLILDCVQDPHNLGAILRTADGAGVDAVIAPRDKSVGITETVLRVSVGAAEKVPFIQVTNLARTMKQLQSRGIWIFGTS-DKGDRGL--YETDFTGPAALVMGAEGEGMRRLTEENCDFLLRIPMKGSIPCLNVSVATGVCLY 186
>gi|196194560|gb|EDX89519.1| RNA methyltransferase, TrmH family, group 3 [Alcanivorax sp. DG881] (249 aa)
Score = 228, Expect = 2.3e-17, Identities = 45/143 (31%), Positives = 82/143 (57%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++L+L+ + DP N GA  R++ +  V  +I  + N   +     +T++G    L + ++ NL+ +L++L+    W V TAL+E+S  L  F+     L +++G E  G+  L +   D +++I M   VQSLNVSV+T ++L+
  S:   101 LLLILENVTDPHNLGACLRSADAAGVQAVIVPRRNAAGLTPVACRTAVGAAESLVYYEIGNLASLLDQLRDRGVWVVGTALEERSESLFTFQPP-ESLAIVMGAEGSGLKRLTRDKCDQLLEIPMAGEVQSLNVSVATGVMLF 242
>gi|72382102|ref|YP_291457.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. NATL2A] >gi|72001952|gb|AAZ57754.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. NATL2A] (416 aa)
Score = 228, Expect = 2.3e-17, Identities = 69/206 (33%), Positives = 110/206 (53%)
  Q:    27 YFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +F  LK+ K+  + + +V+     +     VHQ I L IA   +L    D  + I+       D  ++L LD + DP N GAI R++++    G+I  +     +  +V K + G + +L   +V NL+  L KLK E Y TV    +E S  LS+ K     LVV+VG+E+KG+S + ++  D +V+I +     SLN SV+T+I LY
  S:   184 FFQLLKDQKASGVLVEEVSWSRLGQLTNGAVHQGIVLQIAASKTL----DLKNLIDACKAFG-DSSLLLALDGLTDPQNLGAIIRSAEALGAQGLILPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEKLKDEGY-TVVGLAEEGSSTLSEIKFQ-GPLVVVVGSEDKGISLITRRLCDQLVRIPLKGVTTSLNASVATSIFLY 385
>gi|149192027|ref|ZP_01870254.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio shilonii AK1] >gi|148834128|gb|EDL51138.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio shilonii AK1] (245 aa)
Score = 228, Expect = 2.4e-17, Identities = 58/202 (28%), Positives = 100/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E     + + ++N+K  D       HQ I+   K +      D DS + +       + ++L+LD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W   TA  E +  + + K D   L +++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    41 LNELTQIGVSIQQMNRKTLDDKARGANHQGIIAKVKPAKQLNENDLDSILSQ-----HAQPLLLILDGVTDPHNLGACLRNADAAGVAAVIVPKDRSAPLTATVSKVACGAAETVPLVRVTNLARTMRSLQEQGIWIAGTA-GEATHDIYQAKLD-GPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|116053085|ref|YP_793404.1| TrmH family RNA methyltransferase , group 3 [Pseudomonas aeruginosa UCBPP-PA14] >gi|115588306|gb|ABJ14321.1| putative RNA methyltransferase, TrmH family, group 3 [Pseudomonas aeruginosa UCBPP-PA14] (248 aa)
Score = 228, Expect = 2.4e-17, Identities = 56/194 (28%), Positives = 101/194 (52%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           I + + +++  D++ E VHQ ++     S +      +  +E+   +     ++L LD + DP N GA  RT+ +  V  +I  K+    +N TV K + G    +  + V NL+  L KL++   W V TA +      + ++ D+    V+++G E KG+  L ++  DF+ ++ M  SV SLNVSV+T + L+
  S:    50 IPVGQRDRRELDEWAEGVHQGVVAEVSPSQVWGENMLEELLERSEGV----PLLLALDGVTDPHNLGACLRTADAAGVQAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADK---TLYQLDLTGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238
>gi|191639244|ref|YP_001988410.1| TRNA/rRNA methyltransferase [Lactobacillus casei] >gi|190713546|emb|CAQ67552.1| TRNA/rRNA methyltransferase [Lactobacillus casei BL23] (259 aa)
Score = 228, Expect = 2.5e-17, Identities = 48/141 (34%), Positives = 78/141 (55%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L+LD ++DP N G+I RT+ +  V G+I  K+  + +   V K S G + Y+   +V NL++ +  LK+ + W   TA+D +       K       +++GNE KG+S  + K  D ++ I M   VQSLN SV+  I++Y
  S:   112 LLLDNLEDPHNLGSILRTADASGVHGVIIPKHRAVGLTSAVAKVSTGAIEYVPVARVTNLAQTIKTLKERSMWVFGTAMDGQDYRKWDAK---GSTALVIGNEGKGISPGVAKLMDAMIAIPMVGHVQSLNASVAAGILMY 249
>gi|15600129|ref|NP_253623.1| putative rRNA methylase [Pseudomonas aeruginosa PAO1] >gi|194555158|ref|YP_002090185.1| hypothetical protein PA2G_05016 [Pseudomonas aeruginosa 2192] >gi|52783327|sp|Q9HUM8|RLMB_PSEAE 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|9951215|gb|AAG08321.1|AE004906_9 probable rRNA methylase [Pseudomonas aeruginosa PAO1] >gi|126197551|gb|EAZ61614.1| hypothetical protein PA2G_05016 [Pseudomonas aeruginosa 2192] (248 aa)
Score = 228, Expect = 2.5e-17, Identities = 56/194 (28%), Positives = 101/194 (52%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           I + + +++  D++ E VHQ ++     S +      +  +E+   +     ++L LD + DP N GA  RT+ +  V  +I  K+    +N TV K + G    +  + V NL+  L KL++   W V TA +      + ++ D+    V+++G E KG+  L ++  DF+ ++ M  SV SLNVSV+T + L+
  S:    50 IPVGQRDRRELDEWAEGVHQGVVAEVSPSQVWGENMLEELLERSEGV----PLLLALDGVTDPHNLGACLRTADAAGVQAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADK---TLYQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238
>gi|58698910|ref|ZP_00373774.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534575|gb|EAL58710.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont of Drosophila ananassae] (236 aa)
Score = 228, Expect = 2.6e-17, Identities = 66/213 (30%), Positives = 114/213 (53%)
  Q:    20 SEVYYVSYFDELKE-FKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIP-LSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +E +Y  +  E+++   SK IK+  V  K  +       N  GIA   +  +   ++  IE+I   + D   I++LD++ D  N G+I RTS  F V  ++   N+    N ++ K + G ++ +  + V N+ + +  LKK  YW  C   D  +   + + K+   K V+I G+E KGV  L+K++ D+++KI M +++ SLNVS + AI LY
  S:    17 TENFYREHKKEIRQCVDSKGIKVRLVESKILNDVLPKGANHQGIALNVAPIL---YNLSIEEIAESSNDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPHNHSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYW--CYGFDCNTKENIDEIKSFEKKRVIIFGSEEKGVRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 226
>gi|119487909|ref|ZP_01621406.1| tRNA/rRNA methyltransferase [Lyngbya sp. PCC 8106] >gi|119455485|gb|EAW36623.1| tRNA/rRNA methyltransferase [Lyngbya sp. PCC 8106] (295 aa)
Score = 228, Expect = 2.7e-17, Identities = 65/228 (28%), Positives = 119/228 (52%)
  Q:     5 FGKKAVIEAFK-QNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQ---------NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCT-ALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+  V+ A + +  L+ ++ V        F+ K +   K N    D+  V +Q         N  GI  + S   + +    I+ +    + + +I++ + + DP N GAI RTS++  V+G+I  +   + I  TV+K + G +      +V NL+  L +LK+  +W   T A  ++ +   KF   +   V++VG+E +G++ LI++  D +V I +     SLNVSV+T + LY
  S:    54 YGRHTVLAALENERSLNRIWMVPQLQSDNRFQ-KGLSTAKANGTLIDR--VSNQRLDQIAPGTNHQGIVAQVSPYAYKELSELID-LAKAASSEPVIVMAEGLTDPHNLGAIIRTSEAIGVSGLILPQRRAVGITSTVMKVAAGALETFPVARVVNLNRALEELKQAGFWIYGTSATADQPLYTVKFSGPV---VLVVGSEGQGLTRLIEQSCDILVSIPLVGQTPSLNVSVATGMALY 285
>gi|28377488|ref|NP_784380.1| tRNA/rRNA methyltransferase [Lactobacillus plantarum WCFS1] >gi|28270320|emb|CAD63221.1| tRNA/rRNA methyltransferase [Lactobacillus plantarum WCFS1] (255 aa)
Score = 228, Expect = 2.8e-17, Identities = 64/204 (31%), Positives = 105/204 (51%)
  Q:    29 DELKEFKSKNIKLNKVNKKFFDKY--EVVHQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           D  K  K +N+ +  V K+  D+      HQ + +G+A     TI   F      +     +    L+LD I+DP N G+I RT+ +    GII  K   + +  TV KTS G + ++   +V NL + + +L++   W   T ++         + D +  V +I+GNE KG+S L+KK  D ++ I M   VQSLN SV+ ++++Y
  S:    46 DIAKIAKKRNLIVQYVPKQKLDRLTDNANHQGVAVGVAAFEYATIDDLF-----AVAKAKNEAPFFLILDNIEDPHNLGSIMRTADAAGAHGIIIPKRRAVGLTSTVAKTSTGAIEHVKVARVTNLVQTVKQLQEAGLWIFGTDMNGTDYR----QWDASGAVGLIIGNEGKGISPLLKKSVDEMLTIPMIGHVQSLNASVAASLLIY 244
>gi|148264836|ref|YP_001231542.1| RNA methyltransferase [Geobacter uraniireducens Rf4] >gi|146398336|gb|ABQ26969.1| RNA methyltransferase, TrmH family, group 3 [Geobacter uraniireducens Rf4] (242 aa)
Score = 227, Expect = 2.9e-17, Identities = 51/143 (35%), Positives = 81/143 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD +QDP N GA+ R++      G+I  ++  + +  TV K S G +  +   +V N++  L +LK   +W      D +S PLS F   +   VV+V G+E +G+  L+KK  DF+V I +   V SLN SV+  I+L+
  S:    93 LLLVLDGVQDPHNLGALIRSAACAGAQGVIIPRDRAVGVTATVEKASAGAIETIPVAEVTNVAHTLEELKNAGFWIY--GADGES-PLSIFDQKLTGAVVLVIGSEGEGIRPLVKKKCDFLVSIPLRGGVNSLNASVAGGILLF 233
>gi|121610346|ref|YP_998153.1| RNA methyltransferase [Verminephrobacter eiseniae EF01-2] >gi|121554986|gb|ABM59135.1| RNA methyltransferase, TrmH family, group 3 [Verminephrobacter eiseniae EF01-2] (248 aa)
Score = 227, Expect = 3.0e-17, Identities = 51/161 (31%), Positives = 86/161 (53%)
  Q:    72 TDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +  D  +EK+    +   ++LVLD + DP N GA  R +       +I  K++ + IN TV K + G    + +  V NL+  L++LK+ + W + T  D    P + ++ D+   V +V G E  G+ +  +K  D + +I M  +V+SLNVSV++ I LY
  S:    83 SSLDELLEKLQAAGSGPPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGINATVAKVASGAAETMPYFMVTNLARTLDELKERSIWCIGTCDDA---PGTLYQLDLKGPVALVLGAEGSGMRQRTRKTCDELARIPMQGAVESLNVSVASGICLY 241
>gi|187928166|ref|YP_001898653.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii 12J] >gi|187725056|gb|ACD26221.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii 12J] (250 aa)
Score = 227, Expect = 3.0e-17, Identities = 54/177 (30%), Positives = 95/177 (53%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK  SL++  + D  ++ I        ++LVLD + DP N GA  R + +     +I  K+  + IN TV K + G    + ++ V NL+  L +L++   W + TA + E+ +  + FK       +++G E +G+  L ++  D +V I M  SV+SLNVSV++ + L+
  S:    69 HQGV--VAKAESLSLALNLDELLDGIEG----TPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLYQADFK---GPTAIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLF 237
>gi|190571500|ref|YP_001975858.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia pipientis] >gi|190357772|emb|CAQ55226.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia pipientis] (255 aa)
Score = 227, Expect = 3.3e-17, Identities = 71/228 (31%), Positives = 117/228 (51%)
  Q:     5 FGKKAVIEAFKQNE-------LSEVYYVSYFDELKE-FKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK   I A +          ++E +Y  +  E+K+   SK IK   V  K F+       N  GIA + +   H+     IE+I   + D   I++LD+I D  N G+I RTS  F +  ++   ++    N ++ K + G ++ +  + V N+ + +  LKK  YW  C   D      + + K    K V+I G+E KG+  L+K+  D+++KI M + + SLNVS + AI LY
  S:    13 YGKHTCISALRNKNRRCIELLVTENFYREFEKEIKQCADSKGIKPRLVENKMFNDVLPKGVNHQGIALKVAPIFHS---LNIEEIAEGSGDSSTIVILDQITDTHNIGSILRTSACFNIDALVLPHHHSPSENASIAKAASGALDIVPLIYVTNIVKTMESLKKIGYW--CYGFDCNAKENIDEIKNFGQKRVIIFGSEEKGMRRLVKESCDYLLKIPMSNVIDSLNVSNAAAIGLY 244
>gi|117923731|ref|YP_864348.1| RNA methyltransferase [Magnetococcus sp. MC-1] >gi|117607487|gb|ABK42942.1| RNA methyltransferase, TrmH family, group 3 [Magnetococcus sp. MC-1] (246 aa)
Score = 227, Expect = 3.4e-17, Identities = 54/202 (26%), Positives = 98/202 (48%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ F+++ + +    +   D+      HQ ++            D    +EK       + ++++LD ++DP N GAI R++++F    +I  K+    +N   IK S G    L+ ++V NL+  + +L++ N W +  A  E   PL         L +++GNE  G+  L ++  D +  I M   V SLNVSV+T + LY
  S:    41 IEGFRARGVPIQFCERTAMDRMADGGAHQGVIARCAPREAMSWDDLLDVVEK-----AKQPLLVILDGVEDPHNLGAIMRSAEAFGALAVILPKDRTAPLNAGAIKASAGAAERLDLIRVTNLARAIEQLQQRNVWVIGLA-GEAGAPLIGTLDCKGPLALVMGNEGSGLRRLTRERCDQLAAIPMGGGVGSLNVSVATGVALY 238
>gi|170723830|ref|YP_001751518.1| RNA methyltransferase [Pseudomonas putida W619] >gi|169761833|gb|ACA75149.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida W619] (248 aa)
Score = 227, Expect = 3.5e-17, Identities = 52/143 (36%), Positives = 81/143 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +ILVLD + DP N GA  RT+ +     ++  K+    +   V K + G    +  + V NL+  L KL++   W V TA + E+ I    ++ D+   LV+I+G E KG+  L ++  DF+VK+ M  SV SLNVSV+T + L+
  S:    98 LILVLDGVTDPHNLGACLRTADAAGATAVVVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI----YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMSGSVSSLNVSVATGVCLF 238
>gi|152983804|ref|YP_001350984.1| putative rRNA methylase [Pseudomonas aeruginosa PA7] >gi|150958962|gb|ABR80987.1| probable rRNA methylase [Pseudomonas aeruginosa PA7] (248 aa)
Score = 227, Expect = 3.5e-17, Identities = 56/194 (28%), Positives = 100/194 (51%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           I + + +++  D++ E VHQ ++     S +      +  +E+         ++L LD + DP N GA  RT+ +  V  +I  K+    +N TV K + G    +  + V NL+  L KL++   W V TA +      + ++ D+    V+++G E KG+  L ++  DF+ ++ M  SV SLNVSV+T + L+
  S:    50 IPVGQRDRRELDEWAEGVHQGVVAEVSPSQVWGENMLEELLERAEG----APLLLALDGVTDPHNLGACLRTADAAGVLAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADK---TLYQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238
>gi|26991558|ref|NP_746983.1| RNA methyltransferase [Pseudomonas putida KT2440] >gi|52783313|sp|Q88DE7|RLMB_PSEPK 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|24986644|gb|AAN70447.1|AE016686_1 RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida KT2440] (248 aa)
Score = 227, Expect = 3.5e-17, Identities = 53/143 (37%), Positives = 81/143 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +ILVLD + DP N GA  RT+ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA + E+ I    ++ D+   LV+I+G E KG+  L ++  DF+VK+ M  SV SLNVSV+T + L+
  S:    98 LILVLDGVTDPHNLGACLRTADAAGATAVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI----YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238
>gi|148549961|ref|YP_001270063.1| RNA methyltransferase [Pseudomonas putida F1] >gi|148514019|gb|ABQ80879.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida F1] (248 aa)
Score = 227, Expect = 3.5e-17, Identities = 53/143 (37%), Positives = 81/143 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +ILVLD + DP N GA  RT+ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA + E+ I    ++ D+   LV+I+G E KG+  L ++  DF+VK+ M  SV SLNVSV+T + L+
  S:    98 LILVLDGVTDPHNLGACLRTADAAGATAVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI----YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238
>gi|107104035|ref|ZP_01367953.1| hypothetical protein PaerPA_01005108 [Pseudomonas aeruginosa PACS2] >gi|194549334|ref|YP_002084362.1| hypothetical protein PACG_04484 [Pseudomonas aeruginosa C3719] >gi|126170280|gb|EAZ55791.1| hypothetical protein PACG_04484 [Pseudomonas aeruginosa C3719] (248 aa)
Score = 226, Expect = 3.7e-17, Identities = 56/194 (28%), Positives = 101/194 (52%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           I + + +++  D++ E VHQ ++     S +      +  +E+   +     ++L LD + DP N GA  RT+ +  V  +I  K+    +N TV K + G    +  + V NL+  L KL++   W V TA +      + ++ D+    V+++G E KG+  L ++  DF+ ++ M  SV SLNVSV+T + L+
  S:    50 IPVGQRDRRELDEWAEGVHQGVVAEVSPSQVWGENMLEELLERGEGV----PLLLALDGVTDPHNLGACLRTADAAGVQAVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADK---TLYQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238
>gi|17545948|ref|NP_519350.1| putative tRNA/rRNA methyltransferase protein [Ralstonia solanacearum GMI1000] >gi|52783318|sp|Q8Y016|RLMB_RALSO 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|17428243|emb|CAD14931.1| probable 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna gm2251 2'-o-methyltransferase) protein [Ralstonia solanacearum] (249 aa)
Score = 226, Expect = 3.7e-17, Identities = 54/177 (30%), Positives = 96/177 (54%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK  +L++  + D  ++ I        ++LVLD + DP N GA  R + +     +I  K+  + IN TV K + G    + ++ V NL+  L +L++   W + TA + E+ +  + FK  I    +++G E +G+  L ++  D +V I M  SV+SLNVSV++ + L+
  S:    69 HQGV--VAKAEALSLALNLDELLDGIEG----PPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLYRADFKGPI---ALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLF 237
>gi|186899751|ref|ZP_02972712.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 7424] >gi|186693160|gb|EDU17775.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 7424] (310 aa)
Score = 226, Expect = 4.2e-17, Identities = 57/175 (32%), Positives = 91/175 (52%)
  Q:    58 NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDE-KSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           N  GI  + S   + + +  IE+     +   +IL+ D I DP N GA+ RT+++    G++  +     I  TV+K + G + +L   +V NLS  L +LK+  +W   T  D  K +    FK  +    ++VG+E +G+S L +K  D +V I +     SLN SV+TAI LY
  S:   113 NHQGIVAQISPYAYVELEELIEQAK-ARSSAPVILIADGITDPHNLGAMIRTTEAMGAQGLVIPQRRAAGITSTVMKVAAGALEHLPVARVVNLSRALEQLKEAGFWLYGTMADSGKLLHTIDFKGAVG---LVVGSEGEGLSLLTQKSCDALVSIPLAGKTPSLNASVATAIALY 284
>gi|183602645|ref|ZP_02964009.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis subsp. lactis HN019] >gi|183218063|gb|EDT88710.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis subsp. lactis HN019] (331 aa)
Score = 226, Expect = 4.3e-17, Identities = 51/145 (35%), Positives = 84/145 (57%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD---EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + + LD I DP N GA+ R++ +F V G+I  +     +N    K S G   ++   +V NL++ +  LK+  Y+++   LD    K +  + F+TD   LVV++G+E KG+S L ++  D I  I + S+V+SLN SV+  I LY
  S:   174 RPLFIALDGITDPQNLGAVIRSAAAFGVNGVILPERRSASVNAAAWKVSAGAAAHMPIARVVNLTKAIEALKERGYYSI--GLDGGGSKLVGETGFETD--PLVVVLGSEGKGLSRLTREACDAIASIPITSAVESLNASVAAGIALY 317
>gi|148657561|ref|YP_001277766.1| RNA methyltransferase [Roseiflexus sp. RS-1] >gi|148569671|gb|ABQ91816.1| RNA methyltransferase, TrmH family, group 3 [Roseiflexus sp. RS-1] (252 aa)
Score = 226, Expect = 4.4e-17, Identities = 50/176 (28%), Positives = 92/176 (52%)
  Q:    58 NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYY 233
           N  G+A E S   + D +  +  +     +   +L+LD IQDP N G + RT++   V G++       ++   V+ TS G V +L    V NL+  + +++    W V    DE++    +   D+  L +++G E  G++ L ++  DF+V++ M   + SLNV+V+ +I+LY+
  S:    67 NHQGVALECSDYPYVDLNDCL-ALAEERGEPAFLLLLDHIQDPQNVGTLLRTAEVVGVHGVVIPGRRAAEVTPAVVNTSSGAVEHLRVAVVTNLAATIEQIQHAGVWVVGVEDDERAYEYDRVDLDL-PLALVLGAEGPGLARLTRERCDFLVRLPMRGQIASLNVAVAGSIVLYH 240
>gi|77361394|ref|YP_340969.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pseudoalteromonas haloplanktis TAC125] >gi|76876305|emb|CAI87527.1| Gm2251 methyltransferase of 23S rRNA [Pseudoalteromonas haloplanktis TAC125] (247 aa)
Score = 226, Expect = 4.4e-17, Identities = 55/177 (31%), Positives = 88/177 (49%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K +      D D+ I +      D   +LVLD I DP N GA  R++ +  V  +I  K+   ++N T  K + G    +  ++V NL+  L ++K    W V TA +  +       T    + +++G E +G+  L ++  D +VKI M  +V SLNVSV+T I L+
  S:    68 HQGIIANVKAAPTFNEKDLDAIIAR-----EDTPFLLVLDGITDPHNLGACLRSADAAGVHAVIVPKDRSAKLNGTARKVACGAAETVPLIQVTNLARTLREIKDAGVWVVGTAGETDNHVFDASLT--GPMAIVMGAEGEGMRRLTREHCDLLVKIPMAGTVSSLNVSVATGICLF 237
>gi|189183948|ref|YP_001937733.1| tRNA/rRNA methyltransferase, TrmH family [Orientia tsutsugamushi str. Ikeda] >gi|189180719|dbj|BAG40499.1| tRNA/rRNA methyltransferase, TrmH family [Orientia tsutsugamushi str. Ikeda] (266 aa)
Score = 226, Expect = 4.5e-17, Identities = 53/150 (35%), Positives = 88/150 (58%)
  Q:    83 NLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +L T    I +LD++ D  N GAI R++ +F ++ II  +NN I+ N T+ K ++G +  +N +KV NL   +N LKK  +W +   LD  +      +T  +K+  ++G+ENKG+  L ++  DF++KI M    +SLNV+ +  II Y
  S:   109 DLATPNYKIAILDQLLDHNNLGAIIRSAAAFNISTIILPENNSIEENGTIAKIAVGALEKINLVKVKNLYNTINYLKKYGFWII--GLDLNNSNQLTEQTFHSKMAFVLGSENKGLRNLTRQQCDFLIKIPMSHKTESLNVAGAATIIFY 256
>gi|188535077|ref|YP_001908874.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia tasmaniensis] >gi|188030119|emb|CAO98005.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia tasmaniensis] (245 aa)
Score = 226, Expect = 4.6e-17, Identities = 58/202 (28%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K  +++ I +   NK+  D      VHQ I+   K        D    +  ++N       +L+LD + DP N GA  R++ +  V  II  K+    +N T  K + G   ++  ++V NL+  +  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 VKALEAQGIVIQVANKQMLDNTSEGAVHQGIIARVKPGRQYQEGDLPDLLNSLDN-----PFLLILDGVTDPHNLGACMRSADAAGVHAIIVPKDRSAALNATAKKVASGAAEHIPLIRVTNLARTMRVLQEANVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236
>gi|148244642|ref|YP_001219336.1| RNA methyltransferase [Candidatus Vesicomyosocius okutanii HA] >gi|146326469|dbj|BAF61612.1| RNA methyltransferase, TrmH family [Candidatus Vesicomyosocius okutanii HA] (247 aa)
Score = 225, Expect = 4.8e-17, Identities = 73/228 (32%), Positives = 117/228 (51%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKL-VVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           F  K +I+ F  N+  +    +   E+  F   +I + +  K   DK    +Q   GIA E  L I  +    I  ++ L+ +  +IL+LD IQDP N GA  R++ +  V  +I  K+    I+  V KTS G +N +   +V NLS  +  L+++N W +   LD  +  L  ++ D+     +I+G+E  G+  L K+  D + KI M   V+SLNVSV+T I L+
  S:    19 FNPKYLIKIFILNKRCDKRLNTLILEINNF---DINIQQCTKVQLDKLSN-YQTHQGIAAEILLPILPNQCELITYVSKLD-NASLILILDSIQDPRNLGACLRSANAAGVDCVIINKDGSASISALVHKTSAGAINQIKIFQVTNLSRTIKALQQQNIWVI--GLDSSANTLI-YQIDLTTPNAIIMGSEGFGLKRLTKQSCDQLAKIPMQGKVESLNVSVATGITLF 239
>gi|83594035|ref|YP_427787.1| RNA methyltransferase TrmH, group 3 [Rhodospirillum rubrum ATCC 11170] >gi|83576949|gb|ABC23500.1| RNA methyltransferase TrmH, group 3 [Rhodospirillum rubrum ATCC 11170] (348 aa)
