>gi|26553477|ref|NP_757411.1| 50S ribosomal protein L11 [Mycoplasma penetrans HF-2] >gi|54039100|sp|Q8EX25|RL11_MYCPE 50S ribosomal protein L11 >gi|26453483|dbj|BAC43815.1| ribosomal protein L11 [Mycoplasma penetrans HF-2] (155 aa)
Score = 663, Expect = 3.4e-68, Identities = 154/155 (99%), Positives = 155/155 (100%)
  Q:     1 VLLVAFKDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKKK 155
           +LLVAFKDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKKK
  S:     1 MLLVAFKDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKKK 155
>gi|31544868|ref|NP_853446.1| 50S ribosomal protein L11 [Mycoplasma gallisepticum R] >gi|54039101|sp|Q8RLD9|RL11_MYCGA 50S ribosomal protein L11 >gi|19699028|gb|AAL91132.1| 50S ribosomal protein L11 [Mycoplasma gallisepticum] >gi|31541714|gb|AAP57014.1| RplK [Mycoplasma gallisepticum R] (152 aa)
Score = 444, Expect = 8.1e-43, Identities = 104/147 (70%), Positives = 125/147 (85%)
  Q:     1 VLLVAFKDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           +LLVA K+  ITRIAK+ LIGGQAKPGP LAS+GINMGEFTKQFN++TKD+ G+V+P IITAF DKSF FE+KTTPVT+LLKKAA I+ GAKN KTE V  IS+ +AL+IA+ K+ D NA D EA LRM+AG+AKQMG++IEGVDPV
  S:     1 MLLVAKKE--ITRIAKLELIGGQAKPGPALASVGINMGEFTKQFNEKTKDRMGDVVPVIITAFNDKSFLFELKTTPVTVLLKKAAKIESGAKNPKTEKVGKISKAEALKIAEYKMADLNAYDTEAALRMIAGTAKQMGLEIEGVDPV 145
>gi|13358105|ref|NP_078379.1| 50S ribosomal protein L11 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761940|ref|YP_001752626.1| ribosomal protein L11 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189040988|sp|B1AJI2|RL11_UREP2 50S ribosomal protein L11 >gi|54039106|sp|Q9PPU9|RL11_UREPA 50S ribosomal protein L11 >gi|11276741|pir||H82876 ribosomal protein L11 UU541 [imported] - Ureaplasma urealyticum >gi|6899546|gb|AAF30954.1|AE002153_2 ribosomal protein L11 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827517|gb|ACA32779.1| ribosomal protein L11 [Ureaplasma parvum serovar 3 str. ATCC 27815] (150 aa)
Score = 443, Expect = 9.9e-43, Identities = 104/149 (69%), Positives = 120/149 (80%)
  Q:     4 VAFKDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDG 152
           +A K   +TRIAK+NLIGGQAKPGP LAS+GINM EFTK FND+TKD+NG+VIP IITA+KDKSF + IKTTPVT LLK  A IK GAK+ K +TVATIS+E+ALEIA+ KL+D  A DEEA LRM+AGSAKQMGI IEGV     K G
  S:     1 MAPKKKEVTRIAKLNLIGGQAKPGPALASVGINMAEFTKSFNDKTKDQNGKVIPVIITAYKDKSFDYVIKTTPVTFLLKDIAKIKSGAKDPKKQTVATISKEQALEIARYKLIDMTAYDEEAALRMIAGSAKQMGIVIEGVSAYKEKKG 149
>gi|12044933|ref|NP_072743.1| 50S ribosomal protein L11 [Mycoplasma genitalium G37] >gi|66880308|ref|ZP_00405290.1| COG0080: Ribosomal protein L11 [Mycoplasma genitalium G-37] >gi|1350660|sp|P47327|RL11_MYCGE 50S ribosomal protein L11 >gi|3844668|gb|AAC71299.1| ribosomal protein L11 [Mycoplasma genitalium G37] >gi|166078731|gb|ABY79349.1| ribosomal protein L11 [synthetic Mycoplasma genitalium JCVI-1.0] (137 aa)
Score = 393, Expect = 6.0e-37, Identities = 91/131 (69%), Positives = 111/131 (84%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +TRIAK+NLIGGQAKPGP LAS+GINMGEFTKQFN++TKD+ GE IPCIITAF DKSFTF +KTTPV+ L+K+AA ++ GAKN+KT  V  IS ++A EIA+ KLVD NAN  EA L+MV G+AKQMGI++
  S:     6 VTRIAKINLIGGQAKPGPALASVGINMGEFTKQFNEKTKDRQGETIPCIITAFNDKSFTFVLKTTPVSNLIKQAAKLEKGAKNAKT-IVGKISLQQAKEIAQYKLVDLNANTVEAALKMVLGTAKQMGIEV 135
>gi|13507958|ref|NP_109907.1| 50S ribosomal protein L11 [Mycoplasma pneumoniae M129] >gi|2500250|sp|P75550|RL11_MYCPN 50S ribosomal protein L11 >gi|1674314|gb|AAB96260.1| ribosomal protein L11 [Mycoplasma pneumoniae M129] (137 aa)
Score = 389, Expect = 1.8e-36, Identities = 90/131 (68%), Positives = 111/131 (84%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ITRIAK+NL+GGQAKPGP LAS+GINMGEFTKQFN++TKDK GE+IPC+ITA+ DKSF F +KTTPV++LLK+AA ++ GAKN+KT  V  I+  KA EIA+ KLVD NAN  EA L+MV G+AKQMGI++
  S:     6 ITRIAKINLLGGQAKPGPALASVGINMGEFTKQFNEKTKDKQGEMIPCVITAYNDKSFDFILKTTPVSILLKQAAKLEKGAKNAKT-IVGKITMAKAKEIAQYKLVDLNANTVEAALKMVLGTAKQMGIEV 135
>gi|50365425|ref|YP_053850.1| 50S ribosomal protein L11 [Mesoplasma florum L1] >gi|56404775|sp|Q6F0K7|RL11_MESFL 50S ribosomal protein L11 >gi|50363981|gb|AAT75966.1| 50S ribosomal protein L11 [Mesoplasma florum L1] (142 aa)
Score = 386, Expect = 4.4e-36, Identities = 87/136 (63%), Positives = 110/136 (80%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           RITRIAK+  +  QAKPG +LAS+GINM EFTKQFND TKD+ G+V+P +ITA+ DKSF F +KTTP  +LLKKAA I+ GA N+KT+TVATIS +K  EIA+ KLVD NAND EA ++++AG+AK MGIKI G++
  S:     4 RITRIAKLEFMAMQAKPGAELASLGINMPEFTKQFNDATKDRAGDVVPVVITAYDDKSFDFILKTTPAAILLKKAAGIEKGASNAKTQTVATISADKVREIAEYKLVDLNANDVEAAMKIIAGTAKNMGIKITGME 139
>gi|83319927|ref|YP_424060.1| 50S ribosomal protein L11 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|118597261|sp|Q2ST53|RL11_MYCCT 50S ribosomal protein L11 >gi|83283813|gb|ABC01745.1| 50S ribosomal protein L11 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (142 aa)
Score = 336, Expect = 2.5e-30, Identities = 73/136 (53%), Positives = 101/136 (74%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           +ITRIAK+  +  QAKPG +LAS+GINM  FT++FND TKD+ G+V+P +ITA+ DKSF F +KTTP   +LKK A I+ GA NSKT+TVAT++ +    IA+ K+ D NAN  EA ++ + G+AK MGIK+ G++
  S:     4 KITRIAKLEFMAMQAKPGAELASLGINMPAFTREFNDATKDRAGDVVPVVITAYDDKSFDFVLKTTPAAYMLKKVAKIEKGASNSKTQTVATVTLDDIRSIAEYKMPDLNANTIEAAMKQIIGTAKNMGIKVTGME 139
>gi|42561510|ref|NP_975961.1| 50S ribosomal protein L11 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|167924964|ref|ZP_02512055.1| 50S ribosomal protein L11 [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|54039073|sp|P62437|RL11_MYCMS 50S ribosomal protein L11 >gi|42493009|emb|CAE77603.1| 50S Ribosomal protein L11 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (142 aa)
Score = 335, Expect = 3.5e-30, Identities = 72/136 (52%), Positives = 101/136 (74%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           +ITR+AK+  +  QAKPG +LAS+GINM  FT++FND TKD+ G+V+P +ITA+ DKSF F +KTTP   +LKK A I+ GA NS+T+TVAT++ +    IA+ K+ D NAN  EA ++ V G+AK MGIK+ G++
  S:     4 KITRVAKLEFMAMQAKPGAELASLGINMPAFTREFNDATKDRAGDVVPVVITAYDDKSFDFVLKTTPTAYMLKKVAKIEKGASNSRTQTVATVTLDDIRSIAEYKMPDLNANTIEAAMKQVIGTAKNMGIKVTGME 139
>gi|47458303|gb|AAT27626.1| 50S ribosomal protein l11 [Mycoplasma mobile 163K] (199 aa)
Score = 321, Expect = 1.6e-28, Identities = 70/142 (49%), Positives = 97/142 (68%)
  Q:     7 KDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVV 148
           K   + R+AK+    GQAKPGP+LA +GI M EFTKQFND T++++GE +P  I  +KDKSF F++ T P + +LKKAA IK G+ NSKT  VATI + +  +IAK K+ D N  + E  +  +AG+A+ MGI +EG D +V
  S:     5 KKKEVVRVAKLQFNAGQAKPGPELAGLGIVMPEFTKQFNDATRERSGEPVPVQIIVYKDKSFDFKLFTAPTSFMLKKAAGIKSGSANSKTTIVATIKKSQLEDIAKYKMPDLNTKNLEEAMHTIAGTARNMGILVEGYDDIV 146
>gi|14089422|emb|CAC13182.1| 50S RIBOSOMAL PROTEIN L11 [Mycoplasma pulmonis] (217 aa)
Score = 320, Expect = 1.8e-28, Identities = 70/147 (47%), Positives = 99/147 (67%)
  Q:     1 VLLVAFKDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           VL++A K+  + +IAK+  I GQAKPGP LA +GINM EFT+QFN+QT+D+  E +P  ITA+KDKSF F + T P +  + +A   K G+ NSKT  + T++  +  EIAK KL D N +D +  +  +AG+AK MG+ +EG D V
  S:    18 VLIMAKKE--VVKIAKLQFIAGQAKPGPSLAGVGINMPEFTRQFNEQTRDRGNEPVPVEITAYKDKSFDFRLFTAPASFKILQAIKAKSGSANSKTNIIGTLTLAQLEEIAKYKLPDLNTDDYKVAMHTIAGTAKNMGVLVEGWDDV 162
>gi|161723295|ref|NP_325840.2| 50S ribosomal protein L11 [Mycoplasma pulmonis UAB CTIP] >gi|54039105|sp|Q98RJ9|RL11_MYCPU 50S ribosomal protein L11 (197 aa)
Score = 310, Expect = 2.9e-27, Identities = 66/137 (48%), Positives = 92/137 (67%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           + +IAK+  I GQAKPGP LA +GINM EFT+QFN+QT+D+  E +P  ITA+KDKSF F + T P +  + +A   K G+ NSKT  + T++  +  EIAK KL D N +D +  +  +AG+AK MG+ +EG D V
  S:     6 VVKIAKLQFIAGQAKPGPSLAGVGINMPEFTRQFNEQTRDRGNEPVPVEITAYKDKSFDFRLFTAPASFKILQAIKAKSGSANSKTNIIGTLTLAQLEEIAKYKLPDLNTDDYKVAMHTIAGTAKNMGVLVEGWDDV 142
>gi|54020521|ref|YP_115969.1| 50S ribosomal protein L11 [Mycoplasma hyopneumoniae 232] >gi|71893808|ref|YP_279254.1| 50S ribosomal protein L11 [Mycoplasma hyopneumoniae J] >gi|72080792|ref|YP_287850.1| 50S ribosomal protein L11 [Mycoplasma hyopneumoniae 7448] >gi|53987694|gb|AAV27895.1| 50s ribosomal protein L11 [Mycoplasma hyopneumoniae 232] >gi|71851935|gb|AAZ44543.1| 50S ribosomal protein L11 [Mycoplasma hyopneumoniae J] >gi|71913916|gb|AAZ53827.1| 50S ribosomal protein L11 [Mycoplasma hyopneumoniae 7448] (149 aa)
Score = 304, Expect = 1.2e-26, Identities = 66/144 (45%), Positives = 98/144 (68%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKK 154
           + R+AK+    GQAKPGP LA +GI M EFT++FND+TK++  E +P  IT FKDKSF F++ T+P +  +K+AA I+ G+K SKTE V  I+ ++  EIA+ KL D N  + +  +  V G+A QMG+++EG++  + K G K
  S:     6 VVRVAKLQFNAGQAKPGPALAGLGIVMPEFTRKFNDETKNRGDEPVPVKITVFKDKSFEFQLFTSPTSYKIKQAAKIESGSKKSKTEKVGKITFDQLREIAEYKLPDLNTENLDKAILTVYGTAMQMGVEVEGIEEFIQKQGGK 149
>gi|71894634|ref|YP_278742.1| 50S ribosomal protein L11 [Mycoplasma synoviae 53] >gi|118597263|sp|Q4A5E0|RL11_MYCS5 50S ribosomal protein L11 >gi|71851422|gb|AAZ44031.1| 50S ribosomal protein L11 [Mycoplasma synoviae 53] (193 aa)
Score = 301, Expect = 2.9e-26, Identities = 67/137 (48%), Positives = 96/137 (70%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           + ++AK+  + G+AKPGP LA +G+NM EFTK FND T+D+  E +P  IT FKDK+F F++ T P +  +K+AA I+ G+KN+KT    TI+ E+  EIA+ KL D N +D  A + +VAG+AKQMG+ +EG D V
  S:     5 VQKVAKLQFLAGKAKPGPSLAGVGVNMPEFTKAFNDATRDRGDEPVPVQITVFKDKTFEFKLFTAPASYKIKQAAKIQSGSKNAKTTIAGTITLEQLKEIAEYKLPDLNTDDVNAAMAIVAGTAKQMGVLVEGYDDV 141
>gi|88812768|ref|ZP_01128014.1| ribosomal protein L11 [Nitrococcus mobilis Nb-231] >gi|88790006|gb|EAR21127.1| ribosomal protein L11 [Nitrococcus mobilis Nb-231] (146 aa)
Score = 295, Expect = 1.7e-25, Identities = 69/128 (53%), Positives = 87/128 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   G+N+ EF KQFN QT+D + G  IP +IT + D+SFTF  KT P ++LLKKAA IK G+    T  V T+SRE+  EIAKTK  D  A+D EA LR +AGSA+ MGI +EG
  S:    10 KLQVAAGQANPSPPVGPALGQRGVNIMEFCKQFNAQTQDMEPGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIKSGSGAPNTNKVGTVSREQVAEIAKTKWPDLTASDMEAALRCIAGSARSMGITVEG 142
>gi|108804985|ref|YP_644922.1| 50S ribosomal protein L11P [Rubrobacter xylanophilus DSM 9941] >gi|118597290|sp|Q1AU18|RL11_RUBXD 50S ribosomal protein L11 >gi|108766228|gb|ABG05110.1| ribosomal protein L11 [Rubrobacter xylanophilus DSM 9941] (145 aa)
Score = 286, Expect = 1.7e-24, Identities = 60/133 (45%), Positives = 88/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           R+ R  K+ + GGQA P    GP L    +N+GEF +QFND T+D+ G++IP  IT ++D+SFTF  KT P   LLK+AA ++ G+          +SR +  EIA+TK+ D NA D EA ++++ G+A+ MGIK+E
  S:     8 RVVRKLKLQIPGGQANPAPPVGPALGQAQVNIGEFVRQFNDATRDRMGQLIPVEITVYEDRSFTFVTKTPPAAFLLKQAAGVEKGSGEPNRSAAGRVSRAQVEEIARTKMPDLNAADVEAAVKIIEGTARSMGIKVE 144
>gi|32307496|gb|AAP79153.1| ribosomal protein rpL11 [Bigelowiella natans] (235 aa)
Score = 284, Expect = 2.8e-24, Identities = 61/134 (45%), Positives = 90/134 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T+I K+ L  G+A P    GP L + G+N+ +F K++N  T  K G+VIP  IT F D+SFTF +KT P + LL KAA ++ G+     ET+ATI+R++  EIA+ K+ D NA D E  +R++ G+AK MGI +E 
  S:    95 KVTQIIKLALDAGKANPAPPVGPALGAAGVNIMQFCKEYNAATSTKAGQVIPVEITVFADRSFTFILKTPPASKLLLKAAGLEKGSGTPDKETLATITRDQVKEIAEIKMPDLNAKDIEGAMRIIEGTAKNMGIAVEA 232
>gi|110634173|ref|YP_674381.1| 50S ribosomal protein L11 [Mesorhizobium sp. BNC1] >gi|118597254|sp|Q11HA9|RL11_MESSB 50S ribosomal protein L11 >gi|110285157|gb|ABG63216.1| LSU ribosomal protein L11P [Mesorhizobium sp. BNC1] (142 aa)
Score = 283, Expect = 3.5e-24, Identities = 66/128 (51%), Positives = 88/128 (68%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN Q++D + G  IP +IT ++DKSFTF +KT PV+  LKKAAN+K G+K    ++   ISR K  EIA+TK+ D NAND EA +RMV GSA+ MG+++ G
  S:    10 KLQVPAGSATPSPPIGPALGQRGINIMEFCKAFNAQSQDLEKGSPIPVVITYYQDKSFTFTMKTPPVSYFLKKAANLKSGSKEPGKQSAGQISRAKVREIAETKMKDLNANDVEAAMRMVEGSARSMGLEVVG 142
>gi|34762879|ref|ZP_00143862.1| LSU ribosomal protein L11P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887443|gb|EAA24530.1| LSU ribosomal protein L11P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (141 aa)
Score = 274, Expect = 3.8e-23, Identities = 66/132 (50%), Positives = 89/132 (67%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           + +I K+ L  G+A P    GP L   G+N+ EF K FN +T+DK G +IP  I+ F D+SFTF +KT P + LLKKAA I  GAKNSK E    I+  K  E+A+TK+ D NA+  E  ++++AGSA+ MGIKIE
  S:     5 VIQIIKLQLPAGKANPAPPVGPALGQHGVNIMEFCKAFNAKTQDKAGWIIPVEISVFSDRSFTFILKTPPASDLLKKAAGITSGAKNSKKEVAGKITTAKLKELAETKMPDLNASSIETAMKIIAGSARSMGIKIE 140
>gi|19705331|ref|NP_602826.1| 50S ribosomal protein L11P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|38605372|sp|Q8RHI2|RL11_FUSNN 50S ribosomal protein L11 >gi|19713308|gb|AAL94125.1| LSU ribosomal protein L11P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|148322487|gb|EDK87737.1| ribosomal protein L11 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (141 aa)
Score = 273, Expect = 6.1e-23, Identities = 65/132 (49%), Positives = 89/132 (67%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           + +I K+ L  G+A P    GP L   G+N+ EF K FN +T+DK G +IP  I+ + D+SFTF +KT P + LLKKAA I  GAKNSK E    I+  K  E+A+TK+ D NA+  E  ++++AGSA+ MGIKIE
  S:     5 VIQIIKLQLPAGKANPAPPVGPALGQHGVNIMEFCKAFNAKTQDKAGWIIPVEISVYSDRSFTFILKTPPASDLLKKAAGITSGAKNSKKEVAGKITTAKLKELAETKMPDLNASSVETAMKIIAGSARSMGIKIE 140
>gi|53715481|ref|YP_101473.1| 50S ribosomal protein L11 [Bacteroides fragilis YCH46] >gi|60683454|ref|YP_213598.1| 50S ribosomal protein L11 [Bacteroides fragilis NCTC 9343] >gi|56404757|sp|Q64NJ3|RL11_BACFR 50S ribosomal protein L11 >gi|81313498|sp|Q5L893|RL11_BACFN 50S ribosomal protein L11 >gi|52218346|dbj|BAD50939.1| 50S ribosomal protein L11 [Bacteroides fragilis YCH46] >gi|60494888|emb|CAH09695.1| putative 50S ribosomal protein L11 [Bacteroides fragilis NCTC 9343] (147 aa)
Score = 271, Expect = 9.4e-23, Identities = 64/137 (46%), Positives = 89/137 (64%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           +  + K+ + GG A P    GP L S GIN+ EF KQFN +T+DK G+++P IIT + DKSF F IKT PV + L + A +K G+     + VA I+ E+   IA+ K+VD N    EA +RMVAG+A+ MGI ++G  PV
  S:     5 VAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITYYADKSFDFVIKTPPVAIQLLEVAKVKSGSAEPNRKKVAEITWEQVRTIAQDKMVDLNCFTVEAAMRMVAGTARSMGIAVKGEFPV 145
>gi|15612682|ref|NP_240985.1| 50S ribosomal protein L11 [Bacillus halodurans C-125] >gi|38605490|sp|Q9KGE6|RL11A_BACHD 50S ribosomal protein L11-1 >gi|10172731|dbj|BAB03838.1| 50S ribosomal protein L11 [Bacillus halodurans C-125] (141 aa)
Score = 271, Expect = 9.8e-23, Identities = 63/133 (47%), Positives = 88/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKKAA I+ G+       VAT+ R+K  EIA+TK+ D NA D EA +RMV G+A+ MGI IE
  S:     4 KVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTSDQAGLIIPVEITVFEDRSFTFVTKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIE 140
>gi|13470538|ref|NP_102106.1| 50S ribosomal protein L11 [Mesorhizobium loti MAFF303099] >gi|38605438|sp|Q98N70|RL11_RHILO 50S ribosomal protein L11 >gi|14021279|dbj|BAB47892.1| 50S ribosomal protein L11 [Mesorhizobium loti MAFF303099] (142 aa)
Score = 270, Expect = 1.1e-22, Identities = 64/128 (50%), Positives = 86/128 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN QT++ + G  +P +IT ++DKSFTF +KT PV+  LKKAAN+K G+K        T+SR+K  EIA  K+ D NAND EA +RMV GSA+ MG+++ G
  S:    10 KLQVSAGSATPSPPIGPALGQRGINIMEFCKAFNAQTQEMEKGSPVPVVITYYQDKSFTFVMKTPPVSYFLKKAANLKSGSKEPGKVKAGTVSRDKVREIATAKMKDLNANDVEAAMRMVEGSARSMGLEVVG 142
>gi|7767188|pdb|487D|L Chain L, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution >gi|34811524|pdb|1PN7|L Chain L, Coordinates Of S12, L11 Proteins And P-Trna, From The 70s X- Ray Structure Aligned To The 70s Cryo-Em Map Of E.Coli Ribosome >gi|34811527|pdb|1PN8|L Chain L, Coordinates Of S12, L11 Proteins And E-Site Trna From 70s Crystal Structure Separately Fitted Into The Cryo-Em Map Of E.Coli 70s.Ef-G.Gdpnp Complex. The Atomic Coordinates Originally From The E-Site Trna Were Fitted In The Position Of The Hybrid PE-Site Trna. (133 aa)
Score = 267, Expect = 2.5e-22, Identities = 61/126 (48%), Positives = 88/126 (69%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT P + LLKKAA I+ G+   K + V  ++R++  EIAKTK+ D NAN  EA ++++ G+AK MGI++
  S:     3 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV 132
>gi|49475394|ref|YP_033435.1| 50S ribosomal protein L11 [Bartonella henselae str. Houston-1] >gi|56404780|sp|Q6G3X9|RL11_BARHE 50S ribosomal protein L11 >gi|49238200|emb|CAF27410.1| 50S ribosomal protein l11 [Bartonella henselae str. Houston-1] (142 aa)
Score = 267, Expect = 2.5e-22, Identities = 64/128 (50%), Positives = 86/128 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  T++ + G  IP IIT ++DKSFTF +KT PV+  LKK AN+K G+K     +V +ISR+K   IA+ K+ D NAND EA +RMV GSA+ MG+++ G
  S:    10 KLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGAPIPVIITYYQDKSFTFSLKTPPVSFFLKKEANLKSGSKEPGKVSVGSISRDKIRSIAQAKMKDLNANDIEAAMRMVEGSARSMGLEVVG 142
>gi|90417774|ref|ZP_01225686.1| ribosomal protein L11 [Aurantimonas sp. SI85-9A1] >gi|90337446|gb|EAS51097.1| ribosomal protein L11 [Aurantimonas sp. SI85-9A1] (142 aa)
Score = 266, Expect = 3.1e-22, Identities = 61/128 (47%), Positives = 86/128 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDK-NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN QT+++  G+ IP +IT ++DKSFTF +KT PV+  LKKAAN+K G+K        +++RE+  EIA+ K  D NAND +A + MV GSA+ MG+++ G
  S:    10 KLQVPAGSATPSPPIGPALGQRGINIMEFCKSFNAQTQEQEKGQPIPVVITYYQDKSFTFAMKTPPVSYFLKKAANLKSGSKEPGRSVAGSVTREQVREIAEKKFKDLNANDIDAAVLMVEGSARSMGLEVAG 142
>gi|116495732|ref|YP_807466.1| 50S ribosomal protein L11 [Lactobacillus casei ATCC 334] >gi|191639220|ref|YP_001988386.1| 50S ribosomal protein L11 [Lactobacillus casei] >gi|122262866|sp|Q035U8|RL11_LACC3 50S ribosomal protein L11 >gi|116105882|gb|ABJ71024.1| LSU ribosomal protein L11P [Lactobacillus casei ATCC 334] >gi|190713522|emb|CAQ67528.1| 50S ribosomal protein L11 [Lactobacillus casei BL23] (141 aa)
Score = 266, Expect = 3.4e-22, Identities = 60/134 (44%), Positives = 90/134 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  I K+ +  G+A P    GP L   GIN+  FTK FN +T D+ G +IP +IT ++D+SF F  KT P  +LLKKAA ++ G+    T+ VA +++++  EIA+TK+ D NA D EA +RMV G+A+ MG ++EG
  S:     4 KVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITVYEDRSFDFVTKTPPAAVLLKKAAGVEHGSGEPNTKKVAKVTKDQVKEIAETKMQDLNAADVEAAMRMVEGTARSMGFEVEG 141
>gi|81429284|ref|YP_396285.1| 50S ribosomal protein L11 [Lactobacillus sakei subsp. sakei 23K] >gi|118597252|sp|Q38V05|RL11_LACSS 50S ribosomal protein L11 >gi|78610927|emb|CAI55979.1| 50S ribosomal protein L11 [Lactobacillus sakei subsp. sakei 23K] (141 aa)
Score = 266, Expect = 3.5e-22, Identities = 61/134 (45%), Positives = 89/134 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  I K+ +  G+A P    GP L   GIN+  FTK FN +T D+ G +IP +IT ++D+SF F  KT P  +LLKKAA ++ G+    T+ VAT+++ +  EIA+TK+ D NA D EA +RMV G+A+ MG  +EG
  S:     4 KVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGLLIPVVITVYEDRSFDFVTKTPPAAVLLKKAAGVQKGSGEPNTKKVATVTKAQVQEIAETKMQDLNAADVEAAMRMVEGTARSMGFTVEG 141
>gi|29348147|ref|NP_811650.1| 50S ribosomal protein L11 [Bacteroides thetaiotaomicron VPI-5482] >gi|54039098|sp|Q8A465|RL11_BACTN 50S ribosomal protein L11 >gi|29340050|gb|AAO77844.1| 50S ribosomal protein L11 [Bacteroides thetaiotaomicron VPI-5482] (147 aa)
Score = 266, Expect = 3.9e-22, Identities = 62/137 (45%), Positives = 89/137 (64%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           +  + K+ + GG A P    GP L S GIN+ EF KQFN +T+DK G+++P IIT + DKSF F IKT PV + L + A +K G+     + VA ++ E+   IA+ K+VD N    +A +RMVAG+A+ MGI ++G  PV
  S:     5 VAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITYYADKSFDFVIKTPPVAIQLLEVAKVKSGSAEPNRKKVAELTWEQIRTIAQDKMVDLNCFTVDAAMRMVAGTARSMGIAVKGEFPV 145
>gi|15643220|ref|NP_228264.1| ribosomal protein L11 [Thermotoga maritima MSB8] >gi|170288282|ref|YP_001738520.1| ribosomal protein L11 [Thermotoga sp. RQ2] >gi|132652|sp|P29395|RL11_THEMA 50S ribosomal protein L11 >gi|14278042|pdb|1GIY|L Chain L, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1giy, Contains The 50s Ribosome Subunit. The 30s Ribosome Subunit, Three Trna, And Mrna Molecules Are In The File 1gix >gi|24987762|pdb|1MJ1|L Chain L, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL Proteins Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome >gi|28373728|pdb|1ML5|LL Chain l, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 >gi|66361028|pdb|1YL3|L Chain L, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. Large Subunit. The Coordinates For The Small Subunit Are In The Pdb Entry 1yl4. >gi|88192288|pdb|2B66|K Chain K, 50s Ribosomal Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome. This File Contains The 50s Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome And Is Described In Remark 400 >gi|88192351|pdb|2B9N|K Chain K, 50s Ribosomal Subunit From A Crystal Structure Of Release Factor Rf2, Trnas And Mrna Bound To The Ribosome. This File Contains The 50s Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome And Is Described In Remark 400. >gi|88192406|pdb|2B9P|K Chain K, 50s Ribosomal Subunit From A Crystal Structure Of The Ribosome In Complex With Trnas And Mrna With A Stop Codon In The A-Site. This File Contains The 50s Subunit From A Crystal Structure Of The Ribosome In Complex With Trnas And Mrna With A Stop Codon In The A-Site And Is Described In Remark 400. >gi|152149585|pdb|2JQ7|A Chain A, Model For Thiostrepton Binding To The Ribosomal L11-Rna >gi|190613359|pdb|2K3F|A Chain A, Ribosomal Protein L11 From Thermotoga Maritima >gi|4980960|gb|AAD35537.1|AE001723_7 ribosomal protein L11 [Thermotoga maritima MSB8] >gi|48184|emb|CAA77859.1| ribosomal protein L11 [Thermotoga maritima] >gi|170175785|gb|ACB08837.1| ribosomal protein L11 [Thermotoga sp. RQ2] (141 aa)
Score = 264, Expect = 5.5e-22, Identities = 61/126 (48%), Positives = 88/126 (69%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT P + LLKKAA I+ G+   K + V  ++R++  EIAKTK+ D NAN  EA ++++ G+AK MGI++
  S:    10 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV 139
>gi|28377495|ref|NP_784387.1| 50S ribosomal protein L11 [Lactobacillus plantarum WCFS1] >gi|38605252|sp|Q88YX0|RL11_LACPL 50S ribosomal protein L11 >gi|28270327|emb|CAD63228.1| ribosomal protein L11 [Lactobacillus plantarum WCFS1] (141 aa)
Score = 264, Expect = 5.8e-22, Identities = 58/134 (43%), Positives = 90/134 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  + K+ +  G+A P    GP L   GIN+  FTK FN +T D+ G +IP +IT ++D+SF F  KT P  +LLKKAA ++ G+    T+ VAT+++++  +IA+TK+ D NA D EA +RM+ G+A+ MG  +EG
  S:     4 KVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITVYEDRSFDFITKTPPAAVLLKKAAGVESGSGEPNTKKVATVTKDQVKQIAETKMQDLNAADVEAAMRMIEGTARSMGFTVEG 141
>gi|30018367|ref|NP_829998.1| 50S ribosomal protein L11 [Bacillus cereus ATCC 14579] >gi|38605212|sp|Q81J53|RL11A_BACCR 50S ribosomal protein L11-1 >gi|29893907|gb|AAP07199.1| LSU ribosomal protein L11P [Bacillus cereus ATCC 14579] (141 aa)
Score = 264, Expect = 6.8e-22, Identities = 62/133 (46%), Positives = 87/133 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKKAA I+ G+       VAT+ R+K  EIA+TK+ D NA   EA +RMV G+A+ MGI IE
  S:     4 KVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAASVEAAMRMVEGAARSMGIVIE 140
>gi|7245461|pdb|1EG0|K Chain K, Fitting Of Components With Known Structure Into An 11.5 A Cryo-Em Map Of The E.Coli 70s Ribosome (140 aa)
Score = 264, Expect = 6.8e-22, Identities = 61/126 (48%), Positives = 88/126 (69%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT P + LLKKAA I+ G+   K + V  ++R++  EIAKTK+ D NAN  EA ++++ G+AK MGI++
  S:    10 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV 139
>gi|29377197|ref|NP_816351.1| ribosomal protein L11 [Enterococcus faecalis V583] >gi|38605223|sp|Q830Q5|RL11_ENTFA 50S ribosomal protein L11 >gi|29344663|gb|AAO82421.1| ribosomal protein L11 [Enterococcus faecalis V583] (140 aa)
Score = 263, Expect = 6.9e-22, Identities = 62/133 (46%), Positives = 90/133 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ +I K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+S ++  EIA+ K+ D NA D EA +RMVAG+A+ MGI +E
  S:     4 KVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFITKTPPAAVLLKKAAKIEKGSGEPNKTKVATVSSDQVKEIAELKMADLNAADVEAAMRMVAGTARSMGIIVE 140
>gi|7767082|pdb|1MMS|A Chain A, Crystal Structure Of The Ribosomal Protein L11-Rna Complex >gi|7767083|pdb|1MMS|B Chain B, Crystal Structure Of The Ribosomal Protein L11-Rna Complex >gi|29726521|pdb|1MVR|L Chain L, Decoding Center & Peptidyl Transferase Center From The X- Ray Structure Of The Thermus Thermophilus 70s Ribosome, Aligned To The Low Resolution Cryo-Em Map Of E.Coli 70s Ribosome >gi|40890042|pdb|1OLN|A Chain A, Model For Thiostrepton Antibiotic Binding To L11 Substrate From 50s Ribosomal Rna (140 aa)
Score = 263, Expect = 7.1e-22, Identities = 61/126 (48%), Positives = 88/126 (69%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT P + LLKKAA I+ G+   K + V  ++R++  EIAKTK+ D NAN  EA ++++ G+AK MGI++
  S:     9 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV 138
>gi|56477583|ref|YP_159172.1| 50S ribosomal protein L11 [Azoarcus sp. EbN1] >gi|81677442|sp|Q5P343|RL11_AZOSE 50S ribosomal protein L11 >gi|56313626|emb|CAI08271.1| 50S ribosomal protein L11 [Azoarcus sp. EbN1] (143 aa)
Score = 263, Expect = 7.2e-22, Identities = 66/135 (48%), Positives = 90/135 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +IT   K+ +  G+A P    GP L   G+N+ EF K FN +T+  + G  IP +ITAF DKSFTF +KT P T+L+KKAA I  G+    T+ V +I+R +  EIAKTK+ D  A D EA +R +AGSA+ MGI +EG+
  S:     4 KITGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNARTQGLEPGLPIPVVITAFADKSFTFIMKTPPATILIKKAAKITKGSPKPHTDKVGSITRAQVEEIAKTKMADLTAADMEAAVRTIAGSARSMGITVEGL 143
>gi|71905950|ref|YP_283537.1| 50S ribosomal protein L11 [Dechloromonas aromatica RCB] >gi|118597154|sp|Q47JB4|RL11_DECAR 50S ribosomal protein L11 >gi|71845571|gb|AAZ45067.1| LSU ribosomal protein L11P [Dechloromonas aromatica RCB] (143 aa)
Score = 263, Expect = 7.4e-22, Identities = 67/135 (49%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  IP +ITAF DKSFTF +KT P T+L+KKAA IK G+    T+ V  I+R +  EIAKTK  D  A D EA +R +AGSA+ MGI +EG+
  S:     4 KIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGVEPGLPIPVVITAFADKSFTFVMKTPPATILIKKAAGIKSGSAKPHTDKVGKITRAQCEEIAKTKSPDLTAADMEAAIRTIAGSARSMGITVEGL 143
>gi|15988475|pdb|1JQM|A Chain A, Fitting Of L11 Protein And Elongation Factor G (Ef-G) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G, Gdp And Fusidic Acid >gi|15988477|pdb|1JQS|A Chain A, Fitting Of L11 Protein And Elongation Factor G (Domain G' And V) In The Cryo-Em Map Of E. Coli 70s Ribosome Bound With Ef-G And Gmppcp, A Nonhydrolysable Gtp Analog >gi|15988480|pdb|1JQT|A Chain A, Fitting Of L11 Protein In The Low Resolution Cryo-Em Map Of E.Coli 70s Ribosome (139 aa)
Score = 263, Expect = 7.5e-22, Identities = 61/126 (48%), Positives = 88/126 (69%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT P + LLKKAA I+ G+   K + V  ++R++  EIAKTK+ D NAN  EA ++++ G+AK MGI++
  S:     9 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV 138
>gi|115350310|ref|YP_772149.1| 50S ribosomal protein L11 [Burkholderia ambifaria AMMD] >gi|134294431|ref|YP_001118166.1| 50S ribosomal protein L11 [Burkholderia vietnamiensis G4] >gi|170701416|ref|ZP_02892374.1| ribosomal protein L11 [Burkholderia ambifaria IOP40-10] >gi|171319354|ref|ZP_02908464.1| ribosomal protein L11 [Burkholderia ambifaria MEX-5] >gi|172059329|ref|YP_001806981.1| ribosomal protein L11 [Burkholderia ambifaria MC40-6] >gi|122324278|sp|Q0BJ58|RL11_BURCM 50S ribosomal protein L11 >gi|166230115|sp|A4JAM8|RL11_BURVG 50S ribosomal protein L11 >gi|115280298|gb|ABI85815.1| LSU ribosomal protein L11P [Burkholderia ambifaria AMMD] >gi|134137588|gb|ABO53331.1| LSU ribosomal protein L11P [Burkholderia vietnamiensis G4] >gi|170133668|gb|EDT02038.1| ribosomal protein L11 [Burkholderia ambifaria IOP40-10] >gi|171095425|gb|EDT40397.1| ribosomal protein L11 [Burkholderia ambifaria MEX-5] >gi|171991846|gb|ACB62765.1| ribosomal protein L11 [Burkholderia ambifaria MC40-6] (143 aa)
Score = 263, Expect = 7.5e-22, Identities = 65/135 (48%), Positives = 90/135 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF +KT P T+L+KKAA +  G+    T+ V +I+R +A EIAKTK+ D  A D +A +R +AGSA+ MGI +EGV
  S:     4 KIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAFADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSITRAQAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV 143
>gi|23097562|ref|NP_691028.1| 50S ribosomal protein L11 [Oceanobacillus iheyensis HTE831] >gi|38605316|sp|Q8ETZ3|RL11_OCEIH 50S ribosomal protein L11 >gi|22775785|dbj|BAC12063.1| 50S ribosomal protein L11 [Oceanobacillus iheyensis HTE831] (141 aa)
Score = 263, Expect = 7.6e-22, Identities = 60/133 (45%), Positives = 89/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T+D+ G +IP  IT F+D+SFTF  KT P  +LLKKAA I+ G+       VA++ R++  EIA+TK+ D NA D +A +RMV G+A+ MGI IE
  S:     4 KVIKLVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGMIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNKNKVASVKRDQVKEIAETKMPDLNAADVDAAMRMVEGTARSMGITIE 140
>gi|78064912|ref|YP_367681.1| 50S ribosomal protein L11 [Burkholderia sp. 383] >gi|107024315|ref|YP_622642.1| 50S ribosomal protein L11 [Burkholderia cenocepacia AU 1054] >gi|116688360|ref|YP_833983.1| 50S ribosomal protein L11 [Burkholderia cenocepacia HI2424] >gi|170731670|ref|YP_001763617.1| ribosomal protein L11 [Burkholderia cenocepacia MC0-3] >gi|194557591|ref|YP_002092617.1| Ribosomal protein L11 [Burkholderia cenocepacia PC184] >gi|166230109|sp|A0K3L3|RL11_BURCH 50S ribosomal protein L11 >gi|118597140|sp|Q1BRT6|RL11_BURCA 50S ribosomal protein L11 >gi|118597141|sp|Q39KH9|RL11_BURS3 50S ribosomal protein L11 >gi|77965657|gb|ABB07037.1| LSU ribosomal protein L11P [Burkholderia sp. 383] >gi|105894504|gb|ABF77669.1| LSU ribosomal protein L11P [Burkholderia cenocepacia AU 1054] >gi|116646449|gb|ABK07090.1| LSU ribosomal protein L11P [Burkholderia cenocepacia HI2424] >gi|124871382|gb|EAY63098.1| Ribosomal protein L11 [Burkholderia cenocepacia PC184] >gi|169814912|gb|ACA89495.1| ribosomal protein L11 [Burkholderia cenocepacia MC0-3] (143 aa)
