>gi|26553476|ref|NP_757410.1| hypothetical protein MYPE240 [Mycoplasma penetrans HF-2] >gi|26453482|dbj|BAC43814.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (204 aa)
Score = 889, Expect = 4.0e-94, Identities = 203/204 (99%), Positives = 204/204 (100%)
  Q:     1 LLIMLKKFFYKVNWNECLYLYRTGGSKHIENLLNDLYFTILSKWIWKHLKSKEPLFDDLQLFGYESFKKIINTMDYKNKDFIRWTVSCLIYSYKNELRKQKTKNKAWDDLDFNSLNIISDIFYKSPSEIYENKENDKIKSQWFKKALKEVNSALFEQIVSYKNQGYTHKEISKLLNKSLDQIRGCWNYYKQKIFELSIRDQIFK 204
           +LIMLKKFFYKVNWNECLYLYRTGGSKHIENLLNDLYFTILSKWIWKHLKSKEPLFDDLQLFGYESFKKIINTMDYKNKDFIRWTVSCLIYSYKNELRKQKTKNKAWDDLDFNSLNIISDIFYKSPSEIYENKENDKIKSQWFKKALKEVNSALFEQIVSYKNQGYTHKEISKLLNKSLDQIRGCWNYYKQKIFELSIRDQIFK
  S:     1 MLIMLKKFFYKVNWNECLYLYRTGGSKHIENLLNDLYFTILSKWIWKHLKSKEPLFDDLQLFGYESFKKIINTMDYKNKDFIRWTVSCLIYSYKNELRKQKTKNKAWDDLDFNSLNIISDIFYKSPSEIYENKENDKIKSQWFKKALKEVNSALFEQIVSYKNQGYTHKEISKLLNKSLDQIRGCWNYYKQKIFELSIRDQIFK 204
>gi|118727204|ref|ZP_01575812.1| RNA polymerase, sigma-24 subunit, ECF subfamily [Clostridium cellulolyticum H10] >gi|118663421|gb|EAV70074.1| RNA polymerase, sigma-24 subunit, ECF subfamily [Clostridium cellulolyticum H10] (184 aa)
Score = 86, Expect = 4.8e-01, Identities = 37/139 (26%), Positives = 68/139 (48%)
  Q:    45 IWKHLKSKEPLFDDLQLFGYESFKKIINTMDYKNKDF--IRWTVSCLIYSYKNELRKQKTKNKAWDDLDFNSLNIISDIFYKSPSEIYENKENDKIKSQWFKKALKEVNSALFEQIVSYKNQGYTHKEISKLLNKSLDQIR 183
           ++K +  KE + D  Q    E F ++  ++D  N +F    W V        + LRK+K      DD    ++ + S+I   +P E     +    +SQ  KKA+ E+       IV + N+G +++E++K+LN+ +  I+
  S:    35 VYKMISDKEEVHDVCQ----EVFIRLYRSLDKYNPEFKMSTWIVKITSNLCLDTLRKKKQDTVTLDD----AIGVSSEI--DTPEEALIKHQ----RSQLIKKAVDELPDKYKVLIVLFHNRGMSYEEMTKILNEPMSIIK 161