Score = 225, Expect = 4.9e-17, Identities = 43/146 (29%), Positives = 83/146 (56%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           ++ +LD++ DP N GA+ R++ +F +  ++ +  +  +   T+ K++ GT+  +  ++  NLS+ L+  K+  +W  C  LD  +           + VV++G+E  G+  L++   D +VK+ MDS V+SLNVS + A+  Y L+
  S:   199 VVAILDQVSDPHNIGAVLRSAAAFGIRAVVVQDRHSPEETGTLAKSASGTLERVPLVRAINLSQALDTFKEHGFW--CAGLDASAETTLAEAALPERCVVVLGSEGAGLRRLVRDHCDLLVKLAMDSGVESLNVSNAAAVTFYELS 342
>gi|124025638|ref|YP_001014754.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. NATL1A] >gi|123960706|gb|ABM75489.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. NATL1A] (442 aa)
Score = 225, Expect = 5.0e-17, Identities = 69/206 (33%), Positives = 110/206 (53%)
  Q:    27 YFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +F  LK+ K+  + + +V+     +     VHQ I L IA   +L    D  + I+       D  ++L LD + DP N GAI R++++    G+I  +     +  +V K + G + +L   +V NL+  L KLK E Y TV    +E S  LS+ K     LVV+VG+E+KG+S + ++  D +V+I +     SLN SV+T+I LY
  S:   210 FFQLLKDQKASGVLVEEVSWSRLGQLTNGAVHQGIVLQIAASKTL----DLKNLIDACKAFG-DSSLLLALDGLTDPQNLGAIIRSAEALGAQGLILPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEKLKDEGY-TVVGLAEEGSSTLSEIKFQ-GPLVVVVGSEDKGISLITRRLCDQLVRIPLKGVTTSLNASVATSIFLY 411
>gi|39996562|ref|NP_952513.1| RNA methyltransferase [Geobacter sulfurreducens PCA] >gi|39983443|gb|AAR34836.1| RNA methyltransferase, TrmH family, group 3 [Geobacter sulfurreducens PCA] (245 aa)
Score = 225, Expect = 5.1e-17, Identities = 49/143 (34%), Positives = 79/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +ILVLD IQDP N GA+ R++      G+I  ++    +  +V K S G    +   +V N+ + L  LK+E +W   TA    S   S +  D+   +V+++G E +GV  L++K  DF+V I +   V SLN SV+  ++L+
  S:    97 LILVLDGIQDPHNLGALIRSAACAGAHGVIIPRDRAAGVTASVEKISAGATETIPVAQVTNVVQALETLKEEGFWAFGTA---DSAASSLYSHDLTGNVVIVIGGEGEGVRPLVRKKCDFLVAIPLKGGVSSLNASVAGGVVLF 237
>gi|88810597|ref|ZP_01125854.1| RNA methyltransferase, TrmH family, group 3 [Nitrococcus mobilis Nb-231] >gi|88792227|gb|EAR23337.1| RNA methyltransferase, TrmH family, group 3 [Nitrococcus mobilis Nb-231] (256 aa)
Score = 225, Expect = 5.1e-17, Identities = 46/143 (32%), Positives = 84/143 (58%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD++QDP N GA  RT+    V  +I  ++  + +  TV K + G V ++   +V NL+  L KL++   W +  A   +   ++ ++ D++  LV+++G E  G+  L +   D +++I M  ++ SLNVSV+T ++LY
  S:    99 LLLVLDQVQDPHNLGACLRTAAGAGVQAVITPRDRAVGLTPTVYKAATGAVQHIPLFQVTNLARTLRKLREAGMWLIGAA---EQADVTLYEVDLSGPLVLVMGAEEAGLRRLTRACCDRLIRIPMLGAIDSLNVSVATGVVLY 239
>gi|88658569|ref|YP_507224.1| RNA methyltransferase [Ehrlichia chaffeensis str. Arkansas] >gi|88600026|gb|ABD45495.1| RNA methyltransferase, TrmH family, group 3 [Ehrlichia chaffeensis str. Arkansas] (252 aa)
Score = 225, Expect = 5.1e-17, Identities = 70/202 (34%), Positives = 110/202 (54%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIP-LSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L+  K KNI L +VN  + +     + N  GIA ++S+   T     +E++ N + +   I++LD++ D  N G+I R++  F V  II   +N    N  + KTS G V+ +  + V N+   +  LKK  YW  C   D K    L K K D  KL +I G+E+KG+ +L K++ DF++KI +   + SLNVS + A+ LY
  S:    45 LRLCKQKNINLKQVNPNYINSVLPHNSNHQGIALKASVIDSTT----VEEVLNTSKESSTIILLDQVTDIHNVGSIIRSAVCFNVDAIILPYHNSPSENCGMSKTSSGAVDMIPIVYVINIVNTIKLLKKAGYW--CYGFDAKEGEFLHKTKLDSKKL-IIFGSEDKGMRKLTKENCDFLLKIAISKKIDSLNVSNAAAVALY 240
>gi|148543542|ref|YP_001270912.1| RNA methyltransferase [Lactobacillus reuteri F275] >gi|184152948|ref|YP_001841289.1| tRNA/rRNA methyltransferase [Lactobacillus reuteri F275] >gi|148530576|gb|ABQ82575.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus reuteri F275] >gi|183224292|dbj|BAG24809.1| tRNA/rRNA methyltransferase [Lactobacillus reuteri F275] (249 aa)
Score = 225, Expect = 5.2e-17, Identities = 58/177 (32%), Positives = 97/177 (54%)
  Q:    56 HQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ + L +A     TI   FD+  +     + +    L+LDE++DP N G+I RT+ +  V GII  +   + +   V KTS G + ++   +V NL +   +L++   W   T +  K      ++T D +  V +++GNE KG+S L+KK  D ++ I M   VQSLN SV+ ++++Y
  S:    70 HQGVVLAVAAYQYATIDDLFDNAAK-----HDEDPFFLILDELEDPHNLGSIMRTADAAGVHGIIIPRRRAVGLTSVVAKTSTGAIEHVPVARVTNLVQTAKELQERGVWLFGTDMKGKD-----YRTWDAHGAVALVIGNEGKGISSLLKKTCDEMLTIPMVGHVQSLNASVAASLLIY 239
>gi|194468086|ref|ZP_03074072.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus reuteri 100-23] >gi|194452939|gb|EDX41837.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus reuteri 100-23] (249 aa)
Score = 225, Expect = 5.3e-17, Identities = 58/177 (32%), Positives = 97/177 (54%)
  Q:    56 HQNI-LGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKT-DINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ + L +A     TI   FD+  +     + +    L+LDE++DP N G+I RT+ +  V GII  +   + +   V KTS G + ++   +V NL +   +L++   W   T +  K      ++T D +  V +++GNE KG+S L+KK  D ++ I M   VQSLN SV+ ++++Y
  S:    70 HQGVVLAVAAYQYATIDDLFDNAAK-----HGEDPFFLILDELEDPHNLGSIMRTADAAGVHGIIIPRRRAVGLTSVVAKTSTGAIEHVPVARVTNLVQTAKELQERGVWLFGTDMKGKD-----YRTWDAHGAVALVIGNEGKGISSLLKKTCDEMLTIPMVGHVQSLNASVAASLLIY 239
>gi|89094562|ref|ZP_01167500.1| hypothetical protein MED92_00984 [Oceanospirillum sp. MED92] >gi|89081161|gb|EAR60395.1| hypothetical protein MED92_00984 [Oceanospirillum sp. MED92] (245 aa)
Score = 225, Expect = 5.4e-17, Identities = 56/194 (28%), Positives = 104/194 (53%)
  Q:    39 IKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           I++ +V+K+  ++     VHQ ++ + K     I T  + +++K+ +   +   +L+LD + DP N GA  RT+ +  V  ++  K+    +N T  K + G    + ++ V NL+  L  L++   WT  TA +     L  ++ ++   + +I+G E +G+  L ++  D +VKI M   V SLNVSV+T I L+
  S:    49 IRIEQVSKRELEELVKGAVHQGVVALCK----PIQTYNEQYLDKLLDQLEEPPFLLILDGVTDPHNLGACLRTADAAGVQAVVAPKDKSAPLNATAAKVACGAAESVPYVLVTNLARTLKSLQERGVWTTGTAGETD---LDIYQANLKGPMALIMGAEGQGMRRLTREHCDQLVKIPMAGEVSSLNVSVATGICLF 238
>gi|91216066|ref|ZP_01253034.1| putative tRNA:rRNA methyltransferase [Psychroflexus torquis ATCC 700755] >gi|91185583|gb|EAS71958.1| putative tRNA:rRNA methyltransferase [Psychroflexus torquis ATCC 700755] (249 aa)
Score = 225, Expect = 5.5e-17, Identities = 77/228 (33%), Positives = 128/228 (56%)
  Q:     5 FGKKAVIEAFKQ-NELSEVYYVSYFD--ELKEFK----SKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK-LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           FG  +++EA +Q  ++ ++  +   D  +LKE +       IK++ V  + F KYE ++    G    +S   ++DF+  +EK+  +  +K + L+LD I D  N GAI RT++   V  +I  K+   Q+N   IKTS G    +   KVN+L + L  LK      V  A+ EK+   S ++ ++NK L +++G E +G+   I K +D   K+ M  S++SLNVSV+  +ILY
  S:     8 FGIHSIVEALRQGKDIEKIILLRDSDNPKLKEIEGLAEQNTIKVSYVPIQKFKKYEQLNHQ--GAIAHTSKISYSDFEETVEKVLEIK-EKPLFLLLDGITDVRNLGAILRTAECTGVDAVILPKSGSAQVNNETIKTSAGAAFNIPICKVNHLKDALFYLKSSGVEIV--AVTEKT-NTSVYELELNKPLALLMGGEGEGIQPSILKMADVKGKLPMLGSIESLNVSVACGVILY 237
>gi|118580099|ref|YP_901349.1| RNA methyltransferase [Pelobacter propionicus DSM 2379] >gi|118502809|gb|ABK99291.1| RNA methyltransferase, TrmH family, group 3 [Pelobacter propionicus DSM 2379] (251 aa)
Score = 225, Expect = 5.6e-17, Identities = 55/178 (30%), Positives = 89/178 (50%)
  Q:    61 GIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTV-CTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTHCL 238
           G+A + +   + D D  IE   +       +LVLD IQDP N GA+ RT+     +G++  ++    I     K S G V  +   +V N+++ L KLK+  YW    +   + S+    F     K+ +++G E +G+  L++K  D +V I +   V SLN SV+  I LY +  CL
  S:    69 GMALKVAPFSYADLDDLIEA-GDREDAAGFLLVLDGIQDPHNLGALIRTAACAGASGVVIPRDRACAITPAAEKASAGAVETITVAQVTNIAQSLEKLKRSGYWVYGLSGEADASLYEVAFS---GKIALVIGGEGEGIRPLVRKQCDALVSIPLYGGVGSLNASVAGGIALYEVARCL 243
>gi|149907739|ref|ZP_01896486.1| hypothetical protein PE36_07617 [Moritella sp. PE36] >gi|149809409|gb|EDM69338.1| hypothetical protein PE36_07617 [Moritella sp. PE36] (250 aa)
Score = 225, Expect = 5.6e-17, Identities = 59/202 (29%), Positives = 98/202 (48%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++E     I +  VN+   DK      H  +L   KE      +D D+ + ++        ++L+LD + DP N GA  R++ +  V  +I  K+  +Q+   V K + G    +  + V NL+  + +L+    W V TA  E +  L + K     L + +G E KG+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    41 IEELNDIGISVQLVNRNTLDKKCDGGRHNGVLARVKEGKKLNESDLDTLLNRLEE-KEQHPLLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDKSVQLTSVVRKVACGAAETVPLIAVTNLARTMRELQDRRIWIVGTA-GEATQDLYQPKL-TGPLAIAMGAEEKGLRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 241
>gi|196158259|ref|YP_002127748.1| Gm2251 methyltransferase of 23S rRNA [Alteromonas macleodii 'Deep ecotype'] >gi|196114038|gb|ACG67754.1| Gm2251 methyltransferase of 23S rRNA [Alteromonas macleodii 'Deep ecotype'] (246 aa)
Score = 225, Expect = 5.7e-17, Identities = 55/177 (31%), Positives = 90/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++  AK + +    D D  +E     +  + +ILVLD + DP N GA  RT+    V  ++  K+    +N TV K + G    +  +++ NL+  L  L+ +  W V TA +      + +  D+     +++G E KG+  L K+  D +VK+ M  SV SL VSV+T + LY
  S:    69 HQGVVARAKPARVLDEADLDKILE-----SEAQPLILVLDGVTDPHNLGACLRTADGAGVHAVVVPKDKSASLNGTVRKVACGAAEVVPLIQITNLARTLKHLQDKGLWIVGTAGETDK---TLYDVDLKGSTALVMGAEGKGMRRLTKETCDELVKLPMAGSVTSLYVSVATGVCLY 238
>gi|116495758|ref|YP_807492.1| rRNA methylase [Lactobacillus casei ATCC 334] >gi|116105908|gb|ABJ71050.1| rRNA methylase [Lactobacillus casei ATCC 334] (259 aa)
Score = 225, Expect = 5.7e-17, Identities = 48/141 (34%), Positives = 76/141 (53%)
  Q:    92 LVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L+LD ++DP N G+I RT+ +  V G+I  K+  + +   V K S G + Y+   +V NL++ +  LK+   W   TA+D +       K       +++GNE KG+S  + K  D  + I M   VQSLN SV+  I++Y
  S:   112 LLLDNLEDPHNLGSILRTADASGVHGVIIPKHRAVGLTSAVAKVSTGAIEYVPVARVTNLAQTIKTLKERGMWVFGTAMDGQDYRKWDAK---GSTALVIGNEGKGISPGVAKLMDATIAIPMVGHVQSLNASVAAGILMY 249
>gi|158338300|ref|YP_001519477.1| RNA methyltransferase [Acaryochloris marina MBIC11017] >gi|158308541|gb|ABW30158.1| RNA methyltransferase, TrmH family, group 3 [Acaryochloris marina MBIC11017] (309 aa)
Score = 225, Expect = 5.9e-17, Identities = 67/228 (29%), Positives = 116/228 (50%)
  Q:     5 FGKKAVIEAFK-QNELSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINK-LVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+ +V+ A + Q  L+ V+ VS       +   L + KS+   +++V+ +  ++   +  HQ   GIA + +   + D  + IE+ N   T K +I+  D I DP N GA+ RT+++    G+I  +     I   V K + G +  L   +V NL++ L +LKK  +W    +    S P S       +  V+++G E  G+S   +   D +V I +     SLN SV+T + LY
  S:    63 YGRHSVLSALEHQRSLNRVWVVSRLRYDPRFHSLLNQAKSQGTIIDEVDHRRLNQLTQQATHQ---GIAAQVAAYEYLDISTLIEQANAA-TPKPVIIAADSITDPHNLGAMIRTAEALGAQGVIIPQRRAAGITSVVAKVATGALETLAIARVVNLNQGLEQLKKAGFWIYGLS---TSAPQSIHTVTFTEPTVLVIGAEGPGLSVSTQHHCDQMVSIPLQGKTASLNASVATGMALY 294
>gi|54310420|ref|YP_131440.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Photobacterium profundum SS9] >gi|52783294|sp|Q6LM40|RLMB_PHOPR 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|46914861|emb|CAG21638.1| putative RNA methyltransferase, TrmH family [Photobacterium profundum SS9] (245 aa)
Score = 225, Expect = 6.1e-17, Identities = 59/202 (29%), Positives = 96/202 (47%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E K   I +    +K  D       HQ I+   K +      D D+ +E      ++  ++L+LD + DP N GA  R + +     +I  K+   Q+  T  K + G    +  ++V NL+  +  L+ +  W V TA +    I  SK       L +++G E +G+  L ++  D ++KI M  SV SLNVSV+T I L+
  S:    41 LTELKDLGITIQHAGRKALDDKAKGASHQGIIARVKPAKQLNEHDLDTILE-----GSENPLLLILDGVTDPHNLGACLRNADAAGAVAVIIPKDRAAQLTATASKVACGAAEVMPLVRVTNLARTMRALQDKGVWIVGTAGEATHDIYHSKLT---GPLAIVMGAEGEGMRRLTRETCDDLIKIPMAGSVSSLNVSVATGICLF 237
>gi|114564515|ref|YP_752029.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella frigidimarina NCIMB 400] >gi|114335808|gb|ABI73190.1| RNA methyltransferase, TrmH family, group 3 [Shewanella frigidimarina NCIMB 400] (246 aa)
Score = 225, Expect = 6.1e-17, Identities = 54/177 (30%), Positives = 89/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K        D D  ++K     T    +L+LD + DP N GA  R + +  V  +I  K+N + +  TV K + G    +   +V NL+  +  L+ +  W V TA + +    + ++ D+   L + +G E+KG+  L ++  D +V I M  SV SLNVSV+T + L+
  S:    69 HQGIVARVKAVKPLTEKDLDELLDK-----TAVPFLLILDGVTDPHNLGACLRNADAAGVHAVIVPKDNSVGLTSTVSKVACGAAETIPLFQVTNLARTMRHLQDKGVWIVGTAGEAEG---NVYQADLKGPLAIAMGAEDKGLRRLSREGCDSLVSIPMSGSVSSLNVSVATGVCLF 238
>gi|147676634|ref|YP_001210849.1| rRNA methylases [Pelotomaculum thermopropionicum SI] >gi|146272731|dbj|BAF58480.1| rRNA methylases [Pelotomaculum thermopropionicum SI] (261 aa)
Score = 224, Expect = 6.6e-17, Identities = 60/227 (26%), Positives = 114/227 (50%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+  V EA + N       ++E        E+ +  + + I + +V ++   K   E  HQ ++ +A   ++  + D D  +  +     +   +++LDE+ DP N GAI RT+ +    GII  +     ++ TV ++S G V Y+   +V N++  +  LK +  W      D + +     + D   + +++G E KG+  L+K+  D +V++ M   V SLN SV+ A++ Y
  S:    22 GRNPVREALRANRPINKLLIAEGALTGSLREIYDLARERKIPVQRVERQHLSKLVPEASHQGVVALA---AVREYVDVDDILAGV--APGEDPFLILLDEVHDPHNLGAILRTADAAGAHGIIIPRRRSAPLSRTVARSSAGAVEYVPVARVANIARTIELLKGKGLWVAGADPDGREVYWDA-RLD-GPVALVIGGEGKGLGRLVKEKCDVLVRLPMSGRVNSLNASVAAALLSY 250
>gi|116621924|ref|YP_824080.1| RNA methyltransferase [Solibacter usitatus Ellin6076] >gi|116225086|gb|ABJ83795.1| RNA methyltransferase, TrmH family, group 3 [Solibacter usitatus Ellin6076] (237 aa)
Score = 224, Expect = 6.6e-17, Identities = 51/177 (28%), Positives = 89/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++G+        + D DS  E         ++++VLD ++DP N GAI RT+ +     +I  +     + + V K + G + +L  ++V N++  L  LK+   W     LDE+            K V+++G E KG+ E ++K  D +V+I M   + SLNVSV+  ++L+
  S:    65 HQGVVGLGAARK---YADLDSVAES--------EMLVVLDGVEDPHNLGAIVRTAHAAGAGAVIVPERRAAGVTDVVAKAAAGALEHLPVVRVTNINRALEDLKERGMWIY--GLDERGTESYDQIDYAKKSVLVLGGEGKGLHEQVRKHCDVLVRIPMAGQISSLNVSVAAGVVLF 228
>gi|119713240|gb|ABL97306.1| putative tRNA/rRNA methyltransferase [uncultured marine bacterium HF10_12C08] (228 aa)
Score = 224, Expect = 6.9e-17, Identities = 56/158 (35%), Positives = 96/158 (60%)
  Q:    79 EKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI---NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           E I NLN +  II +LD++ DP N GAI R++ +F + GII   +N +  N  + KT+   ++ + F K+ N+S  +  LK + YW     ++ +S       TDI   NK+V I+G+E+KG+  +     D  +KI+M  +++SLNVS + AI+++Y+++
  S:    68 EFIKNLNKETSIIFLLDQLDDPQNVGAIFRSALAFDIDGIILTDHNSVAENSFLAKTASSAIDKIPFTKIKNISSCIKILKDQGYWIYGLDMEAQSS-----ITDIAFPNKIVFILGSESKGMRRVTSSLCDENLKIKMSDNLESLNVSNAAAIMMFYISN 223
>gi|145629932|ref|ZP_01785714.1| hypothetical protein CGSHi22421_07773 [Haemophilus influenzae 22.4-21] >gi|144984213|gb|EDJ91636.1| hypothetical protein CGSHi22421_07773 [Haemophilus influenzae R3021] (246 aa)
Score = 224, Expect = 7.0e-17, Identities = 62/202 (30%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKELNENDLDEILS-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAEIVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|117617585|ref|YP_855245.1| RNA methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117558992|gb|ABK35940.1| RNA methyltransferase, TrmH family, group 3 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (249 aa)
Score = 224, Expect = 7.7e-17, Identities = 61/202 (30%), Positives = 104/202 (51%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  +  +K+  VN+K  D K E   HQ I+   KE+      D  S ++K+    T +  +LVLD + DP N GA  R++ +  V  +I  ++    +   V K + G    +  ++V NL+  L +L++   W V TA + +  +  +K       + +++G E KG+  L ++  D +V I M  +V SLNVSV+T + L+
  S:    41 LAELDALGLKVQSVNRKTLDDKAEGNNHQGIMARVKEAPKLAEHDLASLLDKLAEQQT-QPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDKATGLTPIVRKVACGAAEVVPLIQVTNLARSLRELQERGVWIVGTAGEADHDVYQAKLT---GPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVATGVCLF 241
>gi|42630311|ref|ZP_00155855.1| COG0566: rRNA methylases [Haemophilus influenzae R2846] (245 aa)
Score = 224, Expect = 7.9e-17, Identities = 62/202 (30%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKELNENDLDEILA-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRNLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|163791188|ref|ZP_02185605.1| tRNA/rRNA methyltransferase [Carnobacterium sp. AT7] >gi|159873519|gb|EDP67606.1| tRNA/rRNA methyltransferase [Carnobacterium sp. AT7] (288 aa)
Score = 223, Expect = 8.6e-17, Identities = 67/227 (29%), Positives = 114/227 (50%)
  Q:     6 GKKAVIEAFKQNE------LSEVYYVSYFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-------EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+   IE  K         L E    S  +E++   K ++++++ V K   D+  V   N  G+   +S   +   D         N D   IL LD ++DP N G+I RT+ +    GII  K   + +  TV K S G + ++   +V NL + + +LK+   W   T ++       E ++P+           +++GNE KG+S L+K+  D ++ I M   VQSLN SV+ ++++Y
  S:    51 GRLPAIEVLKSERDINKIFLQEGLSGSKMEEIQNLAKKRSVQISFVPKSKLDQL-VDGMNHQGVVVAASAFQYATIDDLFAVAAQKNEDPFFIL-LDGVEDPHNLGSIMRTADAIGAHGIIIPKRRAVGLTATVAKASTGAIEHVAVARVTNLVQAIKELKERGLWLYGTDMEGQDYRQWETTLPIG----------LVMGNEGKGISRLVKEQMDGMITIPMTGHVQSLNASVAASLLMY 279
>gi|11499975|ref|NP_071221.1| rRNA methylase, putative [Archaeoglobus fulgidus DSM 4304] >gi|3915500|sp|O30272|Y2399_ARCFU Uncharacterized tRNA/rRNA methyltransferase AF_2399 >gi|2650693|gb|AAB91264.1| rRNA methylase, putative [Archaeoglobus fulgidus DSM 4304] (224 aa)
Score = 223, Expect = 8.6e-17, Identities = 58/173 (33%), Positives = 88/173 (50%)
  Q:    63 AKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           + E S   + DF+  ++K     T    IL LD + D  N GA  RT++ F  AG++  K     I E  +K S G V ++   +V N +  + KLKK  + T+   LD + +        +    V++G E++GVS  +KK  DF+VKI     V SLN+SV+  I LY L+
  S:    54 SAEVSPIKYADFEFIVKKAL---TGGSFILFLDNVVDQRNIGACIRTAEFFGAAGVVLPKRRVGSIQEGAVKASAGAVFHIPIARVENFASAIKKLKKLGFTTLAADLDGEDLEAVSL---LLPAAVVIGGEDRGVSRPVKKQCDFVVKIPGVGKVNSLNLSVAAGIFLYTLS 220
>gi|68171778|ref|ZP_00545123.1| RNA methyltransferase TrmH, group 3 [Ehrlichia chaffeensis str. Sapulpa] >gi|67998803|gb|EAM85510.1| RNA methyltransferase TrmH, group 3 [Ehrlichia chaffeensis str. Sapulpa] (218 aa)
Score = 223, Expect = 8.8e-17, Identities = 70/202 (34%), Positives = 110/202 (54%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIP-LSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L+  K KNI L +VN  + +     + N  GIA ++S+   T     +E++ N + +   I++LD++ D  N G+I R++  F V  II   +N    N  + KTS G V+ +  + V N+   +  LKK  YW  C   D K    L K K D  KL +I G+E+KG+ +L K++ DF++KI +   + SLNVS + A+ LY
  S:    11 LRLCKQKNINLKQVNPNYINSVLPHNSNHQGIALKASVIDSTT----VEEVLNTSKESSTIILLDQVTDIHNVGSIIRSAVCFNVDAIILPYHNSPSENCGMSKTSSGAVDMIPIVYVINIVNTIKLLKKAGYW--CYGFDAKEGEFLHKTKLDSKKL-IIFGSEDKGMRKLTKENCDFLLKIAISKKIDSLNVSNAAAVALY 206
>gi|145637023|ref|ZP_01792687.1| hypothetical protein CGSHiHH_04955 [Haemophilus influenzae PittHH] >gi|145269881|gb|EDK09820.1| hypothetical protein CGSHiHH_04955 [Haemophilus influenzae PittHH] (245 aa)
Score = 223, Expect = 9.3e-17, Identities = 62/202 (30%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKELNENDLDEILA-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|68249454|ref|YP_248566.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus influenzae 86-028NP] >gi|68057653|gb|AAX87906.1| probable tRNA/rRNA methyltransferase [Haemophilus influenzae 86-028NP] (246 aa)
Score = 223, Expect = 9.3e-17, Identities = 62/202 (30%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKELNENDLDEILA-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|16272800|ref|NP_439020.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus influenzae Rd KW20] >gi|145632229|ref|ZP_01787964.1| hypothetical protein CGSHi3655_07239 [Haemophilus influenzae 3655] >gi|145634717|ref|ZP_01790425.1| hypothetical protein CGSHiAA_03913 [Haemophilus influenzae PittAA] >gi|148826495|ref|YP_001291248.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus influenzae PittEE] >gi|1176354|sp|P44906|RLMB_HAEIN 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|1573875|gb|AAC22519.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20] >gi|144987136|gb|EDJ93666.1| hypothetical protein CGSHi3655_07239 [Haemophilus influenzae 3655] >gi|145267883|gb|EDK07879.1| hypothetical protein CGSHiAA_03913 [Haemophilus influenzae PittAA] >gi|148716655|gb|ABQ98865.1| hypothetical protein CGSHiEE_07740 [Haemophilus influenzae PittEE] (246 aa)
Score = 223, Expect = 9.3e-17, Identities = 62/202 (30%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKELNENDLDEILA-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|157828863|ref|YP_001495105.1| tRNA/rRNA methyltransferase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157801344|gb|ABV76597.1| tRNA/rRNA methyltransferase [Rickettsia rickettsii str. 'Sheila Smith'] (240 aa)
Score = 223, Expect = 9.3e-17, Identities = 59/183 (32%), Positives = 100/183 (54%)