Score = 263, Expect = 8.9e-22, Identities = 65/135 (48%), Positives = 90/135 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF +KT P T+L+KKAA +  G+    T+ V +I+R +A EIAKTK+ D  A D +A +R +AGSA+ MGI +EGV
  S:     4 KIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAFADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSITRAQAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV 143
>gi|56961919|ref|YP_173641.1| 50S ribosomal protein L11 [Bacillus clausii KSM-K16] >gi|61214767|sp|Q5WLS5|RL11_BACSK 50S ribosomal protein L11 >gi|56908153|dbj|BAD62680.1| 50S ribosomal protein L11 [Bacillus clausii KSM-K16] (141 aa)
Score = 262, Expect = 9.3e-22, Identities = 62/133 (46%), Positives = 86/133 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKKAA I  G+       VAT+ R+K  EIA+TK+ D NA   EA +RMV G+A+ MGI IE
  S:     4 KVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTSDQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIDSGSGEPNRTKVATVKRDKVREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIE 140
>gi|50902821|gb|AAT86536.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS10394] >gi|71802124|gb|AAX71477.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS6180] >gi|94541516|gb|ABF31565.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS9429] >gi|94543395|gb|ABF33443.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS10270] >gi|94545400|gb|ABF35447.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS2096] >gi|94547280|gb|ABF37326.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS10750] (165 aa)
Score = 262, Expect = 9.4e-22, Identities = 57/132 (43%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+    T  VAT++R +  EIA+TK+ D NA + EA +RM+ G+A+ MG  +
  S:    28 KVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNTTKVATVTRAQVQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTV 163
>gi|85712789|ref|ZP_01043833.1| Ribosomal protein L11 [Idiomarina baltica OS145] >gi|85693429|gb|EAQ31383.1| Ribosomal protein L11 [Idiomarina baltica OS145] (142 aa)
Score = 262, Expect = 9.4e-22, Identities = 64/134 (47%), Positives = 87/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +++ I K+ +  G A P    GP L   G+N+ EF K FN QT + + G  +P  IT F+D+SFTF  KT P + LLKKAA IK G+    TE V T++RE+  EIAKTK  D  A D +A +R +AGSA+ MG+ +EG
  S:     4 KVSAIIKLQVAAGSANPSPPVGPALGQHGVNIMEFCKAFNAQTDNLEKGAPVPVEITVFEDRSFTFITKTPPASFLLKKAAGIKSGSGRPNTEKVGTVTREQLEEIAKTKEPDLTAADLDAAVRTIAGSARAMGLNVEG 142
>gi|121602562|ref|YP_988877.1| 50S ribosomal protein L11 [Bartonella bacilliformis KC583] >gi|166230104|sp|A1USC4|RL11_BARBK 50S ribosomal protein L11 >gi|120614739|gb|ABM45340.1| ribosomal protein L11 [Bartonella bacilliformis KC583] (142 aa)
Score = 262, Expect = 1.0e-21, Identities = 62/128 (48%), Positives = 85/128 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  T++ + G  IP +IT ++DKSFTF +KT PV+  LKK AN+K G+K      V TISR+K   IA+ K+ D NAN+ EA +RM+ GSA+ MG+++ G
  S:    10 KLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGAPIPVVITYYQDKSFTFSLKTPPVSFFLKKEANLKSGSKEPGKVFVGTISRDKICSIAEAKMKDLNANNIEAAMRMIEGSARSMGLEVVG 142
>gi|52078596|ref|YP_077387.1| 50S ribosomal protein L11 [Bacillus licheniformis ATCC 14580] >gi|52783958|ref|YP_089787.1| 50S ribosomal protein L11 [Bacillus licheniformis ATCC 14580] >gi|81691253|sp|Q65PC0|RL11_BACLD 50S ribosomal protein L11 >gi|52001807|gb|AAU21749.1| ribosomal protein L11 [Bacillus licheniformis ATCC 14580] >gi|52346460|gb|AAU39094.1| RplK [Bacillus licheniformis DSM 13] (141 aa)
Score = 261, Expect = 1.2e-21, Identities = 60/122 (49%), Positives = 81/122 (66%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
            G+A P    GP L   G+N+  F K+FN +T D+ G +IP  I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+ R+K  EIA+TK+ D NA D EA +RMV G+A+ MGI IE
  S:    15 AGKANPAPPVGPALGQAGVNIMGFCKEFNARTSDQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIE 140
>gi|161523417|ref|YP_001578429.1| 50S ribosomal protein L11 [Burkholderia multivorans ATCC 17616] >gi|167587783|ref|ZP_02380171.1| ribosomal protein L11 [Burkholderia ubonensis Bu] >gi|189351810|ref|YP_001947438.1| large subunit ribosomal protein L11 [Burkholderia multivorans ATCC 17616] >gi|194564512|ref|YP_002099535.1| Ribosomal protein L11 [Burkholderia dolosa AUO158] >gi|124896136|gb|EAY70016.1| Ribosomal protein L11 [Burkholderia dolosa AUO158] >gi|160340846|gb|ABX13932.1| ribosomal protein L11 [Burkholderia multivorans ATCC 17616] >gi|189335832|dbj|BAG44902.1| large subunit ribosomal protein L11 [Burkholderia multivorans ATCC 17616] (143 aa)
Score = 261, Expect = 1.3e-21, Identities = 64/135 (47%), Positives = 90/135 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITA+ DKSFTF +KT P T+L+KKAA +  G+    T+ V +I+R +A EIAKTK+ D  A D +A +R +AGSA+ MGI +EGV
  S:     4 KIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAYADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGSITRAQAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV 143
>gi|56418628|ref|YP_145946.1| 50S ribosomal protein L11 [Geobacillus kaustophilus HTA426] >gi|61214677|sp|Q5L421|RL11_GEOKA 50S ribosomal protein L11 >gi|56378470|dbj|BAD74378.1| 50S ribosomal protein L11 (BL11) [Geobacillus kaustophilus HTA426] (141 aa)
Score = 261, Expect = 1.5e-21, Identities = 61/133 (45%), Positives = 86/133 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKKAA I+ G+       VATI R+K  EIA+ K+ D NA   EA +RM+ G+A+ MGI IE
  S:     4 KVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVIE 140
>gi|49474311|ref|YP_032353.1| 50S ribosomal protein L11 [Bartonella quintana str. Toulouse] >gi|56404779|sp|Q6FZL5|RL11_BARQU 50S ribosomal protein L11 >gi|49239815|emb|CAF26206.1| 50s ribosomal protein l11 [Bartonella quintana str. Toulouse] (142 aa)
Score = 261, Expect = 1.5e-21, Identities = 63/128 (49%), Positives = 84/128 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  T++ + G  IP IIT ++DKSFTF +KT PV+  LKK  N+K G+K     +V  ISR+K   IA+ K+ D NAND EA +RMV GSA+ MG+++ G
  S:    10 KLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGAPIPVIITYYQDKSFTFSLKTPPVSFFLKKEVNLKSGSKEPGKVSVGRISRDKIRSIAEAKMKDLNANDIEAAMRMVEGSARSMGLEVVG 142
>gi|88802463|ref|ZP_01117990.1| 50S ribosomal protein L11 [Polaribacter irgensii 23-P] >gi|88781321|gb|EAR12499.1| 50S ribosomal protein L11 [Polaribacter irgensii 23-P] (145 aa)
Score = 260, Expect = 1.6e-21, Identities = 58/136 (42%), Positives = 92/136 (67%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P +IT FKDKSF F IKT P  + L + A IK G+     + VA+++ ++   IA+ K+VD NA +  + +RM+AG+A+ MG+ ++G  P
  S:     5 VSKVVKLQVKGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKQGKVLPVVITVFKDKSFDFLIKTPPAAVQLLEVAKIKKGSGEPNRKKVASVTWDQIQVIAEDKMVDLNAFEISSAMRMIAGTARSMGLTVKGNAP 144
>gi|117927504|ref|YP_872055.1| 50S ribosomal protein L11P [Acidothermus cellulolyticus 11B] >gi|166230092|sp|A0LRK9|RL11_ACIC1 50S ribosomal protein L11 >gi|117647967|gb|ABK52069.1| LSU ribosomal protein L11P [Acidothermus cellulolyticus 11B] (143 aa)
Score = 260, Expect = 1.7e-21, Identities = 60/132 (45%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT + K+ +  GQA P    GP L   G+N+ EF KQ+N  T+ + G V+P  IT ++D+SFTF  KT P   L+KKAA I+ G+       VAT++RE+  +IA+TKL D NA+D EA  +++AG+A+ MG+ I
  S:     6 KITAVIKLQINAGQATPAPPIGPALGQHGVNIMEFCKQYNAATESQRGNVVPVEITVYEDRSFTFVTKTPPAAELIKKAAGIEKGSAAPHRTKVATLTREQLRQIAQTKLPDLNAHDVEAAEKIIAGTARSMGVTI 141
>gi|16077170|ref|NP_387983.1| 50S ribosomal protein L11 [Bacillus subtilis subsp. subtilis str. 168] >gi|548739|sp|Q06796|RL11_BACSU 50S ribosomal protein L11 (BL11) >gi|285629|dbj|BAA02561.1| ribosomal protein L11 [Bacillus subtilis] >gi|2632369|emb|CAB11878.1| ribosomal protein L11 (BL11) [Bacillus subtilis subsp. subtilis str. 168] (141 aa)
Score = 260, Expect = 1.8e-21, Identities = 60/122 (49%), Positives = 81/122 (66%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
            G+A P    GP L   G+N+  F K+FN +T D+ G +IP  I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+ R+K  EIA+TK+ D NA D EA +RMV G+A+ MGI IE
  S:    15 AGKANPAPPVGPALGQAGVNVMGFCKEFNARTADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIE 140
>gi|30260288|ref|NP_842665.1| 50S ribosomal protein L11 [Bacillus anthracis str. Ames] >gi|42779178|ref|NP_976425.1| 50S ribosomal protein L11 [Bacillus cereus ATCC 10987] >gi|47777776|ref|YP_016700.2| 50S ribosomal protein L11 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183131|ref|YP_026383.1| 50S ribosomal protein L11 [Bacillus anthracis str. Sterne] >gi|49479292|ref|YP_034449.1| 50S ribosomal protein L11 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|152973944|ref|YP_001373461.1| 50S ribosomal protein L11 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|161763538|ref|YP_081708.2| 50S ribosomal protein L11 [Bacillus cereus E33L] >gi|163938105|ref|YP_001642989.1| 50S ribosomal protein L11 [Bacillus weihenstephanensis KBAB4] >gi|166996977|ref|ZP_02263436.1| 50S ribosomal protein L11 [Bacillus cereus AH820] >gi|167636699|ref|ZP_02394986.1| ribosomal protein L11 [Bacillus anthracis str. A0442] >gi|170689566|ref|ZP_02880752.1| ribosomal protein L11 [Bacillus anthracis str. A0465] >gi|189040944|sp|A7GK08|RL11_BACCN 50S ribosomal protein L11 >gi|38605214|sp|Q81VU3|RL11_BACAN 50S ribosomal protein L11 >gi|54039069|sp|P62431|RL11_BACC1 50S ribosomal protein L11 >gi|56404789|sp|Q6HPS1|RL11_BACHK 50S ribosomal protein L11 >gi|118597135|sp|Q63HA3|RL11_BACCZ 50S ribosomal protein L11 >gi|30253609|gb|AAP24151.1| ribosomal protein L11 [Bacillus anthracis str. Ames] >gi|42735093|gb|AAS39033.1| ribosomal protein L11 [Bacillus cereus ATCC 10987] >gi|47551481|gb|AAT29175.2| ribosomal protein L11 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177058|gb|AAT52434.1| ribosomal protein L11 [Bacillus anthracis str. Sterne] >gi|49330848|gb|AAT61494.1| ribosomal protein L11 (50S ribosomal protein L11) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|152022696|gb|ABS20466.1| ribosomal protein L11 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|163860302|gb|ABY41361.1| ribosomal protein L11 [Bacillus weihenstephanensis KBAB4] >gi|167527873|gb|EDR90700.1| ribosomal protein L11 [Bacillus anthracis str. A0442] >gi|170666479|gb|EDT17256.1| ribosomal protein L11 [Bacillus anthracis str. A0465] (141 aa)
Score = 260, Expect = 1.8e-21, Identities = 61/133 (45%), Positives = 86/133 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKK A I+ G+       VAT+ R+K  EIA+TK+ D NA   EA +RMV G+A+ MGI IE
  S:     4 KVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIE 140
>gi|89890188|ref|ZP_01201699.1| RplK, ribosomal protein L11 [Flavobacteria bacterium BBFL7] >gi|89518461|gb|EAS21117.1| RplK, ribosomal protein L11 [Flavobacteria bacterium BBFL7] (146 aa)
Score = 260, Expect = 1.8e-21, Identities = 59/135 (43%), Positives = 91/135 (67%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P  IT +KDKSF F IKT P  + + +AA +K G+     + VATIS ++   IA+ K+ D NA   ++ +RMVAG+A+ MG+ ++G D
  S:     5 VSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKPGKVLPVAITVYKDKSFDFVIKTPPAAVQILEAAKLKGGSGEPNRKKVATISWDQVRLIAEDKMPDLNAFTVDSAMRMVAGTARSMGVNVKGGD 143
>gi|67156997|ref|ZP_00418359.1| Ribosomal protein L11, bacterial [Azotobacter vinelandii AvOP] >gi|67085674|gb|EAM05146.1| Ribosomal protein L11, bacterial [Azotobacter vinelandii AvOP] (143 aa)
Score = 260, Expect = 1.8e-21, Identities = 63/135 (46%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  GQA P    GP L   G+N+ EF K FN +T+  + G   P IIT + D+SFTFE K+TP ++LLKKAA I  G+    T+ V T++R +  EIAK K  D  A D EA +R +AGSA+ MG+ +EGV
  S:     4 KIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNARTQGMEPGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGISSGSSRPNTQKVGTVNRAQLEEIAKAKQADLTAADLEAAVRTIAGSARSMGLNVEGV 143
>gi|91785477|ref|YP_560683.1| 50S ribosomal protein L11 [Burkholderia xenovorans LB400] >gi|118597143|sp|Q13TF8|RL11_BURXL 50S ribosomal protein L11 >gi|91689431|gb|ABE32631.1| LSU ribosomal protein L11P [Burkholderia xenovorans LB400] (143 aa)
Score = 260, Expect = 1.8e-21, Identities = 66/135 (48%), Positives = 89/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  IP +ITAF DKSFTF +KT P T+L+KKAA I  G+    T+ V  I+R +A +IAKTK+ D  A D +A +R +AGSA+ MGI +EGV
  S:     4 KIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQALEPGLPIPVVITAFADKSFTFVLKTPPATVLIKKAAKIDKGSSKPHTDKVGKITRAQAEDIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV 143
>gi|34499652|ref|NP_903867.1| 50S ribosomal protein L11 [Chromobacterium violaceum ATCC 12472] >gi|38605130|sp|P60100|RL11_CHRVO 50S ribosomal protein L11 >gi|34105502|gb|AAQ61857.1| 50S ribosomal protein L11 [Chromobacterium violaceum ATCC 12472] (143 aa)
Score = 260, Expect = 1.8e-21, Identities = 64/135 (47%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  IP +ITA+ DKSFTF +KT P T LLKKAA IK G+  +  + V  ++R +  EIAKTK  D  A D +A +R +AGSA+ MG+++EGV
  S:     4 KIVGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGMEPGMPIPVVITAYADKSFTFTMKTPPATFLLKKAAGIKSGSAKAHVDKVGKVTRAQLEEIAKTKQADLTAADLDAAVRTIAGSARSMGLEVEGV 143
>gi|50843342|ref|YP_056569.1| 50S ribosomal protein L11 [Propionibacterium acnes KPA171202] >gi|56404768|sp|Q6A6K2|RL11_PROAC 50S ribosomal protein L11 >gi|50840944|gb|AAT83611.1| 50S ribosomal protein L11 [Propionibacterium acnes KPA171202] (143 aa)
Score = 259, Expect = 2.1e-21, Identities = 56/122 (45%), Positives = 84/122 (68%)
  Q:    21 GGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
            GQA P P     L   G+N+ EF K +N QT+ + G ++P  IT ++D++F+F +KT P   L+KKAA IK G +N  T  V  IS+++  EIA+TK+ D NAND EA +++VAG+A+ MG+++E
  S:    17 AGQATPAPPVGMALGPHGVNIMEFCKAYNAQTEGQRGNIVPVEITIYEDRTFSFVLKTPPAAELIKKAAGIKKGTENPATHKVGKISKDQVREIAETKMPDLNANDIEAAMKIVAGTARSMGVEVE 142
>gi|32475091|ref|NP_868085.1| 50S ribosomal protein L11 [Rhodopirellula baltica SH 1] >gi|54039094|sp|Q7UMY7|RL11_RHOBA 50S ribosomal protein L11 >gi|32445631|emb|CAD75637.1| 50S ribosomal protein L11 [Rhodopirellula baltica SH 1] (141 aa)
Score = 259, Expect = 2.2e-21, Identities = 56/134 (41%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T  AK  + GGQA P P     L   G+N+G+F +QFND+TK+ NG  IP I+T + D+SF F  K+ P   +L ++A I  G+     + VAT++R +  EIA+ K+ D NA D +   RM+ G+A+ MGI ++G
  S:     4 QVTGQAKFQVPGGQATPAPPVGTSLGKYGVNLGQFVQQFNDRTKEYNGTPIPVIVTVYNDRSFDFITKSPPAASMLMQSAGIAKGSGVPNKDKVATVTRAQCEEIAQKKMEDLNARDIDQATRMIEGTARSMGIIVDG 141
>gi|77165798|ref|YP_344323.1| ribosomal protein L11 [Nitrosococcus oceani ATCC 19707] >gi|119390739|sp|Q3J8Q3|RL11_NITOC 50S ribosomal protein L11 >gi|76884112|gb|ABA58793.1| LSU ribosomal protein L11P [Nitrosococcus oceani ATCC 19707] (143 aa)
Score = 259, Expect = 2.2e-21, Identities = 60/135 (44%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    ++ +  GQA P    GP L   G+N+ EF K FN QT+  + G  IP +IT + D+SFTF  KT P ++LLKKAA I  G+    ++ V  ++R +  EIA+TK+ D NA D+EA +R +AGSA+ +G++ EGV
  S:     4 KIEAYIRLQVPAGQANPSPPVGPALGQRGVNIMEFCKTFNAQTQGLEQGMPIPVVITVYSDRSFTFVTKTPPASILLKKAAGITSGSSRPNSDKVGKVTRAQLEEIAETKMPDLNAADKEAAIRTIAGSARSLGLETEGV 143
>gi|83855430|ref|ZP_00948959.1| 50S ribosomal protein L11 [Croceibacter atlanticus HTCC2559] >gi|83849230|gb|EAP87098.1| 50S ribosomal protein L11 [Croceibacter atlanticus HTCC2559] (146 aa)
Score = 259, Expect = 2.3e-21, Identities = 58/133 (43%), Positives = 90/133 (67%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P +IT +KDKSF F IKT P  + + +AA  K G+     + VATIS ++   IA+ K+ D NA   E+ ++MVAG+A+ MG+ ++G
  S:     5 VSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNGRTQDKAGKVLPVVITVYKDKSFDFVIKTPPAAVQILEAAKTKSGSGEPNRKKVATISWDQVRAIAEDKMPDLNAFTVESAMQMVAGTARSMGVNVKG 141
>gi|51978591|gb|AAU20141.1| ribosomal protein L11 (50S ribosomal protein L11) [Bacillus cereus E33L] (134 aa)
Score = 259, Expect = 2.5e-21, Identities = 61/129 (47%), Positives = 83/129 (64%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           + K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKK A I+ G+       VAT+ R+K  EIA+TK+ D NA   EA +RMV G+A+ MGI IE
  S:     1 MVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIE 133
>gi|89100744|ref|ZP_01173599.1| 50S ribosomal protein L11 [Bacillus sp. NRRL B-14911] >gi|89084561|gb|EAR63707.1| 50S ribosomal protein L11 [Bacillus sp. NRRL B-14911] (160 aa)
Score = 259, Expect = 2.6e-21, Identities = 58/122 (47%), Positives = 80/122 (65%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
            G+A P    GP L   G+N+  F K+FN +T ++ G +IP  I+ F+D+SFTF  KT P  +LLKKAA I+ G+       VAT+ R+K  EIA+TK+ D NA   E+ +RMV G+A+ MGI IE
  S:    34 AGKANPAPPVGPALGQAGVNIMGFCKEFNARTAEQAGLIIPVEISVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAASVESAMRMVEGTARSMGIVIE 159
>gi|121997660|ref|YP_001002447.1| ribosomal protein L11 [Halorhodospira halophila SL1] >gi|166230143|sp|A1WVD3|RL11_HALHL 50S ribosomal protein L11 >gi|121589065|gb|ABM61645.1| LSU ribosomal protein L11P [Halorhodospira halophila SL1] (143 aa)
Score = 258, Expect = 2.7e-21, Identities = 61/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  GQA P    GP L   G+N+ EF K FN QT++  G + IP +IT + D+SFTF  KT P  +LL KA   K G+    T+ V T+ R++  EIA+TK  D NA+D +A +R +AG+A+ MGI +EGV
  S:     4 KIEAYIKLQVPAGQANPSPPVGPALGQHGLNIMEFCKAFNAQTQEMEGGLPIPVVITVYSDRSFTFVTKTPPAPVLLLKAIGAKGGSGTPNTKKVGTVQRDQLEEIARTKWPDLNASDMDAAVRSIAGTARSMGIDVEGV 143
>gi|86140285|ref|ZP_01058844.1| 50S ribosomal protein L11 [Flavobacterium sp. MED217] >gi|85832227|gb|EAQ50676.1| 50S ribosomal protein L11 [Leeuwenhoekiella blandensis MED217] (145 aa)
Score = 258, Expect = 2.7e-21, Identities = 57/136 (41%), Positives = 91/136 (66%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P +IT + DKSF F +KT P  + L +AA IK G+     + VA+++ ++   I++ K+ D NA   E+ +RMVAG+A+ MGI ++G  P
  S:     5 VSKVVKLQVKGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKAGKVLPVVITVYGDKSFDFVVKTPPAAIQLMEAAKIKGGSGEPNRKKVASVTWDQIRAISEDKMPDLNAFTVESAMRMVAGTARSMGITVKGQAP 144
>gi|91215204|ref|ZP_01252176.1| 50S ribosomal protein L11 [Psychroflexus torquis ATCC 700755] >gi|91186809|gb|EAS73180.1| 50S ribosomal protein L11 [Psychroflexus torquis ATCC 700755] (145 aa)
Score = 258, Expect = 3.1e-21, Identities = 58/136 (42%), Positives = 91/136 (66%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+++P  IT +KDKSF F IKT P  + L +A+ IK G+    ++ V T+S ++   IA+ K+ D NA   E+ ++MVAG+A+ MGI ++G  P
  S:     5 VSKVVKLQVKGGAANPSPPVGPALGAAGVNIMEFCKQFNGRTQDKGGKILPVEITVYKDKSFDFVIKTPPAAVQLMEASKIKKGSGEPNSKKVGTVSWDQVKAIAEDKMQDLNAFSMESAMKMVAGTARSMGITVKGNAP 144
>gi|71083814|ref|YP_266534.1| ribosomal protein L11 [Candidatus Pelagibacter ubique HTCC1062] >gi|91763150|ref|ZP_01265114.1| ribosomal protein L11 [Candidatus Pelagibacter ubique HTCC1002] >gi|118597271|sp|Q4FLK8|RL11_PELUB 50S ribosomal protein L11 >gi|71062927|gb|AAZ21930.1| ribosomal protein L11 [Candidatus Pelagibacter ubique HTCC1062] >gi|91717563|gb|EAS84214.1| ribosomal protein L11 [Candidatus Pelagibacter ubique HTCC1002] (141 aa)
Score = 258, Expect = 3.1e-21, Identities = 59/132 (44%), Positives = 89/132 (67%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           I+   K+ ++GGQA P    GP L   GIN+ EF K FND+TK   G+ IP +IT +KDK F FEIK+ P +  +K+AA +K G+K        +I++++A EIA  K+ D NA+D E  ++++AGSA+ MGI+++
  S:     5 ISGYIKLQIMGGQANPAPPVGPALGQRGINIMEFCKAFNDKTKAFAGKPIPVVITVYKDKKFDFEIKSPPASHFIKEAAKLKGGSKEPGRSIAGSITKKQAEEIATQKMKDLNAHDLEQAVKIIAGSARSMGIEVK 140
>gi|54039097|sp|Q84IF5|RL11_SELRU 50S ribosomal protein L11 >gi|28394172|dbj|BAC57015.1| 50S ribosomal protein L11 [Selenomonas ruminantium] (141 aa)
Score = 258, Expect = 3.3e-21, Identities = 60/132 (45%), Positives = 90/132 (68%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++++I K+ ++ G+A P    GP L   G+N+  F K+FN++TKDK G +IP  IT F+D+SFTF  KT P  +LLKKAA I+  +       VA + R +A++IA++K+ D NA D EA  RM+ G+A+ MGI+I
  S:     4 KVSKIVKLQVVAGKANPAPPVGPALGQAGVNIMGFCKEFNERTKDKAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAKIEKASGEPNKNKVAKLPRAEAMKIAESKMEDLNAADIEAATRMIEGTARSMGIEI 139
>gi|53720833|ref|YP_109819.1| 50S ribosomal protein L11 [Burkholderia pseudomallei K96243] >gi|53723866|ref|YP_104178.1| 50S ribosomal protein L11 [Burkholderia mallei ATCC 23344] >gi|76809183|ref|YP_335154.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 1710b] >gi|83720675|ref|YP_443584.1| 50S ribosomal protein L11 [Burkholderia thailandensis E264] >gi|121600143|ref|YP_994469.1| 50S ribosomal protein L11 [Burkholderia mallei SAVP1] >gi|124386267|ref|YP_001027881.1| 50S ribosomal protein L11 [Burkholderia mallei NCTC 10229] >gi|126441947|ref|YP_001060762.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 668] >gi|126450115|ref|YP_001082977.1| 50S ribosomal protein L11 [Burkholderia mallei NCTC 10247] >gi|126453465|ref|YP_001068050.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 1106a] >gi|134283131|ref|ZP_01769832.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 305] >gi|161358167|ref|ZP_02104040.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 1106b] >gi|167003568|ref|ZP_02269354.1| 50S ribosomal protein L11 [Burkholderia mallei PRL-20] >gi|167564428|ref|ZP_02357344.1| 50S ribosomal protein L11 [Burkholderia oklahomensis EO147] >gi|167571574|ref|ZP_02364448.1| 50S ribosomal protein L11 [Burkholderia oklahomensis C6786] >gi|167582634|ref|ZP_02375508.1| 50S ribosomal protein L11 [Burkholderia thailandensis TXDOH] >gi|167620748|ref|ZP_02389379.1| 50S ribosomal protein L11 [Burkholderia thailandensis Bt4] >gi|167721588|ref|ZP_02404824.1| 50S ribosomal protein L11 [Burkholderia pseudomallei DM98] >gi|167740562|ref|ZP_02413336.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 14] >gi|167817767|ref|ZP_02449447.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 91] >gi|167826164|ref|ZP_02457635.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 9] >gi|167838223|ref|ZP_02465082.1| 50S ribosomal protein L11 [Burkholderia thailandensis MSMB43] >gi|167847676|ref|ZP_02473184.1| 50S ribosomal protein L11 [Burkholderia pseudomallei B7210] >gi|167896248|ref|ZP_02483650.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 7894] >gi|167904630|ref|ZP_02491835.1| 50S ribosomal protein L11 [Burkholderia pseudomallei NCTC 13177] >gi|167912895|ref|ZP_02499986.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 112] >gi|167920855|ref|ZP_02507946.1| 50S ribosomal protein L11 [Burkholderia pseudomallei BCC215] >gi|194317148|ref|YP_002012539.1| 50S ribosomal protein L11 [Burkholderia mallei ATCC 10399] >gi|194514299|ref|YP_002049729.1| 50S ribosomal protein L11 [Burkholderia pseudomallei S13] >gi|194575874|ref|YP_002110757.1| 50S ribosomal protein L11 [Burkholderia mallei 2002721280] >gi|166230110|sp|A3MRU1|RL11_BURM7 50S ribosomal protein L11 >gi|166230111|sp|A2S7G2|RL11_BURM9 50S ribosomal protein L11 >gi|166230112|sp|A1V8B6|RL11_BURMS 50S ribosomal protein L11 >gi|166230113|sp|A3P0C9|RL11_BURP0 50S ribosomal protein L11 >gi|166230114|sp|A3NEJ1|RL11_BURP6 50S ribosomal protein L11 >gi|56404755|sp|Q62GJ3|RL11_BURMA 50S ribosomal protein L11 >gi|56404756|sp|Q63PZ9|RL11_BURPS 50S ribosomal protein L11 >gi|118597142|sp|Q2SU15|RL11_BURTA 50S ribosomal protein L11 >gi|119390736|sp|Q3JMP9|RL11_BURP1 50S ribosomal protein L11 >gi|52211247|emb|CAH37236.1| 50s ribosomal protein L11 [Burkholderia pseudomallei K96243] >gi|52427289|gb|AAU47882.1| ribosomal protein L11 [Burkholderia mallei ATCC 23344] >gi|76578636|gb|ABA48111.1| ribosomal protein L11 [Burkholderia pseudomallei 1710b] >gi|83654500|gb|ABC38563.1| ribosomal protein L11 [Burkholderia thailandensis E264] >gi|121228953|gb|ABM51471.1| 50S ribosomal protein L11 [Burkholderia mallei SAVP1] >gi|124294287|gb|ABN03556.1| 50S ribosomal protein L11 [Burkholderia mallei NCTC 10229] >gi|126221440|gb|ABN84946.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 668] >gi|126227107|gb|ABN90647.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 1106a] >gi|126242985|gb|ABO06078.1| 50S ribosomal protein L11 [Burkholderia mallei NCTC 10247] >gi|134245326|gb|EBA45419.1| 50S ribosomal protein L11 [Burkholderia pseudomallei 305] >gi|148026195|gb|EDK84280.1| 50S ribosomal protein L11 [Burkholderia mallei 2002721280] >gi|160696303|gb|EDP86273.1| 50S ribosomal protein L11 [Burkholderia mallei ATCC 10399] >gi|169655346|gb|EDS88039.1| 50S ribosomal protein L11 [Burkholderia pseudomallei S13] (143 aa)
Score = 257, Expect = 3.5e-21, Identities = 64/135 (47%), Positives = 89/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITA+ DKSFTF +KT P T+L+KKAA +  G+    T+ V  I+R +A EIAKTK+ D  A D +A +R +AGSA+ MGI +EGV
  S:     4 KIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAYADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGKITRAQAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV 143
>gi|86134004|ref|ZP_01052586.1| 50S ribosomal protein L11 [Tenacibaculum sp. MED152] >gi|85820867|gb|EAQ42014.1| 50S ribosomal protein L11 [Polaribacter dokdonensis MED152] (145 aa)
Score = 257, Expect = 4.1e-21, Identities = 57/136 (41%), Positives = 93/136 (68%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P +IT FKDKSF F +KT P  + L +AA IK G+     + VA+++ ++   IA+ K+VD NA +  + ++M+AG+A+ MG+ ++G  P
  S:     5 VSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKQGKVLPVVITVFKDKSFDFVVKTPPAAVQLLEAAKIKKGSGEPNRKKVASVTWDQIKVIAEDKMVDLNAFEVTSAMKMIAGTARSMGLTVKGNAP 144
>gi|2829479|sp|P56210|RL11_BACST 50S ribosomal protein L11 >gi|1008575|gb|AAB34618.1| L11hs=heat-stable ribosomal protein [Bacillus stearothermophilus, Peptide, 133 aa] (133 aa)
Score = 257, Expect = 4.3e-21, Identities = 60/127 (47%), Positives = 82/127 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP  IT F+D+SFTF  KT P  +LLKKAA I+ G+       VATI R+K  EIA+ K+ D NA   EA +RM+ G+A+ MGI +E
  S:     2 KLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNARTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVE 132
>gi|34540217|ref|NP_904696.1| 50S ribosomal protein L11 [Porphyromonas gingivalis W83] >gi|188995439|ref|YP_001929691.1| 50S ribosomal protein L11 [Porphyromonas gingivalis ATCC 33277] >gi|50403581|sp|Q7MX31|RL11_PORGI 50S ribosomal protein L11 >gi|34396529|gb|AAQ65595.1| ribosomal protein L11 [Porphyromonas gingivalis W83] >gi|188595119|dbj|BAG34094.1| 50S ribosomal protein L11 [Porphyromonas gingivalis ATCC 33277] (145 aa)
Score = 256, Expect = 4.6e-21, Identities = 62/131 (47%), Positives = 87/131 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           K+ + GG A P    GP L + GIN+ EF KQFN +T+DK G+V+P +IT + DKSF F +KT PV + L +A+  K G+     + VA I+ E+   IA+ KLVD N  D +A ++MVAG+A+ MGI I+G  P
  S:    10 KLQIKGGAANPSPPVGPALGAKGINIMEFCKQFNARTQDKAGKVLPVVITYYADKSFDFIVKTPPVAIQLLEASKQKSGSAEPNRKKVAEITWEQVRTIAEDKLVDLNCFDIKAAMKMVAGTARSMGIAIKGDFP 144
>gi|17987028|ref|NP_539662.1| 50S ribosomal protein L11 [Brucella melitensis 16M] >gi|23502125|ref|NP_698252.1| 50S ribosomal protein L11 [Brucella suis 1330] >gi|62290158|ref|YP_221951.1| 50S ribosomal protein L11 [Brucella abortus bv. 1 str. 9-941] >gi|82700080|ref|YP_414654.1| 50S ribosomal protein L11 [Brucella melitensis biovar Abortus 2308] >gi|161619203|ref|YP_001593090.1| 50S ribosomal protein L11 [Brucella canis ATCC 23365] >gi|163843512|ref|YP_001627916.1| 50S ribosomal protein L11 [Brucella suis ATCC 23445] >gi|189024394|ref|YP_001935162.1| Ribosomal protein L11 [Brucella abortus S19] >gi|189040946|sp|A9M5R4|RL11_BRUC2 50S ribosomal protein L11 >gi|189040947|sp|B0CH45|RL11_BRUSI 50S ribosomal protein L11 >gi|38605326|sp|Q8G065|RL11_BRUSU 50S ribosomal protein L11 >gi|38605402|sp|Q8YHQ1|RL11_BRUME 50S ribosomal protein L11 >gi|75505259|sp|Q57CP4|RL11_BRUAB 50S ribosomal protein L11 >gi|118597139|sp|Q2YM11|RL11_BRUA2 50S ribosomal protein L11 >gi|17982682|gb|AAL51926.1| LSU ribosomal protein L11P [Brucella melitensis 16M] >gi|23348087|gb|AAN30167.1| ribosomal protein L11 [Brucella suis 1330] >gi|62196290|gb|AAX74590.1| RplK, ribosomal protein L11 [Brucella abortus biovar 1 str. 9-941] >gi|82616181|emb|CAJ11224.1| Ribosomal protein L11:Ribosomal protein L11, bacterial [Brucella melitensis biovar Abortus 2308] >gi|161336014|gb|ABX62319.1| ribosomal protein L11 [Brucella canis ATCC 23365] >gi|163674235|gb|ABY38346.1| ribosomal protein L11 [Brucella suis ATCC 23445] >gi|189019966|gb|ACD72688.1| Ribosomal protein L11 [Brucella abortus S19] (142 aa)
Score = 256, Expect = 4.6e-21, Identities = 61/128 (47%), Positives = 85/128 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  +++ + G  IP +IT ++DKSFTF +KT PVT  LKKAAN+K G+K     +  TI+R+K   IA+ K+ D NA D EA +RM+ GSA+ MG+++ G
  S:    10 KLQVPAGAANPSPPIGPALGQRGINIMEFCKAFNAASQEMEKGSPIPVLITYYQDKSFTFVMKTPPVTYFLKKAANLKSGSKTPGKASAGTITRDKVRAIAEAKMKDLNAADVEAAMRMIEGSARSMGLEVVG 142
>gi|49089016|gb|AAT51632.1| PA4274 [synthetic construct] (144 aa)
Score = 256, Expect = 5.1e-21, Identities = 62/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  GQA P    GP L   G+N+ EF K FN +T+ +  G   P IIT + D+SFTFE K+TP  +LLKKAA I  G+    ++ V T++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAKTQGQEPGLPTPVIITVYSDRSFTFETKSTPAAVLLKKAAGITSGSARPNSQKVGTVTRAQLEEIAKTKQADLTAADLDAAVRTIAGSARSMGLNVEGV 143
>gi|16330011|ref|NP_440739.1| 50S ribosomal protein L11 [Synechocystis sp. PCC 6803] >gi|548743|sp|P36237|RL11_SYNY3 50S ribosomal protein L11 >gi|1075628|pir||C49316 ribosomal protein L11 - Synechocystis sp >gi|452792|emb|CAA51491.1| ribosomal protein L11 [Synechocystis sp. PCC 6803] >gi|1652498|dbj|BAA17419.1| 50S ribosomal protein L11 [Synechocystis sp. PCC 6803] (141 aa)
