>gi|26553692|ref|NP_757626.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453698|dbj|BAC44030.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (153 aa)
Score = 648, Expect = 1.8e-66, Identities = 153/153 (100%), Positives = 153/153 (100%)
  Q:     1 MAHTWWTTIITNQEEYYNIFWKIKKTAKSILWLYLVFFIAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAIFVLEIMLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCVVIDCFILNSKCNRVLENSTYLA 153
           MAHTWWTTIITNQEEYYNIFWKIKKTAKSILWLYLVFFIAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAIFVLEIMLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCVVIDCFILNSKCNRVLENSTYLA
  S:     1 MAHTWWTTIITNQEEYYNIFWKIKKTAKSILWLYLVFFIAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAIFVLEIMLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCVVIDCFILNSKCNRVLENSTYLA 153
>gi|26553687|ref|NP_757621.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453693|dbj|BAC44025.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (178 aa)
Score = 182, Expect = 2.0e-12, Identities = 50/111 (45%), Positives = 71/111 (63%)
  Q:    39 IAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAIFVLEIMLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCVVIDCFILNSKCNRVLENS 149
           ++F I++L  V ++  I+     A L     +GI LI    + L+G+ IA  VLEIMLT++VS A+GKHPEF++ + H VL+I+GI+L      IDCFILNSK   VL N+
  S:    75 LSFIIIILMLVDVLAIILV----AVLAFVPFLGIFLI----IALVGVAIATLVLEIMLTIKVSEAKGKHPEFQDVTVHLVLMILGIVLLPLLSFIDCFILNSKAKTVLANA 177
>gi|26553688|ref|NP_757622.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453694|dbj|BAC44026.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (202 aa)
Score = 180, Expect = 3.2e-12, Identities = 54/135 (40%), Positives = 84/135 (62%)
  Q:    12 NQEEYYNIFWKIKKTAKSILWLYLVFFIAFFIMLLSYVFIMVPI------ISNPEEASLK--SSVLIGIALIAISSLLLMGI-GIAIFVLEIMLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCVVIDCFILNSKCNRVL 146
           N +E  N+F KIKK +K++L  Y   F A  + ++  + I V        +SN         SS + G  ++ +  ++L GI  +  FV+ I+L ++V+ A+GKHPEF++ + HTVLLIIGI++   C +IDCFIL SK  + L
  S:    56 NPQENVNLFTKIKKHSKNMLIFY---FTAIVLAIIGAILISVGAAKIALSLSNNYSGEYYDLSSFINGEWIVGVLFIVLTGIFYLVCFVIGIILVIKVNDAQGKHPEFQDITMHTVLLIIGIVILPICAIIDCFILYSKSKKAL 196
>gi|26553693|ref|NP_757627.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453699|dbj|BAC44031.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (178 aa)
Score = 131, Expect = 1.6e-06, Identities = 44/126 (34%), Positives = 76/126 (60%)
  Q:    23 IKKTAKSILWLYLVFFIAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAI-FVLEIMLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCVVIDCFILNSKCNRVLEN 148
           +K+ + ++L LYL+F +     L+ Y+  M+ +      +   S  +I + ++ I  L +  I   I F+LEI+LTV+VS  + K P+F +   H +LLI+GII+   C ++DCFIL SKC++ L++
  S:    50 VKRISITVLVLYLLFAMTLTASLIIYIPAMLALTLASSLSEEASPQVITLWVVGIILLTVAVISWFIKFILEIVLTVKVSKLKNKQPQFEDIQVHIILLILGIIICPICSIVDCFILVSKCSKALKD 176
>gi|26553690|ref|NP_757624.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453696|dbj|BAC44028.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (202 aa)
Score = 99, Expect = 8.8e-03, Identities = 35/128 (27%), Positives = 73/128 (57%)
  Q:    23 IKKTAKSILWLYLVFFIAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAIFVLEI-------------MLTVRVSGAEGKHPEFRNTSTHTVLLIIGIILFWPCV-VIDCFILNSKCNRVLENST 150
           I+KT+  I++ Y++      + L++Y+ +              +S       I  + +  +G+GI IF++ +             +L ++++   GKH EF++   + +LLIIG+++  P   +IDCF+++SKC ++L  S+
  S:    70 IRKTSAKIVFFYIITVALLIVGLVTYLSMSA------------TSKNFDNDFIDFNPISNIGLGIGIFLIGLSCVFYITIFILEILLILKLNNINGKHNEFKDVKLYKILLIIGLVI--PVFSIIDCFLISSKCAKILGYSS 197
>gi|90961402|ref|YP_535318.1| ComG operon protein 2 [Lactobacillus salivarius UCC118] >gi|90820596|gb|ABD99235.1| ComG operon protein 2 [Lactobacillus salivarius UCC118] (357 aa)
Score = 84, Expect = 4.8e-01, Identities = 21/68 (30%), Positives = 40/68 (58%)
  Q:    28 KSILWLYLVFFIAFFIMLLSYVFIMVPIISNPEEASLKSSVLIGIALIAISSLLLMGIGIAIFVLEIM 95
           KS++   ++ F    I++L   F + P I+N  E S+K+S +I    +   SL+L+ + I ++VL+I+
  S:   126 KSLMVYPMILFFMLIIIMLGIKFWLKPTINNFGEDSVKTSSIINWTAVGKYSLILVALIIVLYVLKIL 193