  Q:    52 YEVVHQNILGIAKESSL------TIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           YE+V+ +IL    E+ +       I   F   +E I+  N   KI  +LD+I D  N GAI R++ +F +  II  ++N    N ++ K + GT+  +  +KV NL   +N LKK  +W +            K  +D  K+V++ G+E+KG+  L+ +  D++ KI +   V+SLNVS + +I+ + L
  S:    53 YEIVNNDILSKLLENQIHQGIAAKIRPIFSYNLEDIDITNPKCKIA-ILDQITDTQNIGAIIRSAAAFDINAIILPQDNSPNENGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLISD--KIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAASILFHSL 238
>gi|119471828|ref|ZP_01614161.1| 23S rRNA (Gm2251)-methyltransferase [Alteromonadales bacterium TW-7] >gi|119445318|gb|EAW26607.1| 23S rRNA (Gm2251)-methyltransferase [Alteromonadales bacterium TW-7] (247 aa)
Score = 223, Expect = 9.7e-17, Identities = 62/204 (30%), Positives = 99/204 (48%)
  Q:    29 DELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           DE ++F    I +  + +K  D    +  HQ I+   K +      D D  I +      +   +LVLD I DP N GA  R++ +  V  II  K+   ++N T  K + G    +  ++V NL+  L ++K    W V TA +  +       T    + +++G E +G+  L ++  D +VKI M  SV SLNVSV+T I L+
  S:    42 DEARKF---GISVQFMQRKALDNKSKDEQHQGIIANVKAAPTYNEKDLDVIIAR-----EETPFLLVLDGITDPHNLGACLRSADAAGVHAIIVPKDKSAKLNGTARKVACGAAETVPLIQVTNLARTLREIKDAGVWVVGTAGETDTHVFDASLT--GPMAIVMGAEGEGMRRLTREHCDVLVKIPMAGSVSSLNVSVATGICLF 237
>gi|150021393|ref|YP_001306747.1| RNA methyltransferase [Thermosipho melanesiensis BI429] >gi|149793914|gb|ABR31362.1| RNA methyltransferase, TrmH family, group 3 [Thermosipho melanesiensis BI429] (238 aa)
Score = 223, Expect = 1.0e-16, Identities = 64/158 (40%), Positives = 96/158 (60%)
  Q:    75 DSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +S IEK+     +K  +++LD+IQDP NFGAI RTS +     ++  KNN +++  TV+K S+GT+   N ++V N++  + K+K    W    A+D K      FK D+ K V IV GNE  G+ E +K   D ++ I M ++V+SLNVSVS  I+LY
  S:    78 ESIIEKM-----EKPFLVILDQIQDPHNFGAIIRTSVAAGADALVIPKNNSVKVTPTVVKVSVGTLFKTNIIEVTNIARFIEKIKTLGIWVYGAAMDGKEY----FKVDLKKPVAIVLGNEGNGIRENVKNKCDDLISIPMKNNVESLNVSVSAGILLY 227
>gi|71735318|ref|YP_272875.1| RNA methyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555871|gb|AAZ35082.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae pv. phaseolicola 1448A] (253 aa)
Score = 222, Expect = 1.1e-16, Identities = 55/194 (28%), Positives = 99/194 (51%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + +  ++  D + E VHQ ++     S +      D  +++    +    ++LVLD + DP N GA  RT+ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA  E  + L  ++ D+    ++I+G E KG+  L ++  D++V++ M  SV SLNVSV+T + L+
  S:    50 VTIGQAERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDR----SEGSPLLLVLDGVTDPHNLGACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTA-GEAEVEL--YQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238
>gi|66043847|ref|YP_233688.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv. syringae B728a] >gi|63254554|gb|AAY35650.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv. syringae B728a] (251 aa)
Score = 222, Expect = 1.1e-16, Identities = 55/194 (28%), Positives = 99/194 (51%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + +  ++  D + E VHQ ++     S +      D  +++    +    ++LVLD + DP N GA  RT+ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA  E  + L  ++ D+    ++I+G E KG+  L ++  D++V++ M  SV SLNVSV+T + L+
  S:    50 VTIGQAERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDR----SEGSPLLLVLDGVTDPHNLGACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTA-GEAEVEL--YQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238
>gi|87120578|ref|ZP_01076472.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas sp. MED121] >gi|86164221|gb|EAQ65492.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas sp. MED121] (270 aa)
Score = 222, Expect = 1.1e-16, Identities = 57/198 (28%), Positives = 98/198 (49%)
  Q:    35 KSKNIKLNKVNKKFFDKY------EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +   IK N V ++  D+        VVHQ +   AK +      D    +E ++    +  +I++LD I DP N GA  R++ +     ++  K+    +N TV K + G    +    V NL+  + KL+ +  W   TA +      + ++ D+     +++G E  G+  L ++  D++VK+ M   V SLNVSV+T I LY
  S:    62 RENGIKANVVARREIDQLFKASQERVVHQGVAAFAKMTRSQDEADLYKLVENLD----EPPLIIILDGITDPHNLGACLRSADAAGAHALVMPKDKSAPLNATVSKVACGAAESMPVYAVTNLARTMKKLQDKGVWIFGTAGEASQ---TIYEQDLTIPSAIVMGAEGDGMRRLTREQCDYLVKLPMAGVVSSLNVSVATGICLY 259
>gi|91788889|ref|YP_549841.1| RNA methyltransferase TrmH, group 3 [Polaromonas sp. JS666] >gi|91698114|gb|ABE44943.1| RNA methyltransferase TrmH, group 3 [Polaromonas sp. JS666] (264 aa)
Score = 222, Expect = 1.1e-16, Identities = 51/147 (34%), Positives = 81/147 (55%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           T + ++LVLD + DP N GA  R +       +I  K++   IN TV K + G    + +  V NL+  L +LK+ N W + T+ D    P + +  D+   V +V G E +G+ +L +K  D +V I M  +V+SLNVSV++ + LY
  S:   113 TAQPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAAGINATVAKVASGAAETMPYFMVTNLARTLGELKERNIWCIGTSDDA---PKTIYDVDLKGPVALVLGAEGEGMRQLTRKTCDELVSIPMRGAVESLNVSVASGVCLY 257
>gi|33240198|ref|NP_875140.1| rRNA methylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33237725|gb|AAP99792.1| rRNA methylase [Prochlorococcus marinus subsp. marinus str. CCMP1375] (418 aa)
Score = 222, Expect = 1.2e-16, Identities = 56/178 (31%), Positives = 99/178 (55%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ   GIA +++ +   D  + IE   +++ +  +++ LD + DP N GAI R++++    G+I  +     +  +V K + G + +L   +V NL+  L +LKK  Y T+     E    +++   D   LV+ +G+E KG+S L ++  DF+VKI +     SLN SV+T+++LY
  S:   214 VHQ---GIALQTAASETFDLKTLIEGCQSID-ESPVLIALDGLTDPQNLGAIVRSAEALGAHGLILPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEELKKSGY-TIIGLAGEGDKTINEITFD-GPLVLAIGSEEKGLSLLTRRHCDFLVKIPLRGVTTSLNASVATSVVLY 385
>gi|166711529|ref|ZP_02242736.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzicola BLS256] (249 aa)
Score = 222, Expect = 1.2e-16, Identities = 63/226 (27%), Positives = 117/226 (51%)
  Q:     7 KKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IEA  +N  L+E+         ++ + K I + +VN +  D    +V HQ +      + L    + +  +E        + ++L+LD +QDP N GA  R++ +  V  ++  K+    +N TV KTS G  + +  + V NL+  L  L+K+  W    A + ++   S +  D+   V +++G E+ G+  L ++  D +VKI M   ++SLNVSV+T + L+
  S:    26 REVLIEAGSKNPRLTEIE--------EQARRKGIDVRRVNTQALDGVGGQVRHQGVAARYAAARLWAENELEGLVEAAEG----RALVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSASVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEA---SLYSVDLRGNVGLVLGGESDGLRRLTREHCDGLVKIPMPGEIESLNVSVATGVTLF 240
>gi|90414465|ref|ZP_01222441.1| putative RNA methyltransferase, TrmH family protein [Photobacterium profundum 3TCK] >gi|90324470|gb|EAS41029.1| putative RNA methyltransferase, TrmH family protein [Photobacterium profundum 3TCK] (245 aa)
Score = 222, Expect = 1.2e-16, Identities = 60/202 (29%), Positives = 98/202 (48%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E K   I + +  +K  D       HQ I+   K +      D D+ +E      ++  ++L+LD + DP N GA  R + +   A +I  K+   Q+  T  K + G    +  ++V NL+  +  L+ +  W V TA +    I  SK       L +++G E +G+  L ++  D ++KI M  SV SLNVSV+T I L+
  S:    41 LTELKDLGITIQQAGRKALDDKAKGASHQGIIARVKPAKQLNEHDLDAILE-----GSENPLLLILDGVTDPHNLGACLRNADAAGAAAVIIPKDRAAQLTATASKVACGAAEVMPLVRVTNLARTMRALQDKGVWIVGTAGEATHDIYHSKLT---GPLAIVMGAEGEGMRRLTRETCDDLIKIPMAGSVSSLNVSVATGICLF 237
>gi|62423610|ref|ZP_00378770.1| COG0566: rRNA methylases [Brevibacterium linens BL2] (311 aa)
Score = 222, Expect = 1.3e-16, Identities = 66/227 (29%), Positives = 119/227 (52%)
  Q:     6 GKKAVIEAFKQNELSEVYYVS----YFDELKEF----KSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ +V+EA +++  +   YV+      D ++E       + I + + +K   D+   + +HQ   GIA +     + +    +E   +   +  +++ LD I DP N GAI R++ +F   G+I  +     +     KTS G    +   +V NL+  +++LKK+N + V   +D E  +P   F  D   L ++VG+E KG+S LI    D IV I + ++ +SLN  ++ A+ LY
  S:    72 GRNSVLEALREDVPATAMYVAGRIDSDDRVREAITLATKRGISMLEASKPDLDRLTDDAIHQ---GIALQIPPYDYAEPRDLLEVAAD-RAEAPLLVALDGITDPRNLGAIVRSAAAFGGHGVIIPERRAASMTAAAWKTSAGAAARIKVAQVVNLARAIDELKKQNVFVVGLDMDGEVELPELTFSRD--PLCIVVGSEGKGISRLIADKCDQIVSIPIAATTESLNAGIAAAVSLY 303
>gi|28872048|ref|NP_794667.1| RNA methyltransferase [Pseudomonas syringae pv. tomato str. DC3000] >gi|52783312|sp|Q87VK2|RLMB_PSESM 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|28855301|gb|AAO58362.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae pv. tomato str. DC3000] (250 aa)
Score = 222, Expect = 1.4e-16, Identities = 55/194 (28%), Positives = 99/194 (51%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + +  ++  D + E VHQ ++     S +      D  +++    +    ++LVLD + DP N GA  RT+ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA  E  + L  ++ D+    ++I+G E KG+  L ++  D++V++ M  SV SLNVSV+T + L+
  S:    50 VTIGQAERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDR----SEGPPLLLVLDGVTDPHNLGACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTA-GEAEVEL--YQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238
>gi|154249698|ref|YP_001410523.1| RNA methyltransferase [Fervidobacterium nodosum Rt17-B1] >gi|154153634|gb|ABS60866.1| RNA methyltransferase, TrmH family, group 3 [Fervidobacterium nodosum Rt17-B1] (234 aa)
Score = 221, Expect = 1.4e-16, Identities = 64/228 (28%), Positives = 115/228 (50%)
  Q:     5 FGKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDK---YEVVHQNILG--IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+  + E    N   ++ Y S         S + +L+K+ ++  ++   Y +  +N+L     +E +  +  D   F     +   +   I++LD++QDP N GAI RT+ +  V  ++  K+N   +    IK S GT+  +  +   NL+  + KLK +  W      D +  PL + K +   L ++ GNE  G+ +L+K+  D +V I M + + SLNVSVS  I++Y
  S:     4 YGRNVLKEILTSNHPVKLIYFS--------DSHDKELDKLIEQVKERKLPYTIAPKNVLKKLCGEEKNQGVVIDIGDFQYADESYLPENPFIVLLDQVQDPQNLGAIVRTAVAAGVNMVVLTKDNSAHVTPGSIKASAGTIFRIPIVITVNLARYIEKLKDKGVWIY--GADMRGKPLWEVKLE-RPLGIVFGNEGSGIRQLVKESCDELVSIPMKTPIDSLNVSVSAGILIY 225
>gi|165933590|ref|YP_001650379.1| 23S rRNA Gm2251 methyltransferase [Rickettsia rickettsii str. Iowa] >gi|165908677|gb|ABY72973.1| 23S rRNA Gm2251 methyltransferase [Rickettsia rickettsii str. Iowa] (240 aa)
Score = 221, Expect = 1.5e-16, Identities = 59/183 (32%), Positives = 100/183 (54%)
  Q:    52 YEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           YE+V+ +IL    E+      +  I   F   +E I+  N   KI  +LD+I D  N GAI R++ +F +  II  ++N    N ++ K + GT+  +  +KV NL   +N LKK  +W +            K  +D  K+V++ G+E+KG+  L+ +  D++ KI +   V+SLNVS + +I+ + L
  S:    53 YEIVNNDILSKLLENQTHQGIAAKIRPIFSYNLEDIDITNPKCKIA-ILDQITDTQNIGAIIRSAAAFDINAIILPQDNSPNENGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLISD--KIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAASILFHSL 238
>gi|153840466|ref|ZP_01993133.1| RNA methyltransferase, TrmH family, group 3 [Vibrio parahaemolyticus AQ3810] >gi|149745870|gb|EDM57000.1| RNA methyltransferase, TrmH family, group 3 [Vibrio parahaemolyticus AQ3810] (247 aa)
Score = 221, Expect = 1.6e-16, Identities = 58/202 (28%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L + +   + + ++ +K  D   +   HQ I+   K +      D D  + +      +  ++LVLD + DP N GA  R + +  VA II  K+    +N TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L +++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    41 LNDLQVCGVSIQQMTRKTLDDKAHGANHQGIIARVKPAKQLNENDIDDILAQ-----HETPLLLVLDGVTDPHNLGACLRNADAAGVAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTA-GEATHDIYQAKL-TGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|144900864|emb|CAM77728.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Magnetospirillum gryphiswaldense MSR-1] (314 aa)
Score = 221, Expect = 1.6e-16, Identities = 51/157 (32%), Positives = 89/157 (56%)
  Q:    78 IEKINNL--NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           IE I  L  N D  +++VLD++ DP N GAI R++ +F    ++    +  +   T+ K++ G +  +  ++V N+   L +LK+  +WT   A  E +  L++ K    K+ +++G E +G+  L ++  D +VK+ M   V+SLNVS + AI LY L
  S:   145 IEDIGRLAQNRDHAVVMVLDQVTDPHNVGAILRSAAAFGALAVVVTDRHSPEETGTLAKSASGALEVMPLVRVTNMVRALEQLKEAGFWTAGLA-GEATQTLAQAKLS-GKIALVMGAEGEGLRRLTREHCDHLVKLPMSDLVESLNVSNAAAISLYEL 301
>gi|32033775|ref|ZP_00134060.1| COG0566: rRNA methylases [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207530|ref|YP_001052755.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|165975500|ref|YP_001651093.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149311|ref|YP_001967836.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126096322|gb|ABN73150.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|165875601|gb|ABY68649.1| putative tRNA/rRNA methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189914442|gb|ACE60694.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (247 aa)
Score = 221, Expect = 1.7e-16, Identities = 62/202 (30%), Positives = 104/202 (51%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKE-NYWTVCTALDEKS-IPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E +   I + +VN++  D      VHQ I+  +  +  L  H D D+ + +  N       +L+LD + DP N GA  RT+ +  V  +I  K+   Q+  T  K + G    +  ++V NL+  + +L+++ N W V TA +  S I  +K    I    +++G E  G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELQRLGISVQQVNRQTLDNKAQGEVHQGIIAKVVPQKELNEH-DLDAILAQKQN-----PFLLILDGVTDPHNLGACLRTADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNIWIVGTAGEATSGIYQAKLTGAI---ALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|163730244|ref|ZP_02137719.1| 23S rRNA (Gm2251)-methyltransferase [Vibrio fischeri MJ11] >gi|161396396|gb|EDQ20690.1| 23S rRNA (Gm2251)-methyltransferase [Vibrio fischeri MJ11] (247 aa)
Score = 221, Expect = 1.7e-16, Identities = 58/202 (28%), Positives = 98/202 (48%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E      K+ ++ +K  D       HQ I+     +      D D  + +     TD  ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA +        F++ +   L +++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    41 LNELTQLGFKIQELPRKTLDDKAKGANHQGIIARVTPAKQLNEHDLDDIVSQ-----TDNPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDKSASMTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAGEATH---DVFQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|34496604|ref|NP_900819.1| RNA methyltransferase [Chromobacterium violaceum ATCC 12472] >gi|52783300|sp|Q7NYX3|RLMB_CHRVO 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|34102459|gb|AAQ58824.1| probable RNA methyltransferase [Chromobacterium violaceum ATCC 12472] (248 aa)
Score = 221, Expect = 1.8e-16, Identities = 58/201 (28%), Positives = 100/201 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           L +  ++N+KL+ V+K+  D       HQ ++ +   S    + D D  +E +    ++  ++L+LD + DP N GA  R + +     +I  K+    +N TV K + G    + ++ V NL+  L  LK    W   T + E    L  F      L  ++G E +G+  L ++  D +V I M  +V+SLNVSVS+ ++L
  S:    42 LDKAGAENVKLHIVDKERLDSMSGNARHQGVVAMIDAS--MNYVDLDDVLENL----SEPPLLLILDGVTDPHNLGACLRVADAMGAHAVIAPKDRSATLNATVSKVACGAAEVVPYITVTNLARTLRDLKDAGVWIAGTTM-EADTDLYHFDAS-GPLAWVMGAEGEGMRRLTREHCDVLVSIPMFGTVESLNVSVSSGMVL 236
>gi|21230973|ref|NP_636890.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769023|ref|YP_243785.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|188992138|ref|YP_001904148.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris] >gi|52783316|sp|Q8PAG5|RLMB_XANCP 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|21112593|gb|AAM40814.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66574355|gb|AAY49765.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|167733898|emb|CAP52104.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris] (249 aa)
Score = 221, Expect = 1.8e-16, Identities = 63/226 (27%), Positives = 116/226 (51%)
  Q:     7 KKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IEA  +N  L+E+         ++ + K I + +VN +  D    +V HQ +      + L    + +  +E        + ++L+LD +QDP N GA  R++ +  V  ++  K+    +N TV KTS G  + +  + V NL+  L  L+K+  W    A + ++   S +  D+   V +++G E  G+  L ++  D +VKI M   ++SLNVSV+T + L+
  S:    26 REVLIEAGSKNPRLTEIE--------EQARRKGIDVRRVNTQALDGVGGQVRHQGVAARYAAARLWAENELEGLVEAAQG----RALVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEA---SLYSVDLRGNVGLVLGGEGDGLRRLTREHCDGLVKIPMPGDIESLNVSVATGVTLF 240
>gi|186681662|ref|YP_001864858.1| RNA methyltransferase [Nostoc punctiforme PCC 73102] >gi|186464114|gb|ACC79915.1| RNA methyltransferase, TrmH family, group 3 [Nostoc punctiforme PCC 73102] (363 aa)
Score = 221, Expect = 1.8e-16, Identities = 68/228 (29%), Positives = 116/228 (50%)
  Q:     5 FGKKAVIEAF-KQNELSEV-------YYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+  V+ A  KQ  L+ +       Y  S+   L + K     +++V  K  D Y     N  G+A +++   + +    IE+  ++ TD  +I+V D I DP N GAI RT+++    G++  +     I  TV+K + G +      +V NLS  L +LK+  +W   TA    + +    FK  I   V+++G+E +G+  L ++  DF+V I +     SLN SV+  + LY
  S:   110 YGRHPVLSALQKQRNLNRIWITTRLRYDPSFHHFLLQAKENGTVIDEVEPKRLD-YLTNGANHQGVAAQTAPYGYIELADLIEQSKSV-TDP-VIVVADGITDPHNLGAIIRTAEAIGAQGLVIPQRRASGITSTVMKVAAGALENFTVSRVVNLSRALEELKEAGFWIYGTAASGSEPVHTVNFKGPI---VLVIGSEGEGLGMLTQRSCDFLVSIPLQGKTPSLNASVAAGMALY 340
>gi|188577053|ref|YP_001913982.1| RNA methyltransferase, TrmH family, group 3 [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188521505|gb|ACD59450.1| RNA methyltransferase, TrmH family, group 3 [Xanthomonas oryzae pv. oryzae PXO99A] (255 aa)
Score = 220, Expect = 1.8e-16, Identities = 63/226 (27%), Positives = 117/226 (51%)
  Q:     7 KKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IEA  +N  L+E+         ++ + K I + +VN +  D    +V HQ +      + L    + +  +E        + ++L+LD +QDP N GA  R++ +  V  ++  K+    +N TV KTS G  + +  + V NL+  L  L+K+  W    A + ++   S +  D+   V +++G E+ G+  L ++  D +VKI M   ++SLNVSV+T + L+
  S:    26 REVLIEAGSKNPRLTEIE--------EQARRKGIDVRRVNTQALDGVAGQVRHQGVAARYAVARLWAENELEGLVEAAEG----RALVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSASVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEA---SLYSVDLRGNVGLVLGGESDGLRRLTREHCDGLVKIPMPGEIESLNVSVATGVTLF 240
>gi|163857018|ref|YP_001631316.1| putative tRNA/rRNA methyltransferase [Bordetella petrii DSM 12804] >gi|163260746|emb|CAP43048.1| putative tRNA/rRNA methyltransferase [Bordetella petrii] (245 aa)
Score = 220, Expect = 1.8e-16, Identities = 54/177 (30%), Positives = 94/177 (53%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++ +A+E  L +  D D  ++ I        ++LVLD + DP N GA  RT+ +  V  ++  ++  + +N TV + + G  + + ++ V NL+  L  LK+   W V T  D+ +  L         +  ++G E +G+  L ++  D +V I M  SV+SLNVSV++A+ LY
  S:    69 HQGVVALAEERLLAV--DVDEVLDTIEG----PALLLVLDGVTDPHNLGACLRTADAAGVHAVVAPRDRAVGLNSTVQRVACGAADTVPYITVTNLARTLRGLKERGVWVVGTD-DQAAGSLHTVDAR-QPMAWVMGAEGEGMRRLTRETCDQLVNIPMLGSVESLNVSVASAVCLY 237
>gi|116493236|ref|YP_804971.1| rRNA methylase [Pediococcus pentosaceus ATCC 25745] >gi|116103386|gb|ABJ68529.1| rRNA methylase [Pediococcus pentosaceus ATCC 25745] (252 aa)
Score = 220, Expect = 1.8e-16, Identities = 59/198 (29%), Positives = 101/198 (51%)
  Q:    35 KSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K + + + +V K   D      QN  G+    +   + + D  I K+     ++  IL+LD I+DP N G+I RT+ +  V G+I  K   + +  TV KTS G +  +  ++V+NL   + +LK+   W   T  D K     ++      + +I+GNE KG++ L K + D ++ I M   +QSLN SV+  +++Y
  S:    51 KKQGLVIQRVTKSKLDTLSN-GQNHQGVVLAVASFEYAELDD-IFKLAKAREEEPFILILDGIEDPHNLGSILRTADAAGVHGVIIPKRRAVGLTSTVAKTSAGAIERVPVVQVSNLVNAIKELKERGLWIFGT--DMKGTDYRRWDAK-GAVGLIIGNEGKGMARLTKDNVDEMLTIPMVGEIQSLNASVAAGLLIY 243
>gi|58581707|ref|YP_200723.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84623620|ref|YP_450992.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58426301|gb|AAW75338.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84367560|dbj|BAE68718.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] (255 aa)
Score = 220, Expect = 1.8e-16, Identities = 63/226 (27%), Positives = 117/226 (51%)
  Q:     7 KKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IEA  +N  L+E+         ++ + K I + +VN +  D    +V HQ +      + L    + +  +E        + ++L+LD +QDP N GA  R++ +  V  ++  K+    +N TV KTS G  + +  + V NL+  L  L+K+  W    A + ++   S +  D+   V +++G E+ G+  L ++  D +VKI M   ++SLNVSV+T + L+
  S:    26 REVLIEAGSKNPRLTEIE--------EQARRKGIDVRRVNTQALDGVGGQVRHQGVAARYAVARLWAENELEGLVEAAEG----RALVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSASVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEA---SLYSVDLRGNVGLVLGGESDGLRRLTREHCDGLVKIPMPGEIESLNVSVATGVTLF 240
>gi|46133163|ref|ZP_00156715.2| COG0566: rRNA methylases [Haemophilus influenzae R2866] >gi|145628238|ref|ZP_01784039.1| hypothetical protein CGSHi22121_04335 [Haemophilus influenzae 22.1-21] >gi|145638336|ref|ZP_01793946.1| hypothetical protein CGSHiII_06179 [Haemophilus influenzae PittII] >gi|144980013|gb|EDJ89672.1| hypothetical protein CGSHi22121_04335 [Haemophilus influenzae 22.1-21] >gi|145272665|gb|EDK12572.1| hypothetical protein CGSHiII_06179 [Haemophilus influenzae PittII] (246 aa)