Score = 256, Expect = 5.1e-21, Identities = 56/132 (42%), Positives = 89/132 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T DK G +IP  I+ F+D+SFTF +KT P ++L++KAA ++ G+       VA+I+RE+  EIA+TKL D NAND +A + ++ G+A+ MGI +
  S:     4 KVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTADKPGMIIPVEISVFEDRSFTFILKTPPASVLIRKAAGVEKGSSEPNKNKVASITREQLREIAQTKLPDLNANDIDAAMNIIEGTARNMGITV 139
>gi|110639546|ref|YP_679755.1| 50S ribosomal protein L11 [Cytophaga hutchinsonii ATCC 33406] >gi|118597153|sp|Q11QA1|RL11_CYTH3 50S ribosomal protein L11 >gi|110282227|gb|ABG60413.1| LSU ribosomal protein L11P [Cytophaga hutchinsonii ATCC 33406] (147 aa)
Score = 256, Expect = 5.6e-21, Identities = 59/136 (43%), Positives = 87/136 (63%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           IT   K+ + GG A P    GP L S G+N+ EF KQFN +T+DK G ++P +IT + DKSF F +KT P  +LL +AA IK G+       V +++ ++   IA+TK+ D NA   E+ ++MVAG+A+ MG+ + G  P
  S:     5 ITGYVKLQIKGGAANPSPPVGPALGSKGLNIMEFCKQFNARTQDKPGVLLPVLITVYTDKSFDFVVKTPPAAILLAEAAKIKKGSAEPNRVKVGSVNWDQIRTIAETKMPDLNAFKIESAMKMVAGTARSMGLTVSGKAP 144
>gi|15599470|ref|NP_252964.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa PAO1] >gi|107103786|ref|ZP_01367704.1| hypothetical protein PaerPA_01004857 [Pseudomonas aeruginosa PACS2] >gi|116052309|ref|YP_788845.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa UCBPP-PA14] >gi|152988956|ref|YP_001346212.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa PA7] >gi|194548119|ref|YP_002083147.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa C3719] >gi|194553904|ref|YP_002088931.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa 2192] >gi|122261458|sp|Q02T91|RL11_PSEAB 50S ribosomal protein L11 >gi|166230914|sp|A6UZH7|RL11_PSEA7 50S ribosomal protein L11 >gi|38605477|sp|Q9HWC5|RL11_PSEAE 50S ribosomal protein L11 >gi|9950493|gb|AAG07662.1|AE004843_4 50S ribosomal protein L11 [Pseudomonas aeruginosa PAO1] >gi|115587530|gb|ABJ13545.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa UCBPP-PA14] >gi|126169065|gb|EAZ54576.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa C3719] >gi|126196297|gb|EAZ60360.1| 50S ribosomal protein L11 [Pseudomonas aeruginosa 2192] >gi|150964114|gb|ABR86139.1| ribosomal protein L11 [Pseudomonas aeruginosa PA7] (143 aa)
Score = 256, Expect = 5.6e-21, Identities = 62/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  GQA P    GP L   G+N+ EF K FN +T+ +  G   P IIT + D+SFTFE K+TP  +LLKKAA I  G+    ++ V T++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAKTQGQEPGLPTPVIITVYSDRSFTFETKSTPAAVLLKKAAGITSGSARPNSQKVGTVTRAQLEEIAKTKQADLTAADLDAAVRTIAGSARSMGLNVEGV 143
>gi|90417546|ref|ZP_01225467.1| ribosomal protein L11 [marine gamma proteobacterium HTCC2207] >gi|90330638|gb|EAS45928.1| ribosomal protein L11 [marine gamma proteobacterium HTCC2207] (143 aa)
Score = 256, Expect = 5.8e-21, Identities = 61/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           ++T   K+ +  GQA P    GP L   G+N+ EF K FN QT+  + G  +P +IT + D+SFTFE+KT P + LLKKAA IK G+    T+ V  ++R +  EI KTK  D  A   +A +R +AGSA+ MG++ EGV
  S:     4 KVTAYIKLQVPAGQANPSPPVGPALGQHGVNIMEFCKGFNAQTQGIEQGAPVPVVITVYADRSFTFEMKTPPASFLLKKAAGIKSGSGRPNTDKVGKVTRAQLEEIVKTKEPDLTAASLDAAVRTIAGSARSMGLETEGV 143
>gi|91774624|ref|YP_544380.1| 50S ribosomal protein L11P [Methylobacillus flagellatus KT] >gi|118597257|sp|Q1H4P8|RL11_METFK 50S ribosomal protein L11 >gi|91708611|gb|ABE48539.1| LSU ribosomal protein L11P [Methylobacillus flagellatus KT] (143 aa)
Score = 255, Expect = 6.0e-21, Identities = 65/129 (50%), Positives = 86/129 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           K+ +  G+A P    GP L   G+N+ EF K FN  T+  + G  IP +ITAF DKSFTF +KT P T+L+KKAA I  G+    T+ V  I+R +A EIAKTK  D  A D +A +R +AGSA+ MGI++EGV
  S:    10 KLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQSMEPGLPIPVVITAFADKSFTFVMKTPPATILIKKAAKIDKGSPRPHTDKVGKITRAQAEEIAKTKAPDLTAADLDAAVRTIAGSARSMGIEVEGV 143
>gi|548741|sp|P36254|RL11_STACA 50S ribosomal protein L11 >gi|581638|emb|CAA53739.1| L11 protein [Staphylococcus carnosus] (140 aa)
Score = 255, Expect = 6.2e-21, Identities = 55/133 (41%), Positives = 91/133 (68%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T+++ G +IP  I+ ++D+SFTF  KT P  +LLKKAA ++ G+       VAT+++++  EIA+TK+ D NA DEEA +R++ G+A+ MGI +E
  S:     4 KVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGVEKGSGEPNKNKVATVTKDQVREIAQTKMPDLNAADEEAAMRIIEGTARSMGITVE 140
>gi|15923527|ref|NP_371061.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926215|ref|NP_373748.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus N315] >gi|21282221|ref|NP_645309.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus MW2] >gi|49482767|ref|YP_039991.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485402|ref|YP_042623.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus MSSA476] >gi|87161133|ref|YP_493225.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus USA300] >gi|88194299|ref|YP_499091.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266997|ref|YP_001245940.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus JH9] >gi|150393044|ref|YP_001315719.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus JH1] >gi|156978866|ref|YP_001441125.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus Mu3] >gi|161508777|ref|YP_001574436.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166230934|sp|A7WYW0|RL11_STAA1 50S ribosomal protein L11 >gi|189040983|sp|A6TZ14|RL11_STAA2 50S ribosomal protein L11 >gi|189040984|sp|A5IQ91|RL11_STAA9 50S ribosomal protein L11 >gi|189040985|sp|A8YZN5|RL11_STAAT 50S ribosomal protein L11 >gi|56404783|sp|Q6GBV0|RL11_STAAS 50S ribosomal protein L11 >gi|56404786|sp|Q6GJD1|RL11_STAAR 50S ribosomal protein L11 >gi|60393640|sp|P0A0F1|RL11_STAAM 50S ribosomal protein L11 >gi|60393641|sp|P0A0F2|RL11_STAAN 50S ribosomal protein L11 >gi|60393642|sp|P0A0F3|RL11_STAAW 50S ribosomal protein L11 >gi|60393643|sp|P0A0F4|RL11_STAA8 50S ribosomal protein L11 >gi|118597299|sp|Q2FJA3|RL11_STAA3 50S ribosomal protein L11 >gi|2078378|gb|AAB54019.1| RplK; ribosomal protein L11 [Staphylococcus aureus] >gi|13700428|dbj|BAB41726.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus N315] >gi|14246305|dbj|BAB56699.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus Mu50] >gi|21203657|dbj|BAB94357.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus MW2] >gi|49240896|emb|CAG39563.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243845|emb|CAG42270.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus MSSA476] >gi|87127107|gb|ABD21621.1| ribosomal protein L11 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201857|gb|ABD29667.1| ribosomal protein L11 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740066|gb|ABQ48364.1| LSU ribosomal protein L11P [Staphylococcus aureus subsp. aureus JH9] >gi|149945496|gb|ABR51432.1| ribosomal protein L11 [Staphylococcus aureus subsp. aureus JH1] >gi|156721001|dbj|BAF77418.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus Mu3] >gi|160367586|gb|ABX28557.1| ribosomal protein L11 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (140 aa)
Score = 255, Expect = 6.4e-21, Identities = 56/133 (42%), Positives = 90/133 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T+D+ G +IP  I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+++++  EIA +K+ D NA DEEA +R++ G+A+ MGI +E
  S:     4 KVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLNAADEEAAMRIIEGTARSMGIVVE 140
>gi|82750245|ref|YP_415986.1| 50S ribosomal protein L11 [Staphylococcus aureus RF122] >gi|118597300|sp|Q2YSC4|RL11_STAAB 50S ribosomal protein L11 >gi|82655776|emb|CAI80176.1| 50S ribosomal protein L11 [Staphylococcus aureus RF122] (140 aa)
Score = 255, Expect = 6.5e-21, Identities = 56/133 (42%), Positives = 90/133 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T+D+ G +IP  I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+++++  EIA +K+ D NA DEEA +R++ G+A+ MGI +E
  S:     4 KVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKAKVATVTKDQVREIANSKMQDLNAADEEAAMRIIEGTARSMGIVVE 140
>gi|33594733|ref|NP_882376.1| 50S ribosomal protein L11 [Bordetella parapertussis 12822] >gi|33599003|ref|NP_886563.1| 50S ribosomal protein L11 [Bordetella bronchiseptica RB50] >gi|38605193|sp|Q7W2H3|RL11_BORPA 50S ribosomal protein L11 >gi|38605198|sp|Q7WRE3|RL11_BORBR 50S ribosomal protein L11 >gi|33564809|emb|CAE39751.1| 50S ribosomal protein L11 [Bordetella parapertussis] >gi|33575049|emb|CAE30512.1| 50S ribosomal protein L11 [Bordetella bronchiseptica RB50] (143 aa)
Score = 255, Expect = 7.3e-21, Identities = 64/135 (47%), Positives = 90/135 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN +T+  + G  IP +ITAF DKSFTF +KT P T+L+KKA+ ++ G+    T+ V T++R +A EIAKTK  D  A D +A +R +AGSA+ MGI +EGV
  S:     4 KIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGMEPGLPIPVVITAFADKSFTFIMKTPPATVLIKKASGVQKGSAKPHTDKVGTLTRAQAEEIAKTKQPDLTAADLDAAVRTIAGSARSMGITVEGV 143
>gi|90962214|ref|YP_536130.1| 50S ribosomal protein L11 [Lactobacillus salivarius UCC118] >gi|118597251|sp|Q1WST2|RL11_LACS1 50S ribosomal protein L11 >gi|90821408|gb|ABE00047.1| LSU ribosomal protein L11P [Lactobacillus salivarius UCC118] (141 aa)
Score = 255, Expect = 7.6e-21, Identities = 56/132 (42%), Positives = 88/132 (66%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +  + K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++D+SF F  KT P  +LLKKAA ++ G+     + VAT+++++  EIA+TK+ D NA D EA +RM+ G+A+ MG  +E
  S:     5 VVNVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDRSFDFVTKTPPAAVLLKKAAGVEKGSGEPNMKKVATVTKDQVKEIAETKMQDLNAADVEAAMRMIEGTARSMGFVVE 140
>gi|94984749|ref|YP_604113.1| 50S ribosomal protein L11 [Deinococcus geothermalis DSM 11300] >gi|118597157|sp|Q1J0P0|RL11_DEIGD 50S ribosomal protein L11 >gi|94555030|gb|ABF44944.1| ribosomal protein L11 [Deinococcus geothermalis DSM 11300] (144 aa)
Score = 254, Expect = 7.8e-21, Identities = 59/134 (44%), Positives = 83/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  + K+ L  G+A P    GP L   G N+ EFTK FN QT DK   +IP  IT + D+SFTF  KT P++ L++KAA ++ G+       V  ++ E+ LEIA+TK+ D NA   EA    VAG+A+ MG+ IEG
  S:     3 KVAGLVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGLQKGSATPNKAKVGKLNWEQVLEIARTKMPDLNAGSVEAAANTVAGTARSMGVTIEG 140
>gi|83816068|ref|YP_445880.1| ribosomal protein L11, putative [Salinibacter ruber DSM 13855] >gi|83757462|gb|ABC45575.1| ribosomal protein L11, putative [Salinibacter ruber DSM 13855] (198 aa)
Score = 254, Expect = 9.1e-21, Identities = 54/133 (40%), Positives = 84/133 (63%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           + +  K+ + GGQA P    GP L   G+N+ EF K FN +T+D+ G ++P  IT + D+SF F +K+ P ++LLK+ A+I+  A +   +   T++ +  L+IA  KL D NA+  E    MVAG+A+ MGI +EG
  S:    57 VEQTIKLQIKGGQANPAPPIGPALGQHGVNIMEFCKAFNSRTEDRMGTLLPVEITVYADRSFDFIVKSPPASVLLKQKADIETAAGDPLRDDAGTVTWDDCLDIADQKLQDLNAHTVEKGASMVAGTARSMGITVEG 193
>gi|99080070|ref|YP_612224.1| 50S ribosomal protein L11 [Silicibacter sp. TM1040] >gi|118597296|sp|Q1GK54|RL11_SILST 50S ribosomal protein L11 >gi|99036350|gb|ABF62962.1| LSU ribosomal protein L11P [Silicibacter sp. TM1040] (141 aa)
Score = 253, Expect = 1.1e-20, Identities = 61/127 (48%), Positives = 84/127 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T D + G   P +IT ++DKSFT +IKT P +  LKKAA IK GA N   ET  T++  +  EIA+ K+ D NAND EA ++++ GSA+ MGI+++
  S:    10 KLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTADMEPGAPCPTVITYYQDKSFTMDIKTPPASYYLKKAAKIKSGANNPSRETAGTVTAAQVKEIAEAKMKDLNANDIEAAMQIILGSARSMGIEVK 141
>gi|118597301|sp|Q5HID8|RL11_STAAC 50S ribosomal protein L11 >gi|13183704|gb|AAK15311.1|AF327733_8 RplK [Staphylococcus aureus] (140 aa)
Score = 253, Expect = 1.1e-20, Identities = 56/133 (42%), Positives = 89/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T+D+ G +IP  I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+++ +  EIA +K+ D NA DEEA +R++ G+A+ MGI +E
  S:     4 KVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKNQVREIANSKMQDLNAADEEAAMRIIEGTARSMGIVVE 140
>gi|15674579|ref|NP_268753.1| 50S ribosomal protein L11 [Streptococcus pyogenes M1 GAS] >gi|19745586|ref|NP_606722.1| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS8232] >gi|21909860|ref|NP_664128.1| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS315] >gi|28896445|ref|NP_802795.1| 50S ribosomal protein L11 [Streptococcus pyogenes SSI-1] >gi|71910187|ref|YP_281737.1| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS5005] >gi|139474300|ref|YP_001129016.1| 50S ribosomal protein L11 [Streptococcus pyogenes str. Manfredo] >gi|161761321|ref|YP_059719.2| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS10394] >gi|162139089|ref|YP_596109.2| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS9429] >gi|162139113|ref|YP_597987.2| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS10270] >gi|162139137|ref|YP_599991.2| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS2096] >gi|162139190|ref|YP_601870.2| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS10750] >gi|162139411|ref|YP_279832.2| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS6180] >gi|166230935|sp|A2RG33|RL11_STRPG 50S ribosomal protein L11 >gi|54039088|sp|P66059|RL11_STRP8 50S ribosomal protein L11 >gi|54039089|sp|P66060|RL11_STRP3 50S ribosomal protein L11 >gi|54041818|sp|P66058|RL11_STRP1 50S ribosomal protein L11 >gi|61214790|sp|Q5XDH7|RL11_STRP6 50S ribosomal protein L11 >gi|118597302|sp|Q1JD61|RL11_STRPB 50S ribosomal protein L11 >gi|118597303|sp|Q1JN34|RL11_STRPC 50S ribosomal protein L11 >gi|118597304|sp|Q1JI80|RL11_STRPD 50S ribosomal protein L11 >gi|118597305|sp|Q1J835|RL11_STRPF 50S ribosomal protein L11 >gi|118597306|sp|Q48UX9|RL11_STRPM 50S ribosomal protein L11 >gi|13621688|gb|AAK33474.1| 50S ribosomal protein L11 [Streptococcus pyogenes M1 GAS] >gi|19747711|gb|AAL97221.1| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS8232] >gi|21904047|gb|AAM78931.1| 50S ribosomal protein L11 [Streptococcus pyogenes MGAS315] >gi|28811696|dbj|BAC64628.1| 50S ribosomal protein L11 [Streptococcus pyogenes SSI-1] >gi|71852969|gb|AAZ50992.1| LSU ribosomal protein L11P [Streptococcus pyogenes MGAS5005] >gi|134272547|emb|CAM30812.1| 50S ribosomal protein L11 [Streptococcus pyogenes str. Manfredo] (141 aa)
Score = 253, Expect = 1.1e-20, Identities = 57/132 (43%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+    T  VAT++R +  EIA+TK+ D NA + EA +RM+ G+A+ MG  +
  S:     4 KVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNTTKVATVTRAQVQEIAETKMPDLNAANIEAAMRMIEGTARSMGFTV 139
>gi|114319608|ref|YP_741291.1| 50S ribosomal protein L11P [Alkalilimnicola ehrlichei MLHE-1] >gi|122312465|sp|Q0ABI6|RL11_ALHEH 50S ribosomal protein L11 >gi|114226002|gb|ABI55801.1| LSU ribosomal protein L11P [Alkalilimnicola ehrlichei MLHE-1] (143 aa)
Score = 253, Expect = 1.2e-20, Identities = 59/135 (43%), Positives = 90/135 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +++   K+ +  G+A P    GP L   G+N+ EF K FN QT++ + G  +P +IT + D+SFTF  KT P  +LL+KAA I+ G+    T+ V T++RE+  EIAKTK  D NA D +A +R +AG+A+ MG+ +EG+
  S:     4 KVSAYIKLQVGAGKANPSPPVGPALGQHGVNIMEFCKAFNAQTQEMEAGLPVPVVITVYNDRSFTFITKTPPAAVLLRKAAGIQKGSGEPNTKKVGTVTREQLEEIAKTKEPDLNAADLDAAVRSIAGTARSMGLDVEGL 143
>gi|86131813|ref|ZP_01050410.1| 50S ribosomal protein L11 [Cellulophaga sp. MED134] >gi|85817635|gb|EAQ38809.1| 50S ribosomal protein L11 [Dokdonia donghaensis MED134] (146 aa)
Score = 253, Expect = 1.2e-20, Identities = 58/135 (42%), Positives = 90/135 (66%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P  IT +KDKSF F IKT P  + L +AA +K G+     + VA ++ ++   IA+ K+ D NA   E+ ++MVAG+A+ MGI ++G D
  S:     5 VSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKAGKVLPVAITVYKDKSFDFVIKTPPAAVQLLEAAKVKSGSGEPNRKKVAKVTWDQVRAIAEDKMPDLNAFTVESAMKMVAGTARSMGITVKGGD 143
>gi|78484629|ref|YP_390554.1| ribosomal protein L11 [Thiomicrospira crunogena XCL-2] >gi|118597355|sp|Q31IZ3|RL11_THICR 50S ribosomal protein L11 >gi|78362915|gb|ABB40880.1| LSU ribosomal protein L11P [Thiomicrospira crunogena XCL-2] (142 aa)
Score = 253, Expect = 1.3e-20, Identities = 59/134 (44%), Positives = 86/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  G A P    GP L   G+N+ EF K FN QT+     + +P +IT F D+SFTF  KT P ++LLKKAA I+ G+     + V T++R +  EIA TK+ D NAND +A ++++AGSA+ MG+ +EG
  S:     4 KIEAYIKLQVPAGNANPSPPVGPALGQHGVNIMEFCKAFNAQTQSMEKNLPVPVVITVFNDRSFTFITKTPPASVLLKKAAGIQKGSGVPNMDKVGTVTRAQLEEIANTKMADLNANDLDAAVKIIAGSARSMGLNVEG 142
>gi|77461311|ref|YP_350818.1| 50S ribosomal protein L11 [Pseudomonas fluorescens PfO-1] >gi|119364580|sp|Q3K5X7|RL11_PSEPF 50S ribosomal protein L11 >gi|77385314|gb|ABA76827.1| LSU ribosomal protein L11P [Pseudomonas fluorescens PfO-1] (143 aa)
Score = 252, Expect = 1.4e-20, Identities = 62/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +IT   K+ +   QA P    GP L   G+N+ EF K FN +T+  + G   P IIT + D+SFTFE K+TP ++LLKKAA +  G+    T  V T++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGLEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRAQLEEIAKTKNADLTAADMDAAVRTIAGSARSMGLNVEGV 143
>gi|70734365|ref|YP_262661.1| 50S ribosomal protein L11 [Pseudomonas fluorescens Pf-5] >gi|118597276|sp|Q4K522|RL11_PSEF5 50S ribosomal protein L11 >gi|68348664|gb|AAY96270.1| ribosomal protein L11 [Pseudomonas fluorescens Pf-5] (143 aa)
Score = 252, Expect = 1.4e-20, Identities = 62/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +IT   K+ +   QA P    GP L   G+N+ EF K FN +T+  + G   P IIT + D+SFTFE K+TP ++LLKKAA +  G+    T  V T++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGLEPGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRAQLEEIAKTKNADLTAADMDAAVRTIAGSARSMGLNVEGV 143
>gi|89893201|ref|YP_516688.1| 50S ribosomal protein L11 [Desulfitobacterium hafniense Y51] >gi|109647485|ref|ZP_01371388.1| ribosomal protein L11 [Desulfitobacterium hafniense DCB-2] >gi|118597159|sp|Q250P8|RL11_DESHY 50S ribosomal protein L11 >gi|89332649|dbj|BAE82244.1| 50S ribosomal protein L11 [Desulfitobacterium hafniense Y51] >gi|109640575|gb|EAT50130.1| ribosomal protein L11 [Desulfitobacterium hafniense DCB-2] (142 aa)
Score = 252, Expect = 1.5e-20, Identities = 59/132 (44%), Positives = 87/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+  F K++N++TKD+ G +IP  IT ++D+SFTF  KT P ++LLKKAANI  G+     + VA +S+ K  EIA+TK+ D NA   EA + MV G+A+ MGI I
  S:     4 KVVGLVKLAINAGKANPAPPVGPALGQHGVNIMAFCKEYNERTKDQAGLIIPVEITVYEDRSFTFITKTPPASILLKKAANINSGSSEPNRKKVAQVSKTKVREIAETKMKDLNAASVEAAMSMVEGTARSMGITI 139
>gi|88713026|ref|ZP_01107110.1| 50S ribosomal protein L11 [Flavobacteriales bacterium HTCC2170] >gi|88708407|gb|EAR00643.1| 50S ribosomal protein L11 [Flavobacteriales bacterium HTCC2170] (145 aa)
Score = 252, Expect = 1.5e-20, Identities = 57/136 (41%), Positives = 89/136 (65%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           + ++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P +IT +KDKSF F +KT P  + L +AA IK G+       + +++ ++   IA+ K+VD NA   E+ + MVAG+A+ MG+K+ G  P
  S:     5 VGKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKPGKVLPVVITVYKDKSFDFIVKTPPAAVQLLEAAKIKKGSGEPNRVKLGSVTWDQIKAIAEDKMVDLNAFTVESAMSMVAGTARSMGMKVAGKRP 144
>gi|86137181|ref|ZP_01055759.1| ribosomal protein L11 [Roseobacter sp. MED193] >gi|85826505|gb|EAQ46702.1| ribosomal protein L11 [Roseobacter sp. MED193] (141 aa)
Score = 252, Expect = 1.5e-20, Identities = 61/127 (48%), Positives = 85/127 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T D + G   P +IT ++DKSFT +IKT P +  LKKAA +K GAK    ETV T++  +  EIA+ K+ D NAND EA ++++ GSA+ MGI+++
  S:    10 KLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTADMEPGAPCPTVITYYQDKSFTMDIKTPPASYYLKKAAKVKSGAKTPSRETVGTVTAAQVKEIAEAKMKDLNANDIEAAMKIILGSARSMGIEVK 141
>gi|33591284|ref|NP_878928.1| 50S ribosomal protein L11 [Bordetella pertussis Tohama I] >gi|38605192|sp|Q7W0S3|RL11_BORPE 50S ribosomal protein L11 >gi|33570926|emb|CAE40390.1| 50S ribosomal protein L11 [Bordetella pertussis Tohama I] (143 aa)
Score = 252, Expect = 1.6e-20, Identities = 63/134 (47%), Positives = 88/134 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  G+A P    GP L   G+N+ EF K FN +T+    G  IP +ITAF DKSFTF +KT P T+L+KKA+ ++ G+    T+ V T++R +A EIAKTK  D  A D +A +R +AGSA+ MGI +EG
  S:     4 KIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGMELGLPIPVVITAFADKSFTFIMKTPPATVLIKKASGVQKGSAKPHTDKVGTLTRAQAEEIAKTKQPDLTAADLDAAVRTIAGSARSMGITVEG 142
>gi|34811560|pdb|1PNU|G Chain G, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. >gi|34811613|pdb|1PNY|G Chain G, Crystal Structure Of The Wild Type Ribosome From E. Coli, 50s Subunit Of 70s Ribosome. This File, 1pny, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit Is In The Pdb File 1pnx. >gi|56966352|pdb|1VOR|J Chain J, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966405|pdb|1VOU|J Chain J, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966458|pdb|1VOW|J Chain J, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966511|pdb|1VOY|J Chain J, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966564|pdb|1VP0|J Chain J, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. (143 aa)
Score = 252, Expect = 1.6e-20, Identities = 60/134 (44%), Positives = 82/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  I K+ L  G+A P    GP L   G N+ EFTK FN QT DK   +IP  IT + D+SFTF  KT P++ L++KAA I  G+       V  ++ ++ LEIAKTK+ D NA   EA    VAG+A+ MG+ +EG
  S:     3 KVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEG 140
>gi|59802176|ref|YP_208888.1| 50S ribosomal protein L11 [Neisseria gonorrhoeae FA 1090] >gi|194099904|ref|YP_002003041.1| 50S ribosomal protein L11 [Neisseria gonorrhoeae NCCP11945] >gi|75507294|sp|Q5F5R1|RL11_NEIG1 50S ribosomal protein L11 >gi|59719071|gb|AAW90476.1| putative 50S ribosomal protein L11 [Neisseria gonorrhoeae FA 1090] >gi|193935194|gb|ACF31018.1| 50S ribosomal protein L11 [Neisseria gonorrhoeae NCCP11945] (144 aa)
Score = 252, Expect = 1.6e-20, Identities = 63/135 (46%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN  T+  ++G  IP +ITAF DKSFTF +KT P ++LLKKAA ++ G+ N  T  V  ++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGMESGLPIPVVITAFADKSFTFVMKTPPASILLKKAAGLQKGSSNPLTNKVGKLTRAQLEEIAKTKEPDLTAADLDAAVRTIAGSARSMGLDVEGV 143
>gi|38492991|pdb|1R2W|A Chain A, Coordinates Of L11 With 58nts Of 23s Rrna Fitted Into The Cryo-Em Map Of The 70s Ribosome >gi|38492993|pdb|1R2X|A Chain A, Coordinates Of L11 With 58nts Of 23s Rrna Fitted Into The Cryo-Em Map Of Ef-Tu Ternary Complex (Gdp.Kirromycin) Bound 70s Ribosome (141 aa)
Score = 251, Expect = 1.7e-20, Identities = 61/126 (48%), Positives = 88/126 (69%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTT-PVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT  P + LLKKAA I+ G+   K + V  ++R++  EIAKTK+ D NAN  EA ++++ G+AK MGI++
  S:     9 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTEPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEV 139
>gi|15807040|ref|NP_295769.1| 50S ribosomal protein L11 [Deinococcus radiodurans R1] >gi|38605509|sp|Q9RSS7|RL11_DEIRA 50S ribosomal protein L11 >gi|28948926|pdb|1NKW|G Chain G, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans >gi|29726794|pdb|1NWX|G Chain G, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 >gi|29726825|pdb|1NWY|G Chain G, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Azithromycin >gi|51247379|pdb|1SM1|G Chain G, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Quinupristin And Dalfopristin >gi|61680342|pdb|1XBP|G Chain G, Inhibition Of Peptide Bond Formation By Pleuromutilins: The Structure Of The 50s Ribosomal Subunit From Deinococcus Radiodurans In Complex With Tiamulin >gi|190613495|pdb|2ZJP|F Chain F, Thiopeptide Antibiotic Nosiheptide Bound To The Large Ribosomal Subunit Of Deinococcus Radiodurans >gi|190613525|pdb|2ZJQ|F Chain F, Interaction Of L7 With L11 Induced By Microccocin Binding To The Deinococcus Radiodurans 50s Subunit >gi|190613556|pdb|2ZJR|F Chain F, Refined Native Structure Of The Large Ribosomal Subunit (50s) From Deinococcus Radiodurans >gi|190613663|pdb|3CF5|F Chain F, Thiopeptide Antibiotic Thiostrepton Bound To The Large Ribosomal Subunit Of Deinococcus Radiodurans >gi|6459834|gb|AAF11593.1|AE002040_10 ribosomal protein L11 [Deinococcus radiodurans R1] (144 aa)
Score = 251, Expect = 1.7e-20, Identities = 60/134 (44%), Positives = 82/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  I K+ L  G+A P    GP L   G N+ EFTK FN QT DK   +IP  IT + D+SFTF  KT P++ L++KAA I  G+       V  ++ ++ LEIAKTK+ D NA   EA    VAG+A+ MG+ +EG
  S:     3 KVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEG 140
>gi|81097391|ref|ZP_00875678.1| Ribosomal protein L11, bacterial [Streptococcus suis 89/1591] >gi|146321195|ref|YP_001200906.1| 50S ribosomal protein L11 [Streptococcus suis 98HAH33] >gi|166230936|sp|A4W2B7|RL11_STRS2 50S ribosomal protein L11 >gi|80976555|gb|EAP40151.1| Ribosomal protein L11, bacterial [Streptococcus suis 89/1591] >gi|145692001|gb|ABP92506.1| Ribosomal protein L11 [Streptococcus suis 98HAH33] (141 aa)
Score = 251, Expect = 2.0e-20, Identities = 57/132 (43%), Positives = 87/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSFTF  KT P  +LLKKAA ++ G+       VAT++R +  EIA+TK+ D NA   EA +RM+ G+A+ MG  +
  S:     4 KVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFITKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQVQEIAETKMPDLNAASLEAAMRMIEGTARSMGFTV 139
>gi|15900537|ref|NP_345141.1| 50S ribosomal protein L11 [Streptococcus pneumoniae TIGR4] >gi|15902599|ref|NP_358149.1| 50S ribosomal protein L11 [Streptococcus pneumoniae R6] >gi|111656809|ref|ZP_01407666.1| hypothetical protein SpneT_02001921 [Streptococcus pneumoniae TIGR4] >gi|116515716|ref|YP_816051.1| 50S ribosomal protein L11 [Streptococcus pneumoniae D39] >gi|148984012|ref|ZP_01817331.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP3-BS71] >gi|148988997|ref|ZP_01820397.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP6-BS73] >gi|148992261|ref|ZP_01821984.1| ribosomal protein L11 [Streptococcus pneumoniae SP9-BS68] >gi|148998305|ref|ZP_01825774.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP11-BS70] >gi|149010750|ref|ZP_01832121.1| ribosomal protein L11 [Streptococcus pneumoniae SP19-BS75] >gi|149021591|ref|ZP_01835646.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP23-BS72] >gi|168482863|ref|ZP_02707815.1| ribosomal protein L11 [Streptococcus pneumoniae CDC1873-00] >gi|168485742|ref|ZP_02710250.1| ribosomal protein L11 [Streptococcus pneumoniae CDC1087-00] >gi|168488315|ref|ZP_02712514.1| ribosomal protein L11 [Streptococcus pneumoniae SP195] >gi|168492293|ref|ZP_02716436.1| ribosomal protein L11 [Streptococcus pneumoniae CDC0288-04] >gi|168492791|ref|ZP_02716934.1| ribosomal protein L11 [Streptococcus pneumoniae CDC3059-06] >gi|168576469|ref|ZP_02722343.1| ribosomal protein L11 [Streptococcus pneumoniae MLV-016] >gi|182683561|ref|YP_001835308.1| 50S ribosomal protein L11 [Streptococcus pneumoniae CGSP14] >gi|194398635|ref|YP_002037289.1| 50S ribosomal protein L11 [Streptococcus pneumoniae G54] >gi|122279063|sp|Q04LP7|RL11_STRP2 50S ribosomal protein L11 >gi|38605289|sp|Q8CWS9|RL11_STRR6 50S ribosomal protein L11 >gi|38605433|sp|Q97RZ6|RL11_STRPN 50S ribosomal protein L11 >gi|14972106|gb|AAK74781.1| ribosomal protein L11 [Streptococcus pneumoniae TIGR4] >gi|15458132|gb|AAK99359.1| 50S Ribosomal protein L11 [Streptococcus pneumoniae R6] >gi|116076292|gb|ABJ54012.1| ribosomal protein L11 [Streptococcus pneumoniae D39] >gi|147755948|gb|EDK62992.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP11-BS70] >gi|147765231|gb|EDK72160.1| ribosomal protein L11 [Streptococcus pneumoniae SP19-BS75] >gi|147924159|gb|EDK75271.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP3-BS71] >gi|147925494|gb|EDK76571.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP6-BS73] >gi|147928887|gb|EDK79899.1| ribosomal protein L11 [Streptococcus pneumoniae SP9-BS68] >gi|147930287|gb|EDK81272.1| 50S ribosomal protein L11 [Streptococcus pneumoniae SP23-BS72] >gi|172043610|gb|EDT51656.1| ribosomal protein L11 [Streptococcus pneumoniae CDC1873-00] >gi|182628895|gb|ACB89843.1| 50S ribosomal protein L11 [Streptococcus pneumoniae CGSP14] >gi|183571231|gb|EDT91759.1| ribosomal protein L11 [Streptococcus pneumoniae CDC1087-00] >gi|183572974|gb|EDT93502.1| ribosomal protein L11 [Streptococcus pneumoniae SP195] >gi|183573537|gb|EDT94065.1| ribosomal protein L11 [Streptococcus pneumoniae CDC0288-04] >gi|183577144|gb|EDT97672.1| ribosomal protein L11 [Streptococcus pneumoniae CDC3059-06] >gi|183577763|gb|EDT98291.1| ribosomal protein L11 [Streptococcus pneumoniae MLV-016] >gi|194358302|gb|ACF56750.1| 50S ribosomal protein L11 [Streptococcus pneumoniae G54] (141 aa)
Score = 251, Expect = 2.0e-20, Identities = 56/132 (42%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSFTF  KT P  +LLKKAA ++ G+       VAT++R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     4 KVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQVQEIAETKMPDLNAANVESAMRMIEGTARSMGFTV 139
>gi|27467218|ref|NP_763855.1| 50S ribosomal protein L11 [Staphylococcus epidermidis ATCC 12228] >gi|57866122|ref|YP_187774.1| 50S ribosomal protein L11 [Staphylococcus epidermidis RP62A] >gi|70727471|ref|YP_254387.1| 50S ribosomal protein L11 [Staphylococcus haemolyticus JCSC1435] >gi|38605288|sp|Q8CTT5|RL11_STAES 50S ribosomal protein L11 >gi|81675389|sp|Q5HRL5|RL11_STAEQ 50S ribosomal protein L11 >gi|82581572|sp|Q4L3J6|RL11_STAHJ 50S ribosomal protein L11 >gi|27314760|gb|AAO03897.1|AE016744_300 50S ribosomal protein L11 [Staphylococcus epidermidis ATCC 12228] >gi|57636780|gb|AAW53568.1| ribosomal protein L11 [Staphylococcus epidermidis RP62A] >gi|68448197|dbj|BAE05781.1| 50S RIBOSOMAL PROTEIN L11 [Staphylococcus haemolyticus JCSC1435] (140 aa)
Score = 251, Expect = 2.0e-20, Identities = 54/133 (40%), Positives = 91/133 (68%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T+++ G +IP  I+ ++D+SFTF  KT P  +LLKKAA ++ G+       VAT+++++  EIA+TK+ D NA DEEA +R++ G+A+ MGI ++
  S:     4 KVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGVEKGSGEPNKTKVATVTKDQVREIAQTKMQDLNAADEEAAMRIIEGTARSMGITVQ 140
>gi|54114553|gb|AAV29910.1| NT02FT0275 [synthetic construct] (144 aa)
Score = 251, Expect = 2.1e-20, Identities = 61/135 (45%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I  I K+ +  G+A P    GP L   G+N+  F K+FN +T+  + G  IP  I+ + D+SFTFE+KT P + L+KKA N+K G+     E V TI+R +  EIAK K  D  A D +A +R++AGSA+ MG+K+EGV
  S:     5 KIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFVGTITRAQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV 144
>gi|83949811|ref|ZP_00958544.1| ribosomal protein L11 [Roseovarius nubinhibens ISM] >gi|83837710|gb|EAP77006.1| ribosomal protein L11 [Roseovarius nubinhibens ISM] (141 aa)
Score = 251, Expect = 2.2e-20, Identities = 60/127 (47%), Positives = 86/127 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T+D + G   P +IT ++DKSF  +IKT P +  L+KAA IK GAK    ETVA+++ ++  EIA+ K  D NAND EA ++++ GSA+ MGI+++
  S:    10 KLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQDMEPGAPCPTVITYYQDKSFEMDIKTPPASYYLRKAAKIKSGAKTPGRETVASVTAKQLREIAEAKWKDLNANDVEAAMKIIQGSARSMGIEVK 141
>gi|120553641|ref|YP_957992.1| ribosomal protein L11 [Marinobacter aquaeolei VT8] >gi|166230151|sp|A1TYI6|RL11_MARAV 50S ribosomal protein L11 >gi|120323490|gb|ABM17805.1| LSU ribosomal protein L11P [Marinobacter aquaeolei VT8] (143 aa)
Score = 251, Expect = 2.2e-20, Identities = 62/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  GQA P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+    T+ V T++R +  EIAKTK  D  A D EA +R +AG+A+ MG+ +EG+
  S:     4 KIEAYIKLQVAAGQANPSPPVGPALGQRGVNIMEFCKAFNAKTQGMEPGLPIPTVITVYSDRSFTFITKTPPAPVLLKKAAGIKSGSGRPNTDKVGTVTRAQLEEIAKTKEPDLTAADMEAAVRTIAGTARSMGLNVEGL 143
>gi|146299699|ref|YP_001194290.1| 50S ribosomal protein L11 [Flavobacterium johnsoniae UW101] >gi|189040959|sp|A5FIK2|RL11_FLAJO 50S ribosomal protein L11 >gi|146154117|gb|ABQ04971.1| LSU ribosomal protein L11P [Flavobacterium johnsoniae UW101] (145 aa)
Score = 250, Expect = 2.4e-20, Identities = 58/136 (42%), Positives = 87/136 (63%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           I+++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G++ P  IT +KDKSF F +KT P  + L +AA +K G+     + VA+++ E+   IA+ K+ D NA   E  + MVAG+A+ MGI + G  P
  S:     5 ISKVVKLQVKGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKPGKICPVQITVYKDKSFDFVVKTPPAAVQLMEAAKLKSGSGEPNRKKVASVTWEQIRTIAEDKMPDLNAFTIEKAMSMVAGTARSMGITVSGDAP 144
>gi|148543545|ref|YP_001270915.1| 50S ribosomal protein L11P [Lactobacillus reuteri F275] >gi|184152952|ref|YP_001841293.1| 50S ribosomal protein L11 [Lactobacillus reuteri F275] >gi|194468090|ref|ZP_03074076.1| ribosomal protein L11 [Lactobacillus reuteri 100-23] >gi|166982110|sp|A5VIA4|RL11_LACRF 50S ribosomal protein L11 >gi|148530579|gb|ABQ82578.1| LSU ribosomal protein L11P [Lactobacillus reuteri F275] >gi|183224296|dbj|BAG24813.1| 50S ribosomal protein L11 [Lactobacillus reuteri F275] >gi|194452943|gb|EDX41841.1| ribosomal protein L11 [Lactobacillus reuteri 100-23] (141 aa)
Score = 250, Expect = 2.4e-20, Identities = 53/116 (45%), Positives = 79/116 (68%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GP L   GIN+  FTK+FN +T D+ G +IP +IT ++D+SF F  KT P  +LLKKAA ++ G+    T  VA++++++  EIA+TK+ D NA D EA +RM+ G+A+ MG  +E
  S:    25 GPALGQAGINIMGFTKEFNARTADQKGMLIPVVITVYEDRSFDFITKTPPAAVLLKKAAGVEHGSGEPNTNKVASVTKDQVKEIAETKMQDLNAADVEAAMRMIEGTARSMGFTVE 140
>gi|56459452|ref|YP_154733.1| 50S ribosomal protein L11 [Idiomarina loihiensis L2TR] >gi|61214741|sp|Q5QWA9|RL11_IDILO 50S ribosomal protein L11 >gi|56178462|gb|AAV81184.1| Ribosomal protein L11 [Idiomarina loihiensis L2TR] (142 aa)
Score = 250, Expect = 2.4e-20, Identities = 62/134 (46%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +++ I K+ +  G A P    GP L   G+N+ EF K FN QT   + G  +P  IT F+D+SFTF  KT P + LLKKAA IK G+    T+ V T++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EG
  S:     4 KVSAIIKLQVAAGSANPSPPVGPALGQHGVNIMEFCKAFNAQTDSLEKGAPVPVEITVFEDRSFTFITKTPPASFLLKKAAGIKSGSGEPNTKKVGTVTRAQLEEIAKTKEPDLTAADMDAAVRTIAGSARAMGLNVEG 142
>gi|71736973|ref|YP_276717.1| 50S ribosomal protein L11 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|118597275|sp|Q48D25|RL11_PSE14 50S ribosomal protein L11 >gi|71557526|gb|AAZ36737.1| ribosomal protein L11 [Pseudomonas syringae pv. phaseolicola 1448A] (143 aa)
Score = 250, Expect = 2.6e-20, Identities = 61/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +IT   K+ +   QA P    GP L   G+N+ EF K FN +T+  + G   P IIT + D+SFTFE K+TP ++LLKKAA +  G+ +  T  V T++R +  +IAK K  D  A D EA +R +AGSA+ MG+ +EGV
  S:     4 KITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGIEPGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSAHPNTVKVGTVTRAQLEDIAKAKNADLTAADMEAAVRTIAGSARSMGLNVEGV 143
>gi|87306549|ref|ZP_01088696.1| 50S ribosomal protein L11 [Blastopirellula marina DSM 3645] >gi|87290728|gb|EAQ82615.1| 50S ribosomal protein L11 [Blastopirellula marina DSM 3645] (141 aa)
Score = 250, Expect = 2.7e-20, Identities = 54/127 (42%), Positives = 79/127 (62%)
  Q:    15 AKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           AK  + GG+A P P     L   G+N+G+F  QFND+TK+ NG  IP +++ + D++F F  K+ P   LLK+AA I  GA     + V  +S E+  EI K K+ D NA+D E   RM+ G+A+ MGI++
  S:     9 AKFQVPGGKATPAPPVGTSLGKFGVNLGQFVTQFNDKTKEFNGMPIPVVVSVYNDRTFEFICKSPPAAALLKQAAGIASGAGRPHVDKVGKVSIEQVDEICKQKMDDLNASDLEHARRMITGTARSMGIEV 139
>gi|94500507|ref|ZP_01307038.1| Ribosomal protein L11 [Oceanobacter sp. RED65] >gi|94427297|gb|EAT12276.1| Ribosomal protein L11 [Oceanobacter sp. RED65] (142 aa)
Score = 250, Expect = 2.7e-20, Identities = 61/129 (47%), Positives = 81/129 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           K+ +  G A P    GP L   G+N+ EF K FN  T+  +G V P IIT + D+SFTFE KT P + LLKKAA IK G+    TE V  ++R +  EIA+ K+ D  A D +A +R +AGSA+ MG+  EGV
  S:    10 KLQVQAGAANPSPPVGPALGQHGLNIMEFCKAFNAATQQMDGPV-PVIITVYNDRSFTFETKTPPASYLLKKAAGIKSGSGRPNTEKVGKVTRAQLEEIAEVKMKDLTAADMDAAVRTIAGSARAMGLDTEGV 141
>gi|33239682|ref|NP_874624.1| 50S ribosomal protein L11 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|38605180|sp|Q7VDY5|RL11_PROMA 50S ribosomal protein L11 >gi|33237207|gb|AAP99276.1| Ribosomal protein L11 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (141 aa)
Score = 250, Expect = 2.7e-20, Identities = 57/132 (43%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I  G+ +S      +I+R +  EIAKTKL D N N+ E+ ++++AG+A+ MG+ +
  S:     4 KITAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFITKTPPASVLITKAAGIAKGSGDSAKGQAGSINRAQLEEIAKTKLPDLNCNNIESAMKVIAGTARNMGVSV 139
>gi|83749361|ref|ZP_00946357.1| LSU ribosomal protein L11P [Ralstonia solanacearum UW551] >gi|83723986|gb|EAP71168.1| LSU ribosomal protein L11P [Ralstonia solanacearum UW551] (143 aa)
Score = 250, Expect = 2.8e-20, Identities = 62/135 (45%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF +K+ P T+L+KKAA ++ G+    T+ V  I+R +A EIAK K  D  A D +A +R +AGSA+ MGI +EG+
  S:     4 KIVGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAFADKSFTFVMKSPPATVLIKKAAGVQKGSAKPHTDKVGKITRAQAEEIAKAKNADLTAADLDAAVRTIAGSARSMGITVEGL 143
>gi|57651413|ref|YP_185469.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus COL] >gi|151220711|ref|YP_001331533.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus str. Newman] >gi|57285599|gb|AAW37693.1| ribosomal protein L11 [Staphylococcus aureus subsp. aureus COL] >gi|150373511|dbj|BAF66771.1| 50S ribosomal protein L11 [Staphylococcus aureus subsp. aureus str. Newman] (143 aa)
Score = 249, Expect = 2.9e-20, Identities = 55/122 (45%), Positives = 82/122 (67%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
            G+A P    GP L   G+N+  F K+FN +T+D+ G +IP  I+ ++D+SFTF  KT P  +LLKKAA I+ G+       VAT+++ +  EIA +K+ D NA DEEA +R++ G+A+ MGI +E
  S:    18 AGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKNQVREIANSKMQDLNAADEEAAMRIIEGTARSMGIVVE 143
>gi|15676055|ref|NP_273185.1| 50S ribosomal protein L11 [Neisseria meningitidis MC58] >gi|38605484|sp|Q9K1J3|RL11_NEIMB 50S ribosomal protein L11 >gi|7225344|gb|AAF40586.1| 50S ribosomal protein L11 [Neisseria meningitidis MC58] (144 aa)
Score = 249, Expect = 2.9e-20, Identities = 63/135 (46%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN  T+  + G  IP +ITAF DKSFTF +KT P ++LLKKAA ++ G+ N  T  V  ++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGMEPGLPIPVVITAFADKSFTFVMKTPPASILLKKAAGLQKGSSNPLTNKVGKLTRAQLEEIAKTKDPDLTAADLDAAVRTIAGSARSMGLDVEGV 143
>gi|15793174|ref|NP_282996.1| 50S ribosomal protein L11 [Neisseria meningitidis Z2491] >gi|121634005|ref|YP_974250.1| 50S ribosomal protein L11 [Neisseria meningitidis FAM18] >gi|166230169|sp|A1KRG2|RL11_NEIMF 50S ribosomal protein L11 >gi|38605481|sp|Q9JX02|RL11_NEIMA 50S ribosomal protein L11 >gi|120865711|emb|CAM09438.1| 50S ribosomal protein L11 [Neisseria meningitidis FAM18] >gi|121051193|emb|CAM07464.1| 50S ribosomal protein L11 [Neisseria meningitidis Z2491] (144 aa)
Score = 249, Expect = 3.0e-20, Identities = 63/135 (46%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN  T+  + G  IP +ITAF DKSFTF +KT P ++LLKKAA ++ G+ N  T  V  ++R +  EIAKTK  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIIGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAATQGMEPGLPIPVVITAFADKSFTFVMKTPPASILLKKAAGLQKGSSNPLTNKVGKLTRAQLEEIAKTKEPDLTAADLDAAVRTIAGSARSMGLDVEGV 143
>gi|87122752|ref|ZP_01078626.1| 50S ribosomal protein L11 [Marinomonas sp. MED121] >gi|86161980|gb|EAQ63271.1| 50S ribosomal protein L11 [Marinomonas sp. MED121] (144 aa)
Score = 249, Expect = 3.0e-20, Identities = 60/130 (46%), Positives = 85/130 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           K+ +  GQA P    GP L   G+N+ EF K FN +T+  + G   P IIT + D+SFTFE K+TP ++LLKKAA +K G+    T+ V T++R +  EIA  K  D  A D +A +R +AGSA+ MG+ +EGV+
  S:    10 KLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAKTQGVEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLKSGSPRPNTQKVGTVTRAQLEEIATAKAEDLTAADMDAAVRTIAGSARAMGLDVEGVN 144
>gi|91200656|emb|CAJ73706.1| strongly similar to 50S ribosomal protein L11 [Candidatus Kuenenia stuttgartiensis] (141 aa)
Score = 249, Expect = 3.1e-20, Identities = 56/126 (44%), Positives = 83/126 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+    GQA P    GP L   G+N+G+F KQFND+TKD  G + P  IT FKDK+FTF IK+ P ++LLK++A I  G+     + V  +++++  EIA  KL D N ++ E+ +R++ G+A  MG+KI
  S:    10 KLQCPAGQATPAPPVGPALGQHGVNIGQFVKQFNDKTKDLQGILTPAEITVFKDKTFTFIIKSPPASVLLKQSAGIVKGSPEPNRQKVGQVNKQQIREIAARKLADLNVSNLESAMRIIEGTAHTMGLKI 139
>gi|17547757|ref|NP_521159.1| 50S ribosomal protein L11 [Ralstonia solanacearum GMI1000] >gi|38605395|sp|Q8XUZ4|RL11_RALSO 50S ribosomal protein L11 >gi|17430062|emb|CAD16747.1| probable 50s ribosomal subunit protein l11 (methylation rna-binding) [Ralstonia solanacearum] (143 aa)
Score = 249, Expect = 3.1e-20, Identities = 62/135 (45%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF +K+ P T+L+KKAA ++ G+    T+ V  I+R +A EIAK K  D  A D +A +R +AGSA+ MGI +EG+
  S:     4 KIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAFADKSFTFVMKSPPATVLIKKAAGVQKGSAKPHTDKVGKITRAQAEEIAKAKNADLTAADLDAAVRTIAGSARSMGITVEGL 143
>gi|88807059|ref|ZP_01122574.1| 50S ribosomal protein L11 [Robiginitalea biformata HTCC2501] >gi|88783005|gb|EAR14179.1| 50S ribosomal protein L11 [Robiginitalea biformata HTCC2501] (145 aa)
Score = 249, Expect = 3.2e-20, Identities = 54/136 (39%), Positives = 87/136 (63%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++++ K+ + GG A P    GP L + G+N+ EF KQFN +T+DK G+V+P +IT + DKSF F +KT P  + L +AA +K G+         +++ ++   IA+ K+ D NA   E+ + MVAG+A+ MG+K+ G  P
  S:     5 VSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNARTQDKQGKVLPVVITVYGDKSFDFVVKTPPAAVQLMEAAKVKKGSGEPNRVKAGSVNWDQIRAIAEDKMADLNAFTTESAMMMVAGTARSMGLKVAGKRP 144
>gi|56707310|ref|YP_169206.1| 50S ribosomal protein L11 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669780|ref|YP_666337.1| 50S ribosomal protein L11 [Francisella tularensis subsp. tularensis FSC198] >gi|118498140|ref|YP_899190.1| 50S ribosomal protein L11 [Francisella tularensis subsp. novicida U112] >gi|134301349|ref|YP_001121317.1| 50S ribosomal protein L11 [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931079|ref|YP_001891063.1| 50S ribosomal protein L11 [Francisella tularensis subsp. mediasiatica FSC147] >gi|166230137|sp|A0Q871|RL11_FRATN 50S ribosomal protein L11 >gi|166230138|sp|A4IW95|RL11_FRATW 50S ribosomal protein L11 >gi|61214712|sp|Q5NID6|RL11_FRATT 50S ribosomal protein L11 >gi|118597163|sp|Q14JT9|RL11_FRAT1 50S ribosomal protein L11 >gi|56603802|emb|CAG44773.1| 50S ribosomal protein L11 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320113|emb|CAL08156.1| 50S ribosomal protein L11 [Francisella tularensis subsp. tularensis FSC 198] >gi|118424046|gb|ABK90436.1| 50S ribosomal protein L11 [Francisella tularensis subsp. novicida U112] >gi|134049126|gb|ABO46197.1| ribosomal protein L11 [Francisella tularensis subsp. tularensis WY96-3418] >gi|187711988|gb|ACD30285.1| 50S ribosomal protein L11 [Francisella tularensis subsp. mediasiatica FSC147] (144 aa)
Score = 249, Expect = 3.3e-20, Identities = 61/135 (45%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I  I K+ +  G+A P    GP L   G+N+  F K+FN +T+  + G  IP  I+ + D+SFTFE+KT P + L+KKA N+K G+     E V TI+R +  EIAK K  D  A D +A +R++AGSA+ MG+K+EGV
  S:     5 KIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFVGTITRAQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV 144
>gi|15606945|ref|NP_214327.1| ribosomal protein L11 [Aquifex aeolicus VF5] >gi|7674161|sp|O67758|RL11_AQUAE 50S ribosomal protein L11 >gi|2984196|gb|AAC07727.1| ribosomal protein L11 [Aquifex aeolicus VF5] (145 aa)
Score = 249, Expect = 3.5e-20, Identities = 60/134 (44%), Positives = 89/134 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    ++ L   QA P    GP L   G+N+ EF KQFN  ++D + G ++P +IT ++D+SFTF +KT PV+ LLKKAA ++ G+ + K   V  I+ ++  EIAK K+ D N  D +A +R VAG+AK MGI+IEG
  S:     4 KVVATIELMLPAQQASPAPPVGPALGQHGVNIMEFVKQFNAASRDYEPGTILPVVITVYQDRSFTFIMKTPPVSYLLKKAAGVEKGSSDPKRVKVGKITVKQLEEIAKMKMKDMNTRDLKAAMRTVAGTAKSMGIEIEG 142
>gi|94312269|ref|YP_585479.1| 50S ribosomal protein L11 [Ralstonia metallidurans CH34] >gi|113869448|ref|YP_727937.1| 50S ribosomal protein L11 [Ralstonia eutropha H16] >gi|194291039|ref|YP_002006946.1| 50S ribosomal subunit protein L11, N-terminal believed to regulate RelA [Cupriavidus taiwanensis] >gi|122946531|sp|Q0K602|RL11_RALEH 50S ribosomal protein L11 >gi|118597280|sp|Q1LI16|RL11_RALME 50S ribosomal protein L11 >gi|93356121|gb|ABF10210.1| LSU ribosomal protein L11P [Ralstonia metallidurans CH34] >gi|113528224|emb|CAJ94569.1| LSU ribosomal protein L11 [Ralstonia eutropha H16] >gi|193224874|emb|CAQ70885.1| 50S ribosomal subunit protein L11, N-terminal believed to regulate RelA [Cupriavidus taiwanensis] (143 aa)
Score = 249, Expect = 3.6e-20, Identities = 63/135 (46%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF +K+ P T+L+KKAA I  G+    T+ V  I+R +A EIAK K  D  A D +A +R +AGSA+ MGI +EG+
  S:     4 KIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAFADKSFTFVMKSPPATVLIKKAAGITKGSPKPHTDKVGKITRAQAEEIAKAKNADLTAADLDAAVRTIAGSARSMGITVEGL 143
>gi|78213979|ref|YP_382758.1| 50S ribosomal protein L11 [Synechococcus sp. CC9605] >gi|118597312|sp|Q3AGS9|RL11_SYNSC 50S ribosomal protein L11 >gi|78198438|gb|ABB36203.1| ribosomal protein L11 [Synechococcus sp. CC9605] (141 aa)
Score = 249, Expect = 3.7e-20, Identities = 57/132 (43%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I+ G+  S   +V +ISR +  EIAKTKL D N    E+ +R++ G+A+ MG+ I
  S:     4 KVVAVIKLALDAGKANPAPPVGPALGQHGVNIMMFCKEYNARTQDKAGYVIPVEISVFEDRSFTFITKTPPASVLITKAAKIQKGSGESAKGSVGSISRAQLEEIAKTKLPDLNCTSIESAMRIIEGTARNMGVSI 139
>gi|84685451|ref|ZP_01013349.1| ribosomal protein L11 [Rhodobacterales bacterium HTCC2654] >gi|84666608|gb|EAQ13080.1| ribosomal protein L11 [Rhodobacterales bacterium HTCC2654] (141 aa)
Score = 248, Expect = 3.9e-20, Identities = 60/127 (47%), Positives = 85/127 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T++ + G   P  IT ++DKSFT +IKT P +  LKKAA +K GA N   ETV T++  +  EIA+ K+ D NAND EA ++++ GSA+ MGI+++
  S:    10 KLQIPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQEMEQGAPCPTEITYYQDKSFTMDIKTPPASYFLKKAAKLKSGANNPGRETVGTVTAAQVKEIAEAKMKDLNANDVEAAMQIILGSARSMGIEVK 141
>gi|26987184|ref|NP_742609.1| 50S ribosomal protein L11 [Pseudomonas putida KT2440] >gi|148545728|ref|YP_001265830.1| 50S ribosomal protein L11 [Pseudomonas putida F1] >gi|167031489|ref|YP_001666720.1| 50S ribosomal protein L11 [Pseudomonas putida GB-1] >gi|170723917|ref|YP_001751605.1| ribosomal protein L11 [Pseudomonas putida W619] >gi|166230916|sp|A5VXN6|RL11_PSEP1 50S ribosomal protein L11 >gi|189040973|sp|B0KK56|RL11_PSEPG 50S ribosomal protein L11 >gi|38605250|sp|Q88QP5|RL11_PSEPK 50S ribosomal protein L11 >gi|24981820|gb|AAN66073.1|AE016236_7 ribosomal protein L11 [Pseudomonas putida KT2440] >gi|148509786|gb|ABQ76646.1| LSU ribosomal protein L11P [Pseudomonas putida F1] >gi|166857977|gb|ABY96384.1| ribosomal protein L11 [Pseudomonas putida GB-1] >gi|169761920|gb|ACA75236.1| ribosomal protein L11 [Pseudomonas putida W619] (143 aa)
Score = 248, Expect = 4.1e-20, Identities = 60/135 (44%), Positives = 85/135 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  GQA P    GP L   G+N+ EF K FN +T+ +  G   P IIT + D+SFTFE K+TP ++LLKKAA +  G+    T  V T++R +  +IAK K  D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNARTQGQEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRAQLEDIAKAKQADLTAADLDAAVRTIAGSARSMGLNVEGV 143
>gi|38233046|ref|NP_938813.1| 50S ribosomal protein L11 [Corynebacterium diphtheriae NCTC 13129] >gi|38605131|sp|P60101|RL11_CORDI 50S ribosomal protein L11 >gi|38199305|emb|CAE48936.1| 50S ribosomal protein L11 [Corynebacterium diphtheriae] (142 aa)
Score = 248, Expect = 4.1e-20, Identities = 54/133 (40%), Positives = 90/133 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ +  GQA P    GP L + G+N+ EF K +N  T+++ G V+P  IT ++D+SF F++KT P   LL KAA ++ G+    T+ V +++ ++  EIA+TK+ D NAND E   R++AG+A+ MGI+++
  S:     6 KVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGSVTMDQVKEIAQTKMEDLNANDIENAARIIAGTARSMGIEVK 142
>gi|28212184|ref|NP_783128.1| 50S ribosomal protein L11 [Clostridium tetani E88] >gi|38605253|sp|Q890N1|RL11_CLOTE 50S ribosomal protein L11 >gi|28204628|gb|AAO37065.1| LSU ribosomal protein L11P [Clostridium tetani E88] (141 aa)
Score = 248, Expect = 4.4e-20, Identities = 56/133 (42%), Positives = 88/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ L  G+A P    GP L   G+N+  F K+FN++T  + G +IP +IT ++D+SF+F +KT P  +L+KKA  I+ G+       VA I++E+  EIA+ K+ D NA   EA +RMVAG+A+ MG+ +E
  S:     4 KVTGMIKLQLAAGKASPAPPVGPALGQHGVNIMAFCKEFNEKTAKQAGLIIPVVITVYQDRSFSFILKTPPAAVLIKKAVGIESGSGVPNKTKVAKITKEQLKEIAEMKMPDLNAGSVEAAMRMVAGTARSMGVTVE 140
>gi|89257017|ref|YP_514379.1| 50S ribosomal protein L11 [Francisella tularensis subsp. holarctica] >gi|115315378|ref|YP_764101.1| 50S ribosomal protein L11 [Francisella tularensis subsp. holarctica OSU18] >gi|167009398|ref|ZP_02274329.1| ribosomal protein L11 [Francisella tularensis subsp. holarctica FSC200] >gi|122324635|sp|Q0BKC0|RL11_FRATO 50S ribosomal protein L11 >gi|166230136|sp|A7NEC4|RL11_FRATF 50S ribosomal protein L11 >gi|118597164|sp|Q2A1M3|RL11_FRATH 50S ribosomal protein L11 >gi|89144848|emb|CAJ80187.1| 50S ribosomal protein L11 [Francisella tularensis subsp. holarctica LVS] >gi|115130277|gb|ABI83464.1| ribosomal protein L11 [Francisella tularensis subsp. holarctica OSU18] (144 aa)
Score = 248, Expect = 4.6e-20, Identities = 60/135 (44%), Positives = 88/135 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I  I K+ +  G+A P    GP L   G+N+  F K+FN +T+  + G  IP  I+ + D+SFTFE+KT P + L+KKA N+K G+     E + TI+R +  EIAK K  D  A D +A +R++AGSA+ MG+K+EGV
  S:     5 KIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFIGTITRAQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV 144
>gi|22537663|ref|NP_688514.1| 50S ribosomal protein L11 [Streptococcus agalactiae 2603V/R] >gi|76788089|ref|YP_330150.1| 50S ribosomal protein L11 [Streptococcus agalactiae A909] >gi|38605305|sp|Q8DYG1|RL11_STRA5 50S ribosomal protein L11 >gi|119364582|sp|Q3K003|RL11_STRA1 50S ribosomal protein L11 >gi|22534550|gb|AAN00387.1|AE014261_15 ribosomal protein L11 [Streptococcus agalactiae 2603V/R] >gi|76563146|gb|ABA45730.1| ribosomal protein L11 [Streptococcus agalactiae A909] (141 aa)
Score = 248, Expect = 4.6e-20, Identities = 56/132 (42%), Positives = 87/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+       VATI+R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     4 KVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGEPNKTKVATITRAQVQEIAETKMPDLNAANLESAMRMIEGTARSMGFTV 139
>gi|87123509|ref|ZP_01079360.1| Ribosomal protein L11 [Synechococcus sp. RS9917] >gi|86169229|gb|EAQ70485.1| Ribosomal protein L11 [Synechococcus sp. RS9917] (141 aa)
Score = 248, Expect = 4.7e-20, Identities = 57/132 (43%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I+ G+  S   +V +ISR +  EIAKTKL D N    E+ +R++ G+A+ MG+ I
  S:     4 KVVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFITKTPPASVLITKAAGIEKGSGESAKGSVGSISRTQLEEIAKTKLPDLNCTSVESAMRIIEGTARNMGVAI 139
>gi|71902453|ref|ZP_00684396.1| Ribosomal protein L11, bacterial [Xylella fastidiosa Ann-1] >gi|71727819|gb|EAO30069.1| Ribosomal protein L11, bacterial [Xylella fastidiosa Ann-1] (168 aa)
Score = 248, Expect = 4.9e-20, Identities = 58/134 (43%), Positives = 87/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  GQA P    GP L   G+N+ +F K FN  T K + G  IP +ITA+ D++FTF  K+ P ++LLKK   I+ G+K   TE V  ++R++  +IAKTK +D  A D +A +R +AGSA+ MG+ +EG
  S:    30 KVTAYIKLQVKAGQASPSPPVGPALGQRGLNIMDFCKAFNAGTQKVEQGLPIPVVITAYSDRTFTFITKSPPASILLKKIVGIQSGSKRPNTEKVGKVTRKQLEDIAKTKELDMTAADLDAAVRTIAGSARSMGLVVEG 168
>gi|28867843|ref|NP_790462.1| 50S ribosomal protein L11 [Pseudomonas syringae pv. tomato str. DC3000] >gi|66047786|ref|YP_237627.1| 50S ribosomal protein L11 [Pseudomonas syringae pv. syringae B728a] >gi|38605246|sp|Q889Y2|RL11_PSESM 50S ribosomal protein L11 >gi|81307856|sp|Q4ZMN3|RL11_PSEU2 50S ribosomal protein L11 >gi|28851079|gb|AAO54157.1| ribosomal protein L11 [Pseudomonas syringae pv. tomato str. DC3000] >gi|63258493|gb|AAY39589.1| Ribosomal protein L11, bacterial [Pseudomonas syringae pv. syringae B728a] (143 aa)
Score = 247, Expect = 5.1e-20, Identities = 61/135 (45%), Positives = 85/135 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +IT   K+ +   QA P    GP L   G+N+ EF K FN +T+  + G   P IIT + D+SFTFE K+TP ++LLKKAA +  G+    T  V T++R +  +IAK K  D  A D EA +R +AGSA+ MG+ +EGV
  S:     4 KITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGIEPGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRAQLEDIAKAKNADLTAADMEAAVRTIAGSARSMGLNVEGV 143
>gi|73542877|ref|YP_297397.1| 50S ribosomal protein L11 [Ralstonia eutropha JMP134] >gi|118597279|sp|Q46WD0|RL11_RALEJ 50S ribosomal protein L11 >gi|72120290|gb|AAZ62553.1| LSU ribosomal protein L11P [Ralstonia eutropha JMP134] (143 aa)
Score = 247, Expect = 5.1e-20, Identities = 62/135 (45%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF +K+ P T+L+KKAA +  G+    T+ V  I+R +A EIAK K  D  A D +A +R +AGSA+ MGI +EG+
  S:     4 KIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQTQGMEPGLPVPVVITAFADKSFTFVMKSPPATVLIKKAAGVTKGSPKPHTDKVGKITRAQAEEIAKAKNADLTAADLDAAVRTIAGSARSMGITVEGL 143
>gi|33864352|ref|NP_895912.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. MIT 9313] >gi|38605173|sp|Q7V479|RL11_PROMM 50S ribosomal protein L11 >gi|33641132|emb|CAE22262.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. MIT 9313] (141 aa)
Score = 247, Expect = 5.1e-20, Identities = 56/132 (42%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I+ G+  S    V ++SR +  EIAKTKL D N    E+ +R++ G+A+ MG+ I
  S:     4 KVVSVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGLVIPVEISVFEDRSFTFITKTPPASVLITKAAGIEKGSGESAHGKVGSLSRSQLEEIAKTKLPDLNCTSIESAMRIIEGTARNMGVSI 139
>gi|46200040|ref|YP_005707.1| 50S ribosomal protein L11 [Thermus thermophilus HB27] >gi|55980216|ref|YP_143513.1| 50S ribosomal protein L11 [Thermus thermophilus HB8] >gi|730525|sp|P36238|RL11_THETH 50S ribosomal protein L11 >gi|54039076|sp|P62442|RL11_THET2 50S ribosomal protein L11 >gi|62287410|sp|Q5SLP6|RL11_THET8 50S ribosomal protein L11 >gi|2120599|pir||S66576 ribosomal protein L11 - Thermus aquaticus >gi|119389742|pdb|2HGJ|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. >gi|119389799|pdb|2HGQ|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgp. >gi|119389855|pdb|2HGU|L Chain L, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgr. >gi|122921169|pdb|2NXN|B Chain B, T. Thermophilus Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Ribosomal Protein L11 >gi|126030608|pdb|2H8W|A Chain A, Solution Structure Of Ribosomal Protein L11 >gi|150261203|pdb|2E34|A Chain A, L11 Structure With Rdc And Rg Refinement >gi|150261204|pdb|2E35|A Chain A, The Minimized Average Structure Of L11 With Rg Refinement >gi|150261205|pdb|2E36|A Chain A, L11 With Sans Refinement >gi|188596422|pdb|3CJT|B Chain B, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596424|pdb|3CJT|D Chain D, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596426|pdb|3CJT|F Chain F, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596428|pdb|3CJT|H Chain H, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596430|pdb|3CJT|J Chain J, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596432|pdb|3CJT|L Chain L, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596434|pdb|3CJT|N Chain N, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|188596436|pdb|3CJT|P Chain P, Ribosomal Protein L11 Methyltransferase (Prma) In Complex With Dimethylated Ribosomal Protein L11 >gi|587583|emb|CAA57138.1| ribosomal protein L11 [Thermus thermophilus] >gi|46197668|gb|AAS82080.1| LSU ribosomal protein L11P [Thermus thermophilus HB27] >gi|55771629|dbj|BAD70070.1| 50S ribosomal protein L11 [Thermus thermophilus HB8] (147 aa)
Score = 247, Expect = 5.2e-20, Identities = 58/138 (42%), Positives = 82/138 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           ++  + K+ L  G+A P    GP L   G N+ EF K FN  T +    ++P  IT + D+SFTF  KT P + L++KAA ++ GA     E V  I+ E+ LEIAK K+ D N  D EA  RM+AGSA+ MG+++ G   V
  S:     3 KVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEV 144
>gi|53804628|ref|YP_113537.1| ribosomal protein L11 [Methylococcus capsulatus str. Bath] >gi|61214824|sp|Q60A10|RL11_METCA 50S ribosomal protein L11 >gi|53758389|gb|AAU92680.1| ribosomal protein L11 [Methylococcus capsulatus str. Bath] (143 aa)
Score = 247, Expect = 5.4e-20, Identities = 60/135 (44%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +IT   K+ +  G+A P    GP L   G+N+ EF K FN QT++ + G  +P +IT + D+SFTF  KT P ++LLKKA  +K G+    T+ V T++R +  EIAK K+ D  A D +A +R +AGSA  MG+ +EGV
  S:     4 KITGYIKLQVKAGEANPSPPVGPALGQRGVNIMEFCKAFNAQTQNVEKGLPLPVVITVYADRSFTFITKTPPASVLLKKALGLKSGSSKPNTDKVGTVTRAQLEEIAKMKMPDLTAADMDAAVRTIAGSATSMGLIVEGV 143
>gi|159902763|ref|YP_001550107.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. MIT 9211] >gi|159887939|gb|ABX08153.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. MIT 9211] (141 aa)
Score = 247, Expect = 5.5e-20, Identities = 57/133 (42%), Positives = 89/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I+ G+ +S    V TI+R +  EIAKTKL D N ++ E+ +R++ G+A+ MG+ ++
  S:     4 KIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTQDKAGFVIPVEISVFEDRSFTFITKTPPASVLITKAAGIEKGSGDSAKGQVGTINRAQLEEIAKTKLPDLNCSNIESAMRVIEGTARNMGVSVK 140
>gi|78043974|ref|YP_361132.1| 50S ribosomal protein L11 [Carboxydothermus hydrogenoformans Z-2901] >gi|118597144|sp|Q3A9Q2|RL11_CARHZ 50S ribosomal protein L11 >gi|77996089|gb|ABB14988.1| ribosomal protein L11 [Carboxydothermus hydrogenoformans Z-2901] (141 aa)
Score = 247, Expect = 5.8e-20, Identities = 56/132 (42%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+  F K++N++T  + G +IP  IT ++D+SFTF  KT P + LLKKAA I+ G+     + V  ++R K  EIA+ KL D NAND EA +RM+ G+A+ MGI++
  S:     4 KVVAVVKLQIPAGKATPAPPVGPALGQHGVNIMAFVKEYNERTAQQAGMIIPVEITVYEDRSFTFVTKTPPASDLLKKAAGIESGSGQPNKKKVGKVTRAKIREIAELKLKDLNANDVEAAMRMIEGTARSMGIEV 139
>gi|87300789|ref|ZP_01083631.1| Ribosomal protein L11 [Synechococcus sp. WH 5701] >gi|87284660|gb|EAQ76612.1| Ribosomal protein L11 [Synechococcus sp. WH 5701] (141 aa)
Score = 247, Expect = 6.0e-20, Identities = 57/132 (43%), Positives = 83/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I  GA  S    V  ISR +  EIA TKL D N +  E+ +R++ G+A+ MG+ I
  S:     4 KVVAVIKLALNAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGYVIPVEISVFEDRSFTFITKTPPASVLITKAAGIDKGAATSAKGRVGAISRAQLQEIASTKLPDLNCSSLESAMRIIEGTARNMGVAI 139
>gi|25011620|ref|NP_736015.1| 50S ribosomal protein L11 [Streptococcus agalactiae NEM316] >gi|77405178|ref|ZP_00782276.1| ribosomal protein L11 [Streptococcus agalactiae H36B] >gi|77411704|ref|ZP_00788043.1| ribosomal protein L11 [Streptococcus agalactiae CJB111] >gi|38605308|sp|Q8E424|RL11_STRA3 50S ribosomal protein L11 >gi|24413160|emb|CAD47238.1| ribosomal protein L11 [Streptococcus agalactiae NEM316] >gi|77162276|gb|EAO73248.1| ribosomal protein L11 [Streptococcus agalactiae CJB111] >gi|77176180|gb|EAO78951.1| ribosomal protein L11 [Streptococcus agalactiae H36B] (141 aa)
Score = 246, Expect = 6.7e-20, Identities = 55/132 (41%), Positives = 87/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+       VAT++R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     4 KVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGEPNKTKVATVTRAQVQEIAETKMPDLNAANLESAMRMIEGTARSMGFTV 139
>gi|62424445|ref|ZP_00379591.1| COG0080: Ribosomal protein L11 [Brevibacterium linens BL2] (145 aa)
Score = 246, Expect = 7.0e-20, Identities = 56/133 (42%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  G A P    GP LA  G+N+ EF K +N  T+ + G VIP  IT F+D+SFTF +KT P   L+KKAA +K G+    T+ VA +S ++  +IA  K+ D NAND +   R+VAG+A+ MG+  +