Score = 220, Expect = 1.8e-16, Identities = 62/202 (30%), Positives = 98/202 (48%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLK-KENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  S  I +  VN++  DK     VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L+   N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKEFNENDLDEILA-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRDLQHNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|196242228|ref|ZP_03140984.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 7425] >gi|196213722|gb|EDY08385.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 7425] (387 aa)
Score = 220, Expect = 2.2e-16, Identities = 63/228 (27%), Positives = 117/228 (51%)
  Q:     5 FGKKAVIEAFK-QNELSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTV-CTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+  ++ A + + +L+ ++ V+       +   L + K+  + +++V+    D+    H    GIA + +   + + D+ +E I  L  D  ++L  D I DP N GAI RT+++    G++  +   + I  TV K + G + +    +V NL++ L +LK   +W     A   K I   +F   +   V++VG E  G+S L ++  D +V I +     SLN SV+T + LY
  S:   130 YGRHTLLAALESERQLNRIWVVNQLRYDPRFHSLLLQAKAAGVVIDEVDYLRLDQI-TAHAKHQGIAAQVAPYSYLELDTLLENIQGL--DHPVLLAADGITDPHNLGAIIRTAEALGAQGLVVPQRRAVGITSTVAKVAAGALEHFAVARVVNLNQALEQLKAAGFWIYGMAATAAKPIYSVEFSGPV---VLVVGAEGTGLSLLAQRYCDQLVSIPLLGKTPSLNASVATGMALY 360
>gi|126696248|ref|YP_001091134.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9301] >gi|126543291|gb|ABO17533.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str. MIT 9301] (334 aa)
Score = 220, Expect = 2.2e-16, Identities = 57/151 (37%), Positives = 88/151 (58%)
  Q:    85 NTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           N    II+  D I DP N GAI R++++F   G+I  +     +  TV K + G + +L+  +V NL+  L +LKK  +  V  + D + I +S F+ +   LVV+VG+E+KG+S L +K  D+I+ I +     SLN SV+ AI LY+LT
  S:   184 NCPNPIIVAFDGITDPHNVGAIIRSAEAFDCKGVIIPQRRSAGLTGTVAKVAAGALEHLHVSRVVNLNRALEELKKNGFLVVGLSGDGQ-ISISNFQ-EKAPLVVVVGSEDKGISLLTQKKCDYILSIPLKGKTSSLNASVAAAISLYHLT 332
>gi|159029966|emb|CAO90345.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (288 aa)
Score = 220, Expect = 2.3e-16, Identities = 66/229 (28%), Positives = 119/229 (51%)
  Q:     4 FFGKKAVIEAFKQN-ELSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDE-KSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +G++ V+ A ++  +L+ ++ V+       Y   L++ K+    +++V+    D+   +  HQ   GIA + S   + +    IEK     +   +I++ + I DP N GAI RT+++    G++  +     +  TV+K + G + YL   +V NL+  L +LK   +W   TA    KS+        I    ++VG+E +G+S L +K  D +V I +     SLN SV+ A+ LY
  S:    44 LYGRRVVLTAMEEERQLNRIWVVNRLRYDPRYHTLLEKAKANGTVIDEVDDLRLDQITNKANHQ---GIAAQMSPYDYIELADLIEKAKG-KSRHPVIVIAEGITDPHNLGAIIRTAEAMGCQGVVIPQRRAAGVTSTVMKVAAGALEYLPVARVVNLNRALEELKAAGFWLYGTAAKTGKSLHTINLTGAIG---LVVGSEGEGLSLLTQKSCDELVSIPLAGKTPSLNASVAAAMALY 276
>gi|28899580|ref|NP_799185.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|52783311|sp|Q87L11|RLMB_VIBPA 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|28807816|dbj|BAC61069.1| RNA methyltransferase, TrmH family [Vibrio parahaemolyticus RIMD 2210633] (247 aa)
Score = 220, Expect = 2.3e-16, Identities = 58/202 (28%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L + +   + + ++ +K  D   +   HQ I+   K +      D D  + +      +  ++LVLD + DP N GA  R + +  VA II  K+    +N TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L +++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    41 LNDLQVCGVSIQQMTRKTLDDKAHGANHQGIIARVKVAKQLNENDIDDILAQ-----HETPLLLVLDGVTDPHNLGACLRNADAAGVAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTA-GEATHDIYQAKL-TGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|153094246|gb|EDN75117.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Mannheimia haemolytica PHL213] (247 aa)
Score = 219, Expect = 2.4e-16, Identities = 60/202 (29%), Positives = 103/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV--VHQNILG-IAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLK-KENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E +   + + +VN++  D      VHQ I+  +  +  L  H D ++ + +  N      ++L+LD + DP N GA  RT+ +  V  +I  K+   Q+  T  K + G    +  ++V NL+  +  L+ + N W V TA + E  I  +K    I    +++G E  G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELQRLGVAIQQVNRQTLDNKSQGEVHQGIIARVVPQKELNEH-DLEAILSQKKN-----PLLLILDGVTDPHNLGACLRTADAAGVDAVIVPKDKSAQLTPTARKVACGAAEVMPLIRVTNLARTMRDLQERHNVWIVGTAGEAESGIYEAKLTGSI---ALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|52424529|ref|YP_087666.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Mannheimia succiniciproducens MBEL55E] >gi|52306581|gb|AAU37081.1| SpoU protein [Mannheimia succiniciproducens MBEL55E] (245 aa)
Score = 219, Expect = 2.4e-16, Identities = 64/202 (31%), Positives = 102/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           LKE     I +  +N++  D      VHQ I+   + +      D    +E+I + N D  ++LVLD + DP N GA  RT+ +  V  +I  K+   Q+     K + G    +  ++V NL+  L  L++  N W V TA  E +  L + K  I  L +++G E  G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LKELHQLGISVQFLNRQTLDNKANGEVHQGIIARVQPAKELNEND----LERILSNNKDP-LLLVLDGVTDPHNLGACLRTADAAGVCAVIVPKDKSAQLTSIARKVACGAAEVVPLIRVTNLARTLRDLQQSHNIWVVGTA-GEATETLYQTKL-IGPLALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|107022620|ref|YP_620947.1| RNA methyltransferase TrmH, group 3 [Burkholderia cenocepacia AU 1054] >gi|116689569|ref|YP_835192.1| RNA methyltransferase [Burkholderia cenocepacia HI2424] >gi|105892809|gb|ABF75974.1| RNA methyltransferase TrmH, group 3 [Burkholderia cenocepacia AU 1054] >gi|116647658|gb|ABK08299.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia cenocepacia HI2424] (247 aa)
Score = 219, Expect = 2.5e-16, Identities = 52/177 (29%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +A+   + +  +    ++ IN       ++LVLD + DP N GA  R + S     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ DE S  L + K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    69 HQGV--VARVEDMPLAQNLSELLDGING----PALLLVLDGVTDPHNLGACLRVADSAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTS-DEASATLYETKLD-GPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237
>gi|146329073|ref|YP_001209512.1| RNA methyltransferase [Dichelobacter nodosus VCS1703A] >gi|146232543|gb|ABQ13521.1| RNA methyltransferase, TrmH family, group 3 [Dichelobacter nodosus VCS1703A] (242 aa)
Score = 219, Expect = 2.6e-16, Identities = 65/198 (32%), Positives = 107/198 (54%)
  Q:    35 KSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           K+  I++  V + + D    +V HQ   GIA E  L+      ++ + I+ +  ++  ILVLD IQDP N GA  RT+ +  V  ++   +    I   V K + G    L   +V NL   +  +K++  W V  A + EKS+    F  D++  LV+IVGNE KG+   +++  D++  I M  +++SLNVSV+  I+L+
  S:    43 KAAQIEIITVPRHYIDHRLPDVRHQ---GIAGECRLSAQAS--NWQQAISGV--ERPFILVLDSIQDPHNLGACLRTAMAAGVDAVVLPNSCAADITPVVRKIACGAAEALAIFRVANLKREVEMMKEKGLWVVGGAGEAEKSL----FDLDLSGGLVMIVGNEEKGIHYGLRQTCDWLAAIPMAETMESLNVSVACGIMLF 233
>gi|15644487|ref|NP_229539.1| hypothetical protein TM1741 [Thermotoga maritima MSB8] >gi|4982318|gb|AAD36806.1|AE001812_16 conserved hypothetical protein [Thermotoga maritima MSB8] (242 aa)
Score = 219, Expect = 2.6e-16, Identities = 79/230 (34%), Positives = 125/230 (54%)
  Q:     3 KFFGKKAVIEAFKQN-ELSEVYYV------SYFDEL-KEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFD------SFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + +G+K + EA + N  + +V++       SYF  L KE + + IK +      F+  E + +N+ G  K   +     FD      S +E+I    T   I+L LD+IQDP N GAI RTS      GII  K+  +++ ETV+K S GTV       V NL+  + +LK++  WT  + +D   I    F         + GNE +G+  L+++  D +V I M++ + SLNVSVS  ++L+
  S:     2 RVYGRKILEEALRNNVPIKKVFFQKMKNPGSYFLSLVKEVEKRGIKYS------FESEERL-KNLSGTKKHQGVV----FDIGEYRYSSVEEILEAKTPPLIVL-LDQIQDPHNLGAIVRTSVGAGANGIIIPKDKSVKVTETVVKVSAGTVFRARIAVVTNLARTIEELKEKGVWTYASDIDGTPIYEEDFTFPT---AFVFGNEGEGIRRLVREKCDRVVTIPMENDIDSLNVSVSVGVVLF 230
>gi|78047165|ref|YP_363340.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78035595|emb|CAJ23264.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] (249 aa)
Score = 219, Expect = 2.6e-16, Identities = 63/226 (27%), Positives = 116/226 (51%)
  Q:     7 KKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IEA  +N  L+E+         ++ + K I + +VN +  D    +V HQ +      + L    + +  +E        + ++L+LD +QDP N GA  R++ +  V  ++  K+    +N TV KTS G  + +  + V NL+  L  L+K+  W    A + ++   S +  D+   V +++G E  G+  L ++  D +VKI M   ++SLNVSV+T + L+
  S:    26 REVLIEAGSKNPRLTEIE--------EQARRKGIDVRRVNTQALDGVGGQVRHQGVAARYAAARLWAENELEGLVEAAEG----RALVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEA---SLYSVDLRGNVGLVLGGEADGLRRLTREHCDGLVKIPMPGEIESLNVSVATGVTLF 240
>gi|126665195|ref|ZP_01736178.1| RNA methyltransferase, TrmH family, group 3 [Marinobacter sp. ELB17] >gi|126630565|gb|EBA01180.1| RNA methyltransferase, TrmH family, group 3 [Marinobacter sp. ELB17] (266 aa)
Score = 219, Expect = 2.6e-16, Identities = 60/189 (31%), Positives = 99/189 (52%)
  Q:    44 VNKKFFD-KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK-IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           V++K  D +   VHQ I+    ES      D  + +      N++K   +L+LD + DP N GA  RT+ +  V  +I  K+    +     K + G    + F++V NL+ +L  L+++  W V TA  E SI L   + D+   L +++G E KG+  L ++  D ++ I M   V+SLNVSV++ + LY
  S:    73 VHRKLLDSRVAGVHQGIVASVSESREWSEDDLLAMLA-----NSEKPPFLLILDGVTDPHNLGACMRTADAVGVQAVIVPKDKSATLTPVARKVACGAAETVPFVRVTNLARLLRTLQEQGVWLVGTA-GEASITLH--QADLTGPLALVMGAEGKGMRRLTREHCDQLINIPMVGDVESLNVSVASGVCLY 256
>gi|149200224|ref|ZP_01877246.1| RNA methyltransferase, TrmH family, group 3 [Lentisphaera araneosa HTCC2155] >gi|149136666|gb|EDM25097.1| RNA methyltransferase, TrmH family, group 3 [Lentisphaera araneosa HTCC2155] (197 aa)
Score = 219, Expect = 2.7e-16, Identities = 54/160 (33%), Positives = 86/160 (53%)
  Q:    73 DFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + +SF+E     +     +L+LD +QDP N GA  RT+    V  +I  K+N   I +TV+  S G  +     +V N++  + KLKK   W   T+ D+    L  + +D+   V +V G+E KG+  L ++  DF++ I M  +V  LNVSV+T + LY
  S:    36 ELESFLE-----SKKTPFVLILDGVQDPHNLGACIRTANGAGVDAVIIPKDNAAPITDTVMSVSCGGASNTAIFRVVNIARTMEKLKKIGVWIAGTS-DKADQDL--YNSDLKGPVALVMGSEGKGMRRLTEEKCDFLLTIPMGGTVPCLNVSVATGVCLY 188
>gi|77977627|ref|ZP_00833071.1| COG0566: rRNA methylases [Yersinia intermedia ATCC 29909] (246 aa)
Score = 219, Expect = 2.8e-16, Identities = 54/178 (30%), Positives = 89/178 (50%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ I+   +E       D  + +E +     D   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N    K + G    +  +KV NL+  L  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  +V SLNVSV+T + L+
  S:    66 VHQGIVARVREGRQYQENDLPALLESV-----DMPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRLLQEHNVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLF 236
>gi|187478616|ref|YP_786640.1| tRNA/rRNA methyltransferase [Bordetella avium 197N] >gi|115423202|emb|CAJ49733.1| putative tRNA/rRNA methyltransferase [Bordetella avium 197N] (246 aa)
Score = 219, Expect = 2.9e-16, Identities = 53/177 (29%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +L +A E  L +    D  +++I         +L+LD + DP N GA  RT+ +  V  +I  ++  + +N TV + + G  + + ++ V NL+  + +LK+   W V T  D+ S  +         +  ++G E +G+  L ++  D +V I M  SV+SLNVSV++A+ LY
  S:    69 HQGVLAVADERQLAV--GIDEVLDEI----VGPAFLLILDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLNSTVQRVACGAADTVPYITVTNLARTMRELKERGVWLVGTD-DQASHDMHAIDAR-QPMAWVMGAEGEGMRRLTRETCDELVNIPMLGSVESLNVSVASAVCLY 237
>gi|167626521|ref|YP_001677021.1| tRNA/rRNA methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596522|gb|ABZ86520.1| tRNA/rRNA methyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] (248 aa)
Score = 219, Expect = 2.9e-16, Identities = 63/177 (35%), Positives = 88/177 (49%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEK-INNLNTDKK--IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQNI  I          DF ++ E  I NL    K   IL+LD +QDP NFGA  R++ S  +  II  K+N   +N TV K + G   +   + V NL+  + KLK+   W +  A +      S    D   + ++ G E  G+ +  K   DF+ K+ M   V SLNVSV+T I LY
  S:    68 HQNIFAIEI-------NDFKTYSENDIENLIPQDKNAFILILDNVQDPHNFGACIRSAHSAGIDFIIIPKDNSAPVNATVKKVACGAAEHTKIVVVTNLARAIEKLKQLGVWIIGLAGEANDSLYSMNLAD--SVAIVAGAEGSGMRQRTKASCDFLAKLPMLGEVSSLNVSVATGIALY 238
>gi|77456761|ref|YP_346266.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens PfO-1] >gi|77380764|gb|ABA72277.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens PfO-1] (255 aa)
Score = 219, Expect = 3.0e-16, Identities = 66/232 (28%), Positives = 117/232 (50%)
  Q:     1 MKKFFGKKAVIEAF--------KQNELSEVYYVSYFDELKEFKSKN-IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++K +G  AV EA         KQ  L+E         L E  ++N +++ +  ++  D + E VHQ ++     S +      D  +++         ++LVLD + DP N GA  R++ +     +I  K+    +   V K + G    +  + V NL+  L KL++   W V TA + +   +S +  D+    ++I+G E KG+  L ++  D++V + M  SV SLNVSV+T + L+
  S:     4 LEKIYGVHAV-EALLRHHPKRVKQIWLAESRNDPRVQTLIELANENRVQIGQAERREMDAWVEGVHQGVVADVSPSQVWGEAMLDELLDRTEG----APLLLVLDGVTDPHNLGACLRSADAAGALAVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAE---VSIYDQDLTGPTILIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLF 238
>gi|148270170|ref|YP_001244630.1| RNA methyltransferase [Thermotoga petrophila RKU-1] >gi|170288875|ref|YP_001739113.1| RNA methyltransferase [Thermotoga sp. RQ2] >gi|147735714|gb|ABQ47054.1| RNA methyltransferase, TrmH family, group 3 [Thermotoga petrophila RKU-1] >gi|170176378|gb|ACB09430.1| RNA methyltransferase, TrmH family, group 3 [Thermotoga sp. RQ2] (242 aa)
Score = 219, Expect = 3.0e-16, Identities = 73/230 (31%), Positives = 120/230 (52%)
  Q:     3 KFFGKKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLT--IHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + +G+K + EA + N  + +V++    +    F S   ++ K   K+  + E   +N+ G  K   +   I     S +E+I    T   I+L LD+IQDP N GAI RTS      GII  K+  +++ ETV+K S+GTV       V NL+  + +LK++  WT  + +D   I    F         + GNE +G+  L+++  D +V I M++ + SLNVSVS  ++L+
  S:     2 RVYGRKILEEALRNNVPIKKVFFQKMQNPGSYFLSLVEEVEKRGIKYSFESEEKLKNLSGTKKHQGVVFDIEEYRYSSVEEILEAKTPPLIVL-LDQIQDPHNLGAIVRTSVGAGANGIIIPKDKSVKVTETVVKVSVGTVFRARIAVVTNLARTIEELKEKGVWTYASDIDGTPIYEEDFTFPT---AFVFGNEGEGIRRLVREKCDRVVTIPMENDIDSLNVSVSVGVVLF 230
>gi|27364705|ref|NP_760233.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio vulnificus CMCP6] >gi|37681244|ref|NP_935853.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio vulnificus YJ016] >gi|52783298|sp|Q7MH13|RLMB_VIBVY 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|52783314|sp|Q8DCT8|RLMB_VIBVU 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|27360850|gb|AAO09760.1|AE016801_79 rRNA methylases [Vibrio vulnificus CMCP6] >gi|37199995|dbj|BAC95824.1| rRNA methylase [Vibrio vulnificus YJ016] (247 aa)
Score = 219, Expect = 3.0e-16, Identities = 57/202 (28%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E +   + L ++ +K  D   +   HQ I+   K +      D D  + K         ++L+LD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L +++G E  G+  L ++  D ++KI M  +V SLNVSV++ I L+
  S:    41 LNELQMVGVSLQQMTRKTLDDKAHGANHQGIIARVKPAKQLNENDLDDILAK-----HASPLLLILDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRHLQEQGIWIVGTA-GEATHDIYQAKL-TGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGAVSSLNVSVASGICLF 237
>gi|21242319|ref|NP_641901.1| tRNA/rRNA methyltransferase [Xanthomonas axonopodis pv. citri str. 306] >gi|52783317|sp|Q8PM64|RLMB_XANAC 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|21107751|gb|AAM36437.1| tRNA/rRNA methyltransferase [Xanthomonas axonopodis pv. citri str. 306] (249 aa)
Score = 219, Expect = 3.0e-16, Identities = 63/226 (27%), Positives = 116/226 (51%)
  Q:     7 KKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++ +IEA  +N  L+E+         ++ + K I + +VN +  D    +V HQ +      + L    + +  +E        + ++L+LD +QDP N GA  R++ +  V  ++  K+    +N TV KTS G  + +  + V NL+  L  L+K+  W    A + ++   S +  D+   V +++G E  G+  L ++  D +VKI M   ++SLNVSV+T + L+
  S:    26 REVLIEAGSKNPRLTEIE--------EQARRKGIDVRRVNTQALDGVGGQVRHQGVAARYAAARLWAENELEGLVEAA----AGRALVLILDGVQDPHNLGACLRSAAAAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGEAEA---SLYSVDLRGNVGLVLGGEADGLRRLTREHCDGLVKIPMPGEIESLNVSVATGVTLF 240
>gi|15838579|ref|NP_299267.1| tRNA/rRNA methyltransferase [Xylella fastidiosa 9a5c] >gi|52783331|sp|Q9PC00|RLMB_XYLFA 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|9107096|gb|AAF84787.1|AE004018_3 tRNA/rRNA methyltransferase [Xylella fastidiosa 9a5c] (249 aa)
Score = 218, Expect = 3.2e-16, Identities = 58/198 (29%), Positives = 106/198 (53%)
  Q:    35 KSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + K I++ +V  +  D     V HQ +   A+ +++ +  + D  ++ + +    + ++LVLD +QDP N GA  R++ +  V  +I  K+  + IN TV KTS G  + L  + V NL+  L +L+K++ W       E     S +  D+  K+ +++G E  G+  L ++  D + +I M   V+SLNVSV+  + L+
  S:    47 RRKGIEVRRVTTQALDGVGGGVRHQGV--AARYAAVRLWEEHD--LKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAAAAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGL---EGEAETSLYALDLRGKVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240
>gi|70734080|ref|YP_257720.1| RNA methyltransferase [Pseudomonas fluorescens Pf-5] >gi|68348379|gb|AAY95985.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas fluorescens Pf-5] (254 aa)
Score = 218, Expect = 3.5e-16, Identities = 53/194 (27%), Positives = 97/194 (50%)
  Q:    39 IKLNKVNKKFFDKY-EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + +  ++  D + E VHQ ++     S +      D  +++         ++LVLD + DP N GA  RT+ +     ++  K+    +  TV K + G    +  + V NL+  L KL++   W V TA + +      +  D+    ++I+G E KG+  L ++  D++V++ M  SV SLNVSV+T + L+
  S:    50 VSVGQAERREMDAWVEGVHQGVVAEVSPSQVWGEAMLDELLDRTEG----APLLLVLDGVTDPHNLGACLRTADAAGALAVLVPKDKSATLTPTVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEQ---ELYDQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238
>gi|90581367|ref|ZP_01237163.1| putative RNA methyltransferase, TrmH family protein [Vibrio angustum S14] >gi|90437477|gb|EAS62672.1| putative RNA methyltransferase, TrmH family protein [Vibrio angustum S14] (244 aa)
Score = 218, Expect = 3.6e-16, Identities = 57/202 (28%), Positives = 96/202 (47%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + E +S  I + +  +K  D       HQ I+   +        D D  +     +  +  ++L+LD + DP N GA  R + +     +I  K+   Q+N T  K + G    +  ++V NL+  +  L+ +  W V TA +    I  SK       L +++G E +G+  L ++  D ++KI M  SV SLNVSV+T I L+
  S:    41 VTELQSLGITIQEAGRKALDDKVKGASHQGIVARVRPGKQYNENDLDDLL-----VGKENPLLLILDGVTDPHNLGACLRNADAAGAVAVIVPKDRSAQLNATASKVACGAAEIMPLVRVTNLARTMRALQDKGVWIVGTAGEATHDIYQSKLT---GPLAIVMGAEGEGMRRLTRETCDDLIKIPMAGSVSSLNVSVATGICLF 237
>gi|123440768|ref|YP_001004760.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122087729|emb|CAL10514.1| putative methylase [Yersinia enterocolitica subsp. enterocolitica 8081] (246 aa)
Score = 218, Expect = 3.7e-16, Identities = 54/178 (30%), Positives = 89/178 (50%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ I+   +E       D  + +E +     +   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N    K + G    +  +KV NL+  L  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    66 VHQGIVARVREGRQYQENDLPALLESV-----ETPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236
>gi|89075975|ref|ZP_01162347.1| putative RNA methyltransferase, TrmH family protein [Photobacterium sp. SKA34] >gi|89048324|gb|EAR53903.1| putative RNA methyltransferase, TrmH family protein [Photobacterium sp. SKA34] (244 aa)
Score = 218, Expect = 3.7e-16, Identities = 57/202 (28%), Positives = 96/202 (47%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + E +S  I + +  +K  D       HQ I+   +        D D  +     +  +  ++L+LD + DP N GA  R + +     +I  K+   Q+N T  K + G    +  ++V NL+  +  L+ +  W V TA +    I  SK       L +++G E +G+  L ++  D ++KI M  SV SLNVSV+T I L+
  S:    41 VTELQSLGITIQEAGRKALDDKVKGASHQGIVARVRPGKQYNENDLDDLL-----VGKESPLLLILDGVTDPHNLGACLRNADAAGAVAVIVPKDRSAQLNATASKVACGAAEIMPLVRVTNLARTMRALQDKGVWIVGTAGEATHDIYQSKLT---GPLAIVMGAEGEGMRRLTRETCDDLIKIPMAGSVSSLNVSVATGICLF 237