  S:     6 KVAGLVKLQIQAGAANPAPPIGPALAQHGVNIMEFCKAYNAATESQRGNVIPVEITVFEDRSFTFVLKTPPAAELIKKAAGVKSGSATPHTDKVAHLSADQVRDIANVKMPDLNANDLDQADRIVAGTARSMGVTTD 142
>gi|55821790|ref|YP_140232.1| 50S ribosomal protein L11 [Streptococcus thermophilus LMG 18311] >gi|55823708|ref|YP_142149.1| 50S ribosomal protein L11 [Streptococcus thermophilus CNRZ1066] >gi|116628506|ref|YP_821125.1| 50S ribosomal protein L11 [Streptococcus thermophilus LMD-9] >gi|122266899|sp|Q03IP3|RL11_STRTD 50S ribosomal protein L11 >gi|81676503|sp|Q5LXZ5|RL11_STRT1 50S ribosomal protein L11 >gi|81676656|sp|Q5M2J9|RL11_STRT2 50S ribosomal protein L11 >gi|55737775|gb|AAV61417.1| 50S ribosomal protein L11 [Streptococcus thermophilus LMG 18311] >gi|55739693|gb|AAV63334.1| 50S ribosomal protein L11 [Streptococcus thermophilus CNRZ1066] >gi|116101783|gb|ABJ66929.1| LSU ribosomal protein L11P [Streptococcus thermophilus LMD-9] (141 aa)
Score = 246, Expect = 7.4e-20, Identities = 55/132 (41%), Positives = 87/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  I K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+    +  VA+++R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     4 KVENIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGTPNSVKVASVTRAQVREIAETKMPDLNAANIESAMRMIEGTARSMGFTV 139
>gi|71275251|ref|ZP_00651538.1| Ribosomal protein L11, bacterial [Xylella fastidiosa Dixon] >gi|71899981|ref|ZP_00682127.1| Ribosomal protein L11, bacterial [Xylella fastidiosa Ann-1] >gi|170731250|ref|YP_001776683.1| 50S ribosomal protein L11 [Xylella fastidiosa M12] >gi|71164060|gb|EAO13775.1| Ribosomal protein L11, bacterial [Xylella fastidiosa Dixon] >gi|71730268|gb|EAO32353.1| Ribosomal protein L11, bacterial [Xylella fastidiosa Ann-1] >gi|167966043|gb|ACA13053.1| 50S ribosomal protein L11 [Xylella fastidiosa M12] (169 aa)
Score = 246, Expect = 7.5e-20, Identities = 58/128 (45%), Positives = 84/128 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   G+N+ +F K FN  T K + G  IP +ITA+ D++FTF  KT P ++LLKK   I+ G+K   TE V  ++R++  +IAKTK +D  A D +A +R +AGSA+ MG+ +EG
  S:    37 KLQVKAGQASPSPPVGPALGQRGLNIMDFCKAFNAGTQKVEQGLPIPVVITAYSDRTFTFITKTPPASILLKKIVGIQSGSKRPNTEKVGKVTRKQLEDIAKTKELDMTAADLDAAVRTIAGSARSMGLVVEG 169
>gi|78185723|ref|YP_378157.1| 50S ribosomal protein L11 [Synechococcus sp. CC9902] >gi|116071970|ref|ZP_01469238.1| Ribosomal protein L11 [Synechococcus sp. BL107] >gi|118597311|sp|Q3AUJ5|RL11_SYNS9 50S ribosomal protein L11 >gi|78170017|gb|ABB27114.1| LSU ribosomal protein L11P [Synechococcus sp. CC9902] >gi|116065593|gb|EAU71351.1| Ribosomal protein L11 [Synechococcus sp. BL107] (141 aa)
Score = 246, Expect = 7.6e-20, Identities = 55/132 (41%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I+ G+ +S   +V +ISR +  EIAKTKL D N +  ++ +R++ G+A+ MG+ +
  S:     4 KVVAVIKLALQAGKANPAPPVGPALGQHGVNIMMFCKEYNARTQDKAGLVIPVEISVFEDRSFTFITKTPPASVLITKAAGIEKGSGDSAKGSVGSISRAQLEEIAKTKLPDLNCSSVDSAMRIIEGTARNMGVAV 139
>gi|89053054|ref|YP_508505.1| 50S ribosomal protein L11 [Jannaschia sp. CCS1] >gi|118597249|sp|Q28UY2|RL11_JANSC 50S ribosomal protein L11 >gi|88862603|gb|ABD53480.1| LSU ribosomal protein L11P [Jannaschia sp. CCS1] (150 aa)
Score = 246, Expect = 8.1e-20, Identities = 62/128 (48%), Positives = 90/128 (70%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV--------GAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   GIN+ EF K FN +T++ + G   P +IT ++DKSFT +IKT P +  LKKAA +K         GA+    ETVA+I+ ++  EIA+ K+VD +AND EA ++++ GSAK MGI+++G
  S:    10 KLQIPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQEMEQGAPCPTVITYYQDKSFTMDIKTPPASYYLKKAAGLKPVGKRNRPRGAETPGRETVASITSKQLREIAEAKMVDLSANDVEAAMKIILGSAKSMGIEVKG 150
>gi|24216123|ref|NP_713604.1| 50S ribosomal protein L11 [Leptospira interrogans serovar Lai str. 56601] >gi|45656643|ref|YP_000729.1| 50S ribosomal protein L11 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|38605317|sp|Q8F0R8|RL11_LEPIN 50S ribosomal protein L11 >gi|54039072|sp|P62436|RL11_LEPIC 50S ribosomal protein L11 >gi|24197366|gb|AAN50622.1|AE011500_9 ribosomal protein L11 [Leptospira interrogans serovar Lai str. 56601] >gi|45599879|gb|AAS69366.1| 50S ribosomal protein L11 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (142 aa)
Score = 245, Expect = 8.5e-20, Identities = 54/134 (40%), Positives = 87/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++ +  K+ +  G+A P    GP L   G+N+ EF KQFN+++K + G  +P +IT F D+SFTF  K+ P  +L+KKA  ++ G+    T  V  I+R++  EIAKTK+ D NAND +A + ++AG+ + MG+ +E 
  S:     5 KVVKQIKLQVEAGKANPAPPVGPALGQAGLNIMEFCKQFNERSKAQIGLKLPVVITVFSDRSFTFITKSPPAALLVKKAIGLETGSATPHTHKVGKITRKQLEEIAKTKMEDLNANDIDAAVNIIAGTCRSMGVTVEA 142
>gi|92112543|ref|YP_572471.1| 50S ribosomal protein L11P [Chromohalobacter salexigens DSM 3043] >gi|118597147|sp|Q1R0I6|RL11_CHRSD 50S ribosomal protein L11 >gi|91795633|gb|ABE57772.1| LSU ribosomal protein L11P [Chromohalobacter salexigens DSM 3043] (143 aa)
Score = 245, Expect = 8.8e-20, Identities = 60/129 (46%), Positives = 84/129 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           K+ +  G+A P    GP L   G+N+ EF K FN +T+D + G   P +IT + D+SFTF  KT P  +LLKKAA IK G+       V T++RE+  EIAKTK  D  A+D +A +R +AGSA+ MG+ +EG+
  S:    10 KLQVAAGKANPSPPVGPALGQHGVNIMEFCKAFNAETQDIEPGLPTPVVITVYSDRSFTFITKTPPAAVLLKKAAGIKSGSGVPNKTKVGTVTREQLEEIAKTKEPDLTASDLDAAVRTIAGSARSMGLNVEGL 143
>gi|115525606|ref|YP_782517.1| 50S ribosomal protein L11 [Rhodopseudomonas palustris BisA53] >gi|122295392|sp|Q07KJ7|RL11_RHOP5 50S ribosomal protein L11 >gi|115519553|gb|ABJ07537.1| LSU ribosomal protein L11P [Rhodopseudomonas palustris BisA53] (142 aa)
Score = 245, Expect = 9.6e-20, Identities = 56/134 (41%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AA I+ G+K    +    +S  +  EIA+ K+ D N +  E+ +RMV GSA+ MG+++EG
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKNFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMSFFLKQAAKIQSGSKLPGRDVAGKVSSAQVREIAERKMKDLNCDSIESAMRMVEGSARSMGLQVEG 142
>gi|88809792|ref|ZP_01125298.1| 50S ribosomal protein L11 [Synechococcus sp. WH 7805] >gi|88786176|gb|EAR17337.1| 50S ribosomal protein L11 [Synechococcus sp. WH 7805] (141 aa)
Score = 245, Expect = 9.8e-20, Identities = 56/132 (42%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I  G+  S    V +I+R +  EIAKTKL D N    E+ +R++ G+A+ MG+ +
  S:     4 KVTAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFITKTPPASVLITKAAGIDKGSGESAKGNVGSINRSQLEEIAKTKLPDLNCTSVESAMRIIEGTARNMGVAV 139
>gi|51894225|ref|YP_076916.1| 50S ribosomal protein L11 [Symbiobacterium thermophilum IAM 14863] >gi|56404764|sp|Q67JS8|RL11_SYMTH 50S ribosomal protein L11 >gi|51857914|dbj|BAD42072.1| 50S ribosomal protein L11 [Symbiobacterium thermophilum IAM 14863] (140 aa)
Score = 245, Expect = 9.8e-20, Identities = 57/133 (42%), Positives = 87/133 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ L  G+A P    GP L + G+N+  F K++N++TKD+ G VIP  IT ++D+SFTF +KT P  +L+KKA  I+  +     + V  ++  +  EIAK K+ D NAND EA  RMV G+A+ MG+ +E
  S:     4 KVTAVIKLALPAGKATPAPPVGPALGAHGVNIMAFCKEYNERTKDQVGLVIPVEITVYEDRSFTFILKTPPTAVLIKKALGIETASGVPNKQKVGKLTDAQVEEIAKIKMPDLNANDLEAAKRMVRGTARSMGVDVE 140
>gi|15607780|ref|NP_215154.1| 50S ribosomal protein L11 [Mycobacterium tuberculosis H37Rv] >gi|15840043|ref|NP_335080.1| 50S ribosomal protein L11 [Mycobacterium tuberculosis CDC1551] >gi|31791824|ref|NP_854317.1| 50S ribosomal protein L11 [Mycobacterium bovis AF2122/97] >gi|121636561|ref|YP_976784.1| 50S ribosomal protein L11 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148660414|ref|YP_001281937.1| 50S ribosomal protein L11 [Mycobacterium tuberculosis H37Ra] >gi|148821844|ref|YP_001286598.1| 50S ribosomal protein L11 [Mycobacterium tuberculosis F11] >gi|167969070|ref|ZP_02551347.1| 50S ribosomal protein L11 [Mycobacterium tuberculosis H37Ra] >gi|194543023|ref|YP_002078052.1| 50S ribosomal protein L11 rplK [Mycobacterium tuberculosis C] >gi|166230162|sp|A1KGC0|RL11_MYCBP 50S ribosomal protein L11 >gi|166230166|sp|A5U025|RL11_MYCTA 50S ribosomal protein L11 >gi|54039087|sp|P66057|RL11_MYCBO 50S ribosomal protein L11 >gi|54041817|sp|P66056|RL11_MYCTU 50S ribosomal protein L11 >gi|1877378|emb|CAB07099.1| PROBABLE 50S RIBOSOMAL PROTEIN L11 RPLK [Mycobacterium tuberculosis H37Rv] >gi|13880189|gb|AAK44894.1| ribosomal protein L11 [Mycobacterium tuberculosis CDC1551] >gi|31617411|emb|CAD93521.1| PROBABLE 50S RIBOSOMAL PROTEIN L11 RPLK [Mycobacterium bovis AF2122/97] >gi|121492208|emb|CAL70675.1| Probable 50S ribosomal protein l11 rplK [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600030|gb|EAY59040.1| 50S ribosomal protein L11 rplK [Mycobacterium tuberculosis C] >gi|134149108|gb|EBA41153.1| 50S ribosomal protein L11 rplK [Mycobacterium tuberculosis str. Haarlem] >gi|148504566|gb|ABQ72375.1| 50S ribosomal protein L11 [Mycobacterium tuberculosis H37Ra] >gi|148720371|gb|ABR04996.1| 50S ribosomal protein L11 rplK [Mycobacterium tuberculosis F11] (142 aa)
Score = 245, Expect = 1.1e-19, Identities = 55/133 (41%), Positives = 85/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ ++ GQA P    GP L   G+N+ EF K +N  T+++ G VIP  IT ++D+SFTF +KT P   LL KAA +  G+       VA ++ ++  EIA+TK  D NAND +A  +++AG+A+ MGI +E
  S:     6 KVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTWDQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE 142
>gi|109896922|ref|YP_660177.1| ribosomal protein L11 [Pseudoalteromonas atlantica T6c] >gi|123171719|sp|Q15YB5|RL11_PSEA6 50S ribosomal protein L11 >gi|109699203|gb|ABG39123.1| LSU ribosomal protein L11P [Pseudoalteromonas atlantica T6c] (142 aa)
Score = 245, Expect = 1.1e-19, Identities = 61/134 (45%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T I K+ +  G A P    GP L   G+N+ EF K FN +T D + G  +P  IT ++D+SFTFE KT+P + +LKKAA IK G+    TE V  ++  +  EIAK K  D  A D EA +R +AGSA+ MG+ +EG
  S:     4 KVTGIIKLQVAAGAANPSPPVGPALGQKGVNIMEFCKAFNAKTGDMEKGSPVPVEITVYEDRSFTFETKTSPASYMLKKAAGIKSGSGRPNTEKVGKVTLAQLEEIAKAKEPDLTAADLEAAVRTIAGSARSMGLVVEG 142
>gi|17232792|ref|NP_489340.1| 50S ribosomal protein L11 [Nostoc sp. PCC 7120] >gi|75908766|ref|YP_323062.1| 50S ribosomal protein L11 [Anabaena variabilis ATCC 29413] >gi|38605405|sp|Q8YLJ8|RL11_ANASP 50S ribosomal protein L11 >gi|118597133|sp|Q3MA19|RL11_ANAVT 50S ribosomal protein L11 >gi|17134439|dbj|BAB76999.1| 50S ribosomal protein L11 [Nostoc sp. PCC 7120] >gi|75702491|gb|ABA22167.1| LSU ribosomal protein L11P [Anabaena variabilis ATCC 29413] (141 aa)
Score = 244, Expect = 1.1e-19, Identities = 55/132 (41%), Positives = 89/132 (67%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T D+ G VIP  I+ ++D+SFTF +KT P ++L++KAA I+ G+     + V TI+  +  EIA+TKL D NAND +A +++VAG+A+ MG+ +
  S:     4 KVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNAKTADQAGMVIPVEISVYEDRSFTFVLKTPPASVLIRKAAKIERGSNEPNKKKVGTITTAQLREIAQTKLPDLNANDIDAAMKIVAGTARNMGVTV 139
>gi|24380007|ref|NP_721962.1| 50S ribosomal protein L11 [Streptococcus mutans UA159] >gi|38605302|sp|Q8DSX9|RL11_STRMU 50S ribosomal protein L11 >gi|24377995|gb|AAN59268.1|AE014993_12 50S ribosomal L11 protein [Streptococcus mutans UA159] (141 aa)
Score = 244, Expect = 1.1e-19, Identities = 55/132 (41%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  I K+ +  G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA +  G+       VA+++R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     4 KVENIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFVTKTPPAAVLLKKAAGVDKGSGEPNKTKVASVTRAQVQEIAETKMPDLNAANLESAMRMIEGTARSMGFTV 139
>gi|20808672|ref|NP_623843.1| ribosomal protein L11 [Thermoanaerobacter tengcongensis MB4] >gi|38605368|sp|Q8R7U2|RL11_THETN 50S ribosomal protein L11 >gi|20517308|gb|AAM25447.1| Ribosomal protein L11 [Thermoanaerobacter tengcongensis MB4] (140 aa)
Score = 244, Expect = 1.1e-19, Identities = 53/132 (40%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P P + +     G+N+  F K+FN++T    G +IP +IT + D+SF+F  KT P ++LLKKAA I+ G+     + V  I++++  EIA+ K+ D N  D EA +RM+AG+A+ MGI+I
  S:     4 KVVAVVKIQLPAGKATPAPPVGTALGPHGVNIMAFCKEFNERTAKDAGLIIPVVITIYSDRSFSFITKTPPASVLLKKAAGIESGSPQPNKQKVGKITKQQLREIAEIKMRDLNTTDIEAAMRMIAGTARSMGIEI 139
>gi|23492323|dbj|BAC17297.1| putative 50S ribosomal protein L11 [Corynebacterium efficiens YS-314] (180 aa)
Score = 244, Expect = 1.2e-19, Identities = 56/140 (40%), Positives = 90/140 (64%)
  Q:     4 VAFKDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +A K  ++T + K+ +  GQA P    GP L + G+N+ EF K +N  T+++ G V+P  IT ++D+SF F++KT P   LL KAA ++ G+    T  V  ++ ++  EIA+TK  D NA D +A  +++AG+A+ MGI +EG
  S:    37 MAPKKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTNKVGKVTMDQIREIAETKKEDLNARDIDAAAKIIAGTARSMGITVEG 180
>gi|90020567|ref|YP_526394.1| 50S ribosomal protein L11P [Saccharophagus degradans 2-40] >gi|118597291|sp|Q21M97|RL11_SACD2 50S ribosomal protein L11 >gi|89950167|gb|ABD80182.1| LSU ribosomal protein L11P [Saccharophagus degradans 2-40] (143 aa)
Score = 244, Expect = 1.2e-19, Identities = 56/129 (43%), Positives = 83/129 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +I+ + D+SFTF +KT P + LLKKAA +K G+    T+ V  ++R +  EIA  K+ D  A D +A +R +AGSA+ MG++ EGV
  S:    10 KLQVAAGKANPSPPVGPALGQKGVNIMEFCKAFNAQTQGMEPGSPVPVVISVYSDRSFTFTMKTPPASFLLKKAAGLKSGSARPNTQKVGKVTRAQLEEIATIKMADLTAGDMDAAVRTIAGSARAMGLETEGV 143
>gi|41410210|ref|NP_963046.1| 50S ribosomal protein L11 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118465827|ref|YP_883655.1| 50S ribosomal protein L11 [Mycobacterium avium 104] >gi|166230161|sp|A0QL67|RL11_MYCA1 50S ribosomal protein L11 >gi|54039074|sp|P62438|RL11_MYCPA 50S ribosomal protein L11 >gi|41399044|gb|AAS06662.1| RplK [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167114|gb|ABK68011.1| ribosomal protein L11 [Mycobacterium avium 104] (142 aa)
Score = 244, Expect = 1.3e-19, Identities = 56/133 (42%), Positives = 85/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  GQA P    GP L   G+N+ EF K +N  T+++ G+VIP  IT ++D+SFTF +KT P   LL KAA +  G+       VA +S ++  EIA+TK  D NAND +A  +++AG+A+ MGI +E
  S:     6 KVVGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGQVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVGKGSAEPHKNKVAKVSWDQVKEIAETKKADLNANDIDAAAKIIAGTARSMGITVE 142
>gi|51244965|ref|YP_064849.1| 50S ribosomal protein L11 [Desulfotalea psychrophila LSv54] >gi|56404772|sp|Q6AP82|RL11_DESPS 50S ribosomal protein L11 >gi|50876002|emb|CAG35842.1| probable 50S ribosomal protein L11 [Desulfotalea psychrophila LSv54] (141 aa)
Score = 244, Expect = 1.3e-19, Identities = 55/126 (43%), Positives = 82/126 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  G+A P    GP L   G+N+ EF K FN +T+     ++P +IT ++D+SF+F  KT P  +LL KAANI  G+ N K+E VA IS+EK  EIA+ K+ D NA D +A + ++ G+A+  GI +
  S:    10 KLQIPAGKANPSPPVGPALGQHGVNIMEFCKGFNARTQSMGDTIVPVVITVYQDRSFSFITKTPPAAVLLMKAANITKGSSNPKSERVAEISKEKIREIAEIKMPDLNAYDIDAAMLIIEGTARSAGITV 139
>gi|77413994|ref|ZP_00790167.1| ribosomal protein L11 [Streptococcus agalactiae 515] >gi|77159974|gb|EAO71112.1| ribosomal protein L11 [Streptococcus agalactiae 515] (141 aa)
Score = 244, Expect = 1.4e-19, Identities = 55/132 (41%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+    G+A P    GP L   GIN+  FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+       VAT++R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     4 KVEKLVKLQXPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGEPNKTKVATVTRAQVQEIAETKMPDLNAANLESAMRMIEGTARSMGFTV 139
>gi|33866873|ref|NP_898432.1| 50S ribosomal protein L11 [Synechococcus sp. WH 8102] >gi|50403582|sp|Q7U3T6|RL11_SYNPX 50S ribosomal protein L11 >gi|33639474|emb|CAE08858.1| 50S ribosomal protein L11 [Synechococcus sp. WH 8102] (141 aa)
Score = 244, Expect = 1.4e-19, Identities = 56/132 (42%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ ++D+SFTF  KT P ++L+ KAA I+ G+  S    V +I+R +  EIAKTKL D N    E+ +R++ G+A+ MG+ I
  S:     4 KVTAVIKLALQAGKANPAPPVGPALGQHGVNIMMFCKEYNARTQDKAGFVIPVEISVYEDRSFTFITKTPPASVLITKAAKIEKGSGESAKGNVGSINRAQLEEIAKTKLPDLNCTSVESAMRIIEGTARNMGVSI 139
>gi|73663527|ref|YP_302308.1| 50S ribosomal protein L11 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581573|sp|Q49V47|RL11_STAS1 50S ribosomal protein L11 >gi|72496042|dbj|BAE19363.1| 50S ribosomal protein L11 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (140 aa)
Score = 244, Expect = 1.4e-19, Identities = 53/133 (39%), Positives = 88/133 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ +  G+A P    GP L   G+N+  F K+FN +T++  G +IP  I+ ++D+SFTF  KT P  +LLKKAA ++ G+       VAT+++++  EIA  K+ D NA DEEA +R++ G+A+ MGI ++
  S:     4 KVEKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQEDAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGVEKGSGEPNKTKVATVTKDQVREIANQKMQDLNAADEEAAMRIIEGTARSMGITVQ 140
>gi|89095349|ref|ZP_01168266.1| ribosomal protein L11 [Oceanospirillum sp. MED92] >gi|89080391|gb|EAR59646.1| ribosomal protein L11 [Oceanospirillum sp. MED92] (144 aa)
Score = 243, Expect = 1.5e-19, Identities = 60/134 (44%), Positives = 82/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  G A P    GP L   G+N+ EF K FN QT+  +NG  +P +IT + D+SFTF  KT P  +LLKKAA +K G+    TE V  ISR +  EIA  K+ D  A D +A +R +AG+A+ MG+  EG
  S:     4 KIEAYIKLQVPAGGANPSPPVGPALGQHGVNIMEFCKAFNAQTQSMENGLPVPVVITVYADRSFTFITKTPPAAVLLKKAAGLKSGSGRPNTEKVGNISRAQMEEIATVKMPDLTAADMDAAVRTIAGTARSMGLIPEG 142
>gi|9107868|gb|AAF85434.1|AE004071_2 50S ribosomal protein L11 [Xylella fastidiosa 9a5c] (158 aa)
Score = 243, Expect = 1.6e-19, Identities = 58/128 (45%), Positives = 84/128 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   G+N+ +F K FN  T K + G  IP +ITA+ D++FTF  KT P ++LLKK   I+ G+K   TE V  ++R++  +IAKTK +D  A D +A +R +AGSA+ MG+ +EG
  S:    26 KLQVKAGQASPSPPVGPALGQRGLNIMDFCKAFNAATQKVEQGLPIPVVITAYSDRTFTFITKTPPASILLKKIVGIQSGSKRPNTEKVGKVTRKQLEDIAKTKELDMTAADLDAAVRTIAGSARSMGLVVEG 158
>gi|16799357|ref|NP_469625.1| 50S ribosomal protein L11 [Listeria innocua Clip11262] >gi|16802294|ref|NP_463779.1| 50S ribosomal protein L11 [Listeria monocytogenes EGD-e] >gi|46906481|ref|YP_012870.1| 50S ribosomal protein L11 [Listeria monocytogenes str. 4b F2365] >gi|47094525|ref|ZP_00232192.1| ribosomal protein L11 [Listeria monocytogenes str. 4b H7858] >gi|116871631|ref|YP_848412.1| 50S ribosomal protein L11 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153165278|ref|ZP_01926229.1| ribosomal protein L11 [Listeria monocytogenes FSL N1-017] >gi|153172935|ref|ZP_01928870.1| ribosomal protein L11 [Listeria monocytogenes FSL N3-165] >gi|153177975|ref|ZP_01931667.1| ribosomal protein L11 [Listeria monocytogenes F6900] >gi|153186396|ref|ZP_01936714.1| ribosomal protein L11 [Listeria monocytogenes J0161] >gi|153189502|ref|ZP_01937086.1| ribosomal protein L11 [Listeria monocytogenes J2818] >gi|153198258|ref|ZP_01942363.1| ribosomal protein L11 [Listeria monocytogenes 10403S] >gi|153200708|ref|ZP_01942789.1| ribosomal protein L11 [Listeria monocytogenes HPB2262] >gi|167211280|ref|ZP_02281587.1| 50S ribosomal protein L11 [Listeria monocytogenes LO28] >gi|167452953|ref|ZP_02319176.1| 50S ribosomal protein L11 [Listeria monocytogenes FSL J2-064] >gi|168264884|ref|ZP_02686849.1| 50S ribosomal protein L11 [Listeria monocytogenes FSL J2-071] >gi|123465953|sp|A0AF47|RL11_LISW6 50S ribosomal protein L11 >gi|54039086|sp|P66055|RL11_LISIN 50S ribosomal protein L11 >gi|54041816|sp|P66054|RL11_LISMO 50S ribosomal protein L11 >gi|56404818|sp|Q724G4|RL11_LISMF 50S ribosomal protein L11 >gi|16409613|emb|CAD00775.1| ribosomal protein L11 [Listeria monocytogenes] >gi|16412709|emb|CAC95513.1| ribosomal protein L11 [Listeria innocua] >gi|46879745|gb|AAT03047.1| ribosomal protein L11 [Listeria monocytogenes str. 4b F2365] >gi|47017097|gb|EAL07963.1| ribosomal protein L11 [Listeria monocytogenes str. 4b H7858] >gi|116740509|emb|CAK19629.1| rplK [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126941164|gb|EBA19057.1| ribosomal protein L11 [Listeria monocytogenes J0161] >gi|127632089|gb|EBA21802.1| ribosomal protein L11 [Listeria monocytogenes 10403S] >gi|127766677|gb|EBA27007.1| ribosomal protein L11 [Listeria monocytogenes J2818] >gi|133728311|gb|EBA30009.1| ribosomal protein L11 [Listeria monocytogenes FSL N1-017] >gi|133731242|gb|EBA32940.1| ribosomal protein L11 [Listeria monocytogenes FSL N3-165] >gi|133733880|gb|EBA35578.1| ribosomal protein L11 [Listeria monocytogenes F6900] >gi|133736450|gb|EBA38148.1| ribosomal protein L11 [Listeria monocytogenes HPB2262] (141 aa)
Score = 243, Expect = 1.7e-19, Identities = 56/133 (42%), Positives = 87/133 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ +  K+ +  G+A P    GP L   G+N+  F K+FN +T D+ G +IP +IT F+D+SFTF  KT P  +LLKKAA ++ G+       VA+++R +  EIA+TK+ D NA + E+ + MV G+A+ MGI I+
  S:     4 KVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQVQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQ 140
>gi|83591288|ref|YP_431297.1| 50S ribosomal protein L11 [Moorella thermoacetica ATCC 39073] >gi|118597260|sp|Q2RFN5|RL11_MOOTA 50S ribosomal protein L11 >gi|83574202|gb|ABC20754.1| LSU ribosomal protein L11P [Moorella thermoacetica ATCC 39073] (141 aa)
Score = 243, Expect = 1.8e-19, Identities = 56/134 (41%), Positives = 84/134 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  I K+ +  G+A P    GP L   G+N+  F K+FND+T  + G +IP  IT ++D+SFTF  KT P  +LLKKA  I+  +     + V  +SREK  EIA+ K+ D NA   EA +RM+ G+A+ MG+++E 
  S:     4 KVAAIVKLQVPAGKATPAPPVGPALGQHGVNIMAFVKEFNDRTASQAGLIIPVEITVYEDRSFTFITKTPPAAVLLKKALGIETASGEPNRKKVGKVSREKIREIAEMKMKDLNAASIEAAMRMIEGTARSMGVEVEA 141
>gi|74316412|ref|YP_314152.1| 50S ribosomal protein L11 [Thiobacillus denitrificans ATCC 25259] >gi|118597356|sp|Q3SF21|RL11_THIDA 50S ribosomal protein L11 >gi|74055907|gb|AAZ96347.1| Ribosomal protein L11 [Thiobacillus denitrificans ATCC 25259] (143 aa)
Score = 243, Expect = 1.8e-19, Identities = 63/135 (46%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN +T+  + G  IP +ITAF DKSFTF +KT P T+L+KKA  +  G+    T+ V TI+R +  EIAKTK  D  A D +A +R +AG+A+ MGI +EGV
  S:     4 KIVGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAKTQGMEPGLPIPVVITAFADKSFTFIMKTPPATVLIKKAIKLDKGSSKPHTDKVGTITRAQLEEIAKTKEPDLTAADMDAAVRTIAGTARSMGIVVEGV 143
>gi|113474160|ref|YP_720221.1| 50S ribosomal protein L11P [Trichodesmium erythraeum IMS101] >gi|123057153|sp|Q119S6|RL11_TRIEI 50S ribosomal protein L11 >gi|110165208|gb|ABG49748.1| LSU ribosomal protein L11P [Trichodesmium erythraeum IMS101] (141 aa)
Score = 243, Expect = 1.9e-19, Identities = 53/132 (40%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+  F K++N +T D+ G V+P  I+ ++D+SFTF +KT P  +L+KKAA ++ G+       V +I++ +  EIA+TK+ D NAN+ EA +++VAG+A+ MGI I
  S:     4 KVVAVIKLAITAGKANPSPPIGPALGQHGVNIMAFCKEYNAKTADQAGTVVPVEISVYEDRSFTFVLKTPPAAVLIKKAAGVESGSSEPNRTKVGSITQAQLQEIAQTKMPDLNANNIEAAMKIVAGTARNMGITI 139
>gi|56551621|ref|YP_162460.1| 50S ribosomal protein L11 [Zymomonas mobilis subsp. mobilis ZM4] >gi|61214721|sp|Q5NPL1|RL11_ZYMMO 50S ribosomal protein L11 >gi|56543195|gb|AAV89349.1| ribosomal protein L11 [Zymomonas mobilis subsp. mobilis ZM4] (143 aa)
Score = 242, Expect = 1.9e-19, Identities = 58/132 (43%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+ +  G+A P    GP L   G+N+ EF K FN +++  + G  +P IIT + D+SF+FE K  PV+ LLKKA N+K G+K         I R + +EIA TK+ D NAND EA  R++ GSA+ MG+++
  S:     4 KITGYIKLQVPAGKANPSPPIGPALGQRGVNIMEFCKAFNAKSQGMEPGTPLPTIITVYADRSFSFESKMPPVSYLLKKAINLKSGSKEPGKAVAGKIKRSQIVEIANTKMPDLNANDVEAATRIIEGSARAMGLEV 140
>gi|89902360|ref|YP_524831.1| ribosomal protein L11 [Rhodoferax ferrireducens T118] >gi|118597283|sp|Q21SF3|RL11_RHOFD 50S ribosomal protein L11 >gi|89347097|gb|ABD71300.1| LSU ribosomal protein L11P [Rhodoferax ferrireducens T118] (143 aa)
Score = 242, Expect = 2.1e-19, Identities = 60/135 (44%), Positives = 87/135 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITAF DKSFTF IK+ P ++L+KKA  +  G+   ++  V  I+R +  EIAKTK+ D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIVGFVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGIEPGLPLPVVITAFADKSFTFVIKSPPSSILIKKAVGVTKGSATPQSVKVGKITRAQLEEIAKTKMKDLTAADMDAAVRTIAGSARSMGVNVEGV 143
>gi|77359189|ref|YP_338764.1| 50S ribosomal subunit protein L11 [Pseudoalteromonas haloplanktis TAC125] >gi|119364579|sp|Q3ILQ4|RL11_PSEHT 50S ribosomal protein L11 >gi|76874100|emb|CAI85321.1| 50S ribosomal subunit protein L11 [Pseudoalteromonas haloplanktis TAC125] (142 aa)
Score = 242, Expect = 2.1e-19, Identities = 55/133 (41%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  +P +I+ + D+SFTF++KT P   LL KAA +K G+    TE V T++R +  EI +TK  D  A+D EA +R +AGSA+ MG+ +E
  S:     4 KVEALIKLQVNAGMANPSPPVGPALGQHGVNIMEFCKAFNARTESIEKGAPVPVVISVYGDRSFTFDMKTPPAAYLLLKAAGVKSGSGRPNTEKVGTVTRAQLEEIVETKRADLTASDLEAAVRTIAGSARAMGLSVE 141
>gi|82701888|ref|YP_411454.1| 50S ribosomal protein L11 [Nitrosospira multiformis ATCC 25196] >gi|118597266|sp|Q2YB09|RL11_NITMU 50S ribosomal protein L11 >gi|82409953|gb|ABB74062.1| LSU ribosomal protein L11P [Nitrosospira multiformis ATCC 25196] (143 aa)
Score = 242, Expect = 2.2e-19, Identities = 59/134 (44%), Positives = 88/134 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  G+A P    GP L   G+N+ EF K FN  T K + G  +P +ITA+ DKSFTF +KTTP T+L+KKAA +  G+    T+ +  ++R++  EIA+ K+ D  A D +A +R +AGSA+ MGI++EG
  S:     4 KIVGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAATQKMEVGLPVPVVITAYADKSFTFTMKTTPATVLIKKAAGVGKGSAKPHTDKIGRLTRKQMEEIAQIKMPDLTAADMDAAVRTIAGSARSMGIEVEG 142
>gi|124268639|ref|YP_001022643.1| 50S ribosomal protein L11P [Methylibium petroleiphilum PM1] >gi|166230158|sp|A2SLG9|RL11_METPP 50S ribosomal protein L11 >gi|124261414|gb|ABM96408.1| LSU ribosomal protein L11P [Methylibium petroleiphilum PM1] (143 aa)
Score = 242, Expect = 2.3e-19, Identities = 61/135 (45%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G V+P +ITAF DKSFTF +K+ P T+L+KKA  +  G+    T+ V  I+R +  EIAKTK  D  A D +A +R +AG+A+ MG+  EGV
  S:     4 KIVGFIKLQIPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQSMEPGLVLPVVITAFADKSFTFVLKSPPATVLIKKAIKLDKGSSKPHTDKVGKITRAQLEEIAKTKTKDLTAADLDAAVRTIAGTARSMGVTTEGV 143
>gi|88799207|ref|ZP_01114786.1| ribosomal protein L11 [Reinekea sp. MED297] >gi|88777966|gb|EAR09162.1| ribosomal protein L11 [Reinekea sp. MED297] (144 aa)
Score = 242, Expect = 2.4e-19, Identities = 57/130 (43%), Positives = 83/130 (63%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           K+ +  GQA P    GP L   G+N+ EF K FN +T+  + G  +P +IT + D+SFTF  KT P  +LLKKAA I+ G+    TE V T++R +  EIA  K  D  + D +A +R +AG+A+ MG+ +EGV+
  S:    10 KLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAETQSLEAGLPVPVVITVYSDRSFTFITKTPPAAILLKKAAGIQSGSGRPNTEKVGTVTRAQLEEIATAKEPDLTSADMDAAVRTIAGTARSMGLNVEGVE 144
>gi|86749397|ref|YP_485893.1| 50S ribosomal protein L11 [Rhodopseudomonas palustris HaA2] >gi|118597284|sp|Q2IXS8|RL11_RHOP2 50S ribosomal protein L11 >gi|86572425|gb|ABD06982.1| LSU ribosomal protein L11P [Rhodopseudomonas palustris HaA2] (142 aa)
Score = 241, Expect = 2.5e-19, Identities = 55/134 (41%), Positives = 86/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AA I+ G+K    ++   ++  +  EIA+ K+ D N +  E+ +RMV GSA+ MG+++EG
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMSFFLKQAAKIQSGSKLPGRDSAGKVTSAQVREIAEKKMKDLNCDSIESAMRMVEGSARSMGLQVEG 142
>gi|15594738|ref|NP_212527.1| 50S ribosomal protein L11 [Borrelia burgdorferi B31] >gi|167933371|ref|ZP_02520446.1| 50S ribosomal protein L11 [Borrelia burgdorferi ZS7] >gi|167944269|ref|ZP_02531343.1| 50S ribosomal protein L11 [Borrelia burgdorferi Bol26] >gi|168692030|ref|ZP_02724822.1| 50S ribosomal protein L11 [Borrelia burgdorferi 94a] >gi|195941257|ref|ZP_03086639.1| 50S ribosomal protein L11 [Borrelia burgdorferi 80a] >gi|195949967|ref|ZP_03091067.1| 50S ribosomal protein L11 [Borrelia burgdorferi WI91-23] >gi|195952041|ref|ZP_03093138.1| 50S ribosomal protein L11 [Borrelia burgdorferi 29805] >gi|195960183|ref|ZP_03096388.1| 50S ribosomal protein L11 [Borrelia burgdorferi 64b] >gi|3914675|sp|O51354|RL11_BORBU 50S ribosomal protein L11 >gi|2688304|gb|AAC66772.1| ribosomal protein L11 (rplK) [Borrelia burgdorferi B31] (143 aa)
Score = 241, Expect = 2.5e-19, Identities = 57/127 (44%), Positives = 88/127 (69%)
  Q:    16 KVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +   QA PG ++       G++  +F K+FN++T K   G V+P IIT + DKSF+F +KT P ++L+KKA  I+ G+K S T+ V TIS+EK +EIA+ K+ D NA  E A  +++AGSA+ MG+++E
  S:    11 KLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFNERTAKMDPGIVVPVIITVYSDKSFSFIVKTPPASILIKKAIGIESGSKKSNTDKVGTISKEKLMEIARIKMSDLNAKSESAAFKIIAGSARSMGVEVE 142
>gi|19551719|ref|NP_599721.1| 50S ribosomal protein L11 [Corynebacterium glutamicum ATCC 13032] >gi|62389374|ref|YP_224776.1| 50S ribosomal protein L11 [Corynebacterium glutamicum ATCC 13032] >gi|38605496|sp|Q9LAK6|RL11_CORGL 50S ribosomal protein L11 >gi|7108628|gb|AAF36507.1|AF130462_4 50S ribosomal protein L11 [Corynebacterium glutamicum] >gi|14041188|emb|CAC38384.1| L11 protein [Corynebacterium glutamicum] >gi|21323241|dbj|BAB97869.1| Ribosomal protein L11 [Corynebacterium glutamicum ATCC 13032] >gi|41324708|emb|CAF19190.1| 50S RIBOSOMAL PROTEIN L11 [Corynebacterium glutamicum ATCC 13032] (145 aa)
Score = 241, Expect = 2.6e-19, Identities = 56/137 (40%), Positives = 88/137 (64%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  GQA P    GP L + G+N+ EF K +N  T+++ G V+P  IT ++D+SF F++KT P   LL KAA ++ G+    T+ V  +S  +  EIA+TK  D NA D +A  +++AG+A+ MGI +EG
  S:     5 KKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGKVSMAQVREIAETKKEDLNARDIDAAAKIIAGTARSMGITVEG 145
>gi|33860764|ref|NP_892325.1| 50S ribosomal protein L11 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|38605171|sp|Q7V381|RL11_PROMP 50S ribosomal protein L11 >gi|33633706|emb|CAE18663.1| 50S ribosomal protein L11 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (141 aa)
Score = 241, Expect = 2.7e-19, Identities = 57/132 (43%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P ++L+ KAA I+ GA  S   +V  IS+ +  EIAKTKL D N    E+ ++++ G+A+ MG+ I