>gi|16120716|ref|NP_404029.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis CO92] >gi|22124552|ref|NP_667975.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis KIM] >gi|45440391|ref|NP_991930.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|51594785|ref|YP_068976.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pseudotuberculosis IP 32953] >gi|108809893|ref|YP_653809.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis Antiqua] >gi|108813450|ref|YP_649217.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis Nepal516] >gi|145600840|ref|YP_001164916.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis Pestoides F] >gi|150260575|ref|ZP_01917303.1| putative methylase [Yersinia pestis CA88-4125] >gi|153949503|ref|YP_001402598.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|162419936|ref|YP_001605270.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis Angola] >gi|165926787|ref|ZP_02222619.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936560|ref|ZP_02225128.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Orientalis str. IP275] >gi|166011869|ref|ZP_02232767.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213970|ref|ZP_02240005.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167400679|ref|ZP_02306188.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419264|ref|ZP_02311017.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423260|ref|ZP_02315013.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167467834|ref|ZP_02332538.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis FV-1] >gi|170026005|ref|YP_001722510.1| RNA methyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186893793|ref|YP_001870905.1| RNA methyltransferase [Yersinia pseudotuberculosis PB1/+] >gi|52783320|sp|Q8ZIV4|RLMB_YERPE 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|21957351|gb|AAM84226.1|AE013666_6 hypothetical protein y0638 [Yersinia pestis KIM] >gi|45435247|gb|AAS60807.1| putative methylase [Yersinia pestis biovar Microtus str. 91001] >gi|51588067|emb|CAH19673.1| putative methylase [Yersinia pseudotuberculosis IP 32953] >gi|108777098|gb|ABG19617.1| methylase [Yersinia pestis Nepal516] >gi|108781806|gb|ABG15864.1| putative methylase [Yersinia pestis Antiqua] >gi|115346195|emb|CAL19063.1| putative methylase [Yersinia pestis CO92] >gi|145212536|gb|ABP41943.1| methylase [Yersinia pestis Pestoides F] >gi|149289983|gb|EDM40060.1| putative methylase [Yersinia pestis CA88-4125] >gi|152960998|gb|ABS48459.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pseudotuberculosis IP 31758] >gi|162352751|gb|ABX86699.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis Angola] >gi|165915676|gb|EDR34285.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Orientalis str. IP275] >gi|165921410|gb|EDR38634.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989228|gb|EDR41529.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204765|gb|EDR49245.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166963258|gb|EDR59279.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050047|gb|EDR61455.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057430|gb|EDR67176.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752539|gb|ACA70057.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pseudotuberculosis YPIII] >gi|186696819|gb|ACC87448.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pseudotuberculosis PB1/+] (246 aa)
Score = 218, Expect = 3.7e-16, Identities = 54/178 (30%), Positives = 89/178 (50%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ I+   +E       D  + +E +     +   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N    K + G    +  +KV NL+  L  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    66 VHQGIVARVREGRQYQENDLPALLESV-----ETPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236
>gi|110600085|ref|ZP_01388313.1| RNA methyltransferase TrmH, group 3 [Geobacter sp. FRC-32] >gi|110549160|gb|EAT62358.1| RNA methyltransferase TrmH, group 3 [Geobacter sp. FRC-32] (245 aa)
Score = 218, Expect = 3.7e-16, Identities = 47/143 (32%), Positives = 82/143 (57%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLV-VIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD +QDP N GA+ R++      G+I  K+  + +   V K S G +  +   +V N+++ L++LK   +W      D +S P+S F+  +   V +++G+E +G+  L+KK  D +V I +   V SLN SV+  I+L+
  S:    96 LLLVLDGVQDPHNLGALIRSAACAGAQGVIIPKDRAVGVTAAVEKASAGAIETIAVAEVTNIAQTLDELKAAGFWIY--GADGES-PISIFEQKLTGAVALVIGSEGEGIRPLVKKRCDILVSIPLKGGVNSLNASVAGGIMLF 236
>gi|161869843|ref|YP_001599012.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria meningitidis 053442] >gi|161595396|gb|ABX73056.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria meningitidis 053442] (234 aa)
Score = 217, Expect = 4.0e-16, Identities = 61/224 (27%), Positives = 115/224 (51%)
  Q:     8 KAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           K+++E + Q   S+       + L++  ++NI++  V+    D       HQ + G    S   +H +     + + NL ++  ++L+LD I DP N GA  RT+ +  V  +I  K+    +N TV K + G    + ++ V NL+  L +LK+   W + T +  +S     +  ++ ++   ++GNE  G+  L ++  D +V I M  +V+S+NVSVS  ++L
  S:     6 KSIVELYIQEGKSDA---RTREVLEKAANENIRVYFVDTTRLDAISKGARHQGVAGFIDASKNHVHLE-----DVLENL-SEPPLLLILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGES---DLYHCNLPDRAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVL 220
>gi|170730155|ref|YP_001775588.1| tRNA/rRNA methyltransferase [Xylella fastidiosa M12] >gi|167964948|gb|ACA11958.1| tRNA/rRNA methyltransferase [Xylella fastidiosa M12] (249 aa)
Score = 217, Expect = 4.3e-16, Identities = 57/198 (28%), Positives = 106/198 (53%)
  Q:    35 KSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + K I++ +V  +  D     V HQ +   A+ +++ +  + D  ++ + +    + ++LVLD +QDP N GA  R++ +  V  +I  K+  + IN TV KTS G  + L  + V NL+  L +L+K++ W    A     +  S +  D+   + +++G E  G+  L ++  D + +I M   V+SLNVSV+  + L+
  S:    47 RRKGIEVRRVTTQALDGVGGGVRHQGV--AARYAAVRLWEEHD--LKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAAAAGVTAVIISKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLA---GEVETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240
>gi|157804038|ref|YP_001492587.1| elongation factor Tu [Rickettsia canadensis str. McKiel] >gi|157785301|gb|ABV73802.1| elongation factor Tu [Rickettsia canadensis str. McKiel] (239 aa)
Score = 217, Expect = 4.4e-16, Identities = 62/190 (32%), Positives = 105/190 (55%)
  Q:    45 NKKFFD--KYEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           NKK      YE+V+ +IL    E+      +  +   F   +E I+  N   KI  +LD+I D  N GAI R++ +F +  I+  ++N    +  + K + GT+  +  +KV NL   +N LKK  +W +           +KF T  NK+ ++ G+E+KG+ +L++K  D++ KI +   V+SLNVS + +II + L
  S:    44 NKKLIGTRSYEIVNNDILSKLLENQTHQGIAAKVRPIFSYNLEDIDIKNPKCKIT-ILDQITDTQNIGAIIRSAAAFDINAILLPQDNAPNESGGIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTNKFIT--NKIALVFGSEDKGMRKLVEKTCDYLAKIPISKRVESLNVSNAASIIFHLL 238
>gi|90408972|ref|ZP_01217104.1| RNA methyltransferase, TrmH family, group 3 [Psychromonas sp. CNPT3] >gi|90309920|gb|EAS38073.1| RNA methyltransferase, TrmH family, group 3 [Psychromonas sp. CNPT3] (246 aa)
Score = 217, Expect = 4.6e-16, Identities = 53/177 (29%), Positives = 91/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +L   K + +    D +S +E +    T+   +L+LD + DP N GA  R++ +  V  +I  K+N   +   V K + G    +  ++V NL+  +  L+ +  W   TA +   S+   +F   I    + +G E+KG+  L ++  D ++K+ M  SV SLNVSV+T I L+
  S:    69 HQGVLARIKIAKVLNDNDLESLLENL----TEAPFLLILDGVTDPHNLGACLRSADAAGVHAVIIPKDNSASLTPVVRKVACGAAESVALIQVTNLARCMRSLQDKGIWIYGTAGEATGSVYDCQFSGGI---AIAMGAEDKGLRRLTREHCDALIKLPMAGSVSSLNVSVATGICLF 239
>gi|156932411|ref|YP_001436327.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Enterobacter sakazakii ATCC BAA-894] >gi|156530665|gb|ABU75491.1| hypothetical protein ESA_00190 [Enterobacter sakazakii ATCC BAA-894] (243 aa)
Score = 217, Expect = 4.7e-16, Identities = 57/199 (28%), Positives = 98/199 (49%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +++ + +   N+++ D+     VHQ I+   K        D    +         +  +L+LD + DP N GA  R++ +  V  +I  K+   Q+N T  K + G    +  ++V NL+  +  L++EN W V TA  E    L + K     L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    43 LEAQGVPVQVANRQWLDEKADGAVHQGIVARVKPGRQYGENDLPDLLAA-----HAQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENVWIVGTA-GEADHTLYQSKM-TGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236
>gi|34581366|ref|ZP_00142846.1| tRNA/rRNA methyltransferase [Rickettsia sibirica 246] >gi|28262751|gb|EAA26255.1| tRNA/rRNA methyltransferase [Rickettsia sibirica 246] (240 aa)
Score = 217, Expect = 4.7e-16, Identities = 62/195 (31%), Positives = 105/195 (53%)
  Q:    40 KLNKVNKKFFDK--YEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           K+ + NKK      YE+V+ +IL    E+      +  I   F   +E I+  N   KI  +LD+I D  N G I R++ +F +  II  ++N    + ++ K + GT+  +  +KV NL   +N LKK  +W +            K  +D  K+V++ G+E+KG+  L+ +  D++ KI +   V+SLNVS + +II + L
  S:    39 KIFETNKKLIGTRAYEIVNNDILSKLLENQTHQGIAAKIRPIFSYNLEDIDITNPKCKIA-ILDQITDTQNIGTIIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLISD--KIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAASIIFHSL 238
>gi|15892932|ref|NP_360646.1| tRNA/rRNA methyltransferase [Rickettsia conorii str. Malish 7] >gi|15620124|gb|AAL03547.1| tRNA/rRNA methyltransferase [EC:2.1.1.-] [Rickettsia conorii str. Malish 7] (240 aa)
Score = 217, Expect = 4.8e-16, Identities = 62/192 (32%), Positives = 105/192 (54%)
  Q:    43 KVNKKFFDK--YEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           + NKK      YE+V+ +IL    E+      +  I   F   +E I+  N   KI  +LD+I D  N GAI R++ +F +  II  ++N    + ++ K + GT+  +  +KV NL   +N LKK  +W +           +K  +D  K+V++ G+E+KG+  L+ +  D++ KI +   V+SLNVS + +II + L
  S:    42 ETNKKLIGTRAYEIVNNDILSKLLENQTHQGIAAKIRPIFSYNLEDIDITNPKCKIA-ILDQITDTQNIGAIIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTNKLISD--KIVLVFGSEDKGIRRLVVETCDYLAKIPISQRVESLNVSNAASIIFHSL 238
>gi|119776198|ref|YP_928938.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella amazonensis SB2B] >gi|119768698|gb|ABM01269.1| RNA methyltransferase TrmH, group 3 [Shewanella amazonensis SB2B] (240 aa)
Score = 216, Expect = 5.4e-16, Identities = 54/194 (27%), Positives = 98/194 (50%)
  Q:    39 IKLNKVNKKFFDKY--EVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           IK  +  +K  D+      HQ I+   + + +    D ++ ++      T+   +L+LD + DP N GA  R + +  V G+I  K+N   +  TV K + G    +   +V NL+  + ++++   W   TA +  S   + ++ ++   L + +G E KG+  L ++  D ++ I M  SV SLNVSV+T I L+
  S:    44 IKAQQAARKTLDEKAESTQHQGIIIRVRPAKVLTENDLEALLDA-----TETPFLLILDGVTDPHNLGACLRNADAAGVHGVIVPKDNSAGLTPTVSKVACGAAETVPLFQVTNLARTMKRIQERGVWIAGTAGEADS---TLYEANLKGPLAIAMGAEGKGLRRLSREGCDTLISIPMAGSVSSLNVSVATGICLF 232
>gi|71275861|ref|ZP_00652145.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Dixon] >gi|71899357|ref|ZP_00681517.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1] >gi|71163439|gb|EAO13157.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Dixon] >gi|71730871|gb|EAO32942.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1] (249 aa)
Score = 216, Expect = 5.4e-16, Identities = 57/198 (28%), Positives = 106/198 (53%)
  Q:    35 KSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + K I++ +V  +  D     V HQ +   A+ +++ +  + D  ++ + +    + ++LVLD +QDP N GA  R++ +  V  +I  K+  + IN TV KTS G  + L  + V NL+  L +L+K++ W    A     +  S +  D+   + +++G E  G+  L ++  D + +I M   V+SLNVSV+  + L+
  S:    47 RRKGIEVRRVTTQALDGVGGGVRHQGV--AARYAAVRLWEEHD--LKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAAAAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLA---GEVETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240
>gi|28198726|ref|NP_779040.1| tRNA/rRNA methyltransferase [Xylella fastidiosa Temecula1] >gi|71897946|ref|ZP_00680151.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1] >gi|182681419|ref|YP_001829579.1| RNA methyltransferase [Xylella fastidiosa M23] >gi|52783310|sp|Q87D65|RLMB_XYLFT 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|28056817|gb|AAO28689.1| tRNA/rRNA methyltransferase [Xylella fastidiosa Temecula1] >gi|71732190|gb|EAO34245.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1] >gi|182631529|gb|ACB92305.1| RNA methyltransferase, TrmH family, group 3 [Xylella fastidiosa M23] (249 aa)
Score = 216, Expect = 5.4e-16, Identities = 57/198 (28%), Positives = 106/198 (53%)
  Q:    35 KSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + K I++ +V  +  D     V HQ +   A+ +++ +  + D  ++ + +    + ++LVLD +QDP N GA  R++ +  V  +I  K+  + IN TV KTS G  + L  + V NL+  L +L+K++ W    A     +  S +  D+   + +++G E  G+  L ++  D + +I M   V+SLNVSV+  + L+
  S:    47 RRKGIEVRRVTTQALDGVGGGVRHQGV--AARYAAVRLWEEHD--LKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAAAAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLA---GEVETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240
>gi|23465262|ref|NP_695865.1| tRNA/rRNA methyltransferase [Bifidobacterium longum NCC2705] >gi|23325895|gb|AAN24501.1| possible tRNA/rRNA methyltransferase [Bifidobacterium longum NCC2705] (169 aa)
Score = 216, Expect = 5.9e-16, Identities = 49/149 (32%), Positives = 85/149 (57%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD---EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           + + + LD + DP N GA+ R++ +F   G+I  +     +N    K S G   ++   +V NL++ L  LK+  Y+ V   LD   +K +  + F++D   LVV++G+E  G+  L+++  D I  I + SSV+SLN SV+  I LY +++
  S:    14 RPLFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVNAAAWKVSAGAAAHMPVARVVNLTKALEGLKERGYYVV--GLDGGGDKLVGETGFESD--PLVVVLGSEGSGLGRLVRETCDAIAGIPISSSVESLNASVAAGISLYAVSN 161
>gi|23335906|ref|ZP_00121137.1| COG0566: rRNA methylases [Bifidobacterium longum DJO10A] >gi|189440335|ref|YP_001955416.1| rRNA methylase [Bifidobacterium longum DJO10A] >gi|189428770|gb|ACD98918.1| rRNA methylase [Bifidobacterium longum DJO10A] (330 aa)
Score = 216, Expect = 5.9e-16, Identities = 49/149 (32%), Positives = 85/149 (57%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD---EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLTH 236
           + + + LD + DP N GA+ R++ +F   G+I  +     +N    K S G   ++   +V NL++ L  LK+  Y+ V   LD   +K +  + F++D   LVV++G+E  G+  L+++  D I  I + SSV+SLN SV+  I LY +++
  S:   175 RPLFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVNAAAWKVSAGAAAHMPVARVVNLTKALEGLKERGYYVV--GLDGGGDKLVGETGFESD--PLVVVLGSEGSGLGRLVRETCDAIAGIPISSSVESLNASVAAGISLYAVSN 322
>gi|196190330|gb|EDX85294.1| RNA methyltransferase, TrmH family, group 3, putative [Synechococcus sp. PCC 7335] (365 aa)
Score = 216, Expect = 6.4e-16, Identities = 70/228 (30%), Positives = 115/228 (50%)
  Q:     5 FGKKAV---IEAFKQ-NEL---SEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNIL-------GIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTV-CTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+ AV   IEA +  N L   ++++Y S+F  L       I   K N    D+ E V  + +       GI  + S   + D +  +++  N    + +I+  D I DP N GAI R++++    GI+  +   + +  TV K S G +  +   +V NL   L  LK  ++W    TA   +SI  + F   +   V++VG E  G+S  ++   D +V IE+     SLN SV+T + LY
  S:   100 YGRHAVEAAIEAGRSLNRLWVNAKLHYDSHFRPL-------IATAKANGSVVDEVENVRLSQMTQGASHQGIVAQVSAYEYVDLEVLVQQAKN-KARRPVIVAADGITDPHNLGAIIRSAEAIGAQGIVIPQRRAVGVTSTVAKVSAGALENIPIARVINLGRALEYLKSNSFWIYGLTAEAAQSIHTTDFSAPV---VLVVGAEGSGLSLSVQNLCDQLVSIELSGKTPSLNASVATGMALY 331
>gi|152995437|ref|YP_001340272.1| RNA methyltransferase [Marinomonas sp. MWYL1] >gi|150836361|gb|ABR70337.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas sp. MWYL1] (255 aa)
Score = 216, Expect = 6.6e-16, Identities = 50/183 (27%), Positives = 90/183 (49%)
  Q:    50 DKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K  VVHQ ++     +      D  S +  +     +  +I++LD + DP N GA  R++ +     ++  K+N   +N TV K + G    +    V NL+  + KL+ +  W   TA +      + ++ D+     +++G E  G+  L ++  D++VK+ M   V SLNVSV+T + LY
  S:    67 NKDRVVHQGVVAYTAMNKAGNEADLHSLVAGLE----ETPLIIILDGVTDPHNLGACLRSADAAGAHAVVMPKDNSAPLNATVSKVACGAAESIPVYAVTNLARTMKKLQDQGVWIFGTAGEATQ---TIYEQDLTIPTAIVMGAEGDGMRRLTREQCDYLVKLPMAGVVSSLNVSVATGVCLY 243
>gi|51473842|ref|YP_067599.1| tRNA/rRNA methyltransferase [Rickettsia typhi str. Wilmington] >gi|51460154|gb|AAU04117.1| tRNA/rRNA methyltransferase [Rickettsia typhi str. Wilmington] (248 aa)
Score = 216, Expect = 6.6e-16, Identities = 55/179 (30%), Positives = 95/179 (53%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           HQ   GIA +       + D       ++N  +  I++LD+I D  N GAI R++ +F +  II  ++N    + ++ K + GT+  +  +KV NL   +N LKK  +W +            KF +D  K+ ++ G E+KG+  L+K+  D++ KI +  SV+SLNV+ + +II + L
  S:    73 HQTHQGIAAKVRPIFSYNLDDI-----DINNPQCKIVILDQITDTQNIGAIIRSAAAFYINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLCSYMNYLKKRGFWIIGVTGYANEYFTDKFISD--KIALVFGAEDKGMRRLVKETCDYLAKIPISKSVESLNVANAASIIFHSL 244
>gi|169634562|ref|YP_001708298.1| putative tRNA/rRNA methyltransferase [Acinetobacter baumannii SDF] >gi|184156660|ref|YP_001844999.1| rRNA methylase [Acinetobacter baumannii ACICU] >gi|169153354|emb|CAP02471.1| putative tRNA/rRNA methyltransferase [Acinetobacter baumannii] >gi|183208254|gb|ACC55652.1| rRNA methylase [Acinetobacter baumannii ACICU] >gi|193076173|gb|ABO10788.2| putative tRNA/rRNA methyltransferase [Acinetobacter baumannii ATCC 17978] (249 aa)
Score = 215, Expect = 7.1e-16, Identities = 55/177 (31%), Positives = 89/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVC-TALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   +        D D  + +     T   ++L LD++ DP N GA  RT+ +  V  +I  ++    +  T  K + G    + F++V NL+  L  LK+  +  V  T LDE ++P+   K D +  VVIV G E+ G+  + +   D    I M  ++QSLNVSV+T + LY
  S:    69 HQGVVAAVRPHPTLNEKDLDQLLAE-----TPDALLLALDQVTDPHNLGACIRTAAAMGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTLAHLKETTHVRVIGTMLDENALPIQ--KCDFSGAVVIVMGAEDTGLRPITQAQCDQKAYIPMSGNLQSLNVSVATGMALY 240
>gi|169797417|ref|YP_001715210.1| putative tRNA/rRNA methyltransferase [Acinetobacter baumannii AYE] >gi|169150344|emb|CAM88241.1| putative tRNA/rRNA methyltransferase [Acinetobacter baumannii] (249 aa)
Score = 215, Expect = 7.1e-16, Identities = 55/177 (31%), Positives = 89/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVC-TALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   +        D D  + +     T   ++L LD++ DP N GA  RT+ +  V  +I  ++    +  T  K + G    + F++V NL+  L  LK+  +  V  T LDE ++P+   K D +  VVIV G E+ G+  + +   D    I M  ++QSLNVSV+T + LY
  S:    69 HQGVVAAVRPHPTLNEKDLDQLLTE-----TPDALLLALDQVTDPHNLGACIRTAAAMGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTLAHLKETTHVRVIGTMLDENALPIQ--KCDFSGAVVIVMGAEDTGLRPITQAQCDQKAYIPMSGNLQSLNVSVATGMALY 240
>gi|126640406|ref|YP_001083390.1| putative tRNA/rRNA methyltransferase [Acinetobacter baumannii ATCC 17978] (226 aa)
Score = 215, Expect = 7.1e-16, Identities = 55/177 (31%), Positives = 89/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVC-TALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   +        D D  + +     T   ++L LD++ DP N GA  RT+ +  V  +I  ++    +  T  K + G    + F++V NL+  L  LK+  +  V  T LDE ++P+   K D +  VVIV G E+ G+  + +   D    I M  ++QSLNVSV+T + LY
  S:    46 HQGVVAAVRPHPTLNEKDLDQLLAE-----TPDALLLALDQVTDPHNLGACIRTAAAMGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTLAHLKETTHVRVIGTMLDENALPIQ--KCDFSGAVVIVMGAEDTGLRPITQAQCDQKAYIPMSGNLQSLNVSVATGMALY 217
>gi|91791876|ref|YP_561527.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella denitrificans OS217] >gi|91713878|gb|ABE53804.1| RNA methyltransferase TrmH, group 3 [Shewanella denitrificans OS217] (246 aa)
Score = 215, Expect = 7.6e-16, Identities = 51/177 (28%), Positives = 91/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   + + +    + D+ ++     +T+   +L+LD + DP N GA  R + +  V GII  K+N   +  TV K + G    +   +V NL+  +  L+    W V TA +      + ++ ++   L + +G E+KG+  L ++  D +V I M  SV SLNVSV+T + L+
  S:    69 HQGVVARVQAAKVLAENELDALLD-----STEVPFLLILDGVTDPHNLGACLRNADAAGVQGIIVPKDNSAGLTPTVSKVACGAAETVPLFQVTNLARTMRHLQDRGVWIVGTAGEADG---ALYQAELTGPLAIAMGAEDKGLRRLSREACDKLVSIPMAGSVSSLNVSVATGVCLF 238
>gi|167472143|ref|ZP_02336847.1| 23S rRNA Gm2251 methyltransferase [Rickettsia africae ESF-5] (240 aa)
Score = 215, Expect = 7.7e-16, Identities = 62/192 (32%), Positives = 105/192 (54%)
  Q:    43 KVNKKFFDK--YEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           + NKK      YE+V+ +IL    E+      +  I   F   +E I+  N   KI  +LD+I D  N GAI R++ +F +  II  ++N    + ++ K + GT+  +  +KV NL   +N LKK  +W +            K  +D  K+V++ G+E+KG+ +L+ +  D++ KI +   V+SLNVS + +II + L
  S:    42 ETNKKLIGTRAYEIVNNDILSKLLENQTHQGIAAKIRPIFSYNLEDIDITNPKCKIA-ILDQITDTQNIGAIIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVINLRSCMNYLKKHGFWIIGLTGSANDYFTDKLISD--KIVLVFGSEDKGIRKLVAETCDYLAKIPISQRVESLNVSNAASIIFHSL 238
>gi|15676825|ref|NP_273970.1| RNA methyltransferase [Neisseria meningitidis MC58] >gi|52783329|sp|Q9JZR3|RLMB_NEIMB 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|7226169|gb|AAF41338.1| RNA methyltransferase, TrmH family [Neisseria meningitidis MC58] (250 aa)
Score = 215, Expect = 7.7e-16, Identities = 61/224 (27%), Positives = 115/224 (51%)
  Q:     8 KAVIEAFKQNELS-----EVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           K+++E + Q   S     EV   +  + ++ + +   +LN ++K         HQ ++G    S   +H +     + + NL ++  ++L+LD I DP N GA  RT+ +  V  +I  K+    +N TV K + G    + ++ V NL+  L +LK+   W + T +  +S     +  ++ +    ++GNE  G+  L ++  D +V I M  +V+S+NVSVS  ++L
  S:    22 KSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISKG------ARHQGVVGFIDASKNHVHLE-----DVLENL-SEPPLLLILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGES---DLYHCNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVL 236