  S:     4 KIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKAGFVIPVEISVFEDRSFTFITKTPPASVLITKAAGIEKGAGESSKGSVGNISKSQLEEIAKTKLPDLNCTSIESAMKVIEGTARNMGVSI 139
>gi|21241726|ref|NP_641308.1| 50S ribosomal protein L11 [Xanthomonas axonopodis pv. citri str. 306] >gi|38605363|sp|Q8PNT4|RL11_XANAC 50S ribosomal protein L11 >gi|21107095|gb|AAM35844.1| 50S ribosomal protein L11 [Xanthomonas axonopodis pv. citri str. 306] (142 aa)
Score = 241, Expect = 3.1e-19, Identities = 61/134 (45%), Positives = 86/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +IT   K+ +  GQA P    GP L   G+N+ EF K FN  T K + G   P IITA+ D++FTF  K+TP ++LLKKAA +  G+K   T+ V  ++R++  EIAK K  D  A + EA +R +AGSA+ MG+ +EG
  S:     4 KITAFIKLQVKAGQANPAPPVGPALGQRGLNIMEFCKAFNAATSKLEPGLPTPVIITAYSDRTFTFVTKSTPASVLLKKAAGVSSGSKRPNTDKVGKVTRKQLEEIAKVKEADLTAAELEAAVRTIAGSARSMGLTVEG 142
>gi|114567854|ref|YP_755008.1| ribosomal protein L11 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317274|sp|Q0AUG7|RL11_SYNWW 50S ribosomal protein L11 >gi|114338789|gb|ABI69637.1| LSU ribosomal protein L11P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (141 aa)
Score = 240, Expect = 3.4e-19, Identities = 54/125 (43%), Positives = 83/125 (66%)
  Q:    17 VNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           + +  G+A P    GP L   G+N+  F K++N +T ++ G ++P  IT F+D+SFTF IK+ P + LLKKAANI  G+     + +  + R K LEIA+TK  D NA+D EA ++M+ G+A+ MG++I
  S:    11 LQIAAGKATPAPPVGPALGQYGVNIMGFCKEYNARTANQAGYIVPVEITVFEDRSFTFVIKSPPASDLLKKAANIDKGSGEPNKKKIGKVPRAKLLEIAETKKEDLNASDIEAAVKMIEGTARSMGLEI 139
>gi|161485997|ref|NP_737097.2| 50S ribosomal protein L11 [Corynebacterium efficiens YS-314] >gi|38605322|sp|Q8FSA7|RL11_COREF 50S ribosomal protein L11 (144 aa)
Score = 240, Expect = 3.4e-19, Identities = 56/140 (40%), Positives = 90/140 (64%)
  Q:     4 VAFKDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +A K  ++T + K+ +  GQA P    GP L + G+N+ EF K +N  T+++ G V+P  IT ++D+SF F++KT P   LL KAA ++ G+    T  V  ++ ++  EIA+TK  D NA D +A  +++AG+A+ MGI +EG
  S:     1 MAPKKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAYNAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTNKVGKVTMDQIREIAETKKEDLNARDIDAAAKIIAGTARSMGITVEG 144
>gi|88861456|ref|ZP_01136083.1| 50S ribosomal subunit protein L11 [Pseudoalteromonas tunicata D2] >gi|88816538|gb|EAR26366.1| 50S ribosomal subunit protein L11 [Pseudoalteromonas tunicata D2] (142 aa)
Score = 240, Expect = 3.7e-19, Identities = 57/134 (42%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  + K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  +P +I+ + D+SFTFE+KT P T LLKKAA IK G+  + T  V T++R +  +I K K  D  A D EA +R +AGSA+ +G+ +EG
  S:     4 KVEALIKLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNARTESMEKGAPVPVVISVYGDRSFTFEMKTPPATYLLKKAAGIKSGSARANTVKVGTVTRAQLEDIVKAKQTDLTAADLEAGVRTIAGSARSIGLVVEG 142
>gi|78046543|ref|YP_362718.1| 50S ribosomal protein L11 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|118597358|sp|Q3BWZ5|RL11_XANC5 50S ribosomal protein L11 >gi|78034973|emb|CAJ22618.1| 50S ribosomal protein L11 [Xanthomonas campestris pv. vesicatoria str. 85-10] (142 aa)
Score = 240, Expect = 3.8e-19, Identities = 61/134 (45%), Positives = 86/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +IT   K+ +  GQA P    GP L   G+N+ EF K FN  T K + G   P IITA+ D++FTF  K+TP ++LLKKAA +  G+K   T+ V  ++R++  EIAK K  D  A + EA +R +AGSA+ MG+ +EG
  S:     4 KITAFIKLQVKAGQANPAPPVGPALGQRGLNIMEFCKAFNAATSKLEPGLPTPVIITAYSDRTFTFVTKSTPASVLLKKAAGVTSGSKRPNTDKVGKVTRKQLEEIAKVKEADLTAAELEAAVRTIAGSARSMGLTVEG 142
>gi|29831453|ref|NP_826087.1| 50S ribosomal protein L11 [Streptomyces avermitilis MA-4680] >gi|38605220|sp|Q82DQ9|RL11_STRAW 50S ribosomal protein L11 >gi|29608568|dbj|BAC72622.1| putative ribosomal protein L11 [Streptomyces avermitilis MA-4680] (144 aa)
Score = 240, Expect = 3.8e-19, Identities = 57/137 (41%), Positives = 85/137 (62%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF  KT P   ++ KAA ++ G+       VA I++ +  EIA TKL D NAND +A  +++AG+A+ MGI +EG
  S:     4 KKKKVTGLIKLQIQAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFITKTPPAAKMILKAAGVEKGSGEPHKTKVAKITQAQVREIATTKLPDLNANDLDAASKIIAGTARSMGITVEG 144
>gi|90424961|ref|YP_533331.1| 50S ribosomal protein L11 [Rhodopseudomonas palustris BisB18] >gi|118597285|sp|Q211C4|RL11_RHOPB 50S ribosomal protein L11 >gi|90106975|gb|ABD89012.1| LSU ribosomal protein L11P [Rhodopseudomonas palustris BisB18] (142 aa)
Score = 240, Expect = 3.9e-19, Identities = 55/134 (41%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AAN+K G+K    +    ++  +  EIA+ K+ D N +  EA ++MV GSA+ MG+++ G
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMSFFLKQAANVKSGSKLPGRDVAGKVTSAQVREIAERKMKDLNCDSIEAAMKMVEGSARSMGLQVAG 142
>gi|50954136|ref|YP_061424.1| 50S ribosomal protein L11 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|56404770|sp|Q6AH26|RL11_LEIXX 50S ribosomal protein L11 >gi|50950618|gb|AAT88319.1| 50S ribosomal protein L11 [Leifsonia xyli subsp. xyli str. CTCB07] (143 aa)
Score = 240, Expect = 3.9e-19, Identities = 55/134 (41%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF +KT P   L+KKAA +  G+    T  V  +++E+   IA+ K+VD NAND +A  +++AG+A+ MGI +E 
  S:     6 KVTGLIKLQINAGAANPAPPIGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFVLKTPPAAELIKKAAGVAKGSGVPHTTKVGKLTQEQVRAIAEQKMVDLNANDIDAASKIIAGTARSMGITVEA 143
>gi|37521168|ref|NP_924545.1| 50S ribosomal protein L11 [Gloeobacter violaceus PCC 7421] >gi|38605132|sp|P60102|RL11_GLOVI 50S ribosomal protein L11 >gi|35212164|dbj|BAC89540.1| 50S ribosomal protein L11 [Gloeobacter violaceus PCC 7421] (141 aa)
Score = 240, Expect = 4.0e-19, Identities = 57/132 (43%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +++   K+ L  G+A P    GP L   G+N+  F K++N +T D+ G VIP  IT F+D+SFTF +KT P ++LL KAA ++ G+     E   TI+  +  +IA+ KL D NAND EA ++++AG+A+ MGI I
  S:     4 KVSAKIKLALPAGKANPAPPVGPALGQHGVNIMMFCKEYNARTADQVGMVIPVEITVFEDRSFTFVLKTPPASVLLTKAAGVEKGSGKPNKEKAGTITGAQLRQIAEQKLPDLNANDVEAAMKIIAGTARNMGIVI 139
>gi|84494812|ref|ZP_00993931.1| 50S ribosomal protein L11 [Janibacter sp. HTCC2649] >gi|84384305|gb|EAQ00185.1| 50S ribosomal protein L11 [Janibacter sp. HTCC2649] (145 aa)
Score = 240, Expect = 4.1e-19, Identities = 53/136 (38%), Positives = 86/136 (63%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K  +++    + +  G A P    GP L   G+N+ EF K +N  T+ + G +IP +IT F+D+SFTF  KT P + L+KKAA ++ G+       VA ++ ++  EIA+ K+ D NAND +A ++++AG+A+QMGI  +
  S:     4 KSKKVSGYINLQIQAGAATPAPPVGPALGQHGVNIMEFVKAYNAATEHQRGNIIPVVITVFEDRSFTFITKTPPASELIKKAAGVQKGSGEPHKTKVAKLTTDQVREIAEQKMPDLNANDIDAAMKIIAGTARQMGITTD 143
>gi|39936336|ref|NP_948612.1| 50S ribosomal protein L11 [Rhodopseudomonas palustris CGA009] >gi|167365736|ref|ZP_02299880.1| ribosomal protein L11 [Rhodopseudomonas palustris TIE-1] >gi|192292062|ref|YP_001992667.1| ribosomal protein L11 [Rhodopseudomonas palustris TIE-1] >gi|50403578|sp|P62441|RL11_RHOPA 50S ribosomal protein L11 (RRP-L11) >gi|39650191|emb|CAE28714.1| 50S ribosomal protein L11 [Rhodopseudomonas palustris CGA009] >gi|192285811|gb|ACF02192.1| ribosomal protein L11 [Rhodopseudomonas palustris TIE-1] (142 aa)
Score = 239, Expect = 4.3e-19, Identities = 55/134 (41%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AA I+ G+K    +    ++  +  EIA+ K+ D N +  E+ +RMV GSA+ MG+++EG
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMSYFLKQAAKIQSGSKLPGRDFAGKVTSAQVREIAEKKMKDLNCDTVESAMRMVEGSARSMGLRVEG 142
>gi|94676858|ref|YP_588933.1| ribosomal protein L11 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|118597136|sp|Q1LSY1|RL11_BAUCH 50S ribosomal protein L11 >gi|94220008|gb|ABF14167.1| ribosomal protein L11 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (142 aa)
Score = 239, Expect = 4.4e-19, Identities = 59/134 (44%), Positives = 83/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN QT++ + G  IP IIT + D+SFTF IKT P  +LL KAA IK GA   K E V  ++  +  EIA+ K+ D N+N+ EA+ R + G+A  MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKIFNLQTENFEKGLPIPVIITVYSDRSFTFIIKTPPAAVLLSKAAGIKSGANQPKKEQVGKVTYSQIREIAEKKVADMNSNNIEAISRSILGTALSMGLIVEG 142
>gi|2447004|dbj|BAA22445.1| ribosomal protein L11 [Streptomyces griseus] (140 aa)
Score = 239, Expect = 4.6e-19, Identities = 54/137 (39%), Positives = 82/137 (59%)
  Q:     7 KDPRITRIAKVNLIGGQAKPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P P +   G+N+ EF K +N  T+ + G V+P  IT ++D+SFTF  KT P   L+ KAA +  G+       VA ++  +  EIA TKL D NAND +A  +++AG+A+ MGI +EG
  S:     4 KKKKVTGLIKLQINAGAANPAPPVGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRSFTFVTKTPPAAKLILKAAGVDKGSGEPHKTKVAKLTAAQVREIATTKLPDLNANDLDAASKIIAGTARSMGITVEG 140
>gi|58583219|ref|YP_202235.1| 50S ribosomal protein L11 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84625055|ref|YP_452427.1| 50S ribosomal protein L11 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188575477|ref|YP_001912406.1| ribosomal protein L11 [Xanthomonas oryzae pv. oryzae PXO99A] >gi|75508097|sp|Q5GWS1|RL11_XANOR 50S ribosomal protein L11 >gi|118597359|sp|Q2NZX4|RL11_XANOM 50S ribosomal protein L11 >gi|58427813|gb|AAW76850.1| 50S ribosomal protein L11 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84368995|dbj|BAE70153.1| 50S ribosomal protein L11 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519929|gb|ACD57874.1| ribosomal protein L11 [Xanthomonas oryzae pv. oryzae PXO99A] (142 aa)
Score = 239, Expect = 4.7e-19, Identities = 60/134 (44%), Positives = 84/134 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  GQA P    GP L   G+N+ EF K FN  T K + G   P IITA+ D++FTF  K+TP ++LLKKAA +  G+K   T+ V  ++R++  EI K K  D  A D EA +R +AGSA+ MG+ +EG
  S:     4 KINCYIKLQVKAGQANPAPPVGPALGQRGLNIMEFCKAFNAATSKLEPGLPTPVIITAYSDRTFTFVTKSTPASVLLKKAAGVTSGSKRPNTDKVGKVTRKQLEEIVKVKEADLTAADLEAAVRTIAGSARSMGLTVEG 142
>gi|22297839|ref|NP_681086.1| 50S ribosomal protein L11 [Thermosynechococcus elongatus BP-1] >gi|38605298|sp|Q8DM28|RL11_SYNEL 50S ribosomal protein L11 >gi|22294016|dbj|BAC07848.1| 50S ribosomal protein L11 [Thermosynechococcus elongatus BP-1] (141 aa)
Score = 239, Expect = 4.7e-19, Identities = 52/132 (39%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+  F K++N +T D+ G V+P  I+ ++D+SFTF +KT P ++L++KAA I+ G+     + V +I+R +  EIA+ K+ D NAND EA +R++ G+A+ MG+ I
  S:     4 KVVAVIKLAIQAGKANPAPPIGPALGQHGVNIMMFCKEYNARTADQVGMVVPVEISVYEDRSFTFVLKTPPASVLIQKAAGIEKGSGEPNKKKVGSITRAQLREIAEKKMPDLNANDIEAAMRIIEGTARNMGVTI 139
>gi|91790279|ref|YP_551231.1| 50S ribosomal protein L11P [Polaromonas sp. JS666] >gi|118597272|sp|Q123F9|RL11_POLSJ 50S ribosomal protein L11 >gi|91699504|gb|ABE46333.1| LSU ribosomal protein L11P [Polaromonas sp. JS666] (144 aa)
Score = 239, Expect = 4.8e-19, Identities = 61/135 (45%), Positives = 84/135 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITA+ DKSFTF IKT P   L+KKA  +  G+    T  V  I+R +  EIAKTK+ D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIVGFVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGVEPGLPLPVVITAYADKSFTFIIKTPPAVTLIKKAIKLDKGSATPHTAKVGKITRAQLEEIAKTKMKDMTAADLDAAVRTIAGSARSMGVTVEGV 143
>gi|6225957|sp|O87085|RL11_STRAT 50S ribosomal protein L11 >gi|3355894|dbj|BAA31981.1| ribosomal protein L11 [Streptomyces antibioticus] (144 aa)
Score = 239, Expect = 4.8e-19, Identities = 56/137 (40%), Positives = 84/137 (61%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF + +N  T+ + G VIP  IT ++D+SFTF  KT P   ++ KAA I+ G+       VA I+  +  EIA TKL D NAND +A  +++AG+A+ MG+ +EG
  S:     4 KKKKVTGLIKLQIQAGAANPAPPVGPALGQHGVNIMEFCRAYNAATESQRGWVIPVEITVYEDRSFTFITKTPPAAKMILKAAGIEKGSGEPHKTKVAKITEAQVREIATTKLPDLNANDLDAAAKIIAGTARSMGVTVEG 144
>gi|108797897|ref|YP_638094.1| 50S ribosomal protein L11 [Mycobacterium sp. MCS] >gi|119866992|ref|YP_936944.1| 50S ribosomal protein L11 [Mycobacterium sp. KMS] >gi|122977370|sp|Q1BDJ6|RL11_MYCSS 50S ribosomal protein L11 >gi|166230165|sp|A1UBE6|RL11_MYCSK 50S ribosomal protein L11 >gi|108768316|gb|ABG07038.1| LSU ribosomal protein L11P [Mycobacterium sp. MCS] >gi|119693081|gb|ABL90154.1| LSU ribosomal protein L11P [Mycobacterium sp. KMS] (142 aa)
Score = 239, Expect = 5.0e-19, Identities = 55/133 (41%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ +  GQA P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF +KT P   LL KAA ++ G+       VA ++ ++  EIA+TK  D NAND +   +++AG+A+ MGI +E
  S:     6 KVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVQKGSGEPHKTKVAKVTWDQVREIAETKKSDLNANDIDQAAKIIAGTARSMGITVE 142
>gi|78776550|ref|YP_392865.1| ribosomal protein L11 [Sulfurimonas denitrificans DSM 1251] >gi|118597357|sp|Q30TQ1|RL11_THIDN 50S ribosomal protein L11 >gi|78497090|gb|ABB43630.1| LSU ribosomal protein L11P [Sulfurimonas denitrificans DSM 1251] (141 aa)
Score = 239, Expect = 5.1e-19, Identities = 57/132 (43%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I    K+ +  G+A P    GP L   G+N+ EFTK FN++TKDK G  +P +IT F DKSFTF +K  P + LL  AA +K G+ N     VA +++ + +EI   K+ D N +D+EA  + +AGSA+ +GI+I
  S:     4 KIMGYIKLQIEAGKATPAPPVGPALGQRGVNIMEFTKAFNEKTKDKMGFKVPVVITVFTDKSFTFVVKQPPASALLMHAAGLKGGSSNPLKNKVAKLTQAQLMEIVNRKIEDLNTDDKEAAAKTIAGSARSIGIEI 139
>gi|21223030|ref|NP_628809.1| 50S ribosomal protein L11 [Streptomyces coelicolor A3(2)] >gi|61230489|sp|P0A463|RL11_STRCO 50S ribosomal protein L11 >gi|61230497|sp|P0A464|RL11_STRLI 50S ribosomal protein L11 >gi|61230500|sp|P0A465|RL11_STRVN 50S ribosomal protein L11 >gi|971289|dbj|BAA06986.1| ribosomal protein [Streptomyces coelicolor A3(2)] >gi|3355896|dbj|BAA31982.1| ribosomal protein L11 [Streptomyces coelicolor A3(2)] >gi|3355898|dbj|BAA31983.1| ribosomal protein L11 [Streptomyces lividans] >gi|3355902|dbj|BAA31985.1| ribosomal protein L11 [Streptomyces violaceoruber] >gi|7248342|emb|CAB77422.1| 50S ribosomal protein L11 [Streptomyces coelicolor A3(2)] (144 aa)
Score = 239, Expect = 5.2e-19, Identities = 55/137 (40%), Positives = 85/137 (62%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF  KT P   ++ KAA ++ G+       VA I+R++  EIA TK+ D NAND +   +++AG+A+ MG+ +EG
  S:     4 KKKKVTGLIKLQIQAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFITKTPPAAKMILKAAGVEKGSGEPHKTKVAKITRDQVREIATTKMPDLNANDLDQAEKIIAGTARSMGVTVEG 144
>gi|25446681|gb|AAN74828.1| Putative plastid ribosomal protein L11 [Oryza sativa (japonica cultivar-group)] >gi|125584739|gb|EAZ25403.1| hypothetical protein OsJ_008886 [Oryza sativa (japonica cultivar-group)] (221 aa)
Score = 239, Expect = 5.4e-19, Identities = 56/140 (40%), Positives = 89/140 (63%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGK 153
           + K+ L  G+A P    GP L + G+N+  F K++N +T +K G +IP  IT F DKSFTF +KT P ++LL KAA I+ G+K  + E V  ++ ++   IA+ KL D N    ++ +R++AG+A  MGI+++   P++ K  K
  S:    66 LIKLALEAGKATPAPPVGPALGAKGVNIMSFCKEYNAKTAEKAGYIIPVEITVFDDKSFTFILKTPPASVLLLKAAGIEKGSKEPQREKVGKVTADQVRTIAQEKLPDLNCKSIDSAMRIIAGTAANMGIEVD--PPILEKKEK 207
>gi|15223354|ref|NP_174575.1| PRPL11 (PLASTID RIBOSOMAL PROTEIN L11); structural constituent of ribosome [Arabidopsis thaliana] >gi|38605500|sp|Q9MAP3|RK11_ARATH 50S ribosomal protein L11, chloroplast precursor (CL11) >gi|6910575|gb|AAF31280.1|AC006424_9 Very similar to Spinacia oleracea 50S ribosomal p> [Arabidopsis thaliana] >gi|11762194|gb|AAG40375.1|AF325023_1 At1g32990 [Arabidopsis thaliana] >gi|13877983|gb|AAK44069.1|AF370254_1 putative ribosomal protein L11 [Arabidopsis thaliana] >gi|15724330|gb|AAL06558.1|AF412105_1 At1g32990/F9L11_15 [Arabidopsis thaliana] >gi|17104711|gb|AAL34244.1| putative ribosomal protein L11 [Arabidopsis thaliana] >gi|21553791|gb|AAM62884.1| ribosomal protein L11, putative [Arabidopsis thaliana] (222 aa)
Score = 239, Expect = 5.4e-19, Identities = 61/148 (41%), Positives = 90/148 (60%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKK 154
           K  ++  + K+ L  G+A P    GP L S G+N+  F K +N +T DK G +IP  IT F DKSFTF +KT P ++LL KAA ++ G+K+ + + V  I+ ++   IA  KL D N    E+ +R++AG+A  MGI I   DP + +  KK
  S:    70 KAKKVVGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKAGYIIPVEITVFDDKSFTFILKTPPASVLLLKAAGVEKGSKDPQQDKVGVITIDQLRTIAAEKLPDLNCTTIESAMRIIAGTAANMGIDI---DPPILEPKKK 218
>gi|119714943|ref|YP_921908.1| 50S ribosomal protein L11P [Nocardioides sp. JS614] >gi|166230904|sp|A1SEI6|RL11_NOCSJ 50S ribosomal protein L11 >gi|119535604|gb|ABL80221.1| LSU ribosomal protein L11P [Nocardioides sp. JS614] (142 aa)
Score = 238, Expect = 5.9e-19, Identities = 56/133 (42%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I  + KV L  G A P P + +     G+N+ EF K +N QT+   G VIP  IT ++D+SFTF  KT P   L+KKAA ++ G+     E V  +++++  EIA+TKL D NAND EA +++V G+A+ MG+  +
  S:     6 KIAALVKVQLQAGAATPAPPVGTALGPHGVNIMEFCKAYNAQTESMRGNVIPVEITIYEDRSFTFITKTPPAAELIKKAAGLQKGSGVPHKEKVGKLTKDQVREIAQTKLPDLNANDIEAAMKIVEGTARSMGVTTD 142
>gi|91977668|ref|YP_570327.1| 50S ribosomal protein L11 [Rhodopseudomonas palustris BisB5] >gi|123721723|sp|Q134R3|RL11_RHOPS 50S ribosomal protein L11 >gi|91684124|gb|ABE40426.1| LSU ribosomal protein L11P [Rhodopseudomonas palustris BisB5] (142 aa)
Score = 238, Expect = 6.1e-19, Identities = 54/134 (40%), Positives = 86/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AA I+ G+K    ++   ++  +  EIA+ K+ D N +  ++ +RMV GSA+ MG+++EG
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFELKTPPMSFFLKQAAKIQSGSKLPGRDSAGKVTTAQVREIAEKKMKDLNCDSIDSAMRMVEGSARSMGLQVEG 142
>gi|81299445|ref|YP_399653.1| 50S ribosomal protein L11 [Synechococcus elongatus PCC 7942] >gi|118597310|sp|Q31QK3|RL11_SYNP7 50S ribosomal protein L11 >gi|81168326|gb|ABB56666.1| LSU ribosomal protein L11P [Synechococcus elongatus PCC 7942] (141 aa)
Score = 238, Expect = 6.5e-19, Identities = 56/132 (42%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF +KT P ++L+ KAA I+ G+ N     V  I+  +  EIA+TKL D N  + EA +R+V G+A+ MG+ I
  S:     4 KVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKVGLVIPVEISVFEDRSFTFILKTPPASVLIAKAAGIERGSGNPNKTKVGKITTAQLREIAETKLPDLNTKNVEAAMRIVEGTARNMGVTI 139
>gi|56750900|ref|YP_171601.1| 50S ribosomal protein L11 [Synechococcus elongatus PCC 6301] >gi|61214702|sp|Q5N3N9|RL11_SYNP6 50S ribosomal protein L11 >gi|56685859|dbj|BAD79081.1| 50S ribosomal protein L11 [Synechococcus elongatus PCC 6301] (141 aa)
Score = 238, Expect = 6.8e-19, Identities = 56/132 (42%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF +KT P ++L+ KAA I+ G+ N     V  I+  +  EIA+TKL D N  + EA +R+V G+A+ MG+ I
  S:     4 KVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNARTQDKVGLVIPVEISVFEDRSFTFILKTPPASVLIAKAAGIERGSGNPNKTKVGKITTAQLREIAETKLPDFNTKNVEAAMRIVEGTARNMGVTI 139
>gi|42518505|ref|NP_964435.1| 50S ribosomal protein L11 [Lactobacillus johnsonii NCC 533] >gi|54039071|sp|P62435|RL11_LACJO 50S ribosomal protein L11 >gi|41582790|gb|AAS08401.1| 50S ribosomal protein L11 [Lactobacillus johnsonii NCC 533] (141 aa)
Score = 238, Expect = 6.9e-19, Identities = 53/116 (45%), Positives = 77/116 (66%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GP L   GIN+  FTK FN +T D+ G +IP +IT ++D+SF F  KT P  +LLKKAA +  G+    T+ VA +++++  EIA+TK+ D NA D EA +RM+ G+A+ MG  +E
  S:    25 GPALGQAGINIVGFTKDFNARTADQKGMIIPVVITVYEDRSFEFITKTPPAAVLLKKAAKVDKGSGEPNTKKVAKVTKDQVKEIAETKMKDLNAADIEAAMRMIEGTARSMGFTVE 140
>gi|88856012|ref|ZP_01130674.1| 50S ribosomal protein L11 [marine actinobacterium PHSC20C1] >gi|88814879|gb|EAR24739.1| 50S ribosomal protein L11 [marine actinobacterium PHSC20C1] (143 aa)
Score = 237, Expect = 7.4e-19, Identities = 53/134 (39%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF +KT P   L+KKAA +  G+    T  VA +++++   IA+ K+ D NAND +  ++++AG+A+ MGI +E 
  S:     6 KVTGLIKLQIQAGAANPAPPIGPALGQHGVNIMEFCKAYNAATEAQRGNVIPVEITVYEDRSFTFILKTPPAAELIKKAAGVPKGSGTPHTVKVAQLTKDQVRTIAEQKMADLNANDIDGAMKIIAGTARSMGITVEA 143
>gi|28199871|ref|NP_780185.1| 50S ribosomal protein L11 [Xylella fastidiosa Temecula1] >gi|38605236|sp|Q87A28|RL11_XYLFT 50S ribosomal protein L11 >gi|28057992|gb|AAO29834.1| 50S ribosomal protein L11 [Xylella fastidiosa Temecula1] (142 aa)
Score = 237, Expect = 7.5e-19, Identities = 58/134 (43%), Positives = 87/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  GQA P    GP L   G+N+ +F K FN  T K + G  IP +ITA+ D++FTF  K+ P ++LLKK   I+ G+K   TE V  ++R++  +IAKTK +D  A D +A +R +AGSA+ MG+ +EG
  S:     4 KVTAYIKLQVKAGQASPSPPVGPALGQRGLNIMDFCKAFNAGTQKIEQGLPIPVVITAYSDRTFTFITKSPPASILLKKIVGIQSGSKRPNTEKVGKVTRKQLEDIAKTKELDMTAADLDAAVRTIAGSARSMGLVVEG 142
>gi|126433560|ref|YP_001069251.1| 50S ribosomal protein L11 [Mycobacterium sp. JLS] >gi|166230164|sp|A3PV33|RL11_MYCSJ 50S ribosomal protein L11 >gi|126233360|gb|ABN96760.1| LSU ribosomal protein L11P [Mycobacterium sp. JLS] (142 aa)
Score = 237, Expect = 7.7e-19, Identities = 55/133 (41%), Positives = 83/133 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ +  GQA P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF +KT P   LL KAA +  G+       VA ++ ++  EIA+TK  D NAND +   +++AG+A+ MGI +E
  S:     6 KVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVPKGSGEPHKTKVAKVTWDQVREIAETKKSDLNANDIDQAAKIIAGTARSMGITVE 142
>gi|42527926|ref|NP_973024.1| 50S ribosomal protein L11 [Treponema denticola ATCC 35405] >gi|54039077|sp|P62443|RL11_TREDE 50S ribosomal protein L11 >gi|41818971|gb|AAS12943.1| ribosomal protein L11 [Treponema denticola ATCC 35405] (143 aa)
Score = 237, Expect = 8.0e-19, Identities = 59/127 (46%), Positives = 86/127 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+    G+A P    GP L   G++  +F +QFND+TK  + G VIP +IT + DKSFTF +KT P ++L+KKA  I+ G+  S T  V  +S+    EIAKTK+ D NAND EA  +++AG+A+ MG+++E
  S:    11 KLQCPAGKATPAPPIGPALGPHGVSAPQFVQQFNDRTKSMEPGLVIPVVITVYADKSFTFILKTPPASVLIKKACKIEKGSATSVTAKVGKLSKAALEEIAKTKMPDINANDIEAAKKIIAGTARSMGVEVE 142
>gi|116748980|ref|YP_845667.1| ribosomal protein L11 [Syntrophobacter fumaroxidans MPOB] >gi|166230940|sp|A0LII0|RL11_SYNFM 50S ribosomal protein L11 >gi|116698044|gb|ABK17232.1| LSU ribosomal protein L11P [Syntrophobacter fumaroxidans MPOB] (140 aa)
Score = 237, Expect = 8.1e-19, Identities = 55/127 (43%), Positives = 79/127 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   G+N+ EF K FN +T+ + G +IP +IT + D+SFTF  KT P  +LLKK A I  G+       VA ++R +  EIAK K+ D NA D +A +  + G+A+ MGI++E
  S:    10 KLQVPAGQANPSPPIGPALGQHGVNIMEFCKAFNARTQGQEGMIIPVVITVYADRSFTFITKTPPAAVLLKKTAQIAKGSNEPNRTKVAKVTRAQVEEIAKLKMPDLNARDLDAAVLTIMGTARSMGIEVE 140
>gi|585863|sp|Q07975|RL11_STRSF 50S ribosomal protein L11 >gi|303918|dbj|BAA03346.1| L11 equivalent ribosomal protein [Streptomyces sp. FRI-5] (144 aa)
Score = 237, Expect = 8.3e-19, Identities = 54/137 (39%), Positives = 84/137 (61%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G V+P  IT ++D+SFTF  KT P   L+ K A I+ G+       VA ++R++  EIA  K+ D NAND +A  +++AG+A+ MG+ +EG
  S:     4 KKKKVTGLIKLQIKAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRSFTFVTKTPPAARLILKHAGIEKGSGEPHKTKVANVTRDQVREIATIKMPDLNANDLDAAEKIIAGTARSMGVTVEG 144
>gi|145225692|ref|YP_001136370.1| 50S ribosomal protein L11 [Mycobacterium gilvum PYR-GCK] >gi|189040967|sp|A4T1M2|RL11_MYCGI 50S ribosomal protein L11 >gi|145218178|gb|ABP47582.1| LSU ribosomal protein L11P [Mycobacterium gilvum PYR-GCK] (142 aa)
Score = 237, Expect = 8.4e-19, Identities = 55/133 (41%), Positives = 83/133 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ +  GQA P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF +KT P   LL KAA +  G+       VA ++ ++  EIA+TK  D NAND +   +++AG+A+ MGI +E
  S:     6 KVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVPKGSGEPHKTKVAKVTWDQVREIAETKKEDLNANDIDQAAKIIAGTARSMGITVE 142
>gi|15640351|ref|NP_229978.1| 50S ribosomal protein L11 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|147675238|ref|YP_001218592.1| 50S ribosomal protein L11 [Vibrio cholerae O395] >gi|153827146|ref|ZP_01979813.1| ribosomal protein L11 [Vibrio cholerae MZO-2] >gi|172047472|sp|A5F3P1|RL11_VIBC3 50S ribosomal protein L11 >gi|38605493|sp|Q9KV34|RL11_VIBCH 50S ribosomal protein L11 >gi|9654737|gb|AAF93497.1| ribosomal protein L11 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|146317121|gb|ABQ21660.1| ribosomal protein L11 [Vibrio cholerae O395] >gi|149738974|gb|EDM53290.1| ribosomal protein L11 [Vibrio cholerae MZO-2] (142 aa)
Score = 237, Expect = 8.6e-19, Identities = 59/134 (44%), Positives = 82/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTFE KT P ++LLKKAA IK G+    T  V TI+  +  EIA TK  D    D EA+ R +AG+A+ MG+ +EG
  S:     4 KVEAYVKLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNARTESLEKGLPIPVVITVYSDRSFTFETKTPPASVLLKKAAGIKSGSARPNTAKVGTITDAQIQEIAATKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|54027089|ref|YP_121331.1| putative ribosomal protein L11 [Nocardia farcinica IFM 10152] >gi|61214793|sp|Q5YPC4|RL11_NOCFA 50S ribosomal protein L11 >gi|54018597|dbj|BAD59967.1| putative ribosomal protein L11 [Nocardia farcinica IFM 10152] (144 aa)
Score = 237, Expect = 8.7e-19, Identities = 54/137 (39%), Positives = 85/137 (62%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++  I K+ +  GQA P    GP L   G+N+ EF K +N  T+ + G VIP  I+ ++D++F F++KT P   LL KAA ++ G+       VA ++ ++  EIAKTK+ D NAND +   +++AG+A+ MGI +E 
  S:     4 KKKKLAGIIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEISVYEDRTFDFKLKTPPAAKLLLKAAGVQKGSAEPHRNKVAKVTMDQVREIAKTKMEDLNANDIDQAAKIIAGTARSMGITVEA 144
>gi|75675538|ref|YP_317959.1| 50S ribosomal protein L11 [Nitrobacter winogradskyi Nb-255] >gi|118597267|sp|Q3SSY4|RL11_NITWN 50S ribosomal protein L11 >gi|74420408|gb|ABA04607.1| LSU ribosomal protein L11P [Nitrobacter winogradskyi Nb-255] (142 aa)
Score = 236, Expect = 9.9e-19, Identities = 55/132 (41%), Positives = 83/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P+   LK+AA I+ G+K    +   T++R +  EIA+ K+ D N +  EA + MV GSA+ MG+++
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMAYFLKQAAKIQSGSKTPGRDAAGTLTRAQVREIAEKKMKDLNCDTVEAAMSMVEGSARSMGLQV 140
>gi|86608697|ref|YP_477459.1| 50S ribosomal protein L11 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|118597309|sp|Q2JM51|RL11_SYNJB 50S ribosomal protein L11 >gi|86557239|gb|ABD02196.1| ribosomal protein L11 [Synechococcus sp. JA-2-3B'a(2-13)] (141 aa)
Score = 236, Expect = 1.0e-18, Identities = 50/132 (37%), Positives = 87/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+  F K++N +T D+ G V+P  I+ F+D+SFTF +KT P ++L+KKA  I+ G+       V +++R +  +IA+ KL D NA+D EA ++++AG+A+ MG+ +
  S:     4 KLVAVVKLAIQAGKATPAPPIGPALGQHGVNIMAFCKEYNAKTADQAGMVVPVEISIFEDRSFTFVLKTPPASVLIKKALGIESGSSEPHKTKVGSLTRAQLRQIAEQKLPDLNAHDVEAAMKIIAGTARSMGVTV 139
>gi|88606987|ref|YP_505587.1| 50S ribosomal protein L11 [Anaplasma phagocytophilum HZ] >gi|88598050|gb|ABD43520.1| ribosomal protein L11 [Anaplasma phagocytophilum HZ] (148 aa)
Score = 236, Expect = 1.0e-18, Identities = 52/130 (40%), Positives = 92/130 (70%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKDKN-----GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++++NL+   G+A PGP++AS+    GI M +F ++FN+ T  +      G+++   I+ + DK+++F I  +PV+ LL+KAA +  G+     E+ A+I  E+ ++IA+ K+ D NA+D EA ++MV G+A+ MGI +EG
  S:     7 LSRINLVMEAGKAAPGPKVASVLGPRGIPMPQFCREFNEATSAQGTPYEIGDLVTARISVYVDKTYSFTISDSPVSFLLRKAAGLTKGSSAPGKESCASIKMEEVVKIAERKIADMNADDIEAAVKMVIGTARSMGITVEG 147
>gi|78778592|ref|YP_396704.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. MIT 9312] >gi|118597273|sp|Q31CX7|RL11_PROM9 50S ribosomal protein L11 >gi|78712091|gb|ABB49268.1| LSU ribosomal protein L11P [Prochlorococcus marinus str. MIT 9312] (141 aa)
Score = 236, Expect = 1.0e-18, Identities = 56/132 (42%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SFTF  KT P  +L+ KAA I  G+  S   +V  IS+ +  EIAKTKL D N +  E+ ++++ G+A+ MG+ I
  S:     4 KIVAVIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTQDKAGFVIPVEISVFEDRSFTFITKTPPAAVLITKAAGIDKGSGESSKGSVGNISKAQLEEIAKTKLPDLNCSSVESAMKVIEGTARNMGVSI 139
>gi|115450395|ref|NP_001048798.1| Os03g0122200 [Oryza sativa (japonica cultivar-group)] >gi|12583659|dbj|BAB21483.1| plastid ribosomal protein L11 [Oryza sativa Japonica Group] >gi|108705910|gb|ABF93705.1| 50S ribosomal protein L11, chloroplast precursor, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113547269|dbj|BAF10712.1| Os03g0122200 [Oryza sativa (japonica cultivar-group)] (210 aa)
Score = 236, Expect = 1.1e-18, Identities = 56/140 (40%), Positives = 89/140 (63%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGK 153
           + K+ L  G+A P    GP L + G+N+  F K++N +T +K G +IP  IT F DKSFTF +KT P ++LL KAA I+ G+K  + E V  ++ ++   IA+ KL D N    ++ +R++AG+A  MGI+++   P++ K  K
  S:    66 LIKLALEAGKATPAPPVGPALGAKGVNIMSFCKEYNAKTAEKAGYIIPVEITVFDDKSFTFILKTPPASVLLLKAAGIEKGSKEPQREKVGKVTADQVRTIAQEKLPDLNCKSIDSAMRIIAGTAANMGIEVD--PPILEKKEK 207
>gi|42524387|ref|NP_969767.1| 50S ribosomal protein L11 [Bdellovibrio bacteriovorus HD100] >gi|39576596|emb|CAE80760.1| 50S ribosomal protein L11 [Bdellovibrio bacteriovorus HD100] (145 aa)
Score = 236, Expect = 1.1e-18, Identities = 56/132 (42%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T + K+ +  G+A P    GP L   G+N+ EF KQFN +T+     +IP IIT ++D+SFTF  KT PV+ L+KKA  ++ G+K  + + V  I+ ++  +IA TKL D N    E+ +  VAG+AK MGI I
  S:     9 KVTGMIKLQIPAGKANPAPPVGPALGQHGVNIMEFCKQFNARTQALGDSIIPIIITVYQDRSFTFITKTPPVSSLIKKALKLESGSKQPQKDKVGKINNDQIKQIATTKLPDLNCLKVESAMSQVAGTAKSMGIDI 144
>gi|161378155|ref|NP_299914.2| 50S ribosomal protein L11 [Xylella fastidiosa 9a5c] >gi|38605501|sp|Q9PA82|RL11_XYLFA 50S ribosomal protein L11 (142 aa)
Score = 236, Expect = 1.1e-18, Identities = 58/128 (45%), Positives = 84/128 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   G+N+ +F K FN  T K + G  IP +ITA+ D++FTF  KT P ++LLKK   I+ G+K   TE V  ++R++  +IAKTK +D  A D +A +R +AGSA+ MG+ +EG
  S:    10 KLQVKAGQASPSPPVGPALGQRGLNIMDFCKAFNAATQKVEQGLPIPVVITAYSDRTFTFITKTPPASILLKKIVGIQSGSKRPNTEKVGKVTRKQLEDIAKTKELDMTAADLDAAVRTIAGSARSMGLVVEG 142
>gi|85057745|ref|YP_456661.1| 50S ribosomal protein L11 [Aster yellows witches'-broom phytoplasma AYWB] >gi|118597134|sp|Q2NJ11|RL11_AYWBP 50S ribosomal protein L11 >gi|84789850|gb|ABC65582.1| LSU ribosomal protein L11P [Aster yellows witches'-broom phytoplasma AYWB] (141 aa)