>gi|15639103|ref|NP_218549.1| rRNA methylase, putative [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025343|ref|YP_001933115.1| possible rRNA methylase [Treponema pallidum subsp. pallidum SS14] >gi|3322373|gb|AAC65100.1| rRNA methylase, putative [Treponema pallidum subsp. pallidum str. Nichols] >gi|189017918|gb|ACD70536.1| possible rRNA methylase [Treponema pallidum subsp. pallidum SS14] (292 aa)
Score = 215, Expect = 7.9e-16, Identities = 47/143 (32%), Positives = 76/143 (53%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD I DP N GAI R++  F V  ++   ++     ET+ + S G V ++  ++V NL      LK+  +W     +  ++I    F     K  +++GNE  GVS L++   D ++ I    +V SLNVSV+  I+LY
  S:   132 LVLVLDAITDPHNVGAIVRSADQFSVDAVLLPHHHGAGGTETITRVSAGAVAWVPLVRVRNLVRTAGILKRSGFWLYGADVAGEAIGARTFPP---KTALVLGNEGHGVSPLLRTHCDALISIPTQGNVDSLNVSVAAGILLY 271
>gi|152979716|ref|YP_001345345.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus succinogenes 130Z] >gi|150841439|gb|ABR75410.1| RNA methyltransferase, TrmH family, group 3 [Actinobacillus succinogenes 130Z] (245 aa)
Score = 215, Expect = 8.1e-16, Identities = 61/202 (30%), Positives = 103/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E  +  I +  +N++  D   +  VHQ I+   + +     +D D+ +    N      ++LVLD + DP N GA  RT+ +  V  +I  K+   Q+     K + G    L  ++V NL+  L  +++  N W V TA  E S  L  ++T++   L +++G E  G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    40 LNELHNLGISVQFLNRQTLDNKAHGEVHQGIIARVQPAKELNESDLDNILNGKPN-----PLLLVLDGVTDPHNLGACLRTADAAGVDAVIVPKDKSAQLTSIARKVACGAAEVLPLIRVTNLARTLRDIQQSHNIWVVGTA-GEASETL--YQTELTGSLALVMGAEGDGMRRLTRECCDQLISIPMAGSVSSLNVSVATGVCLF 237
>gi|37528393|ref|NP_931738.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|52783299|sp|Q7MYU6|RLMB_PHOLL 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|36787831|emb|CAE16946.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] (244 aa)
Score = 215, Expect = 8.4e-16, Identities = 55/199 (27%), Positives = 99/199 (49%)
  Q:    34 FKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +S  + +   N+++ D      VHQ I+   K        D    + ++     +   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N T  K + G    +  ++V NL+  L  L++ N W V TA + + ++  SK       + +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    43 LESIGMTIQLANRQWLDNQTEGAVHQGIIAKVKPGRQYQENDLPDLLAQV-----ETPFLLVLDGVTDPHNLGACLRSADAAGVHAVIIPRDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRLLQEYNIWVVGTAGEADHTLYQSKLT---GPMALVMGAEGEGMRRLTREHCDELISIPMVGSVSSLNVSVATGVCLF 236
>gi|158521920|ref|YP_001529790.1| RNA methyltransferase [Desulfococcus oleovorans Hxd3] >gi|158510746|gb|ABW67713.1| RNA methyltransferase, TrmH family, group 3 [Desulfococcus oleovorans Hxd3] (256 aa)
Score = 214, Expect = 9.3e-16, Identities = 62/202 (30%), Positives = 102/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD---EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L+  +  NI +N++  +  ++     VHQ   GIA   S+         +  + +  TD   ILV D + DP N GA+ RT+    V G+I  K+N        +K S G + +L   +  N++ VL+ LK    W     LD   E++I    + +D+   L ++VG+E +G+  L+ +  DFI+ I     V SLN SV+ A+ +Y
  S:    46 LQAAEQHNIPVNEIPARDLEQMTGGKVHQ---GIAARVSVYPFVPLADLLAAVPS--TDTPFILVADGLTDPHNLGALARTALCAGVHGLIIPKDNAASPTPAAVKASAGALEFLPVARETNIARVLDALKDAGLWI--AGLDGRGEQTI----YDSDLTGPLALVVGDEGRGIRRLVGQKCDFILSIPQTDMVHSLNASVAGAVAMY 242
>gi|119474664|ref|ZP_01615017.1| RNA methyltransferase, TrmH family, group 3 [marine gamma proteobacterium HTCC2143] >gi|119450867|gb|EAW32100.1| RNA methyltransferase, TrmH family, group 3 [marine gamma proteobacterium HTCC2143] (247 aa)
Score = 214, Expect = 9.6e-16, Identities = 52/194 (26%), Positives = 101/194 (52%)
  Q:    39 IKLNKVNKKFFDK-YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +K   V ++  DK  +  HQ ++   K +      D    ++ +++      ++L+LD + DP N GA  RT+ +  V  +I  K++   +N TV K + G    + +++V NL+  +  ++    W   TA + +    S ++ ++   V +V G E KG+  L +++ D+++ + M  SV SLNVSV+T + L+
  S:    50 VKCKTVPREELDKQVDGRHQGVVAFTKPAQTLRDRDLKEMLDGLDH----PPLLLILDGVTDPHNLGACLRTADAAGVDAVIAPKDSSAPLNATVRKVACGAAEVVPYIQVTNLARTMKDIQGRGIWITGTAGEAEQ---SVYQANLTGPVALVMGAEGKGMRRLTRENCDYLINLPMAGSVSSLNVSVATGVCLF 238
>gi|170732873|ref|YP_001764820.1| RNA methyltransferase [Burkholderia cenocepacia MC0-3] >gi|169816115|gb|ACA90698.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia cenocepacia MC0-3] (247 aa)
Score = 214, Expect = 9.6e-16, Identities = 51/177 (28%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +A+   + +  +    ++ IN       ++LVLD + DP N GA  R + S     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ DE    L + K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    69 HQGV--VARVEDMPLAQNLSELLDGING----PALLLVLDGVTDPHNLGACLRVADSAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTS-DEAPATLYETKLD-GPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237
>gi|124023282|ref|YP_001017589.1| rRNA methylase [Prochlorococcus marinus str. MIT 9303] >gi|123963568|gb|ABM78324.1| rRNA methylase [Prochlorococcus marinus str. MIT 9303] (536 aa)
Score = 214, Expect = 9.8e-16, Identities = 60/206 (29%), Positives = 103/206 (50%)
  Q:    27 YFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +   L+E KS  + + +V      +     VHQ   GI  +++     D  S IE    L  +  ++L LD + DP N GAI R++++    G++  +     +  +V K + G + +L   +V NL+  L  LK+  Y  +  A +E  I L     D   LV++ G+E +G+S L ++  D +V++ +     SLN SV+TA+ LY
  S:   212 FLQLLREAKSSGVLVEEVTWARLGQLTGGAVHQ---GIVLQTAAAETLDLQSLIEGCAGLG-ESPLLLALDGLTDPHNLGAIIRSAEALGAHGVVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEALKQAGYRVIGLA-EEGDITLPDVDLD-GPLVIVTGSEKQGISLLTRRHCDQLVRVPLRGVTPSLNASVATAMCLY 413
>gi|33862923|ref|NP_894483.1| tRNA/rRNA methyltransferase (SpoU):RNA methyltransferase TrmH... [Prochlorococcus marinus str. MIT 9313] >gi|33634840|emb|CAE20825.1| tRNA/rRNA methyltransferase [Prochlorococcus marinus str. MIT 9313] (535 aa)
Score = 214, Expect = 9.8e-16, Identities = 60/206 (29%), Positives = 103/206 (50%)
  Q:    27 YFDELKEFKSKNIKLNKVNKKFFDKYE--VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +   L+E KS  + + +V      +     VHQ   GI  +++     D  S IE    L  +  ++L LD + DP N GAI R++++    G++  +     +  +V K + G + +L   +V NL+  L  LK+  Y  +  A +E  I L     D   LV++ G+E +G+S L ++  D +V++ +     SLN SV+TA+ LY
  S:   211 FLQLLREAKSSGVLVEEVTWARLGQLTGGAVHQ---GIVLQTAAAETLDLQSLIEGCAGLG-ESPLLLALDGLTDPHNLGAIIRSAEALGAHGVVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEALKQAGYRVIGLA-EEGDITLPDVDLD-GPLVIVTGSEKQGISLLTRRHCDQLVRVPLRGVTPSLNASVATAMCLY 412
>gi|125973737|ref|YP_001037647.1| RNA methyltransferase [Clostridium thermocellum ATCC 27405] >gi|196253021|ref|ZP_03151665.1| RNA methyltransferase, TrmH family, group 3 [Clostridium thermocellum DSM 4150] >gi|125713962|gb|ABN52454.1| RNA methyltransferase, TrmH family, group 3 [Clostridium thermocellum ATCC 27405] >gi|196197583|gb|EDX92436.1| RNA methyltransferase, TrmH family, group 3 [Clostridium thermocellum DSM 4150] (267 aa)
Score = 214, Expect = 1.0e-15, Identities = 67/231 (29%), Positives = 123/231 (53%)
  Q:     2 KKFF---GKKAVIEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESS----LTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           KK F   G + V EA K+    E   VS  D+L E  S    L KV+   +  +++ H+  + I+   +    L + +  +  IE + +   +K   ++LD +QDPGN G I RT+ +  + G+I  K      N  V+++++G++ ++   +  ++ E ++++KK     +C A  E S      +   N + +++GNE  G+SE +K  +D +V+I M    +SLN SV+  I++Y
  S:    27 KKLFFIEGIRFVEEALKEGVQIERILVS--DKLAETNSGYEILKKVSNGGYPVFQLPHKLFMEISDTQNPQGILAVLSMKNCDIEDVWD---EKNFFVILDSVQDPGNMGTIIRTADAAGMTGVIVSKGCVDVYNPKVLRSTMGSIFHIPICQSQDIFETMDRMKKRGI-KICAAHLEGSCDYFDLEYK-NNIAIVIGNEANGISEEVKNFADILVRIPMPGRAESLNASVAAGILMY 257
>gi|160871681|ref|ZP_02061813.1| RNA methyltransferase, TrmH family, group 3 [Rickettsiella grylli] >gi|159120480|gb|EDP45818.1| RNA methyltransferase, TrmH family, group 3 [Rickettsiella grylli] (253 aa)
Score = 214, Expect = 1.0e-15, Identities = 56/178 (31%), Positives = 85/178 (47%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ +    K++S     D   F+    + N +   +LVLD +QDP N GA  R++ +  V  +I  ++  +     V KT+ G     +   V NL+  L +LKK   W  C  LD+    L         L +++G E KG+  L K   D +V I M  +V SLNVSV+  + L+
  S:    71 VHQGVFAKIKKTSRLNEQDLMIFLHHRLHNNLNPPFLLVLDGVQDPHNLGACLRSANAAGVDAVIIPQDRAVNKTPIVQKTAAGAAEVTSLFTVTNLATCLERLKKCGIW--CYGLDQSGTRLIYDAPLTGPLALVLGAEGKGLRRLTKVCCDDLVAIPMVGTVGSLNVSVAAGVGLF 246
>gi|126656120|ref|ZP_01727504.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. CCY0110] >gi|126622400|gb|EAZ93106.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. CCY0110] (291 aa)
Score = 214, Expect = 1.0e-15, Identities = 55/175 (31%), Positives = 89/175 (50%)
  Q:    58 NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           N  G+A + +   + + D  I +    N+D  +I++ D I DP N GAI RT+++    G+I  +     +  TV K + G +      +V NLS  L  LKKE +W   T + E    L  F  +   + +++G+E  G+S L ++  D +V I ++    SLN SV+ AI LY
  S:   107 NHQGVAAQVAPYTYHELDELITQAK-ANSDAPVIVIADGIADPHNLGAIIRTAEAMGCQGLIIPQRRAAGVTSTVSKVAAGALESFPVARVVNLSRALETLKKEGFWIYGT-VAEGGKRLHDFNFE-GAIGLVIGSEGSGLSLLTQRCCDQLVSIPLEGKTPSLNASVAAAINLY 278
>gi|184201514|ref|YP_001855721.1| rRNA methyltransferase [Kocuria rhizophila DC2201] >gi|183581744|dbj|BAG30215.1| rRNA methyltransferase [Kocuria rhizophila DC2201] (322 aa)
Score = 214, Expect = 1.1e-15, Identities = 52/143 (36%), Positives = 80/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD---EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++  D I DP N GAI R+  +F   G+I  +     +  T  KTS G    +   K  NL+  L   KK+ Y+ V   LD   + S+P  +  T+   LVV+VG+E KG+S L+ +  D IV I ++S+++SLN S++  I LY
  S:   172 LLVAADGITDPRNLGAIIRSVSAFAGDGVILPERRSAGVTATAWKTSSGAAARVPVAKATNLTRTLQNCKKQGYFVV--GLDGGGDMSLPQLELATE--PLVVVVGSEGKGLSRLVTEHCDAIVSIPIESAMESLNASMAVGITLY 313
>gi|157964809|ref|YP_001499633.1| tRNA/rRNA methyltransferase [Rickettsia massiliae MTU5] >gi|157844585|gb|ABV85086.1| tRNA/rRNA methyltransferase [Rickettsia massiliae MTU5] (256 aa)
Score = 214, Expect = 1.1e-15, Identities = 62/190 (32%), Positives = 102/190 (53%)
  Q:    45 NKKFFD--KYEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           NKK      YE+V+ +IL    E+      +  I   F   +E I+  N   KI  +LD+I D  N GAI R++ +F +  II  ++N    +  + K + GT+  +  +KV NL   +N LKK  +W +            K  +D  K+V++ G+E+KG+  L+ +  D++ KI +   V+SLNVS + +II + L
  S:    59 NKKLIGTRSYEIVNNDILSKLLENHTHQGIAAKIRPIFSYNLEDIDITNPKCKIA-ILDQITDTQNIGAIIRSAAAFDINAIILPQDNSPNESGGIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLISD--KIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAASIIFHSL 253
>gi|52783328|sp|Q9JUU8|RLMB_NEIMA 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|121052025|emb|CAM08334.1| putative RNA methylase [Neisseria meningitidis Z2491] (250 aa)
Score = 214, Expect = 1.2e-15, Identities = 61/224 (27%), Positives = 114/224 (50%)
  Q:     8 KAVIEAFKQNELS-----EVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           K+++E + Q   S     EV   +  + ++ + +   +LN ++K         HQ ++G    S   +H +     + + NL ++  ++L+LD I DP N GA  RT+ +  V  +I  K+    +N TV K + G    + ++ V NL+  L +LK+   W + T +   +     +  D+ +    ++GNE  G+  L ++  D +V I M  +V+S+NVSVS  ++L
  S:    22 KSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISKG------ARHQGVVGFIDASKNHVHLE-----DVLENL-SEPPLLLILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNA---DLYHCDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVL 236
>gi|15794073|ref|NP_283895.1| RNA methylase [Neisseria meningitidis Z2491] (261 aa)
Score = 214, Expect = 1.2e-15, Identities = 61/224 (27%), Positives = 114/224 (50%)
  Q:     8 KAVIEAFKQNELS-----EVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           K+++E + Q   S     EV   +  + ++ + +   +LN ++K         HQ ++G    S   +H +     + + NL ++  ++L+LD I DP N GA  RT+ +  V  +I  K+    +N TV K + G    + ++ V NL+  L +LK+   W + T +   +     +  D+ +    ++GNE  G+  L ++  D +V I M  +V+S+NVSVS  ++L
  S:    33 KSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAISKG------ARHQGVVGFIDASKNHVHLE-----DVLENL-SEPPLLLILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNA---DLYHCDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVL 247
>gi|78066159|ref|YP_368928.1| RNA methyltransferase TrmH, group 3 [Burkholderia sp. 383] >gi|77966904|gb|ABB08284.1| RNA methyltransferase TrmH, group 3 [Burkholderia sp. 383] (247 aa)
Score = 213, Expect = 1.3e-15, Identities = 47/143 (32%), Positives = 80/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD + DP N GA  R + S     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ DE S  L + K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    97 LLLVLDGVTDPHNLGACLRVADSAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTS-DEASATLYETKLD-GPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237
>gi|121634735|ref|YP_974980.1| putative RNA methylase [Neisseria meningitidis FAM18] >gi|120866441|emb|CAM10187.1| putative RNA methylase [Neisseria meningitidis FAM18] (250 aa)
Score = 213, Expect = 1.4e-15, Identities = 52/176 (29%), Positives = 92/176 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIIL 231
           HQ ++G    S   +H +     + + NL ++  ++L+LD I DP N GA  RT+ +  V  +I  K+    +N TV K + G    + ++ V NL+  L +LK+   W + T +   +     +  D+ +    ++GNE  G+  L ++  D +V I M  +V+S+NVSVS  ++L
  S:    69 HQGVVGFIDASKNHVHLE-----DVLENL-SEPPLLLILDGITDPHNLGACLRTADAMGVHAVIAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNA---DLYHCDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVL 236
>gi|114778983|ref|ZP_01453770.1| RNA methyltransferase, TrmH family, group 3 [Mariprofundus ferrooxydans PV-1] >gi|114550782|gb|EAU53352.1| RNA methyltransferase, TrmH family, group 3 [Mariprofundus ferrooxydans PV-1] (247 aa)
Score = 213, Expect = 1.4e-15, Identities = 53/179 (29%), Positives = 104/179 (58%)
  Q:    54 VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVI-KTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           V HQ ++     +       F+++++ ++ + T   ++L+LD++ DP N GA  RT+++   A +I  K++   ++  V+ K + G ++ L  L+V N+   + +L+++ +WTV  A + E SI  +K         V++G+E+KGV  L+++  D ++ I M   V+SLNVSV+T + L+
  S:    63 VPHQGVVAKMVAAGAQAVPTFEAWLKTVD-MET-APMVLLLDQVTDPHNLGACVRTAEAAGCAAVIVLKDHAADVHSPVVAKAACGALSRLPVLRVINMKRCIEQLQQQGFWTVGLAGEAELSIYDAKLS---GATAVVMGSEDKGVRRLVRETCDQLIHIPMPGVVESLNVSVATGVALF 238
>gi|134094504|ref|YP_001099579.1| tRNA (guanosine-2'-O-)-methyltransferase [Herminiimonas arsenicoxydans] >gi|133738407|emb|CAL61452.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23S rRNA Gm2251 2'-O-methyltransferase) [Herminiimonas arsenicoxydans] (247 aa)
Score = 213, Expect = 1.5e-15, Identities = 54/177 (30%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK   L++  + D  ++ I+       ++LVLD I DP N GA  R +       +I  K+  + +N T  K + G  + + ++ V NL+  L +LK+ +   + T  D EK +  + F        +I+G+E +G+  L ++  D +V I M  SV+SLNVSV++ + LY
  S:    68 HQGV--VAKAGELSLARNLDELLDAIDG----PPLLLVLDGITDPHNLGACLRVADGAGAHAVIAPKDRAVGLNATAAKVASGAADTVPYITVTNLARTLRELKERDILLIGTTDDSEKGLYEADFS---GPAALIMGSEGEGMRRLTRETCDVLVSIPMFGSVESLNVSVASGVCLY 236
>gi|15604508|ref|NP_221026.1| hypothetical protein RP664 [Rickettsia prowazekii str. Madrid E] >gi|3861202|emb|CAA15102.1| unknown [Rickettsia prowazekii] (248 aa)
Score = 212, Expect = 1.5e-15, Identities = 55/179 (30%), Positives = 95/179 (53%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           HQ   GIA +       + D       ++N  +  I++LD+I D  N GAI R++ +F +  II  ++N    + ++ K + GT+  +  +KV NL   +N LKK  +W +      K     K  +D  K+ ++ G E+KG+  L+K+  D++ KI +  SV+SLNV+ + +II + L
  S:    73 HQTHQGIAAKVRPIFSYNLDDI-----DINKPQCKIVILDQITDTQNIGAIIRSAAAFYINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLCSYMNYLKKRGFWIIGVTGYAKEYFTDKLISD--KIALVFGAEDKGMRRLVKETCDYLAKIPISKSVESLNVANAASIIFHSL 244
>gi|161524858|ref|YP_001579870.1| RNA methyltransferase [Burkholderia multivorans ATCC 17616] >gi|189350392|ref|YP_001946020.1| TrmH family RNA methyltransferase [Burkholderia multivorans ATCC 17616] >gi|160342287|gb|ABX15373.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia multivorans ATCC 17616] >gi|189334414|dbj|BAG43484.1| TrmH family RNA methyltransferase [Burkholderia multivorans ATCC 17616] (247 aa)
Score = 212, Expect = 1.5e-15, Identities = 51/177 (28%), Positives = 91/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +A+   L +  +    ++ I        ++LVLD + DP N GA  R + +     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ DE S  L   K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    69 HQGV--VARVEDLPLAQNLSELLDGIQG----PALLLVLDGVTDPHNLGACLRVADAAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTS-DEASATLYDTKLD-GPVAIVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237
>gi|166365581|ref|YP_001657854.1| tRNA/rRNA methyltransferase [Microcystis aeruginosa NIES-843] >gi|166087954|dbj|BAG02662.1| probable tRNA/rRNA methyltransferase [Microcystis aeruginosa NIES-843] (288 aa)
Score = 212, Expect = 1.6e-15, Identities = 63/229 (27%), Positives = 116/229 (50%)
  Q:     4 FFGKKAVIEAFKQN-ELSEVYYVS-------YFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDE-KSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
            +G++ V+ A ++  +L+ ++ V+       Y   L++ K+    +++V+    D+      N  GIA + S   + +    IEK     +   +I++ + I DP N GAI RT+++    G++  +     +  TV+K + G + YL   +V NL+  L +LK   +W    A    KS+        I    +++G+E +G+S L +K  D +V I +     SLN SV+ A+ LY
  S:    44 LYGRRVVLTAMEEERQLNRIWVVNRLRYDPRYHTLLEKAKANGTVIDEVDDLRLDQI-TSKANHQGIAAQMSPYEYIELADLIEKAKG-KSRHPVIVIAEGITDPHNLGAIIRTAEAMGCQGVVIPQRRAAGVTSTVMKVAAGALEYLPVARVVNLNRALEELKAAGFWLYGAAAKSGKSLHTINLTGAIG---LVLGSEGEGLSLLTQKSCDELVSIPLAGKTPSLNASVAAAMALY 276
>gi|119947021|ref|YP_944701.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Psychromonas ingrahamii 37] >gi|119865625|gb|ABM05102.1| RNA methyltransferase, TrmH family, group 3 [Psychromonas ingrahamii 37] (246 aa)
Score = 212, Expect = 1.6e-15, Identities = 52/177 (29%), Positives = 88/177 (49%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    D DS +E +    T    +L+LD + DP N GA  R++ +  V  +I  K+N   +   V K + G    +  + V NL+  +  L+ +  W   TA  E +  L   K +   + + +G E KG+  L ++  D ++K+ M  +V SLNVSV+T + L+
  S:    69 HQGIIARVKTAKVLNDNDLDSLLESL----TAPPFLLILDGVTDPHNLGACLRSADAAGVHAVIIPKDNSASLTPVVRKVACGAAESVPLIHVTNLARAMRSLQDKGVWIYGTA-GEATQSLYDCKLE-GGMALAMGAEGKGLRRLTREHCDQLIKLPMAGAVSSLNVSVATGVCLF 239
>gi|77956194|ref|ZP_00820320.1| COG0566: rRNA methylases [Yersinia bercovieri ATCC 43970] (246 aa)
Score = 212, Expect = 1.6e-15, Identities = 56/202 (27%), Positives = 102/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV---VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + E ++  + +   N+++ D  +V   VHQ I+   +E       D  + ++ +     +   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N    K + G    +  +KV NL+  L  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  +V SLNVSV+T + L+
  S:    40 IAELEAAGLVIQVANRQWLDA-QVEGGVHQGIVARVREGRQYQENDLPALLKSV-----EMPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLF 236
>gi|157963403|ref|YP_001503437.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella pealeana ATCC 700345] >gi|157848403|gb|ABV88902.1| RNA methyltransferase, TrmH family, group 3 [Shewanella pealeana ATCC 700345] (246 aa)
Score = 212, Expect = 1.6e-15, Identities = 52/177 (29%), Positives = 88/177 (49%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K + +    +  + +EK     T+   +L+LD + DP N GA  R + +  V G+I  K+N + +   V K + G    +   +V NL+  +  L+++  W +  A  E    L +  +    L + +G E KG+  L ++  D +V I M  SV SLNVSV+T + L+
  S:    69 HQGIVAKVKPAKILSDNELSAMLEK-----TEVPFLLILDGVTDPHNLGACLRNADAAGVHGVIVPKDNSVGLTPVVSKVACGAAEVVPLYQVTNLARTMRSLQEKGIWIIGAA-GEADCELYQ-ASLTGPLAIAMGAEGKGLRRLSRESCDTLVSIPMAGSVSSLNVSVATGVCLF 238
>gi|110800667|ref|YP_697113.1| RNA methyltransferase [Clostridium perfringens ATCC 13124] >gi|168211254|ref|ZP_02636879.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens B str. ATCC 3626] >gi|110675314|gb|ABG84301.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens ATCC 13124] >gi|170710748|gb|EDT22930.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens B str. ATCC 3626] (289 aa)
Score = 212, Expect = 1.7e-15, Identities = 70/227 (30%), Positives = 118/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFD--KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIE  K ++  E  ++       S    L   K K I + +V++K  D       HQ   G+  + +   ++  +  ++   + N D   I++LDE++DP N G+I RT++     GII  K   + +  TV K S+G + ++   KV N++  + +LK  N W     +  E+    + FK       +I+G+E +G+S L KK  D +VKI M   + SLN SV+  I++Y
  S:    51 GRNAVIELLKSDKTIEQIFIANGKMEGSINKILGLAKEKKIVVKEVDRKKLDLMSETKAHQ---GVIAQITPFKYSTVEDILDLAKSKNEDP-FIVILDELEDPHNLGSIVRTAELCGAHGIIIPKRRNVGVTGTVYKASVGAIEHMKIAKVTNINNAIEELKANNLWIYGADIAGEEYSYETNFKGACG---IIIGSEGRGMSNLTKKKCDKLVKIPMVGKINSLNASVAGGIMMY 280
>gi|145297770|ref|YP_001140611.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850542|gb|ABO88863.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aeromonas salmonicida subsp. salmonicida A449] (249 aa)
Score = 212, Expect = 1.7e-15, Identities = 60/202 (29%), Positives = 101/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E +S  +K+  VN+K  D K E   HQ I+    E+      D  S ++ +      +  +LVLD + DP N GA  R++ +  V  +I  ++    +   V K + G    +  ++V NL+  L +LK    W V TA + +  +  +K       + +++G E KG+  L ++  D +V I M  +V SLNVSV+T + L+
  S:    41 LAEMESLGLKVQSVNRKTLDDKAEGNNHQGIMAKVIEAPKLAEHDLASLLDNLAEQKA-QPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDKASGLTSVVRKVACGAAEVVPLIQVTNLARSLRELKDRGVWIVGTAGEADHDVYQAKLT---GPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVATGVCLF 241
>gi|119502817|ref|ZP_01624902.1| RNA methyltransferase TrmH, group 3 [marine gamma proteobacterium HTCC2080] >gi|119461163|gb|EAW42253.1| RNA methyltransferase TrmH, group 3 [marine gamma proteobacterium HTCC2080] (247 aa)
Score = 212, Expect = 1.7e-15, Identities = 49/146 (33%), Positives = 82/146 (56%)
  Q:    87 DKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           D  ++L+LD + DP N GA  RT+ +  V  ++  ++    ++    K + G  + + F++V NL+  L +LK    W + T+ D+ S  L  F+ D +  V IV G E  G+  L +++ DF+V + M  +V SLNVSV+T I L+
  S:    95 DSPLLLILDGVTDPHNLGACLRTADAAGVTAVVVPQDGAAGLSPVARKVACGAADTVPFVRVTNLARTLGQLKAAGVWLIGTS-DKASRTL--FEQDFSGPVAIVMGAEGAGMRRLTEENCDFLVSLPMQGAVSSLNVSVATGICLF 238
>gi|92113015|ref|YP_572943.1| RNA methyltransferase TrmH, group 3 [Chromohalobacter salexigens DSM 3043] >gi|91796105|gb|ABE58244.1| RNA methyltransferase TrmH, group 3 [Chromohalobacter salexigens DSM 3043] (261 aa)
Score = 212, Expect = 1.8e-15, Identities = 48/143 (33%), Positives = 76/143 (53%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDI-NKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++L+LD + DP NFGA  R++ +    G+I  K+    +N TV K + G  +     +V NL+  + +LK    W V TA +        +  D+   L V++G E KG+  L +   D + K+ M  SV SLNVSV+T + L+
  S:   112 LLLILDGVTDPHNFGACLRSADAAGAHGVIVPKDKAAPLNATVRKVACGAADVTPVYQVTNLARAMGRLKTHGVWIVGTAGESAQ---CLYDIDLAGPLAVVMGAEGKGMRRLTRDACDLLAKLPMAGSVSSLNVSVATGVCLF 252
>gi|170692230|ref|ZP_02883393.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia graminis C4D1M] >gi|170142660|gb|EDT10825.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia graminis C4D1M] (247 aa)
Score = 212, Expect = 1.8e-15, Identities = 51/177 (28%), Positives = 94/177 (53%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +A+   + +  +    ++ IN       ++LVLD + DP N GA  R + +     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W V TA + K    S ++T+++  V IV G E +G+  L     D +++I M  +V+SLNVSV++ + L+
  S:    69 HQGV--VARAGDMPLAQNLAELLDGING----SPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIVGTAGEAKK---SLYETELDGPVAIVMGAEGEGMRRLTHDTCDIVMQIPMAGTVESLNVSVASGVCLF 237
>gi|163802755|ref|ZP_02196645.1| RNA methyltransferase, TrmH family protein [Vibrio campbellii AND4] >gi|159173462|gb|EDP58284.1| RNA methyltransferase, TrmH family protein [Vibrio campbellii AND4] (247 aa)
Score = 212, Expect = 1.8e-15, Identities = 58/202 (28%), Positives = 100/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDK--YEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L + +   + + ++ +K  D   +   HQ I+   K +      D D  + +      D  ++LVLD + DP N GA  R + +   A II  K+    +N TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L +++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    41 LNDLQVCGVSIQQMTRKTLDDKAHGANHQGIIARVKAAKQLNENDIDGILAQ-----HDAPLLLVLDGVTDPHNLGACLRNADAAGAAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTA-GEATHDIYQAKL-TGPLAIVMGAEGGGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|110803075|ref|YP_699682.1| RNA methyltransferase [Clostridium perfringens SM101] >gi|168206818|ref|ZP_02632823.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens E str. JGS1987] >gi|168217917|ref|ZP_02643542.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens NCTC 8239] >gi|169344116|ref|ZP_02865099.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens C str. JGS1495] >gi|110683576|gb|ABG86946.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens SM101] >gi|169297727|gb|EDS79826.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens C str. JGS1495] >gi|170661756|gb|EDT14439.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens E str. JGS1987] >gi|182380031|gb|EDT77510.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens NCTC 8239] (289 aa)
Score = 212, Expect = 1.9e-15, Identities = 70/227 (30%), Positives = 118/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFD--KYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIE  K ++  E  ++       S    L   K K I + +V++K  D       HQ   G+  + +   ++  +  ++   + N D   I++LDE++DP N G+I RT++     GII  K   + +  TV K S+G + ++   KV N++  + +LK  N W     +  E+    + FK       +I+G+E +G+S L KK  D +VKI M   + SLN SV+  I++Y
  S:    51 GRNAVIELLKSDKTIEQIFIANGKMEGSINKILGLAKEKKIVVKEVDRKKLDLMSETKAHQ---GVIAQITPFKYSTVEDILDLAKSKNEDP-FIVILDELEDPHNLGSIVRTAELCGAHGIIIPKRRNVGVTGTVYKASVGAIEHMKIAKVTNINNAIEELKANNVWIYGADIAGEEYSYETNFKGACG---IIIGSEGRGMSNLTKKKCDKLVKIPMVGKINSLNASVAGGIMMY 280
>gi|148651964|ref|YP_001279057.1| RNA methyltransferase [Psychrobacter sp. PRwf-1] >gi|148571048|gb|ABQ93107.1| RNA methyltransferase, TrmH family, group 3 [Psychrobacter sp. PRwf-1] (261 aa)
Score = 212, Expect = 1.9e-15, Identities = 53/150 (35%), Positives = 86/150 (57%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD--EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMD----SSVQSLNVSVSTAIILYYLT 235
           +D  + LVLD+I D  N GA  RT+ +  V  +I  K++   +  TV K S+G +  +  + V NL+  +  LK+   +   TALD   K++P    K    K+ +I+G+E +G+  L  +  D +V I M      S+QSLNVSV+T ++LY ++
  S:   103 SDDALFLVLDQITDAHNLGACLRTAAAMGVDAVICPKHHSASLTPTVAKVSVGAMEIMPVIAVTNLARCIENLKQAGVFVYGTALDATAKALPDVDLK---GKVAIIMGSEGEGMRRLTTERCDELVYIPMTGNKHGSLQSLNVSVATGMVLYEVS 255
>gi|73667231|ref|YP_303247.1| RNA methyl transferase TrmH, group 3 [Ehrlichia canis str. Jake] >gi|72394372|gb|AAZ68649.1| RNA methyl transferase TrmH, group 3 [Ehrlichia canis str. Jake] (252 aa)
Score = 212, Expect = 1.9e-15, Identities = 80/228 (35%), Positives = 118/228 (51%)
  Q:     5 FGKKAVIEAFKQNELSEVYYV----------SYFDELKEF-KSKNIKLNKVNKKFFDKYEVVHQNILGIA-KESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +GK A I A  QN+  E Y +          S   ++ E  K +NI L  VN  + +     + N  GIA K S++   T     IE+I N +T    I++LD+I D  N GAI R++  F V  II   +N    N  + KTS G ++ +    V NL   +   K   YW  C   D K   L       NK ++I G+E+KG+ +L K++ DF++KI   + + SLNVS + A+ LY
  S:     9 YGKHACIAAL-QNKNRECYEMLVTENITKNNSEITKISELCKQRNINLKTVNLNYINSVLPHNSNHQGIALKASTINPLT-----IEEILNSSTINSTIILLDQITDIHNVGAIMRSAVCFNVDAIILPYHNSPSENCGMSKTSSGAIDMIPIAYVINLVSTIKLFKNAGYW--CYGFDTKEGELLHKTKFDNKKLIIFGSEDKGMRKLTKENCDFLLKIATSNKIDSLNVSNAAAVALY 240
>gi|77973971|ref|ZP_00829514.1| COG0566: rRNA methylases [Yersinia frederiksenii ATCC 33641] (246 aa)
Score = 212, Expect = 2.0e-15, Identities = 53/178 (29%), Positives = 88/178 (49%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ I+   +E       D  + +  +     +   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N    K + G    +  +KV NL+  L  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:    66 VHQGIVARVREGRQYQENDLPALLASV-----ETPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236
>gi|77961297|ref|ZP_00825138.1| COG0566: rRNA methylases [Yersinia mollaretii ATCC 43969] (246 aa)
Score = 212, Expect = 2.0e-15, Identities = 56/202 (27%), Positives = 102/202 (50%)
  Q:    31 LKEFKSKNIKLNKVNKKFFDKYEV---VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + E ++  + +   N+++ D  +V   VHQ I+   +E       D  + ++ +     +   +LVLD + DP N GA  R++ +  V  +I  ++   Q+N    K + G    +  +KV NL+  L  L++ N W V TA  E    L + K     + +++G E +G+  L ++  D ++ I M  +V SLNVSV+T + L+
  S:    40 VAELEAAGLVIQVANRQWLDA-QVEGGVHQGIVARVREGRQYQENDLPALLKSV-----EMPFLLVLDGVTDPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTA-GEADHTLYQSKM-TGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLF 236
>gi|171058586|ref|YP_001790935.1| RNA methyltransferase [Leptothrix cholodnii SP-6] >gi|170776031|gb|ACB34170.1| RNA methyltransferase, TrmH family, group 3 [Leptothrix cholodnii SP-6] (244 aa)
Score = 211, Expect = 2.0e-15, Identities = 50/143 (34%), Positives = 80/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIV-GNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD + DP N GA  R +       +I  K++ + +N TV K + G    + +  V NL+  LN+LK+ +   + T+ D      S +  D++  V IV G E  G+ +L +K  D +V I M  +V+SLNVSV++A+ LY
  S:    97 LVLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGVNATVAKVASGAAETVPYFMVTNLARTLNELKERDIRVIGTSEDATQ---SIYDIDLSGPVAIVLGAEGPGMRQLTRKTCDELVHIPMRGAVESLNVSVASAVCLY 237
>gi|171741926|ref|ZP_02917733.1| hypothetical protein BIFDEN_01025 [Bifidobacterium dentium ATCC 27678] >gi|171277540|gb|EDT45201.1| hypothetical protein BIFDEN_01025 [Bifidobacterium dentium ATCC 27678] (329 aa)
Score = 211, Expect = 2.1e-15, Identities = 48/145 (33%), Positives = 79/145 (54%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPL---SKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + + LD + DP N GA+ R++ +F   G+I  +     +     K S G   ++   +V NL++ +  LK+  Y+++   LD     L   + F+TD   LVV++G+E  G+S L++   D I  I M S V+SLN SV+  I LY
  S:   174 RPLFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHMPVARVVNLTKAIESLKERGYYSI--GLDGGGDALVGETGFETD--PLVVVLGSEGNGLSRLVRSTCDVIAGIPMSSMVESLNASVAAGITLY 317
>gi|18311406|ref|NP_563340.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens str. 13] >gi|168214713|ref|ZP_02640338.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens CPE str. F4969] >gi|182626981|ref|ZP_02954711.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens D str. JGS1721] >gi|18146090|dbj|BAB82130.1| probable tRNA/rRNA methyltransferase [Clostridium perfringens str. 13] >gi|170713821|gb|EDT26003.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens CPE str. F4969] >gi|177907651|gb|EDT70275.1| RNA methyltransferase, TrmH family, group 3 [Clostridium perfringens D str. JGS1721] (289 aa)
Score = 211, Expect = 2.1e-15, Identities = 72/227 (31%), Positives = 116/227 (51%)
  Q:     6 GKKAVIEAFKQNELSEVYYV-------SYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKK---IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           G+ AVIE  K ++  E  ++       S    L   K K I + +V++K  D       +   IA+ +     T     +E I +L   K     I++LDE++DP N G+I RT++     GII  K   + +  TV K S+G + ++   KV N++  + +LK  N W     +  E+    + FK       +I+G+E +G+S L KK  D +VKI M   + SLN SV+  I++Y
  S:    51 GRNAVIELLKSDKTIEQIFIANGKMEGSINKILGLAKEKKIVVKEVDRKKLDLMSETKAHQGVIAQITPFKYST-----VEDILDLAKSKNEDPFIVILDELEDPHNLGSIVRTAELCGAHGIIIPKRRNVGVTGTVYKASVGAIEHMKIAKVTNINNAIEELKANNVWIYGADIAGEEYSYETNFKGACG---IIIGSEGRGMSNLTKKKCDKLVKIPMVGKINSLNASVAGGIMMY 280
>gi|148242427|ref|YP_001227584.1| tRNA/rRNA methyltransferase [Synechococcus sp. RCC307] >gi|147850737|emb|CAK28231.1| Possible tRNA/rRNA methyltransferase [Synechococcus sp. RCC307] (442 aa)
Score = 211, Expect = 2.2e-15, Identities = 54/178 (30%), Positives = 96/178 (53%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ   GI  +++     D ++ I+    L  +  +++ +D + DP N GAI R++++    G++  +     +  +V K + G + +L   +V NL+  L +LK   Y  V  A +E S  L++   D   LVV+ G+E +G+S L ++  D +V+I +     SLN SV+TA++LY
  S:   214 VHQ---GIVLQTAAAQTHDLETLIDSCAGLG-EAPLLMAVDGLTDPHNLGAIVRSAEALGAHGLVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLERLKDAGYRVVGLA-EEGSATLAEADLD-GPLVVVTGSEGQGLSMLTRRHCDQLVRIPLRGVTPSLNASVATALLLY 385
>gi|172036714|ref|YP_001803215.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. ATCC 51142] >gi|171698168|gb|ACB51149.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. ATCC 51142] (292 aa)
Score = 211, Expect = 2.2e-15, Identities = 54/175 (30%), Positives = 89/175 (50%)
  Q:    58 NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           N  G+A + +   + + D  I +    N+D+ +I++ D I DP N GAI RT+++    G+I  +     +  TV K S G +      +V NLS  L  LK E +W   T  +  K +    F+  I    +++G+E  G+S L ++  D ++ I ++    SLN SV+ AI LY
  S:   108 NHQGVAAQVAPYTYHELDELITQAK-ANSDEPVIVIADGIADPHNLGAIIRTAEAMGCQGLIIPQRRAAGVTSTVSKVSAGALESFPVARVVNLSRALETLKAEGFWIYGTVAEGGKRLQDFDFRGAIG---LVIGSEGSGLSLLTQRCCDELISIPLEGKTPSLNASVAAAINLY 279
>gi|148981039|ref|ZP_01816259.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrionales bacterium SWAT-3] >gi|145961015|gb|EDK26338.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrionales bacterium SWAT-3] (246 aa)
Score = 211, Expect = 2.3e-15, Identities = 54/177 (30%), Positives = 90/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ I+   K +     T  D  + +      ++ ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L V++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    68 HQGIIAKVKPAKQLNETHLDDILAQ-----HEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDRSSPLTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFVGTA-GEATHDIYQAKL-TGPLAVVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|196256513|ref|ZP_03155050.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 7822] >gi|196201908|gb|EDX96726.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 7822] (313 aa)
Score = 211, Expect = 2.3e-15, Identities = 53/175 (30%), Positives = 91/175 (52%)
  Q:    58 NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCT-ALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           N  GI  + S   + +    IE+    +T   +IL+ D I DP N GAI RT+++    G++  +   + I  +V+K + G + +L   +V NLS  L +LK+  +W   T +   K++    F   +    ++VG+E +G+S L ++  D ++ I +     SLN SV+ AI LY
  S:   116 NHQGIVAQVSPYTYVELGDLIEQAR-ASTPAPVILIADGITDPHNLGAIIRTTEAIGAQGLVIPQRRAVGITSSVMKVAAGALEHLPVARVVNLSRALEELKEAGFWIYGTMSQGSKALHTIDFSGAVG---LVVGSEGEGLSLLTQRCCDALISIPLAGKTPSLNASVAAAIALY 287
>gi|189501044|ref|YP_001960514.1| tRNA/rRNA methyltransferase (SpoU) [Chlorobium phaeobacteroides BS1] >gi|189496485|gb|ACE05033.1| tRNA/rRNA methyltransferase (SpoU) [Chlorobium phaeobacteroides BS1] (267 aa)
Score = 211, Expect = 2.4e-15, Identities = 48/143 (33%), Positives = 80/143 (55%)
  Q:    89 KIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKI---EMDSSVQSLNVSVSTAIIL 231
           +++L LD++QDPGN G I RT+  F V+ ++       + N   I+   G+V  LN   V +L + L K+++  Y  +C++L      L     +  + V+++GNE KGVS  I + +D  + I     D+ V+SLN +VS  I+L
  S:   119 ELVLALDDVQDPGNVGTILRTASWFGVSTVVCGPGTADRYNPKAIRAGAGSVFCLNHYSVGDLEKELEKMRRAGYHIICSSLHGTDFRLQHAVPE--RTVLVIGNEAKGVSMSILRKADLQITIPRGRKDAGVESLNAAVSAGILL 262
>gi|167625583|ref|YP_001675877.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella halifaxensis HAW-EB4] >gi|167355605|gb|ABZ78218.1| RNA methyltransferase, TrmH family, group 3 [Shewanella halifaxensis HAW-EB4] (246 aa)
Score = 211, Expect = 2.5e-15, Identities = 51/177 (28%), Positives = 88/177 (49%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   K + +    +  + +EK     T+   +L+LD + DP N GA  R + +  V G+I  K+N + +   V K + G    +   +V NL+  +  L+++  W +  A  E    L +  +    L + +G E KG+  L ++  D +V I M  SV SLNVSV+T + L+
  S:    69 HQGVVAKVKPAKILSDNELSAMLEK-----TEVPFLLILDGVTDPHNLGACLRNADAAGVHGVIVPKDNSVGLTPVVSKVACGAAEVVPLYQVTNLARTMRSLQEKGIWIIGAA-GEADCELYQ-ASLTGPLAIAMGAEGKGLRRLSRESCDTLVSIPMAGSVSSLNVSVATGVCLF 238
>gi|118497130|ref|YP_898180.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. novicida U112] >gi|194323428|ref|ZP_03057205.1| RNA methyltransferase, TrmH family, group 3 [Francisella tularensis subsp. novicida FTE] >gi|118423036|gb|ABK89426.1| tRNA/rRNA methyltransferase [Francisella tularensis subsp. novicida U112] >gi|194322283|gb|EDX19764.1| RNA methyltransferase, TrmH family, group 3 [Francisella tularensis subsp. novicida FTE] (248 aa)
Score = 211, Expect = 2.5e-15, Identities = 66/222 (29%), Positives = 98/222 (44%)
  Q:    11 IEAFKQNELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNILGIAKESSLTI-HTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           IE       S+   V+Y D  K+   +  K            +  HQNI  +      T    D +  + +  N       IL+LD +QDP NFGA  R++ S  +  II  K+N   +N TV K + G   +   + V NL+  + KLK+   W +  A +      S    D   + ++ G E  G+ +  K   DF+ K+ M   V SLNVSV+T I LY
  S:    35 IEGIISKAESKGLKVTYIDSFKQLPGRVRK------------DANHQNIFAVEINDFKTYSENDIEFLVPQDKN-----AFILILDNVQDPHNFGACIRSAHSAGIDFIIIPKDNSAPVNATVKKVACGAAEHTKIVVVTNLARAIEKLKQLGVWIIGLAGEADDSLYSMNLAD--SVAIVAGAEGSGMRQRTKASCDFLAKLPMLGEVSSLNVSVATGIALY 238
>gi|67924215|ref|ZP_00517655.1| RNA methyltransferase TrmH, group 3 [Crocosphaera watsonii WH 8501] >gi|67853934|gb|EAM49253.1| RNA methyltransferase TrmH, group 3 [Crocosphaera watsonii WH 8501] (292 aa)
Score = 211, Expect = 2.6e-15, Identities = 55/175 (31%), Positives = 87/175 (49%)
  Q:    58 NILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           N  G+A + +   + D D  I +    N+D+ +I++ D I DP N GAI RT+++    G+I  +     +  TV K + G +      +V NLS  L  LK E +W   T + E    L  F      + +++G+E  G+S L ++  D +V I +     SLN SV+ AI LY
  S:   107 NHQGVAAQVAPYNYHDLDGLIAQAK-ANSDEPVIVIADSISDPHNLGAIIRTAEALGCQGMIIPQRRAAGVTSTVSKVAAGALESFPVARVVNLSRALETLKAEGFWIYGT-VSEGGKRLQDFNFR-GAIGLVIGSEGSGLSLLTQRCCDELVSIPLGGKTPSLNASVAAAINLY 278
>gi|177665460|ref|ZP_02941259.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 8801] >gi|196244434|ref|ZP_03143161.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 8802] >gi|172075246|gb|EDT60661.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 8801] >gi|196207882|gb|EDY02674.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC 8802] (292 aa)
Score = 210, Expect = 2.7e-15, Identities = 60/228 (26%), Positives = 117/228 (51%)
  Q:     5 FGKKAVIEAFKQN-ELSEVYYVSYFDELKEFKSKNIKLNKVNKKFFDKYEVVHQNIL-------GIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCT-ALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +G+ +V+ A + + +L+ ++  +       F +  I+  K      D+  +   N L       G+A + +   + + ++ IE+    ++++ +I++ D I DP N GAI RT+++    G++  +     +  TVIK + G +      +V NLS  L  LK+  +W   T A   KS+   + +  I    +++G+E  G+S L ++  D ++ I +     SLN SV+ AI+LY
  S:    48 YGRHSVLAALESDRQLNRIWITNKLHYDARFHTL-IQAAKAKGSVIDEVSIQRLNQLTHGGNHQGVAAQVAPYAYHELETLIEQAK-ASSNEPVIVIADGIADPQNLGAIIRTAEALGTQGLVIPQRRAAGVTSTVIKVAAGALESFPVARVVNLSRALETLKEAGFWIYGTAATGGKSLHNMELRGPIG---LVIGSEESGLSLLTERCCDQLISIPLTGKTPSLNASVAAAIVLY 279
>gi|145589451|ref|YP_001156048.1| RNA methyltransferase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047857|gb|ABP34484.1| RNA methyltransferase, TrmH family, group 3 [Polynucleobacter sp. QLW-P1DMWA-1] (251 aa)
Score = 210, Expect = 2.8e-15, Identities = 54/177 (30%), Positives = 93/177 (52%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++ +A++  +T+       +E   +    K + LVLD + DP NFGA  R +    V  ++  K+    IN TV K S G    +  + V NL   + ++++   W V T  + EKSI    +  D+   + +++G E +G+  L ++  D +V+I M   V+SLNVSV++ + LY
  S:    68 HQGVVALAEK--ITVARTITEVVEDAESAQK-KPLFLVLDGVTDPHNFGACLRVADGAGVDAVVIPKDRSASINATVSKVSSGASEVIPVITVTNLVRSMKEMQEAGVWLVGTDDEAEKSI----YDLDLTGPIAIVMGAEGEGMRRLTRETCDELVRIPMQGVVESLNVSVASGVCLY 239
>gi|110598736|ref|ZP_01386998.1| tRNA/rRNA methyltransferase (SpoU) [Chlorobium ferrooxidans DSM 13031] >gi|110339639|gb|EAT58152.1| tRNA/rRNA methyltransferase (SpoU) [Chlorobium ferrooxidans DSM 13031] (266 aa)
Score = 210, Expect = 2.9e-15, Identities = 50/141 (35%), Positives = 83/141 (58%)
  Q:    91 ILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIE---MDSSVQSLNVSVSTAIIL 231
           I+VLD++QDPGN G I RT+  F   G+I       + N   +++S G++  +    V ++++ LN+LK   Y  +  +L+ K      F+ +  K V+++GNE  GVSE ++  SD +V+I      + V+SLN SVS AI++
  S:   119 IVVLDDVQDPGNVGTILRTAVWFGADGVICSGGTVDRYNAKTVRSSAGSIYAIPHYGVEHVADELNRLKALGYCIISASLEGKDFREFSFRPE--KQVLVIGNEANGVSEQVQTLSDRLVRIPHAGKKARVESLNASVSAAILI 260
>gi|194289992|ref|YP_002005899.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) [Cupriavidus taiwanensis] >gi|193223827|emb|CAQ69834.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) [Cupriavidus taiwanensis] (247 aa)
Score = 210, Expect = 3.0e-15, Identities = 53/177 (29%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++  A++ +L +  + D  ++ I        ++LVLD + DP N GA  R +       +I  K+  + +N TV K + G    + ++ V NL+  L +L++   W + TA   EKS+    FK       +++G E +G+  L ++  D +V I M   V+SLNVSV++ + LY
  S:    69 HQGVVARAEDVALAL--NLDELLDGIEG----TPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDRSVGLNATVAKVASGAAETVPYITVTNLARTLRELQERGIWVIGTADGTEKSLYDIDFK---GPTAIVMGAEGEGMRRLTRETCDELVGIPMAGGVESLNVSVASGVCLY 237
>gi|170698709|ref|ZP_02889775.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria IOP40-10] >gi|171317519|ref|ZP_02906709.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria MEX-5] >gi|170136413|gb|EDT04675.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria IOP40-10] >gi|171097348|gb|EDT42193.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria MEX-5] (247 aa)