Score = 236, Expect = 1.2e-18, Identities = 55/133 (41%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ +  K+ +  G+A P    GP L    +N+  F  QFN+ TKD+ G VIP II+ ++D++FTF  KT P + LLKKAA I+ G+ N+    VATI+ ++  EIA  KL D NA   E   +++ G+A+ MGI ++
  S:     4 KVVKTVKLQIPAGKANPAPPVGPALGQAQVNIPSFCSQFNETTKDQMGFVIPVIISVYEDRTFTFVTKTPPASDLLKKAAKIESGSANASQTKVATITHKQVEEIANLKLSDLNAYCVEKACKIIEGTARNMGILVK 140
>gi|120402247|ref|YP_952076.1| 50S ribosomal protein L11 [Mycobacterium vanbaalenii PYR-1] >gi|166230168|sp|A1T4H0|RL11_MYCVP 50S ribosomal protein L11 >gi|119955065|gb|ABM12070.1| LSU ribosomal protein L11P [Mycobacterium vanbaalenii PYR-1] (142 aa)
Score = 236, Expect = 1.2e-18, Identities = 55/133 (41%), Positives = 83/133 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  GQA P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF +KT P   LL KAA +  G+       VA ++ ++  EIA+TK  D NAND +A  +++AG+A+ MGI +E
  S:     6 KVVGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATEAQRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVPKGSGEPHKTKVAKVTWDQVREIAETKKEDLNANDIDAAAKIIAGTARSMGITVE 142
>gi|28493681|ref|NP_787842.1| 50S ribosomal protein L11 [Tropheryma whipplei str. Twist] >gi|28572872|ref|NP_789652.1| 50S ribosomal protein L11 [Tropheryma whipplei TW08/27] >gi|54039095|sp|Q83FK8|RL11_TROWT 50S ribosomal protein L11 >gi|54039096|sp|Q83HA9|RL11_TROW8 50S ribosomal protein L11 >gi|28411005|emb|CAD67390.1| 50S ribosomal protein L11 [Tropheryma whipplei TW08/27] >gi|28476723|gb|AAO44811.1| 50S ribosomal protein L11 [Tropheryma whipplei str. Twist] (141 aa)
Score = 235, Expect = 1.2e-18, Identities = 55/134 (41%), Positives = 83/134 (61%)
  Q:     8 DPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           D ++  + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G VIP  I+ ++D+SFTF +KT PV  L+KKAA I  G+       VA I+ E+   IA+ K+VD NAND +A  ++V G+A+ MG+ +
  S:     3 DKKVVGVIKLQIQAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQKGNVIPVEISVYEDRSFTFVLKTPPVVELIKKAARISKGSPTPHNLKVAQITPEQVKSIAEAKMVDLNANDIDAASKIVRGTARSMGVTV 140
>gi|83854993|ref|ZP_00948523.1| ribosomal protein L11 [Sulfitobacter sp. NAS-14.1] >gi|83941515|ref|ZP_00953977.1| ribosomal protein L11 [Sulfitobacter sp. EE-36] >gi|83842836|gb|EAP82003.1| ribosomal protein L11 [Sulfitobacter sp. NAS-14.1] >gi|83847335|gb|EAP85210.1| ribosomal protein L11 [Sulfitobacter sp. EE-36] (141 aa)
Score = 235, Expect = 1.2e-18, Identities = 56/127 (44%), Positives = 84/127 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T D + G   P +I+ ++DKSFT +IKT P +  LKKAA +  GAK    ETV T++ ++  EIA+ K+ D +A D E+ ++++ GSA+ MGI+++
  S:    10 KLQVKAGQANPSPPVGPALGQRGINIMEFCKAFNAKTADMEPGAPCPTVISYYQDKSFTMDIKTPPASYYLKKAAKVNSGAKTPSRETVGTVTTKQLREIAEAKMADLSAVDVESAMKIILGSARSMGIEVK 141
>gi|11467611|ref|NP_050663.1| ribosomal protein L11 [Guillardia theta] >gi|6093977|sp|O78412|RK11_GUITH Chloroplast 50S ribosomal protein L11 >gi|3602936|gb|AAC35597.1| ribosomal protein L11 [Guillardia theta] (141 aa)
Score = 235, Expect = 1.3e-18, Identities = 55/132 (41%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  I K+ L  G+A P    GP L   G+N+  F K +N +T DK G +IP  IT ++DKS+TF +KT P ++LL KAA ++ G+ N K   V ++++++  EIA+TKL D N    E+ +R++ G+AK MGI +
  S:     4 KVVAIIKLALEAGKATPAPPVGPALGQRGVNIVMFCKDYNARTADKAGLIIPVEITVYEDKSYTFVLKTPPASVLLAKAAGVQKGSGNPKKTQVGSVTKKQVEEIAQTKLPDLNTRRLESAIRIIEGTAKNMGIGV 139
>gi|125975202|ref|YP_001039112.1| 50S ribosomal protein L11P [Clostridium thermocellum ATCC 27405] >gi|166230130|sp|A3DIZ0|RL11_CLOTH 50S ribosomal protein L11 >gi|125715427|gb|ABN53919.1| LSU ribosomal protein L11P [Clostridium thermocellum ATCC 27405] (141 aa)
Score = 235, Expect = 1.3e-18, Identities = 53/127 (41%), Positives = 82/127 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G+A P    GP L   G+N+  F K+FN++T    G VIP +IT + D+SF+F  KT P ++L+K+A  I+ G+     E VA IS+E+  +IA+ K+ D NA   EA + M+AG+A+ MG+ +E
  S:    10 KLQIPAGKATPAPPVGPALGQHGVNIMAFCKEFNERTAKDAGLVIPVVITVYADRSFSFVTKTPPASVLIKRACKIEKGSGRPNREKVAKISKEEVRKIAEMKMPDLNAASLEAAMSMIAGTARSMGVVVE 140
>gi|24371818|ref|NP_715860.1| 50S ribosomal protein L11 [Shewanella oneidensis MR-1] >gi|50403584|sp|Q8EK78|RL11_SHEON 50S ribosomal protein L11 >gi|24345623|gb|AAN53305.1|AE015471_10 ribosomal protein L11 [Shewanella oneidensis MR-1] (142 aa)
Score = 235, Expect = 1.3e-18, Identities = 59/134 (44%), Positives = 81/134 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  G A P    GP L   G+N+ EF K FN +T K + G  IP +IT + D+SFTFE KT P + LLK AA +K G+    T+ V TI+R K  EIA+ K  D    D EA+ R + G+A+ MG+ +EG
  S:     4 KIDAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNARTEKMEKGMPIPVVITVYSDRSFTFETKTPPASYLLKTAAGLKSGSPRPNTQKVGTIARAKIQEIAEMKAADMTGADVEAMTRSIEGTARSMGLVVEG 142
>gi|83648863|ref|YP_437298.1| ribosomal protein L11 [Hahella chejuensis KCTC 2396] >gi|118597246|sp|Q2S901|RL11_HAHCH 50S ribosomal protein L11 >gi|83636906|gb|ABC32873.1| ribosomal protein L11 [Hahella chejuensis KCTC 2396] (142 aa)
Score = 235, Expect = 1.3e-18, Identities = 55/133 (41%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  GQA P    GP L   G+N+ EF K FN +T++ + G   P +IT + D+SFTF  KT P ++LL+KAA IK G+    TE V T++R +  EIA  K+ D +A   +A +R +AG+A+ MG+ +E
  S:     4 KVNAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAKTQNLEPGLPTPVVITVYSDRSFTFITKTPPASVLLRKAAGIKSGSGRPNTEKVGTVNRAQLEEIANVKMPDLSAGSLDAAVRTIAGTARSMGLNVE 141
>gi|39938742|ref|NP_950508.1| 50S ribosomal protein L11 [Onion yellows phytoplasma OY-M] >gi|54039075|sp|P62439|RL11_ONYPE 50S ribosomal protein L11 >gi|39721851|dbj|BAD04341.1| ribosomal protein L11 [Onion yellows phytoplasma OY-M] (141 aa)
Score = 235, Expect = 1.4e-18, Identities = 55/133 (41%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ +  K+ +  G+A P    GP L    +N+  F  QFN+ TKD+ G VIP II+ ++D++FTF  KT P + LLKKAA I+ G+ N+    VATI+ ++  EIA  KL D NA   E   +++ G+A+ MGI ++
  S:     4 KVVKTVKLQIPAGKANPAPPVGPALGQAQVNIPSFCSQFNETTKDQMGFVIPVIISVYEDRTFTFVTKTPPASDLLKKAAKIESGSANASQTKVATITHKQVEEIANLKLPDLNAYCVEKACKIIEGTARNMGILVK 140
>gi|15828019|ref|NP_302282.1| 50S ribosomal protein L11 [Mycobacterium leprae TN] >gi|13633834|sp|Q9CBK1|RL11_MYCLE 50S ribosomal protein L11 >gi|13093572|emb|CAC30859.1| 50S ribosomal protein L11 [Mycobacterium leprae] (142 aa)
Score = 235, Expect = 1.4e-18, Identities = 54/133 (40%), Positives = 82/133 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  GQA P    GP L   G+N+ EF K +N  T+++ G+VIP  IT ++D+SFTF +KT P   LL  AA +  G        V  +S ++  EIA+TK  D NAND +A  +++AG+A+ MGI +E
  S:     6 KVAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGQVIPVEITVYEDRSFTFALKTPPAAKLLLDAAGVGKGVAEPHKTKVVKVSWDQVREIAETKKADLNANDIDAAAKIIAGTARSMGITVE 142
>gi|15896396|ref|NP_349745.1| 50S ribosomal protein L11 [Clostridium acetobutylicum ATCC 824] >gi|38605430|sp|Q97EG5|RL11_CLOAB 50S ribosomal protein L11 >gi|15026214|gb|AAK81085.1|AE007810_4 Ribosomal protein L11 [Clostridium acetobutylicum ATCC 824] (141 aa)
Score = 235, Expect = 1.5e-18, Identities = 52/132 (39%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T ++ G  IP +IT ++D+SF+F +KT P  +L+KKAA I+ G+       V  I++E+  EIA+TK+ D NA   EA + M+AG+A+ MG+++
  S:     4 KVVGLIKLQLPAGKATPAPPVGPALGQHGVNIMAFCKEYNAKTANQAGFTIPVVITVYQDRSFSFILKTPPAAVLIKKAAGIESGSGVPNKNKVGKITKEQVKEIAQTKMPDLNAASLEAAMSMIAGTARSMGVEV 139
>gi|126697628|ref|YP_001086525.1| 50S ribosomal protein L11 [Clostridium difficile 630] >gi|145956373|ref|ZP_01805369.1| hypothetical protein CdifQ_04000069 [Clostridium difficile QCD-32g58] >gi|168696857|ref|ZP_02729134.1| 50S ribosomal protein L11 [Clostridium difficile QCD-37x79] >gi|168715539|ref|ZP_02747816.1| 50S ribosomal protein L11 [Clostridium difficile QCD-63q42] >gi|168726727|ref|ZP_02759004.1| 50S ribosomal protein L11 [Clostridium difficile QCD-76w55] >gi|168730443|ref|ZP_02762720.1| 50S ribosomal protein L11 [Clostridium difficile QCD-97b34] >gi|196127778|ref|ZP_03119527.1| 50S ribosomal protein L11 [Clostridium difficile ATCC 43255] >gi|196160589|ref|ZP_03121150.1| 50S ribosomal protein L11 [Clostridium difficile CIP 107932] >gi|196165498|ref|ZP_03126029.1| 50S ribosomal protein L11 [Clostridium difficile QCD-23m63] >gi|118597148|sp|Q18CE5|RL11_CLOD6 50S ribosomal protein L11 >gi|115249065|emb|CAJ66876.1| 50S ribosomal protein L11 [Clostridium difficile 630] (141 aa)
Score = 235, Expect = 1.5e-18, Identities = 54/127 (42%), Positives = 83/127 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G+A P    GP L   G+N+  FTK+FN +T D+ G +IP +IT ++D+SF+F  KT P  +L+KKA N+K G+     + VA ++  +  EIA+ K+ D NA   EA + M+AG+A+ MG+ IE
  S:    10 KLQIPAGKATPAPPVGPALGQHGVNIMGFTKEFNAKTADQAGMIIPVVITVYQDRSFSFITKTPPAAVLIKKALNLKSGSGEPNKKKVAKMTSAQVREIAELKMPDLNAASVEAAMSMIAGTARSMGVVIE 140
>gi|740019|prf||2004301A ribosomal protein L11 (147 aa)
Score = 235, Expect = 1.5e-18, Identities = 55/138 (39%), Positives = 79/138 (57%)
  Q:    10 RITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           ++  + K+ L  G+A PGP     L   G N+ EF K FN  T +    ++P  IT + D+SFTF  KT P + L++KAA ++ GA     E V  I+ E+ LEIAK K+ D N  D EA  RM+   A+ MG+++ G   V
  S:     3 KVVAVVKLQLPAGKATPGPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIGARARSMGVEVVGAPEV 144
>gi|30249990|ref|NP_842060.1| 50S ribosomal protein L11 [Nitrosomonas europaea ATCC 19718] >gi|38605221|sp|Q82T71|RL11_NITEU 50S ribosomal protein L11 >gi|30139097|emb|CAD85961.1| Ribosomal protein L11 [Nitrosomonas europaea ATCC 19718] (143 aa)
Score = 235, Expect = 1.6e-18, Identities = 57/135 (42%), Positives = 86/135 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L    +N+ EF K FN  T K + G  +P +ITA+ DKSFTF +KTTP ++L+KK A +  G+     + V  ++R +A EIAK K+ D  A D +A +R +AGSA+ MG++++GV
  S:     4 KIVGYIKLQIPAGKANPSPPVGPALGQRQLNIMEFCKAFNAATQKMEPGLPVPVVITAYADKSFTFILKTTPASVLIKKLAGLSKGSAQPHVDKVGKLTRSQAEEIAKIKMADLTAADMDAAVRTIAGSARSMGVEVDGV 143
>gi|58336697|ref|YP_193282.1| 50S ribosomal protein L11 [Lactobacillus acidophilus NCFM] >gi|75507649|sp|Q5FM23|RL11_LACAC 50S ribosomal protein L11 >gi|58254014|gb|AAV42251.1| 50S ribosomal protein L11 [Lactobacillus acidophilus NCFM] (141 aa)
Score = 234, Expect = 1.7e-18, Identities = 53/116 (45%), Positives = 77/116 (66%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GP L   GIN+  FTK FN +T D+ G +IP +IT ++D+SF F  KT P  +LLK+AA I   +    T+ V  +++++  EIA+TK+ D NA D EA +RMV G+A+ MGI++E
  S:    25 GPALGQAGINIVGFTKDFNARTADQKGMIIPVVITVYEDRSFEFITKTPPAPVLLKQAAKIDKASGEPNTKKVGKVTKDQVKEIAETKMKDLNAADIEAAMRMVEGTARSMGIEVE 140
>gi|71280797|ref|YP_271417.1| 50S ribosomal protein L11 [Colwellia psychrerythraea 34H] >gi|118597151|sp|Q47UV5|RL11_COLP3 50S ribosomal protein L11 >gi|71146537|gb|AAZ27010.1| ribosomal protein L11 [Colwellia psychrerythraea 34H] (142 aa)
Score = 234, Expect = 1.7e-18, Identities = 57/133 (42%), Positives = 81/133 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  G A P    GP L   G+N+ EF K FN +T   + G  +P +IT + D+SFTFE KT P + LLKKAA IK G+    T+ V T++  +  EI KTK  D  A   EA +R +AGSA+ MG+ +E
  S:     4 KVQALIKLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAKTDSLEKGAPVPVVITVYSDRSFTFETKTPPASFLLKKAAGIKSGSGRPNTDKVGTVTTAQLEEIVKTKEPDLTAGSLEAAVRTIAGSARSMGLVVE 141
>gi|182436667|ref|YP_001824386.1| putative 50S ribosomal protein L11 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|548742|sp|P36258|RL11_STRGR 50S ribosomal protein L11 >gi|288461|emb|CAA51297.1| ribosomal protein L11 [Streptomyces griseus] >gi|2447003|dbj|BAA22444.1| ribosomal protein L11 [Streptomyces griseus] >gi|178465183|dbj|BAG19703.1| putative 50S ribosomal protein L11 [Streptomyces griseus subsp. griseus NBRC 13350] (144 aa)
Score = 234, Expect = 1.9e-18, Identities = 56/137 (40%), Positives = 83/137 (60%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G V+P  IT ++D+SFTF  KT P   L+ KAA +  G+       VA ++  +  EIA TKL D NAND +A  +++AG+A+ MGI +EG
  S:     4 KKKKVTGLIKLQINAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRSFTFVTKTPPAAKLILKAAGVDKGSGEPHKTKVAKLTAAQVREIATTKLPDLNANDLDAASKIIAGTARSMGITVEG 144
>gi|152964645|ref|YP_001360429.1| ribosomal protein L11 [Kineococcus radiotolerans SRS30216] >gi|189040964|sp|A6W5S6|RL11_KINRD 50S ribosomal protein L11 >gi|151359162|gb|ABS02165.1| ribosomal protein L11 [Kineococcus radiotolerans SRS30216] (143 aa)
Score = 234, Expect = 1.9e-18, Identities = 54/132 (40%), Positives = 82/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  GQA P    GP L   G+N+ EF K +N QT+ + G VIP  IT ++D+SFTF  KT P   L+KKAA ++ G+     + VA ++  +  EIA+ KL D NA D +   R++AG+A+ MGI +
  S:     6 KVAGLIKLQIKAGQATPAPPIGPALGQHGVNIMEFCKAYNAQTESQRGNVIPVEITVYEDRSFTFITKTPPAAELIKKAAGVEKGSGEPHVKKVANLTSAQVREIAEQKLQDLNAKDVDMAARIIAGTARSMGITV 141
>gi|51209889|ref|YP_063553.1| ribosomal protein L11 [Gracilaria tenuistipitata var. liui] >gi|68053125|sp|Q6B907|RK11_GRATL Chloroplast 50S ribosomal protein L11 >gi|50657643|gb|AAT79628.1| 50S ribosomal protein L11 [Gracilaria tenuistipitata var. liui] (141 aa)
Score = 234, Expect = 2.0e-18, Identities = 57/132 (43%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G N+  F K++N +T +K G VIP  I+ ++D+SF F +KT P  +LLKKAA I+ G+    T+ + +IS ++  EIAKTKL D N  D +  +++V G+AK MGIKI
  S:     4 KLIGLVKLALNAGKATPAPPVGPALGQYGANIVMFCKEYNARTANKVGLVIPVEISIYEDRSFCFILKTPPAAVLLKKAAQIQSGSGQPNTKKIGSISLQQLEEIAKTKLQDLNTQDVKKAMKIVKGTAKNMGIKI 139
>gi|84704027|ref|ZP_01017855.1| 50S ribosomal Protein L11 [Parvularcula bermudensis HTCC2503] >gi|84690461|gb|EAQ16302.1| 50S ribosomal Protein L11 [Parvularcula bermudensis HTCC2503] (142 aa)
Score = 233, Expect = 2.3e-18, Identities = 55/128 (42%), Positives = 82/128 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN  T++ + G  +P IIT + DKSFTFE K+ P +  LKKAA +  G++    ET   +++ +  EIA+ K+ D NAND +A  +++AGSA+ MG+ +EG
  S:    10 KLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAATQEMEKGMPVPTIITIYTDKSFTFETKSPPASYFLKKAAGLPKGSQAPGKETAGKVTKAQLREIAEAKMNDLNANDLDAAEKIIAGSARAMGLDVEG 142
>gi|72163057|ref|YP_290714.1| 50S ribosomal protein L11P [Thermobifida fusca YX] >gi|118597313|sp|Q47LI1|RL11_THEFY 50S ribosomal protein L11 >gi|71916789|gb|AAZ56691.1| LSU ribosomal protein L11P [Thermobifida fusca YX] (142 aa)
Score = 233, Expect = 2.6e-18, Identities = 51/133 (38%), Positives = 83/133 (62%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + KV L  GQA P P + +     G+N+ EF KQ+N  T+ + G +IP  I+ ++D+SF+F  KT P   L+ KAA ++ GA         +I+R++  EIA+TKL D N    EA  +++AG+A+ MGI+++
  S:     6 KLAAVVKVQLPAGQATPAPPVGTALGPHGVNIMEFCKQYNAATESQRGNIIPVEISIYEDRSFSFVTKTPPAPALILKAAGLEKGASTPSRSVAGSITRDQVREIAQTKLPDLNTTSLEAAEKIIAGTARSMGIEVK 142
>gi|114331776|ref|YP_747998.1| 50S ribosomal protein L11 [Nitrosomonas eutropha C91] >gi|122313477|sp|Q0AF49|RL11_NITEC 50S ribosomal protein L11 >gi|114308790|gb|ABI60033.1| LSU ribosomal protein L11P [Nitrosomonas eutropha C91] (143 aa)
Score = 233, Expect = 2.6e-18, Identities = 57/135 (42%), Positives = 85/135 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L    +N+ EF K FN  T K + G  +P +ITA+ DKSFTF +KTTP ++L+KK A +  G+     + V  ++R +  EIAK K+ D  A D +A +R +AGSA+ MG+++EGV
  S:     4 KIIGYIKLQIPAGKANPSPPVGPALGQRQLNIMEFCKAFNAATQKMEPGLPVPVVITAYADKSFTFVLKTTPASVLIKKLAGLSKGSAQPHVDKVGKLTRSQVEEIAKIKMEDLTAADMDAAIRTIAGSARSMGVEVEGV 143
>gi|32265864|ref|NP_859896.1| 50S ribosomal protein L11 [Helicobacter hepaticus ATCC 51449] >gi|38605182|sp|Q7VJ78|RL11_HELHP 50S ribosomal protein L11 >gi|32261913|gb|AAP76962.1| ribosomal protein L11 [Helicobacter hepaticus ATCC 51449] (141 aa)
Score = 233, Expect = 2.6e-18, Identities = 60/127 (47%), Positives = 83/127 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G+A P    GP L    +N+ EF K FN++TKD     IP IIT ++DKSFTF  K  PVT L+KKAA I  G+ N     V  ++ ++  EIA+TK+ D NA+D EA  ++VAGSA+ MGI+I+
  S:    10 KLQIPAGKANPSPPVGPALGQRSVNIMEFCKAFNERTKDMGDFNIPVIITIYQDKSFTFITKKPPVTDLIKKAAKITKGSDNPLKNKVGKLTSKQLEEIAQTKMEDLNASDIEAAKKIVAGSARSMGIEIQ 140
>gi|54039070|sp|P62432|RL11_BDEBA 50S ribosomal protein L11 (140 aa)
Score = 233, Expect = 2.7e-18, Identities = 56/132 (42%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T + K+ +  G+A P    GP L   G+N+ EF KQFN +T+     +IP IIT ++D+SFTF  KT PV+ L+KKA  ++ G+K  + + V  I+ ++  +IA TKL D N    E+ +  VAG+AK MGI I
  S:     4 KVTGMIKLQIPAGKANPAPPVGPALGQHGVNIMEFCKQFNARTQALGDSIIPIIITVYQDRSFTFITKTPPVSSLIKKALKLESGSKQPQKDKVGKINNDQIKQIATTKLPDLNCLKVESAMSQVAGTAKSMGIDI 139
>gi|51598650|ref|YP_072838.1| 50S ribosomal protein L11 [Borrelia garinii PBi] >gi|56404761|sp|Q661M5|RL11_BORGA 50S ribosomal protein L11 >gi|51573221|gb|AAU07246.1| ribosomal protein L11 [Borrelia garinii PBi] (143 aa)
Score = 232, Expect = 2.8e-18, Identities = 55/127 (43%), Positives = 86/127 (67%)
  Q:    16 KVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +   QA PG ++       G++  +F K+FN++T K   G V+P IIT + DKSF+F +KT P ++L+KK   I+ G+K S T+ V TIS+EK +EI K K+ D NA  E A  ++++GSA+ MG+++E
  S:    11 KLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEFNERTAKMDPGIVVPVIITVYSDKSFSFIVKTPPASILIKKTIGIESGSKKSNTDKVGTISKEKLMEIVKIKMPDLNAKSESAAFKIISGSARSMGVEVE 142
>gi|86606433|ref|YP_475196.1| 50S ribosomal protein L11 [Synechococcus sp. JA-3-3Ab] >gi|118597308|sp|Q2JTQ6|RL11_SYNJA 50S ribosomal protein L11 >gi|86554975|gb|ABC99933.1| ribosomal protein L11 [Synechococcus sp. JA-3-3Ab] (141 aa)
Score = 232, Expect = 3.0e-18, Identities = 50/132 (37%), Positives = 86/132 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+  F K++N +T D+ G V+P  I+ ++D+SFTF +KT P ++L+KKA  I+ G+       V +++R +  +IA+ KL D NA D EA ++++AG+A+ MG+ I
  S:     4 KLVAVVKLAIQAGKATPAPPIGPALGQHGVNIMAFCKEYNAKTADQAGMVVPVEISIYEDRSFTFVLKTPPASVLIKKALGIESGSSEPHKVKVGSLTRAQLRQIAEQKLPDLNARDVEAAMKIIAGTARSMGVTI 139
>gi|21230353|ref|NP_636270.1| 50S ribosomal protein L11 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769653|ref|YP_244415.1| 50S ribosomal protein L11 [Xanthomonas campestris pv. campestris str. 8004] >gi|38605374|sp|Q8RTJ5|RL11_XANCP 50S ribosomal protein L11 >gi|81304392|sp|Q4URC8|RL11_XANC8 50S ribosomal protein L11 >gi|18496619|gb|AAL74156.1|AF426391_3 large subunit ribosomal protein L11 [Xanthomonas campestris pv. campestris] >gi|21111907|gb|AAM40194.1| 50S ribosomal protein L11 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66574985|gb|AAY50395.1| 50S ribosomal protein L11 [Xanthomonas campestris pv. campestris str. 8004] (142 aa)
Score = 232, Expect = 3.0e-18, Identities = 58/134 (43%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++  + K+ +  GQA P    GP L   G+N+ EF K FN  T K + G   P IITA+ D++FTF  K+TP ++LLKKAA +  G+K   T+ V  ++R++  EI K K  D  A + EA +R +AGSA+ MG+ +EG
  S:     4 KVVALIKLQVKAGQANPAPPVGPALGQRGLNIMEFCKAFNAATSKLEPGLPTPVIITAYSDRTFTFITKSTPASVLLKKAAGVSSGSKRPNTDKVGKVTRKQLEEIVKVKEADLTAAELEAAVRTIAGSARSMGLTVEG 142
>gi|121606532|ref|YP_983861.1| ribosomal protein L11 [Polaromonas naphthalenivorans CJ2] >gi|166230909|sp|A1VTG2|RL11_POLNA 50S ribosomal protein L11 >gi|120595501|gb|ABM38940.1| LSU ribosomal protein L11P [Polaromonas naphthalenivorans CJ2] (144 aa)
Score = 232, Expect = 3.0e-18, Identities = 59/135 (43%), Positives = 83/135 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  +P +ITA+ DKSFTF IKT P   L+KKA  +  G+    +  V  I+R +  EIAK K+ D  A D +A +R +AGSA+ MG+ +EGV
  S:     4 KIVGFVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQGVEPGLPLPVVITAYADKSFTFIIKTPPAITLIKKAIKLDKGSATPHSAKVGKITRAQLEEIAKAKMKDLTAADLDAAVRTIAGSARSMGVTVEGV 143
>gi|72383407|ref|YP_292762.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. NATL2A] >gi|124024993|ref|YP_001014109.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. NATL1A] >gi|166230911|sp|A2C034|RL11_PROM1 50S ribosomal protein L11 >gi|118597274|sp|Q46HG9|RL11_PROMT 50S ribosomal protein L11 >gi|72003257|gb|AAZ59059.1| LSU ribosomal protein L11P [Prochlorococcus marinus str. NATL2A] >gi|123960061|gb|ABM74844.1| 50S ribosomal protein L11 [Prochlorococcus marinus str. NATL1A] (141 aa)
Score = 232, Expect = 3.3e-18, Identities = 54/133 (40%), Positives = 85/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T+DK G VIP  I+ F+D+SF+F  KT P ++L+ KAA I  G+  S   +  +IS  +  EIAKTKL D N +  E+ ++++ G+AK MG+ I+
  S:     4 KVVALIKLALQAGKANPAPPVGPALGQHGVNIMAFCKEYNSRTQDKAGFVIPVEISVFEDRSFSFITKTPPASVLITKAAGIAKGSGESAKGSAGSISTSQLEEIAKTKLPDLNCSSIESAMKVIEGTAKNMGVSIK 140
>gi|9957209|gb|AAG09266.1| L11 [EDTA-degrading bacterium BNC1] (128 aa)
Score = 232, Expect = 3.5e-18, Identities = 55/107 (51%), Positives = 72/107 (67%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAND 122
           K+ +  G A P    GP L   GIN+ EF K FN Q++D + G  IP +IT ++DKSFTF +KT PV+  LKKAAN+K G+K    ++   ISR K  EIA+TK+ D NAND
  S:    10 KLQVPAGSATPSPPIGPALGQRGINIMEFCKAFNAQSQDLEKGSPIPVVITYYQDKSFTFTMKTPPVSYFLKKAANLKSGSKEPGKQSAGQISRAKVREIAETKMKDLNAND 121
>gi|6225958|sp|O87733|RL11_STRLA 50S ribosomal protein L11 >gi|3355885|dbj|BAA31976.1| ribosomal protein L11 [Streptomyces lavendulae] (144 aa)
Score = 232, Expect = 3.5e-18, Identities = 53/137 (38%), Positives = 85/137 (62%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G V+P  IT ++D++FTF  KT P   L+ KAA I+ G+       VA ++  +  EIA+ K+ D NAND +A ++++AG+A+ MG+ +EG
  S:     4 KKKKVTGLIKLQIKAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYEDRTFTFITKTPPAARLILKAAGIEKGSGEPHKTKVAKLTGAQVREIAELKMPDLNANDVDAAMKIIAGTARSMGVTVEG 144
>gi|400983|sp|P31164|RK11_SPIOL 50S ribosomal protein L11, chloroplast precursor (CL11) >gi|189096133|pdb|3BBO|K Chain K, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome >gi|21313|emb|CAA39950.1| ribosomal protein L11 [Spinacia oleracea] (224 aa)
Score = 231, Expect = 3.6e-18, Identities = 61/148 (41%), Positives = 90/148 (60%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKK 154
           K  ++  + K+ L  G+A P    GP L S G+N+  F K +N +T DK G VIP  IT F DKSFTF +KT P ++LL KA+  + G+K+ + E V  I+ ++   IA  KL D N    E+ +R++AG+A  MGI I+   P++ K  K+
  S:    72 KAKKVIGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKPGFVIPVEITVFDDKSFTFILKTPPASVLLLKASGAEKGSKDPQMEKVGKITIDQLRGIATEKLPDLNCTTIESAMRIIAGTAANMGIDID--PPILVKKKKE 221
>gi|89071241|ref|ZP_01158420.1| ribosomal protein L11 [Oceanicola granulosus HTCC2516] >gi|89043227|gb|EAR49457.1| ribosomal protein L11 [Oceanicola granulosus HTCC2516] (141 aa)
Score = 231, Expect = 3.7e-18, Identities = 57/127 (44%), Positives = 82/127 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +   QA P    GP L   GIN+ EF K FN +T+D + G   P IIT ++DKSFT +IKT P +  LKKAA +  GAK    ET  T++  +  EIA+ K+ D +AND E  ++++ GSA+ MGI+++
  S:    10 KLQVKAAQANPSPPVGPALGQRGINIMEFCKAFNAKTQDMEPGAPCPTIITYYQDKSFTMDIKTPPASYFLKKAAKLNSGAKLPGKETAGTVTVAQVREIAEAKMKDLSANDIEGAMQIILGSARSMGIEVK 141
>gi|90407969|ref|ZP_01216142.1| Ribosomal protein L11 [Psychromonas sp. CNPT3] >gi|90310907|gb|EAS39019.1| Ribosomal protein L11 [Psychromonas sp. CNPT3] (142 aa)
Score = 231, Expect = 3.9e-18, Identities = 56/128 (43%), Positives = 80/128 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T K + G  +P +IT + D+SFTF  KT P + LLKKAA IK G+     + V T++R +  EI K K  D    D +A++R +AGSA+ MG+++EG
  S:    10 KLQVSAGMANPSPPVGPALGQHGVNIMEFCKAFNAKTDKMEKGAPVPVVITVYNDRSFTFVTKTPPASYLLKKAAGIKSGSGVPNKDKVGTVTRAQLEEIVKIKETDLTGADLDAMVRCIAGSARSMGLEVEG 142
>gi|56698336|ref|YP_168709.1| 50S ribosomal protein L11 [Silicibacter pomeroyi DSS-3] >gi|81676082|sp|Q5LMP9|RL11_SILPO 50S ribosomal protein L11 >gi|56680073|gb|AAV96739.1| ribosomal protein L11 [Silicibacter pomeroyi DSS-3] (141 aa)
Score = 231, Expect = 3.9e-18, Identities = 55/127 (43%), Positives = 81/127 (63%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G+A P    GP L   GIN+ EF K FN +T D   G   P +I+ ++DKSFT +IKT P +  LKKAA I+ GA     ET  T++  +  EIA+ K+ D NAND +  ++++ GSA+ MGI+++
  S:    10 KLQVPAGKANPSPPVGPALGQRGINIMEFCKAFNAKTADMEVGAPCPTVISYYQDKSFTMDIKTPPASYFLKKAAKIQSGANKPSRETAGTVTVAQIREIAEAKMKDLNANDIDGAMQIILGSARSMGIEVK 141
>gi|194337665|ref|YP_002019459.1| ribosomal protein L11 [Pelodictyon phaeoclathratiforme BU-1] >gi|194310142|gb|ACF44842.1| ribosomal protein L11 [Pelodictyon phaeoclathratiforme BU-1] (141 aa)
Score = 231, Expect = 4.0e-18, Identities = 50/117 (42%), Positives = 74/117 (63%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           GP L   G+N+ EF KQFN +T+ + G +IP +IT + DKSFTF  KT P  +LL K A++K G+       V T++R++  +IA+ K+ D NA + E    M+ G+A+ MGI +EG
  S:    25 GPALGQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVYSDKSFTFITKTPPAAVLLLKEASLKKGSGEPNRNKVGTVTRDQVRKIAELKMPDLNAVNSEGAEEMIMGTARSMGIVVEG 141
>gi|87198855|ref|YP_496112.1| 50S ribosomal protein L11 [Novosphingobium aromaticivorans DSM 12444] >gi|118597268|sp|Q2GA45|RL11_NOVAD 50S ribosomal protein L11 >gi|87134536|gb|ABD25278.1| LSU ribosomal protein L11P [Novosphingobium aromaticivorans DSM 12444] (143 aa)
Score = 231, Expect = 4.6e-18, Identities = 56/132 (42%), Positives = 81/132 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I    K+ +  G AKP    GP L   G+N+ EF KQFN  T++ + G  +P +IT + D+SFTF  KT P T  +KKA  IK G+K     +  TI R +  EIA+ K+ D NAND +A  +++ GSA+ MG+ +
  S:     4 KIEGYIKLQVAAGDAKPAPPIGPALGQRGVNIMEFCKQFNAATQEIEKGTPLPTVITVYADRSFTFVTKTPPATFFIKKAVGIKSGSKTPGKASAGTIKRSQLAEIAQAKMKDLNANDIDAATKIIEGSARAMGLTV 140
>gi|158317803|ref|YP_001510311.1| ribosomal protein L11 [Frankia sp. EAN1pec] >gi|158113208|gb|ABW15405.1| ribosomal protein L11 [Frankia sp. EAN1pec] (144 aa)
Score = 231, Expect = 4.6e-18, Identities = 56/135 (41%), Positives = 82/135 (60%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K  +IT + K+ +  G+A P    GP L   G+N+ EF KQ+N  T+ + G V+P  IT + D+SFTF  KT P   L+ KAA +  G+       VA ++  +  EIA+TKL D NAN  EA  +++AG+A+ MGI +
  S:     4 KKKKITALIKLQINAGKATPAPPVGPALGQHGVNIMEFCKQYNAATESQTGNVVPVEITVYDDRSFTFVTKTPPAARLILKAAGVDKGSGTPHRVKVAKLTPAQVREIAQTKLPDLNANSIEAAEKIIAGTARSMGITV 142
>gi|89898123|ref|YP_515233.1| 50S ribosomal protein L11 [Chlamydophila felis Fe/C-56] >gi|118597146|sp|Q255F0|RL11_CHLFF 50S ribosomal protein L11 >gi|89331495|dbj|BAE81088.1| 50S ribosomal protein L11 [Chlamydophila felis Fe/C-56] (141 aa)
Score = 230, Expect = 4.7e-18, Identities = 51/135 (37%), Positives = 87/135 (64%)
  Q:     8 DPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           + ++ ++ K+ + GG+A P    GP L + G+N+  F K+FN  T+D+ G+++P +IT + DK+FTF  K  PV+ L+KKA N++ G+K      V  +++E+   IA+ K+ D +    E+  RMV G+A+ MGI +E
  S:     3 NKKVIKLIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFTFITKQPPVSSLIKKALNLESGSKIPNRNKVGKLTQEQVTAIAEQKMKDMDVVLLESAKRMVEGTARSMGIDVE 141
>gi|57234276|ref|YP_181716.1| 50S ribosomal protein L11 [Dehalococcoides ethenogenes 195] >gi|118597155|sp|Q3Z7T3|RL11_DEHE1 50S ribosomal protein L11 >gi|57224724|gb|AAW39781.1| ribosomal protein L11 [Dehalococcoides ethenogenes 195] (140 aa)
Score = 230, Expect = 4.7e-18, Identities = 55/133 (41%), Positives = 80/133 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  I K+ +  G+A P    GP L   GIN+  F K++ND+T    G ++P  IT + D+SFTF  KT P   LLKKAA ++ G+       VA IS+ +  EIA  K+ D NA + E   R++ G+A+ MGIK+E
  S:     4 KVKAIVKLQIPAGKANPAPPIGPALGQHGINIMGFCKEYNDRTASMAGTIVPAEITIYDDRSFTFITKTPPAADLLKKAAGVEAGSGTPSKSVVAVISKGQLREIASVKMKDLNAVNIEGAERIIEGTARSMGIKVE 140
>gi|90994528|ref|YP_537018.1| ribosomal protein L11 [Porphyra yezoensis] >gi|122232139|sp|Q1XDF0|RK11_PORYE Chloroplast 50S ribosomal protein L11 >gi|90819092|dbj|BAE92461.1| 50S ribosomal protein L11 [Porphyra yezoensis] (141 aa)
Score = 230, Expect = 4.8e-18, Identities = 55/133 (41%), Positives = 87/133 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T I K+ L  G+A P    GP L   G+N+  F K++N +T DK+G VIP  I+ ++D+SFTF +KT P ++L+ KAA +  G+    T+ V +I+ ++   IA+TKL D N N+    +++V G+AK MGI I+
  S:     4 KVTGIVKLALNAGKATPAPPVGPALGQHGVNIVMFCKEYNARTADKSGLVIPVEISIYEDRSFTFILKTPPASVLIAKAAGLNKGSGEPNTKKVGSITNKQLESIAETKLPDLNTNNIPQAMKIVGGTAKNMGILIK 140
>gi|34556888|ref|NP_906703.1| 50S ribosomal protein L11 [Wolinella succinogenes DSM 1740] >gi|38605136|sp|P60106|RL11_WOLSU 50S ribosomal protein L11 >gi|34482603|emb|CAE09603.1| 50S RIBOSOMAL PROTEIN L11 [Wolinella succinogenes] (141 aa)
Score = 230, Expect = 4.9e-18, Identities = 56/126 (44%), Positives = 80/126 (63%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  G+A P    GP L   G+N+ EF K FN++TKD     IP ++T ++DKSFTF  K  PVT L+KKAA I+ G+ N     +  I++ +  EIA TK+ D NA   E  +++V GSA+ MGI+I
  S:    10 KLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVVLTIYQDKSFTFITKKPPVTDLIKKAAGIQKGSDNPLKNKIGKITKAQVAEIAATKMEDLNAKSTEGAIKIVEGSARSMGIEI 139
>gi|84499875|ref|ZP_00998141.1| ribosomal protein L11 [Oceanicola batsensis HTCC2597] >gi|84391809|gb|EAQ04077.1| ribosomal protein L11 [Oceanicola batsensis HTCC2597] (141 aa)
Score = 230, Expect = 5.0e-18, Identities = 55/127 (43%), Positives = 82/127 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T++ + G   P +I  ++DKSFT +IKT P +  LKKAA +K G+K     T  T++  +  EIA+ K+ D NAND E  ++++ GSA+ MGI+++
  S:    10 KLQVPAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQEMEPGAPCPTVIQYYQDKSFTMDIKTPPASYYLKKAAKLKSGSKEPGKSTAGTVTVAQVKEIAEAKMKDLNANDVEGAMQIILGSARSMGIEVK 141
>gi|21672992|ref|NP_661057.1| 50S ribosomal protein L11 [Chlorobium tepidum TLS] >gi|38605335|sp|Q8KG19|RL11_CHLTE 50S ribosomal protein L11 >gi|21646054|gb|AAM71399.1| ribosomal protein L11 [Chlorobium tepidum TLS] (141 aa)
Score = 230, Expect = 5.1e-18, Identities = 55/134 (41%), Positives = 81/134 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +IT   K+ +  G A P    GP L   G+N+ EF KQFN +T+ + G +IP +IT + DKSFTF  KT P  +LL K A ++ G+       V T++ ++  +IA+ K  D N+ D E   +MV G+A+ MGI +EG
  S:     4 KITGFIKLQIPAGGANPAPPVGPALGQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVYSDKSFTFVTKTPPAAVLLLKEAKLQKGSGEPNRNKVGTVTMDQVRKIAELKRPDLNSIDLEGATQMVIGTARSMGIVVEG 141
>gi|116671540|ref|YP_832473.1| 50S ribosomal protein L11P [Arthrobacter sp. FB24] >gi|169175776|ref|ZP_02837604.1| ribosomal protein L11 [Arthrobacter chlorophenolicus A6] >gi|166230100|sp|A0JZA3|RL11_ARTS2 50S ribosomal protein L11 >gi|116611649|gb|ABK04373.1| LSU ribosomal protein L11P [Arthrobacter sp. FB24] >gi|169015985|gb|EDS62482.1| ribosomal protein L11 [Arthrobacter chlorophenolicus A6] (143 aa)