Score = 210, Expect = 3.0e-15, Identities = 46/143 (32%), Positives = 79/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD + DP N GA  R + S     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ D+ S  L   K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    97 LLLVLDGVTDPHNLGACLRVADSAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWVIGTS-DDASATLYDTKLD-GPVAIVMGAEGEGMRRLTRDTCDDVMSIPMAGSVESLNVSVASGVCLY 237
>gi|113868323|ref|YP_726812.1| rRNA methylase [Ralstonia eutropha H16] >gi|113527099|emb|CAJ93444.1| rRNA methylase [Ralstonia eutropha H16] (247 aa)
Score = 210, Expect = 3.0e-15, Identities = 53/177 (29%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTAL-DEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++  A++ +L +  + D  ++ I        ++LVLD + DP N GA  R +       +I  K+  + +N TV K + G    + ++ V NL+  L +L++   W + TA   EKS+    FK       +++G E +G+  L ++  D +V I M   V+SLNVSV++ + LY
  S:    69 HQGVVARAEDVALAL--NLDELLDGIEG----TPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDRSVGLNATVAKVASGAAETVPYITVTNLARTLRELQERGIWVIGTADGTEKSLYDIDFK---GPTAIVMGAEGEGMRRLTRETCDELVGIPMAGGVESLNVSVASGVCLY 237
>gi|82703073|ref|YP_412639.1| RNA methyltransferase TrmH, group 3 [Nitrosospira multiformis ATCC 25196] >gi|82411138|gb|ABB75247.1| RNA methyltransferase TrmH, group 3 [Nitrosospira multiformis ATCC 25196] (249 aa)
Score = 210, Expect = 3.0e-15, Identities = 55/177 (31%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +A+  S   + D D  ++ +     +  ++LVLD IQDP N GA  R + +F V  +I  K+  + +   V K + G  + + ++ V NL+  L  LK+     + TA D  +  L   +     +  ++G+E KG+  L +++ D +V I M  SV+SLNVSVS  I L+
  S:    69 HQGV--VARIDSARAYVDIDDVLDTL----AEPALLLVLDGIQDPHNLGACLRVADAFGVHAVIAPKDRAVGLTAAVHKVASGAADNVPYISVTNLARTLRGLKQRGVTVLGTAADADT-QLGVLQL-AGPIAWVLGSEEKGMRRLTRENCDQLVSIPMLGSVESLNVSVSAGICLF 237
>gi|84393177|ref|ZP_00991941.1| RNA methyltransferase, TrmH family [Vibrio splendidus 12B01] >gi|84376229|gb|EAP93113.1| RNA methyltransferase, TrmH family [Vibrio splendidus 12B01] (246 aa)
Score = 210, Expect = 3.0e-15, Identities = 53/177 (29%), Positives = 90/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   K +     T  D  + +      ++ ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L V++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    68 HQGLIAKVKPAKQLNETHLDDILAQ-----HEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDRSSPLTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFVGTA-GEATHDIYQAKL-TGPLAVVMGAEGDGMRRLTRETCDDLIKIPMSGSVSSLNVSVASGICLF 237
>gi|127514216|ref|YP_001095413.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella loihica PV-4] >gi|126639511|gb|ABO25154.1| RNA methyltransferase, TrmH family, group 3 [Shewanella loihica PV-4] (246 aa)
Score = 210, Expect = 3.1e-15, Identities = 47/147 (31%), Positives = 79/147 (53%)
  Q:    86 TDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVI-VGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           T+   +L+LD + DP N GA  R + +  V G+I  ++N + +  TV K + G    +   +V NL+  +  L+++  W V  A + +      +K D+   + I +G E+KG+  L ++  D +  I M  SV SLNVSV+T I L+
  S:    94 TETPFLLILDGVTDPHNLGACLRNADAAGVHGVIVPRDNSVGLTPTVSKVACGAAEVVPLFQVTNLARTMKALQEKGVWIVGAAGEAEH---DLYKADLKGPIAIAMGAEDKGLRRLTRESCDSLASIPMAGSVSSLNVSVATGICLF 238
>gi|71064641|ref|YP_263368.1| RNA methyltransferase [Psychrobacter arcticus 273-4] >gi|71037626|gb|AAZ17934.1| probable RNA methyltransferase, TrmH family, group 3 [Psychrobacter arcticus 273-4] (256 aa)
Score = 210, Expect = 3.1e-15, Identities = 52/143 (36%), Positives = 82/143 (57%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMD----SSVQSLNVSVSTAIILY 232
           ++LVLD+I D  NFGA  RT+ +  V  +I  K++   +  TV K S+G    +  + V NL+  L K+K    +   TAL+  + PL     D+  K+ +I+G+E +G+  L  +  D +V I M      ++QSLNVSV+T + LY
  S:    98 LLLVLDQITDAHNFGACLRTAVAMGVDAVICPKHHAASLTPTVAKVSVGAAEMMPIVSVTNLARTLTKIKNAGVFVFGTALNADAKPLH--TADLTGKIAIIMGSEGEGMRRLTTESCDELVYIPMSGNEHGNLQSLNVSVATGMALY 243
>gi|67458667|ref|YP_246291.1| tRNA/rRNA methyltransferase [Rickettsia felis URRWXCal2] >gi|67004200|gb|AAY61126.1| tRNA/rRNA methyltransferase [Rickettsia felis URRWXCal2] (240 aa)
Score = 210, Expect = 3.2e-15, Identities = 60/190 (31%), Positives = 103/190 (54%)
  Q:    45 NKKFFD--KYEVVHQNILGIAKES------SLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYL 234
           NKK      YE+V+ +IL    E+      +  +   F   +E ++  N   KI  +LD+I D  N GAI R+S +F +  II  ++N    + ++ K + GT+  +  +KV NL   +N LKK  +W +            K  +D  K+ ++ G+E+KG+  L+++  D++ KI +   V+SLNVS + +II + L
  S:    44 NKKLIGTRSYEIVNNDILSKLLENQTHQGIAAKVRPIFSYNLEDVDIKNPKCKIA-ILDQITDTQNIGAIIRSSAAFDIDAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLISD--KMALVFGSEDKGIRRLVEETCDYLAKILISKRVESLNVSNAASIIFHSL 238
>gi|88808428|ref|ZP_01123938.1| hypothetical protein WH7805_02022 [Synechococcus sp. WH 7805] >gi|88787416|gb|EAR18573.1| hypothetical protein WH7805_02022 [Synechococcus sp. WH 7805] (370 aa)
Score = 210, Expect = 3.2e-15, Identities = 56/178 (31%), Positives = 92/178 (51%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ   GIA +++     D    IE    L  +  ++L LD + DP N GAI R++++    G++  +     +  +V K + G + +L   +V NL+  L  LK   Y  V  A +E    L +   D   LVV+ G+E++G+S L ++  D +++I +     SLN SV+TA+ LY
  S:   136 VHQ---GIALQTAAAETLDLSDLIEGCAALQ-EAPLLLALDGLTDPHNLGAIVRSAEALGAHGVVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLETLKDAGYRVVGLA-EEGDQTLEEVDLD-GPLVVVTGSEDQGLSMLTRRHCDHLIRIPLRGITPSLNASVATALCLY 307
>gi|153005091|ref|YP_001379416.1| RNA methyltransferase [Anaeromyxobacter sp. Fw109-5] >gi|152028664|gb|ABS26432.1| RNA methyltransferase, TrmH family, group 3 [Anaeromyxobacter sp. Fw109-5] (245 aa)
Score = 210, Expect = 3.3e-15, Identities = 45/143 (31%), Positives = 77/143 (53%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++VLD ++DP N GAI R++ +    G++  K+  + +   V K S G V      +V N+S+ L  LK+   W+V  A D  + PL         + +++G+E +G+  L++K  D   +I M   + SL+VS S A+ LY
  S:    97 LVVVLDGVEDPHNLGAIIRSAHALGAHGVVIPKDRAVGVTPAVAKASAGAVERCPVARVTNVSKTLEALKEAGIWSVALAADGDA-PLGAVDL-TGPIALVLGSEGEGLRPLVRKTCDHSARIPMSGDLDSLSVSASAAVALY 237
>gi|196179333|gb|EDX74328.1| RNA methyltransferase, TrmH family, group 3 [Microcoleus chthonoplastes PCC 7420] (328 aa)
Score = 210, Expect = 3.3e-15, Identities = 47/143 (32%), Positives = 78/143 (54%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +I+V D I DP N GAI RT+++    G++  +   + +  TV+K + G +  L   +V NLS  L +LK   +W   T  D   +  +    D+N  +V+++G+E  G+S L ++  D +V I +     SLN SV+ A+ LY
  S:   163 VIVVCDGITDPHNLGAIIRTAEALGAQGLVIPQRRAVGVTSTVMKVAAGALETLPIARVVNLSRALEELKTAGFWIYGTCADAGKLLHT---VDLNGSIVLVIGSEGSGLSLLTQRCCDVLVSIPLYGKTPSLNASVAAAMTLY 303
>gi|15805774|ref|NP_294471.1| RNA methyltransferase [Deinococcus radiodurans R1] >gi|6458456|gb|AAF10325.1|AE001930_6 RNA methyltransferase, TrmH family [Deinococcus radiodurans R1] (246 aa)
Score = 210, Expect = 3.4e-15, Identities = 46/146 (31%), Positives = 85/146 (58%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDIN-KLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILYYLT 235
           ++++LD + DP NFGAI R+++     G++ ++     ++  V KT+ G   YL   +  NL  ++++LK +  W V  A  E +  ++  +TD + K  +++G E +G+  L+++  D +V I +   VQSLN SV+  I+LY +T
  S:    93 LMVLLDGVTDPRNFGAIIRSAEVLGAHGVVVEERRSAPLSPVVAKTAAGATAYLPVAQTKNLPRLIDQLKADGVW-VYGAAGEAAQDVT--RTDFSGKAALVIGAEGEGMRRLVREKCDVLVSIPVRGQVQSLNASVAAGILLYEMT 236
>gi|153820492|ref|ZP_01973159.1| RNA methyltransferase, TrmH family [Vibrio cholerae NCTC 8457] >gi|126508965|gb|EAZ71559.1| RNA methyltransferase, TrmH family [Vibrio cholerae NCTC 8457] (229 aa)
Score = 209, Expect = 3.6e-15, Identities = 58/202 (28%), Positives = 100/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E     + + ++++K  D K E   HQ ++   K +      D D  + +      ++ ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA +    I  SK       L +++G E  G+  L ++  D ++KI M  SV SLNVSV+  + L+
  S:    23 LNELMRLGVSIQEMSRKALDDKAEGANHQGLIARVKPARQLNENDLDDILAQ-----HEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAGEATHDIYQSKLT---GSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACGVCLF 219
>gi|15642593|ref|NP_232226.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|153225385|ref|ZP_01954741.1| RNA methyltransferase, TrmH family [Vibrio cholerae MAK 757] >gi|153824008|ref|ZP_01976675.1| RNA methyltransferase, TrmH family [Vibrio cholerae B33] >gi|194533103|ref|YP_002068522.1| RNA methyltransferase, TrmH family [Vibrio cholerae MO10] >gi|52783330|sp|Q9KNY2|RLMB_VIBCH 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251 2'-O-methyltransferase) >gi|9657186|gb|AAF95739.1| RNA methyltransferase, TrmH family [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|124117332|gb|EAY36075.1| RNA methyltransferase, TrmH family [Vibrio cholerae MAK 757] >gi|125619155|gb|EAZ47685.1| RNA methyltransferase, TrmH family [Vibrio cholerae MO10] >gi|126518472|gb|EAZ75695.1| RNA methyltransferase, TrmH family [Vibrio cholerae B33] >gi|150421905|gb|EDN13882.1| RNA methyltransferase, TrmH family [Vibrio cholerae AM-19226] (247 aa)
Score = 209, Expect = 3.6e-15, Identities = 58/202 (28%), Positives = 100/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E     + + ++++K  D K E   HQ ++   K +      D D  + +      ++ ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA +    I  SK       L +++G E  G+  L ++  D ++KI M  SV SLNVSV+  + L+
  S:    41 LNELMRLGVSIQEMSRKALDDKAEGANHQGLIARVKPARQLNENDLDDILAQ-----HEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAGEATHDIYQSKLT---GSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACGVCLF 237
>gi|115351501|ref|YP_773340.1| RNA methyltransferase [Burkholderia ambifaria AMMD] >gi|172060520|ref|YP_001808172.1| RNA methyltransferase [Burkholderia ambifaria MC40-6] >gi|115281489|gb|ABI87006.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria AMMD] >gi|171993037|gb|ACB63956.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria MC40-6] (247 aa)
Score = 209, Expect = 3.6e-15, Identities = 46/143 (32%), Positives = 79/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD + DP N GA  R + S     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ D+ S  L   K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    97 LLLVLDGVTDPHNLGACLRVADSAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTS-DDASATLYDTKLD-GPVAIVMGAEGEGMRRLTRDTCDDVMSIPMAGSVESLNVSVASGVCLY 237
>gi|154508505|ref|ZP_02044147.1| hypothetical protein ACTODO_01006 [Actinomyces odontolyticus ATCC 17982] >gi|153798139|gb|EDN80559.1| hypothetical protein ACTODO_01006 [Actinomyces odontolyticus ATCC 17982] (325 aa)
Score = 209, Expect = 3.6e-15, Identities = 49/143 (34%), Positives = 76/143 (53%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           +++ LD++ DP N GA+ R++ +F   G+I  +     +N T  K S G    +   +V NL   L + K+  Y+ V   LD     PL         LVV+ G E  G+S L+++  D IV I + S+V+SLN +V+T I LY
  S:   175 LLVALDQVTDPHNLGAVLRSAGAFGADGVIIPERRSAGVNTTAWKVSAGAAARVPVARVTNLVRALEEAKQAGYFVV--GLDGGGDAPLRGLSLADGPLVVVTGAEGAGLSRLVRETCDQIVSIPIASTVESLNAAVATGIALY 316
>gi|145640974|ref|ZP_01796556.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus influenzae R3021] >gi|145274488|gb|EDK14352.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus influenzae 22.4-21] (189 aa)
Score = 209, Expect = 3.8e-15, Identities = 54/178 (30%), Positives = 88/178 (49%)
  Q:    55 VHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKK-ENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           VHQ ++   + +      D D  +      N    ++LVLD + DP N GA  RT+ +     +I  K+   Q+     K + G    +  ++V NLS  L  L++  N W V TA +  ++I  SK       L +++G E +G+  L ++  D ++ I M  SV SLNVSV+T + L+
  S:     9 VHQGVIARVQAAKELNENDLDEILA-----NKQNPLLLVLDGVTDPHNLGACLRTADAAGAVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRDLQQNHNIWVVGTAGEATETIYQSKLT---GPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 180
>gi|151570225|gb|EDN35879.1| hypothetical protein FTCG_00059 [Francisella tularensis subsp. novicida GA99-3549] (248 aa)
Score = 209, Expect = 4.0e-15, Identities = 58/177 (32%), Positives = 85/177 (48%)
  Q:    56 HQNILGIAKESSLTI-HTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQNI  +      T    D +  + +  N       IL+LD +QDP NFGA  R++ S  +  II  K+N   +N TV K + G   +   + V NL+  + KLK+   W +  A +      S    D   + ++ G E  G+ +  K   DF+ K+ M   V SLNVSV+T I LY
  S:    68 HQNIFAVEINDFKTYSENDIEFLVPQDKN-----AFILILDNVQDPHNFGACIRSAHSAGIDFIIIPKDNSAPVNATVKKVACGAAEHTKIVVVTNLARAIEKLKQLGVWIIGLAGEADDSLYSMNLAD--SVAIVAGAEGSGMRQRTKASCDFLAKLPMLGEVSSLNVSVATGIALY 238
>gi|151571679|gb|EDN37333.1| hypothetical protein FTDG_00115 [Francisella tularensis subsp. novicida GA99-3548] (248 aa)
Score = 209, Expect = 4.1e-15, Identities = 58/177 (32%), Positives = 85/177 (48%)
  Q:    56 HQNILGIAKESSLTI-HTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQNI  +      T    D +  + +  N       IL+LD +QDP NFGA  R++ S  +  II  K+N   +N TV K + G   +   + V NL+  + KLK+   W +  A +      S    D   + ++ G E  G+ +  K   DF+ K+ M   V SLNVSV+T I LY
  S:    68 HQNIFAVEINDFKTYSENDIEFLVPQDKN-----AFILILDNVQDPHNFGACIRSAHSAGIDFIIIPKDNSAPVNATVKKVACGAAEHTKIVVVTNLARAIEKLKQLGVWIIGLAGEADDSLYSMNLAD--SVAIVAGAEGSGMRQRTKASCDFLAKLPMLGEVSSLNVSVATGIALY 238
>gi|134295618|ref|YP_001119353.1| RNA methyltransferase [Burkholderia vietnamiensis G4] >gi|134138775|gb|ABO54518.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia vietnamiensis G4] (247 aa)
Score = 209, Expect = 4.1e-15, Identities = 47/143 (32%), Positives = 78/143 (54%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD + DP N GA  R + +     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK    W + TA DE S  L   K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    97 LLLVLDGVTDPHNLGACLRVADAAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWIIGTA-DEASGTLYDTKLD-GPVAIVMGAEGEGMRRLTRDTCDDVMSIPMAGSVESLNVSVASGVCLY 237
>gi|160893095|ref|ZP_02073883.1| hypothetical protein CLOL250_00641 [Clostridium sp. L2-50] >gi|156865178|gb|EDO58609.1| hypothetical protein CLOL250_00641 [Clostridium sp. L2-50] (268 aa)
Score = 209, Expect = 4.3e-15, Identities = 63/222 (28%), Positives = 115/222 (51%)
  Q:    11 IEAFKQNELSEVYYVSYFDELKE--FKSKNIKLNKVNKKFFDKYEVVH--QNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++  KQ  +SE  Y  Y  EL E     ++ +L  V+   F         Q +L + +    T+  D  S ++K  N NT     LVL+ IQDPGN G I RT+++  V GII   ++    N  V+++++GT+  + F+ V++ ++ +++LK+         LD   +   K K +      ++GNE  G+++ +   +D +++I M   V+SLN ++S  ++ Y
  S:    44 VDRVKQVFVSETAYQRYGTELPEKGITEQDRRLVVVSDSVFRSMSQTKTPQGLLAVVERYHYTME-DLISVMDKRENGNT----FLVLESIQDPGNLGTIVRTAEAADVTGIIIGGDSCDIYNPKVVRSTMGTIFRVPFVYVDDPAKAVDRLKEHGIVVYGAHLDGCDLYAGKLKRNN---AFLIGNEGNGLTDELSSKADRLLRIPMAGQVESLNAAISATLLAY 261
>gi|121728986|ref|ZP_01681989.1| RNA methyltransferase, TrmH family [Vibrio cholerae V52] >gi|147673348|ref|YP_001218092.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio cholerae O395] >gi|153214903|ref|ZP_01949701.1| RNA methyltransferase, TrmH family [Vibrio cholerae 1587] >gi|153803651|ref|ZP_01958237.1| RNA methyltransferase, TrmH family [Vibrio cholerae MZO-3] >gi|121628709|gb|EAX61177.1| RNA methyltransferase, TrmH family [Vibrio cholerae V52] >gi|124115062|gb|EAY33882.1| RNA methyltransferase, TrmH family [Vibrio cholerae 1587] >gi|124120810|gb|EAY39553.1| RNA methyltransferase, TrmH family [Vibrio cholerae MZO-3] >gi|146315231|gb|ABQ19770.1| RNA methyltransferase, TrmH family [Vibrio cholerae O395] (247 aa)
Score = 208, Expect = 4.5e-15, Identities = 58/202 (28%), Positives = 100/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E     + + ++++K  D K E   HQ ++   K +      D D  + +      ++ ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA +    I  SK       L +++G E  G+  L ++  D ++KI M  SV SLNVSV+  + L+
  S:    41 LNELMRLGVSIQEMSRKALDDKAEGANHQGLIARVKPARQLNENDLDDILAQ-----HEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAGEATHDIYQSKLT---GPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACGVCLF 237
>gi|167589923|ref|ZP_02382311.1| RNA methyltransferase TrmH, group 3 [Burkholderia ubonensis Bu] (247 aa)
Score = 208, Expect = 4.6e-15, Identities = 46/143 (32%), Positives = 79/143 (55%)
  Q:    90 IILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           ++LVLD + DP N GA  R + +     +I  ++  + +N T  K + G  + + ++ V NL+  L +LK+   W + T+ DE S  L   K D   + +++G E +G+  L +   D ++ I M  SV+SLNVSV++ + LY
  S:    97 LLLVLDGVTDPHNLGACLRVADAAGAHAVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTS-DEASATLYDTKLD-GPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237
>gi|86148225|ref|ZP_01066522.1| RNA methyltransferase, TrmH family protein [Vibrio sp. MED222] >gi|85833995|gb|EAQ52156.1| RNA methyltransferase, TrmH family protein [Vibrio sp. MED222] (246 aa)
Score = 208, Expect = 4.7e-15, Identities = 53/177 (29%), Positives = 90/177 (50%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ ++   K +     T  D  + +      ++ ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA  E +  + + K     L V++G E  G+  L ++  D ++KI M  SV SLNVSV++ I L+
  S:    68 HQGLIAKVKPAKQLNETHLDDILAQ-----HEQPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDRSSPLTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFVGTA-GEATHDIYQAKL-TGPLAVVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237
>gi|152981297|ref|YP_001353804.1| RNA methyltransferase [Janthinobacterium sp. Marseille] >gi|151281374|gb|ABR89784.1| RNA methyltransferase, TrmH family [Janthinobacterium sp. Marseille] (247 aa)
Score = 208, Expect = 4.8e-15, Identities = 53/177 (29%), Positives = 92/177 (51%)
  Q:    56 HQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALD-EKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           HQ +  +AK   L++  + D  ++ I        ++LVLD I DP N GA  R +       +I  K+  + +N T  K + G  + + ++ V NL+  L +LK+ +   + T  D EK +  + F        +++G+E +G+  L ++  D +V I M  SV+SLNVSV++ + LY
  S:    68 HQGV--VAKAGELSLARNLDELLDAIEG----PPLLLVLDGITDPHNLGACLRVADGAGAHAVIAPKDRAVGLNATAAKVASGAADTVPYITVTNLARTLRELKERDIMLIGTTDDSEKGLYEADFS---GPAALVMGSEGEGMRRLTRETCDVLVGIPMFGSVESLNVSVASGVCLY 236
>gi|149177691|ref|ZP_01856292.1| YacO [Planctomyces maris DSM 8797] >gi|148843509|gb|EDL57871.1| YacO [Planctomyces maris DSM 8797] (261 aa)
Score = 208, Expect = 5.0e-15, Identities = 51/155 (32%), Positives = 81/155 (52%)
  Q:    78 IEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           IE  N       + L+LD IQDP NFGAI R+++     GI    + Q ++   V +TS G VN++  ++  +L  +    K+     V TA+ + S  L+ +        VIVGNE  G+S  ++ +   +V+I      +SLNV+VS +I+LY
  S:   100 IELFNQQEITSPLFLILDRIQDPFNFGAIIRSAEIMGADGIFSGTHEQCEVTSLVCRTSAGAVNHVPLVQATDLVSLCRDWKQNGINIVGTAM-QASEKLNDYNFQ-QPTAVIVGNEGTGISPELQAECTHLVRIPQQGKTESLNVAVSASILLY 252
>gi|125620326|gb|EAZ48723.1| RNA methyltransferase, TrmH family [Vibrio cholerae V51] (247 aa)
Score = 208, Expect = 5.2e-15, Identities = 59/202 (29%), Positives = 99/202 (49%)
  Q:    31 LKEFKSKNIKLNKVNKKFFD-KYE-VVHQNILGIAKESSLTIHTDFDSFIEKINNLNTDKKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEK-SIPLSKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           L E     + + ++++K  D K E   HQ ++   K +      D D  + +      +  ++LVLD + DP N GA  R + +  VA +I  K+    +  TV K + G    +  ++V NL+  +  L+++  W V TA +    I  SK       L +++G E  G+  L ++  D ++KI M  SV SLNVSV+  I L+
  S:    41 LNELMRLGVSIQEMSRKALDDKAEGANHQGLIARVKPARQLNENDLDDILAQ-----HEHPLLLVLDGVTDPHNLGACLRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFVGTAGEATHDIYQSKLT---GPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACGICLF 237
>gi|154487598|ref|ZP_02029005.1| hypothetical protein BIFADO_01455 [Bifidobacterium adolescentis L2-32] >gi|154083727|gb|EDN82772.1| hypothetical protein BIFADO_01455 [Bifidobacterium adolescentis L2-32] (330 aa)
Score = 208, Expect = 5.5e-15, Identities = 48/145 (33%), Positives = 80/145 (55%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPL---SKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + + LD + DP N GA+ R++ +F   G+I  +     +     K S G   ++   +V NL++ +  LK+  Y++V   LD     L   + F+TD   LVV++G+E  G+S L+++  D I  I M + V+SLN SV+  I LY
  S:   174 RPLFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHMPVARVVNLTKAIESLKERGYYSV--GLDGGGDALVGETGFETD--PLVVVLGSEGNGLSRLVREACDSIAGIPMSNMVESLNASVAAGITLY 317
>gi|119026609|ref|YP_910454.1| tRNA/rRNA methyltransferase protein [Bifidobacterium adolescentis ATCC 15703] >gi|118766193|dbj|BAF40372.1| tRNA/rRNA methyltransferase protein [Bifidobacterium adolescentis ATCC 15703] (329 aa)
Score = 208, Expect = 5.5e-15, Identities = 48/145 (33%), Positives = 80/145 (55%)
  Q:    88 KKIILVLDEIQDPGNFGAICRTSKSFQVAGIIFKKNNQIQINETVIKTSLGTVNYLNFLKVNNLSEVLNKLKKENYWTVCTALDEKSIPL---SKFKTDINKLVVIVGNENKGVSELIKKDSDFIVKIEMDSSVQSLNVSVSTAIILY 232
           + + + LD + DP N GA+ R++ +F   G+I  +     +     K S G   ++   +V NL++ +  LK+  Y++V   LD     L   + F+TD   LVV++G+E  G+S L+++  D I  I M + V+SLN SV+  I LY
  S:   172 RPLFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHMPVARVVNLTKAIESLKERGYYSV--GLDGGGDALVGETGFETD--PLVVVLGSEGNGLSRLVREACDSIAGIPMSNMVESLNASVAAGITLY 315