Score = 230, Expect = 5.2e-18, Identities = 55/134 (41%), Positives = 82/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G VIP  IT ++D+SFTF  KT P   L+KKAA +  G+    T  VA +++ +  EIA TK+ D NA   E   +++AG+A+ MGI +EG
  S:     6 KVTGLIKLQIQAGAANPAPPIGPALGQHGVNIMEFCKAYNAATEAQRGNVIPVEITVYEDRSFTFITKTPPAAELIKKAAGVAKGSATPHTVKVAKLTQAQVNEIASTKMEDLNATSLEGAAKIIAGTARSMGITVEG 143
>gi|117924144|ref|YP_864761.1| 50S ribosomal protein L11P [Magnetococcus sp. MC-1] >gi|166230150|sp|A0L5W2|RL11_MAGSM 50S ribosomal protein L11 >gi|117607900|gb|ABK43355.1| LSU ribosomal protein L11P [Magnetococcus sp. MC-1] (142 aa)
Score = 230, Expect = 6.0e-18, Identities = 55/132 (41%), Positives = 85/132 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKN-SKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+    G AKP    GP L   G+N+ EF K FN QT + +    +P +I+ + D++F+FE+KT P +  LKKAA ++ G+K  ++   V  ++  +  EIAK K+VD NAND EA  +++AGSA  MG+++
  S:     4 KITAYIKLQCPAGAAKPSPPVGPALGQHGLNIMEFCKAFNAQTANMEPASPVPVLISVYADRTFSFELKTPPASYFLKKAAGLQGGSKAPNRDPAVGKVTWAQVEEIAKAKMVDLNANDIEAAKKIIAGSANSMGLEV 141
>gi|78187808|ref|YP_375851.1| 50S ribosomal protein L11 [Pelodictyon luteolum DSM 273] >gi|118597270|sp|Q3B1H3|RL11_PELLD 50S ribosomal protein L11 >gi|78167710|gb|ABB24808.1| LSU ribosomal protein L11P [Pelodictyon luteolum DSM 273] (141 aa)
Score = 229, Expect = 6.4e-18, Identities = 51/117 (43%), Positives = 72/117 (61%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           GP L   G+N+ EF KQFN +T+ + G +IP +IT F DKSFTF  KT P  +LL K A ++ G+       V T++RE+  +IA+ K+ D NA D      M+ G+A+ MGI +EG
  S:    25 GPALGQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVFSDKSFTFITKTPPAAVLLLKEAKLQKGSGEPNRNKVGTVTREQVKKIAELKMPDLNAFDLRGAEEMIMGTARSMGIVVEG 141
>gi|59713026|ref|YP_205802.1| 50S ribosomal protein L11 [Vibrio fischeri ES114] >gi|163730894|ref|ZP_02138364.1| 50S ribosomal protein L11 [Vibrio fischeri MJ11] >gi|75506896|sp|Q5E232|RL11_VIBF1 50S ribosomal protein L11 >gi|59481127|gb|AAW86914.1| 50S ribosomal subunit protein L11 [Vibrio fischeri ES114] >gi|161395899|gb|EDQ20198.1| 50S ribosomal protein L11 [Vibrio fischeri MJ11] (142 aa)
Score = 229, Expect = 6.8e-18, Identities = 56/128 (43%), Positives = 80/128 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +I+ + D+SFTF  KT P  +LLKKAA +K G+    TE V T++  +  EIA+TK  D    D EA+ R +AG+A+ MG+ +EG
  S:    10 KLQVAAGMANPSPPVGPALGQHGVNIMEFCKAFNAKTESIEKGLPIPVVISVYNDRSFTFVTKTPPAAVLLKKAAGVKSGSGRPNTEKVGTVTDAQLQEIAETKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|39997958|ref|NP_953909.1| 50S ribosomal protein L11 [Geobacter sulfurreducens PCA] >gi|50403576|sp|P62434|RL11_GEOSL 50S ribosomal protein L11 >gi|39984903|gb|AAR36259.1| ribosomal protein L11 [Geobacter sulfurreducens PCA] (141 aa)
Score = 229, Expect = 7.2e-18, Identities = 54/132 (40%), Positives = 80/132 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+ +   +A P    GP L   G+N+ EF K FN +T+   G +IP +IT + D+SFTF  K  P+++L+KKA  I+ G+       V  ++RE+  EIA  KL D NA   EA +R V G+A+ MG++I
  S:     4 KITGYIKLQIPAAKANPSPPIGPALGQHGVNIMEFCKAFNAKTQADEGTIIPVVITVYADRSFTFITKVPPMSVLIKKAVGIESGSSVPNKNKVGKLTREQVREIATKKLPDMNAASLEAAMRTVEGTARSMGVEI 139
>gi|27380526|ref|NP_772055.1| 50S ribosomal protein L11 [Bradyrhizobium japonicum USDA 110] >gi|38605265|sp|Q89J69|RL11_BRAJA 50S ribosomal protein L11 >gi|27353690|dbj|BAC50680.1| 50S ribosomal Protein L11 [Bradyrhizobium japonicum USDA 110] (142 aa)
Score = 229, Expect = 7.3e-18, Identities = 54/134 (40%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP IIT + D+SFTFE+KT P++  LK+AA I+ G+K    +    +++ +  EIA+ K+ D N +  E+ ++MV GSA+ MG+++ G
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVIITIYADRSFTFEMKTPPMSYFLKQAAKIQSGSKAPGRDKAGKVTKAQVREIAEKKMKDLNCDTIESAMKMVEGSARSMGLEVAG 142
>gi|16124894|ref|NP_419458.1| ribosomal protein L11 [Caulobacter crescentus CB15] >gi|50403585|sp|Q9AAF9|RL11_CAUCR 50S ribosomal protein L11 >gi|13421854|gb|AAK22626.1| ribosomal protein L11 [Caulobacter crescentus CB15] (143 aa)
Score = 229, Expect = 7.5e-18, Identities = 57/126 (45%), Positives = 82/126 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  G A P    GP L   G+N+  F K+FN +T++ + G  +P +IT ++DKSFTF  KT P T  LK+   +K GAK +  ETV  ++R +  EIA+ K+ D NAND EA  +++ GSAK MG+KI
  S:    10 KLQVKAGSATPSPPIGPALGQRGVNIMGFCKEFNARTENVEKGTPLPTVITVYQDKSFTFITKTPPATHYLKQITGLKSGAKLTGRETVGEVTRTQLREIAEKKMKDLNANDLEAAAKIIEGSAKAMGLKI 140
>gi|85858134|ref|YP_460336.1| 50S ribosomal protein L11 [Syntrophus aciditrophicus SB] >gi|85721225|gb|ABC76168.1| LSU ribosomal protein L11 [Syntrophus aciditrophicus SB] (144 aa)
Score = 229, Expect = 7.6e-18, Identities = 54/128 (42%), Positives = 80/128 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G+A P    GP L   G+N+ EF K +N  T+ + G VIP +IT + D+SF+F  KT P  +LLK+AA I  GA + K + V T+S  +  EIA  K  D NA + E  ++++ G+A+ MGI+I G
  S:    13 KLQIKAGKATPSPPIGPALGQHGVNIMEFCKAYNALTQSQEGMVIPVVITVYADRSFSFVTKTPPAAVLLKQAAKIAKGAGDPKRDKVGTVSAAQVREIADLKYKDLNAVNIEGAIKIIEGTARSMGIEISG 144
>gi|15673983|ref|NP_268158.1| 50S ribosomal protein L11 [Lactococcus lactis subsp. lactis Il1403] >gi|38605460|sp|Q9CE46|RL11_LACLA 50S ribosomal protein L11 >gi|12725047|gb|AAK06099.1|AE006430_4 50S ribosomal protein L11 [Lactococcus lactis subsp. lactis Il1403] (141 aa)
Score = 229, Expect = 7.9e-18, Identities = 52/132 (39%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   G+N+  FTK+FN +T D+ G +IP +I+ + DKSFTF  KT P  +LLKKAA ++ G+       VA++++ +  EIA+ K+ D NA+  E  + M+ G+AK MG  +
  S:     4 QVEKLVKLQIPAGKATPAPPVGPALGQAGVNIMGFTKEFNARTADQAGMIIPVVISVYDDKSFTFITKTPPAAVLLKKAAGVQKGSGEPNKTKVASVTKAQIKEIAELKMPDLNASSVETAMSMIEGTAKSMGFTV 139
>gi|30468130|ref|NP_849017.1| ribosomal protein L11 [Cyanidioschyzon merolae strain 10D] >gi|51702800|sp|Q85G12|RK11_CYAME Chloroplast 50S ribosomal protein L11 >gi|30409230|dbj|BAC76179.1| 50S ribosomal protein L11 [Cyanidioschyzon merolae strain 10D] (138 aa)
Score = 228, Expect = 8.2e-18, Identities = 54/132 (40%), Positives = 88/132 (66%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ L  G+A P    GP L   G+N+  FTK++N +T D+ G +IP  IT ++DKS++F +KT P ++LLK+AA I+ G+ N     VA+I++E+  +IA TKL D N  D +  + +++G+A  MGI+I
  S:     4 KVLAVVKLALPAGKATPAPPVGPALGQYGVNLVMFTKEYNAKTADQIGLIIPAQITIYEDKSYSFILKTPPASVLLKRAAQIEKGSNNGT--IVASITQEQLQQIALTKLPDLNTKDVKKAMSIISGTAANMGIQI 137
>gi|77918304|ref|YP_356119.1| 50S ribosomal protein L11 [Pelobacter carbinolicus DSM 2380] >gi|118597269|sp|Q3A6Q8|RL11_PELCD 50S ribosomal protein L11 >gi|77544387|gb|ABA87949.1| LSU ribosomal protein L11P [Pelobacter carbinolicus DSM 2380] (140 aa)
Score = 228, Expect = 8.3e-18, Identities = 52/132 (39%), Positives = 83/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  + K+ +  G+A P    GP L   G+N+ EF K FN +T+ ++G +IP +IT F D+SF+F  KT P  +LL KAA I  G+     + V  +++ +  EIA+ K+ D NA D EA +R + G+A+ MG++I
  S:     4 KVVGLIKLQIPAGKANPSPPVGPALGQHGVNIMEFCKAFNAKTQAQDGMIIPVVITVFADRSFSFITKTPPAAVLLMKAAKIPKGSSVPNKDKVGKVTKAQVREIAELKMPDLNAFDIEAAIRTIEGTARSMGLEI 139
>gi|148256407|ref|YP_001240992.1| 50S ribosomal protein L11 [Bradyrhizobium sp. BTAi1] >gi|166230106|sp|A5ELP2|RL11_BRASB 50S ribosomal protein L11 >gi|146408580|gb|ABQ37086.1| LSU ribosomal protein L11P [Bradyrhizobium sp. BTAi1] (142 aa)
Score = 228, Expect = 8.3e-18, Identities = 53/134 (39%), Positives = 85/134 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AA I+ G+K    +    +++ +  EIA+ K+ D N +  E+ ++MV GSA+ MG+++ G
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMSYFLKQAAKIQSGSKAPGRDKAGKVTKAQVREIAEKKMKDLNCDSIESAMKMVEGSARSMGLEVAG 142
>gi|118579108|ref|YP_900358.1| 50S ribosomal protein L11 [Pelobacter propionicus DSM 2379] >gi|166230908|sp|A1ALT0|RL11_PELPD 50S ribosomal protein L11 >gi|118501818|gb|ABK98300.1| LSU ribosomal protein L11P [Pelobacter propionicus DSM 2379] (140 aa)
Score = 228, Expect = 8.6e-18, Identities = 56/132 (42%), Positives = 80/132 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+ +  G+A P    GP L   G+N+ EF K FN +T+   G + P +IT + D+SFTF  KT PV +L+KKAA I  G+       V  +++ +  EIAKTK+ D NA   EA +R V G+A+ MG+ I
  S:     4 KITGYIKLQVPAGKANPAPPIGPALGQHGVNIMEFCKAFNAKTQADEGTITPVVITVYADRSFTFITKTPPVPVLIKKAAGIASGSAVPNKTKVGKLTKAQVEEIAKTKMPDLNAASLEAAMRTVEGTARSMGVDI 139
>gi|146297207|ref|YP_001180978.1| ribosomal protein L11 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166230116|sp|A4XLK2|RL11_CALS8 50S ribosomal protein L11 >gi|145410783|gb|ABP67787.1| LSU ribosomal protein L11P [Caldicellulosiruptor saccharolyticus DSM 8903] (141 aa)
Score = 228, Expect = 8.7e-18, Identities = 54/127 (42%), Positives = 81/127 (63%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G+A P    GP L   G+N+ +F K+FN++T    G +IP +IT + D+SFTF  KT P ++LLKKAA I+ G+     + VAT+ R+   +IA+ K+ D  A   EA +R + G+AK MGI +E
  S:    10 KLQIPAGKATPAPPVGPALGQHGVNIMQFCKEFNERTAKDAGLIIPVVITVYSDRSFTFITKTPPASVLLKKAAGIESGSPKPNKQKVATLKRDVIRKIAEQKMPDLTAATLEAAMRTIEGTAKSMGIVVE 140
>gi|119025265|ref|YP_909110.1| 50S ribosomal protein L11 [Bifidobacterium adolescentis ATCC 15703] >gi|154486661|ref|ZP_02028068.1| hypothetical protein BIFADO_00481 [Bifidobacterium adolescentis L2-32] >gi|166230105|sp|A0ZZZ5|RL11_BIFAA 50S ribosomal protein L11 >gi|118764849|dbj|BAF39028.1| 50S ribosomal protein L11 [Bifidobacterium adolescentis ATCC 15703] >gi|154084524|gb|EDN83569.1| hypothetical protein BIFADO_00481 [Bifidobacterium adolescentis L2-32] (143 aa)
Score = 228, Expect = 9.5e-18, Identities = 57/132 (43%), Positives = 91/132 (68%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +++ + K+ +  G+A P    GP L S G+N+ +F KQ+N  T+DK G+VIP  IT ++D+SFTF +KT P   LLKKAA I+ G +N  T  V ++++ +  EIA+ K+ D +A D EA ++++AG+A+ MGI +
  S:     6 KVSALLKLQIQAGKANPAPPLGPALGSHGVNIMDFCKQYNAATQDKMGQVIPVEITVYEDRSFTFILKTPPAAALLKKAAGIQKGTENPLTHKVGSVTKAQVREIAEIKMADLSARDVEAGMKIIAGTARSMGITV 141
>gi|27364612|ref|NP_760140.1| 50S ribosomal protein L11 [Vibrio vulnificus CMCP6] >gi|38605293|sp|Q8DD24|RL11_VIBVU 50S ribosomal protein L11 >gi|27360731|gb|AAO09667.1|AE016800_272 Ribosomal protein L11 [Vibrio vulnificus CMCP6] (142 aa)
Score = 228, Expect = 1.0e-17, Identities = 56/128 (43%), Positives = 80/128 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  +P +IT + D+SFTF  KT+P  +LLKKAA IK G+    TE V T++  +  EIA+ K  D    D EA+ R +AG+A+ MG+ +EG
  S:    10 KLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNAKTESMEKGLPVPVVITVYSDRSFTFVTKTSPAAVLLKKAAGIKSGSGRPNTEKVGTVTDAQIQEIAEAKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|134298081|ref|YP_001111577.1| 50S ribosomal protein L11 [Desulfotomaculum reducens MI-1] >gi|172044211|sp|A4J0Z9|RL11_DESRM 50S ribosomal protein L11 >gi|134050781|gb|ABO48752.1| LSU ribosomal protein L11P [Desulfotomaculum reducens MI-1] (142 aa)
Score = 227, Expect = 1.0e-17, Identities = 55/132 (41%), Positives = 80/132 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  I K+ +  G+A P    GP L   G+N+  F KQ+N+ T  + G +IP  IT ++D+SFTF  KT P  +LLKKA  I+  +     + V  + R K  EIA+ K+ D NA   EA +RMV G+A+ MGI+I
  S:     4 KVAAIIKLQIPAGKATPAPPVGPALGQHGVNIMGFVKQYNEVTAAQAGLIIPVEITVYEDRSFTFVTKTPPAAVLLKKALGIETASGEPNKKKVGKLDRSKVREIAELKMPDLNAASVEAAMRMVEGTARSMGIEI 139
>gi|92117080|ref|YP_576809.1| 50S ribosomal protein L11 [Nitrobacter hamburgensis X14] >gi|118597265|sp|Q1QN48|RL11_NITHX 50S ribosomal protein L11 >gi|91799974|gb|ABE62349.1| LSU ribosomal protein L11P [Nitrobacter hamburgensis X14] (142 aa)
Score = 227, Expect = 1.1e-17, Identities = 53/132 (40%), Positives = 83/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P+   LK+AA I+ G+K    ++   +++ +  EIA+ K+ D N +  EA + MV GSA+ MG+++
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMAYFLKQAAKIQSGSKAPGRDSAGQVTKAQVREIAEKKMKDLNCDTVEAAMSMVEGSARSMGLQV 140
>gi|147669526|ref|YP_001214344.1| 50S ribosomal protein L11 [Dehalococcoides sp. BAV1] >gi|189040956|sp|A5FQR2|RL11_DEHSB 50S ribosomal protein L11 >gi|146270474|gb|ABQ17466.1| LSU ribosomal protein L11P [Dehalococcoides sp. BAV1] (140 aa)
Score = 227, Expect = 1.3e-17, Identities = 55/133 (41%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  I K+ +  G+A P    GP L   GIN+  F K++N++T    G ++P  IT + D+SFTF  KT P   LLKKAA +  G+       VA IS+ +  EIA  K+ D NA D E   R++ G+A+ MGIK+E
  S:     4 KVKAIVKLQIPAGKANPAPPIGPALGQHGINIMGFCKEYNERTASMVGTIVPAEITIYDDRSFTFITKTPPAADLLKKAAGVTSGSGTPSKSVVAVISKGQLREIASVKMKDLNAVDIEGAERIIEGTARSMGIKVE 140
>gi|116512946|ref|YP_811853.1| 50S ribosomal protein L11 [Lactococcus lactis subsp. cremoris SK11] >gi|125625042|ref|YP_001033525.1| 50S ribosomal protein L11 [Lactococcus lactis subsp. cremoris MG1363] >gi|123025148|sp|Q02WD2|RL11_LACLS 50S ribosomal protein L11 >gi|166230148|sp|A2RNF4|RL11_LACLM 50S ribosomal protein L11 >gi|116108600|gb|ABJ73740.1| LSU ribosomal protein L11P [Lactococcus lactis subsp. cremoris SK11] >gi|124493850|emb|CAL98843.1| 50S ribosomal protein L11 [Lactococcus lactis subsp. cremoris MG1363] (141 aa)
Score = 227, Expect = 1.3e-17, Identities = 52/132 (39%), Positives = 83/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L   G+N+  FTK+FN +T D+ G +IP +I+ + DKSFTF  KT P  +LLKKAA ++ G+       VA++++ +  EIA+ K+ D NA   E  + M+ G+AK MG  +
  S:     4 QVEKLVKLQIPAGKATPAPPVGPALGQAGVNIMGFTKEFNARTADQAGMIIPVVISVYDDKSFTFITKTPPAAVLLKKAAGVQKGSGEPNKTKVASVTKAQIKEIAELKMPDLNAASVETAMSMIEGTAKSMGFTV 139
>gi|114561325|ref|YP_748838.1| 50S ribosomal protein L11 [Shewanella frigidimarina NCIMB 400] >gi|122301124|sp|Q089R5|RL11_SHEFN 50S ribosomal protein L11 >gi|114332618|gb|ABI70000.1| ribosomal protein L11 [Shewanella frigidimarina NCIMB 400] (142 aa)
Score = 226, Expect = 1.4e-17, Identities = 57/133 (42%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ +  G A P    GP L   G+N+ EF K FN +T K + G  IP +IT + D+SFTFE KT P + LL KA  +K G+    T+ V TI R    EIA+TK  D    D EA+ R + G+A+ MG+ +E
  S:     4 KIEAYIKLQVAAGAANPSPPVGPALGQKGVNIMEFCKAFNARTEKFEKGMPIPVVITVYNDRSFTFETKTPPASFLLLKAVGLKSGSGRPNTQKVGTIKRSAVQEIAETKAADMTGADIEAMTRSIEGTARSMGLVVE 141
>gi|11465803|ref|NP_053947.1| ribosomal protein L11 [Porphyra purpurea] >gi|1710408|sp|P51337|RK11_PORPU Chloroplast 50S ribosomal protein L11 >gi|1276803|gb|AAC08223.1| 50S ribosomal protein L11 [Porphyra purpurea] (141 aa)
Score = 226, Expect = 1.4e-17, Identities = 53/133 (39%), Positives = 85/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T I K+ L  G+A P    GP L   G+N+  F K++N +T DK G VIP  I+ ++D+SF+F +KT P ++L+ KAA +  G+     + + +I+ ++   IA+TKL D N N+    +++V G+AK MGI IE
  S:     4 KVTGIVKLALNAGKATPAPPVGPALGQHGVNIVMFCKEYNARTADKTGLVIPVEISVYEDRSFSFILKTPPASVLIVKAAGLNKGSGEPNIKKIGSITTKQLESIAETKLPDLNTNNLSQAMKIVGGTAKNMGILIE 140
>gi|132651|sp|P27310|RL11_STRVG 50S ribosomal protein L11 >gi|217022|dbj|BAA01263.1| 50S ribosomal protein L11 [Streptomyces virginiae] >gi|217031|dbj|BAA01262.1| 50S ribosomal protein L11 [Streptomyces virginiae] >gi|1217912|dbj|BAA09302.1| ribosomal protein L11 [Streptomyces virginiae] (144 aa)
Score = 226, Expect = 1.4e-17, Identities = 53/137 (38%), Positives = 83/137 (60%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K  ++T + K+ +  G A P    GP L   G+N+ EF K +N  T+ + G V+P  IT + D+SFTF  KT P   L+ K A I+ G+       VA ++  +  EIA+ K+ D NAND +A ++++AG+A+ MG+ +EG
  S:     4 KKKKVTGLIKLQIKAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGMVVPVEITVYDDRSFTFITKTPPAARLILKHAGIEKGSGEPHKTKVAKLTAAQVKEIAELKMPDLNANDIDAAVKIIAGTARSMGVTVEG 144
>gi|189499295|ref|YP_001958765.1| ribosomal protein L11 [Chlorobium phaeobacteroides BS1] >gi|189494736|gb|ACE03284.1| ribosomal protein L11 [Chlorobium phaeobacteroides BS1] (141 aa)
Score = 226, Expect = 1.5e-17, Identities = 48/117 (41%), Positives = 74/117 (63%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           GP L   G+N+ EF KQFN +T+ ++G +IP +IT + DKSFTF  KT P  +LL K A ++ G+       V  ++ E+  +IA+ K+ D NA D +  ++M+ G+A+ MGI +EG
  S:    25 GPALGQKGVNIMEFCKQFNAKTQSQSGTIIPVVITVYSDKSFTFITKTPPAAVLLVKEAGLQKGSGEPNKNKVGKVTEEQVRKIAELKMPDLNAFDIDGAMQMIRGTARSMGIVVEG 141
>gi|88704395|ref|ZP_01102109.1| 50S ribosomal protein L11 [gamma proteobacterium KT 71] >gi|88701446|gb|EAQ98551.1| 50S ribosomal protein L11 [Congregibacter litoralis KT71] (144 aa)
Score = 226, Expect = 1.5e-17, Identities = 56/129 (43%), Positives = 80/129 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           K+ +  GQA P    GP L   G+N+ EF K FN +T+    G  IP +IT + D+SFTF  KT P ++LL+K A I  G+    T+ VA ++R +  E+A+ K  D  A D +A +R +AGSA+  GI +EGV
  S:    10 KLQVPAGQANPSPPVGPALGQHGVNIMEFCKAFNAETQGTEPGLPIPVVITVYSDRSFTFIKKTPPASVLLRKVAGIAKGSGEPNTKKVAKVNRAQLEEVAEQKWPDLTAADMDAAVRTIAGSARSAGIDVEGV 143
>gi|91791528|ref|YP_561179.1| 50S ribosomal protein L11 [Shewanella denitrificans OS217] >gi|123061373|sp|Q12SX0|RL11_SHEDO 50S ribosomal protein L11 >gi|91713530|gb|ABE53456.1| LSU ribosomal protein L11P [Shewanella denitrificans OS217] (142 aa)
Score = 226, Expect = 1.6e-17, Identities = 58/133 (43%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ +  G A P    GP L   G+N+ EF K FN +T K + G  IP +IT + D+SFTFE KT P + LL KAAN+K G+    T  V TI R    EIA+ K  D    D EA+ R + G+A+ MG+ +E
  S:     4 KIEAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNARTEKMEKGMPIPVVITVYSDRSFTFETKTPPASYLLLKAANLKSGSARPNTVKVGTIKRNAVQEIAELKAADMTGADVEAMTRTIEGTARSMGLVVE 141
>gi|189345741|ref|YP_001942270.1| ribosomal protein L11 [Chlorobium limicola DSM 245] >gi|189339888|gb|ACD89291.1| ribosomal protein L11 [Chlorobium limicola DSM 245] (141 aa)
Score = 226, Expect = 1.6e-17, Identities = 50/116 (43%), Positives = 71/116 (61%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GP L   G+N+ EF KQFN +T+ + G + P +IT + DKSFTF  KT P  +LL K A ++ G+       V T+SRE+   IA+ K+ D NA D +   +MV G+A+ MGI +E
  S:    25 GPALGQKGVNIMEFCKQFNAKTQSEAGMITPVVITVYSDKSFTFVTKTPPAAVLLLKEAKLQKGSGEPNRNKVGTVSREQVRRIAELKMPDLNAFDLDGAEQMVMGTARSMGIIVE 140
>gi|154247288|ref|YP_001418246.1| ribosomal protein L11 [Xanthobacter autotrophicus Py2] >gi|154161373|gb|ABS68589.1| ribosomal protein L11 [Xanthobacter autotrophicus Py2] (149 aa)
Score = 226, Expect = 1.7e-17, Identities = 60/134 (44%), Positives = 87/134 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAK---NSKTET----VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +IT   K+ +  G A P    GP L   G+N+ EF K FN QT   + G  IP +ITA++D+SFTFE+KT PV+  LKKAA ++   K    SKT      V  ++R +  EIA+ K+ D N    EA ++M+ GSA+ MG++++G
  S:     4 KITGYVKLQVPAGSANPAPPIGPALGQRGLNIMEFCKAFNAQTAQLEKGMPIPVVITAYQDRSFTFELKTPPVSYFLKKAAGLETKKKPGSGSKTPGKGTFVGKVTRAQLSEIAEKKMKDLNCETVEAAVQMIEGSARSMGLQVQG 149
>gi|69938860|ref|ZP_00633221.1| Ribosomal protein L11, bacterial [Paracoccus denitrificans PD1222] >gi|119383495|ref|YP_914551.1| 50S ribosomal protein L11 [Paracoccus denitrificans PD1222] >gi|166230907|sp|A1B011|RL11_PARDP 50S ribosomal protein L11 >gi|119373262|gb|ABL68855.1| LSU ribosomal protein L11P [Paracoccus denitrificans PD1222] (150 aa)
Score = 226, Expect = 1.7e-17, Identities = 57/128 (44%), Positives = 88/128 (68%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKT--------ETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   GIN+ EF K FN +T++ + G  +P +IT + DKSFTFE KT P + LLKKAA +K   K ++         +T  T++ ++  EIA+ K+ D +AND EA ++++ GSA+ +GI+++G
  S:    10 KLQIKAGQANPSPPVGPALGQRGINIMEFCKAFNAKTQEMEQGAPVPVVITYYADKSFTFETKTPPASFLLKKAAGLKPQGKRNRAKGSEKPGRQTAGTVTAKQVREIAEAKMKDLSANDVEAAMQIILGSARSIGIEVKG 150
>gi|28899700|ref|NP_799305.1| 50S ribosomal protein L11 [Vibrio parahaemolyticus RIMD 2210633] >gi|38605239|sp|Q87KQ0|RL11_VIBPA 50S ribosomal protein L11 >gi|28807952|dbj|BAC61189.1| ribosomal protein L11 [Vibrio parahaemolyticus RIMD 2210633] (142 aa)
Score = 226, Expect = 1.7e-17, Identities = 56/128 (43%), Positives = 79/128 (61%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T+  + G   P +IT + D+SFTF  KT P  +LLKKAA +K G+    TE V T++  +  EIA+TK  D    D EA+ R +AG+A+ MG+ +EG
  S:    10 KLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAKTESLEKGLPTPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGRPNTEKVGTVTDAQIQEIAETKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|37681347|ref|NP_935956.1| 50S ribosomal protein L11 [Vibrio vulnificus YJ016] >gi|38605135|sp|P60105|RL11_VIBVY 50S ribosomal protein L11 >gi|37200098|dbj|BAC95927.1| ribosomal protein L11 [Vibrio vulnificus YJ016] (142 aa)
Score = 226, Expect = 1.7e-17, Identities = 56/128 (43%), Positives = 79/128 (61%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  +P +IT + D+SFTF  KT P  +LLKKAA IK G+    TE V T++  +  EIA+ K  D    D EA+ R +AG+A+ MG+ +EG
  S:    10 KLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNAKTESMEKGLPVPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGRPNTEKVGTVTDAQIQEIAEAKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|57242442|ref|ZP_00370380.1| ribosomal protein L11 [Campylobacter upsaliensis RM3195] >gi|57016727|gb|EAL53510.1| ribosomal protein L11 [Campylobacter upsaliensis RM3195] (141 aa)
Score = 225, Expect = 1.8e-17, Identities = 55/126 (43%), Positives = 75/126 (59%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +   +A P    GP L   G+N+ EF K FN++TKD  G  IP +IT + DKSFTF  K  P T L+KKA  I  GA N     V  ++R + LEI   KL D N  D +   +++AGSA+ MG++I
  S:    10 KLQIAATKANPSPPVGPALGQQGVNIMEFCKAFNERTKDMAGFNIPVVITVYADKSFTFITKQPPATDLIKKAVGISKGADNPLKNKVGKLTRAQVLEIVDKKLADLNTKDRDQAAKIIAGSARSMGVEI 139
>gi|54310502|ref|YP_131522.1| 50S ribosomal protein L11 [Photobacterium profundum SS9] >gi|50403577|sp|P62440|RL11_PHOPR 50S ribosomal protein L11 >gi|46914945|emb|CAG21720.1| putative ribosomal protein L11 [Photobacterium profundum SS9] (142 aa)
Score = 225, Expect = 1.9e-17, Identities = 56/128 (43%), Positives = 78/128 (60%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T   + G   P +IT + D+SFTF  KT P  +LLKKAA +K G+    TE V T++  +  EIA+TK  D    D EA+ R +AG+A+ MG+ +EG
  S:    10 KLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNARTDSVEKGLPTPVVITVYSDRSFTFITKTPPAAVLLKKAAGVKSGSGRPNTEKVGTVTDAQVQEIAETKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|85715148|ref|ZP_01046132.1| Ribosomal protein L11 [Nitrobacter sp. Nb-311A] >gi|85698063|gb|EAQ35936.1| Ribosomal protein L11 [Nitrobacter sp. Nb-311A] (142 aa)
Score = 225, Expect = 1.9e-17, Identities = 51/132 (38%), Positives = 84/132 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T   K+ +  G A P    GP L   G+N+ EF K FN QT K++    IP +IT + D+SFTFE+KT P++  LK+AA ++ G+K    ++   +++ +  EIA+ K+ D N +  E+ + MV GSA+ MG+++
  S:     4 KVTGYLKLQVPAGAANPSPPIGPALGQRGLNIMEFCKAFNAQTQKEEKNTPIPVVITIYADRSFTFEMKTPPMSYFLKQAAKVQSGSKTPGRDSAGKVTKAQVREIAEKKMKDLNCDTLESAMSMVEGSARSMGLQV 140
>gi|62185278|ref|YP_220063.1| 50S ribosomal protein L11 [Chlamydophila abortus S26/3] >gi|81312566|sp|Q5L5H9|RL11_CHLAB 50S ribosomal protein L11 >gi|62148345|emb|CAH64112.1| putative 50S ribosomal protein L11 [Chlamydophila abortus S26/3] (141 aa)
Score = 225, Expect = 2.0e-17, Identities = 50/135 (37%), Positives = 86/135 (63%)
  Q:     8 DPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           + ++ ++ K+ + GG+A P    GP L + G+N+  F K+FN  T+D+ G+++P +IT + DK+FTF  K  PV+ L+KKA N++ G+K      V  +++ +   IA+ K+ D +    E+  RMV G+A+ MGI +E
  S:     3 NKKVIKLIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFTFITKQPPVSSLIKKALNLESGSKIPNRNKVGKLTQAQVTAIAEQKMKDMDVVLLESAKRMVEGTARSMGIDVE 141
>gi|78358032|ref|YP_389481.1| 50S ribosomal protein L11 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|118597158|sp|Q30X10|RL11_DESDG 50S ribosomal protein L11 >gi|78220437|gb|ABB39786.1| LSU ribosomal protein L11P [Desulfovibrio desulfuricans G20] (140 aa)
Score = 225, Expect = 2.1e-17, Identities = 53/127 (41%), Positives = 80/127 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G A P    GP L   G+N+ EF K FN +T+D+ G VIP +ITA+ D+SFTF  KT P ++LL KAA +  G+       V +++ E+  EIAK K+ D +A D    ++ +AG+A+ MGI ++
  S:    10 KLQIQAGAANPSPPVGPALGQHGLNIMEFCKAFNARTQDQKGMVIPVVITAYADRSFTFITKTPPASVLLAKAAKVAKGSGEPNKTKVGSVTMEQVEEIAKLKMPDLSAKDLPGAVKTIAGTARSMGIDVK 140
>gi|67640302|ref|ZP_00439114.1| COG0080: Ribosomal protein L11 [Burkholderia mallei GB8 horse 4] (108 aa)
Score = 224, Expect = 2.7e-17, Identities = 54/106 (50%), Positives = 73/106 (68%)
  Q:    39 EFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           EF K FN QT+  + G  +P +ITA+ DKSFTF +KT P T+L+KKAA +  G+    T+ V  I+R +A EIAKTK+ D  A D +A +R +AGSA+ MGI +EGV
  S:     2 EFCKAFNAQTQGMEPGLPVPVVITAYADKSFTFVMKTPPATVLIKKAAKVDKGSSKPHTDKVGKITRAQAEEIAKTKMPDLTAADLDAAVRTIAGSARSMGITVEGV 108
>gi|45644661|gb|AAS73049.1| predicted ribosomal protein L11 [uncultured marine gamma proteobacterium EBAC20E09] (142 aa)
Score = 224, Expect = 3.0e-17, Identities = 51/133 (38%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  G A P    GP L  +G+N+ +F   FN  T+D + G  +P +I  ++DKSF F +KT P  +L++KA  I+ G+     E V  ++R +  EIAKTK  D NAND +A ++++AG+A+ MG++ E
  S:     4 KLVNVLKLQIPAGGANPSPPVGPALGQVGLNIMDFCNAFNSATQDSEKGIPLPVVINVYEDKSFDFVVKTPPAAVLIRKALKIEKGSGEPNREKVGKLTRAQLEEIAKTKEPDLNANDIDAAVKIIAGTARSMGVETE 141
>gi|77977800|ref|ZP_00833240.1| COG0080: Ribosomal protein L11 [Yersinia intermedia ATCC 29909] (142 aa)
Score = 223, Expect = 3.6e-17, Identities = 54/134 (40%), Positives = 81/134 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V T++  +  EIA+TK  D    D +A++R + G+A+ MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGTVTSAQVREIAETKAADMTGADVDAMMRSIEGTARSMGLVVEG 142
>gi|119356076|ref|YP_910720.1| 50S ribosomal protein L11 [Chlorobium phaeobacteroides DSM 266] >gi|166230123|sp|A1BD19|RL11_CHLPD 50S ribosomal protein L11 >gi|119353425|gb|ABL64296.1| LSU ribosomal protein L11P [Chlorobium phaeobacteroides DSM 266] (141 aa)
Score = 223, Expect = 3.8e-17, Identities = 51/116 (43%), Positives = 70/116 (60%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GP L   G+N+ EF KQFN +T+ + G + P +IT + DKSFTF  KT P  +LL K A +K G+       V T+SRE+   IA+ K+ D NA D     +MV G+A+ MGI +E
  S:    25 GPALGQKGVNIMEFCKQFNAKTQAEAGMITPVVITVYSDKSFTFITKTPPAAVLLLKEAQLKKGSGEPNRNKVGTVSREQVRRIAELKMPDLNAVDVAGAEQMVMGTARSMGIVVE 140
>gi|548740|sp|P36250|RL11_LIBAS 50S ribosomal protein L11 >gi|144456|gb|AAA23105.1| ribosomal protein L11 [Candidatus Liberibacter asiaticus] >gi|38195604|gb|AAR13467.1| 50S ribosomal subunit protein L11 [Candidatus Liberibacter asiaticus] >gi|739023|prf||2002224B ribosomal protein L11 (142 aa)
Score = 222, Expect = 4.1e-17, Identities = 56/131 (42%), Positives = 77/131 (58%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++RI K+ +  G AKP    GP +   GI +  F K FN  T+  + G  IP  +T +KDKSFTF +   PV+  LKK   IK G+K    E+  +I+RE   +IA+ K+ D  A D E  +RMV GSA  MGI +
  S:     5 VSRIVKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKSGSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISV 140
>gi|15791838|ref|NP_281661.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237528|ref|YP_178542.1| 50S ribosomal protein L11 [Campylobacter jejuni RM1221] >gi|57504725|ref|ZP_00370779.1| ribosomal protein L11 [Campylobacter coli RM2228] >gi|86149196|ref|ZP_01067428.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151724|ref|ZP_01069938.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153610|ref|ZP_01071813.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596878|ref|ZP_01100114.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613479|ref|YP_001000181.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148925853|ref|ZP_01809540.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni CG8486] >gi|153951352|ref|YP_001398489.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. doylei 269.97] >gi|157414767|ref|YP_001482023.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 81116] >gi|167005139|ref|ZP_02270897.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 81-176] >gi|166230121|sp|A7H4Q9|RL11_CAMJD 50S ribosomal protein L11 >gi|166230122|sp|A1VYJ0|RL11_CAMJJ 50S ribosomal protein L11 >gi|172047071|sp|A8FKQ9|RL11_CAMJ8 50S ribosomal protein L11 >gi|50403586|sp|Q9PI35|RL11_CAMJE 50S ribosomal protein L11 >gi|81675618|sp|Q5HVZ3|RL11_CAMJR 50S ribosomal protein L11 >gi|57019381|gb|EAL56079.1| ribosomal protein L11 [Campylobacter coli RM2228] >gi|57166332|gb|AAW35111.1| ribosomal protein L11 [Campylobacter jejuni RM1221] >gi|85840554|gb|EAQ57811.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841353|gb|EAQ58601.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842571|gb|EAQ59783.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250168|gb|EAQ73126.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190567|gb|EAQ94540.1| ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359835|emb|CAL34622.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844839|gb|EDK21943.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni CG8486] >gi|152938798|gb|ABS43539.1| ribosomal protein L11 [Campylobacter jejuni subsp. doylei 269.97] >gi|157385731|gb|ABV52046.1| 50S ribosomal protein L11 [Campylobacter jejuni subsp. jejuni 81116] (141 aa)
Score = 222, Expect = 4.2e-17, Identities = 54/126 (42%), Positives = 75/126 (59%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +   +A P    GP L   G+N+ EF K FN++TKD  G  IP +IT + DKSFTF  K  P T L+KKAA I  G  N     V  ++R + LEI   K+ D N  D +   +++AGSA+ MG++I
  S:    10 KLQIAATKANPSPPVGPALGQQGVNIMEFCKAFNERTKDMAGFNIPVVITVYADKSFTFITKQPPATDLIKKAAGISKGTDNPLKNKVGKLTRAQVLEIVDKKIADLNTKDRDQAAKIIAGSARSMGVEI 139
>gi|73748760|ref|YP_307999.1| 50S ribosomal protein L11 [Dehalococcoides sp. CBDB1] >gi|118597156|sp|Q3ZXX7|RL11_DEHSC 50S ribosomal protein L11 >gi|73660476|emb|CAI83083.1| ribosomal protein L11 [Dehalococcoides sp. CBDB1] (140 aa)
Score = 222, Expect = 4.3e-17, Identities = 54/133 (40%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  I K+ +  G+A P    GP L   GIN+  F K++N++T    G ++P  IT + D+SFTF  KT P   LLKKAA +  G+       VA IS+ +  EIA  K+ D NA + E   R++ G+A+ MGIK+E
  S:     4 KVKAIVKLQIPAGKANPAPPIGPALGQHGINIMGFCKEYNERTASMVGTIVPAEITIYDDRSFTFITKTPPAADLLKKAAGVTSGSGTPSKSVVAVISKGQLREIASVKMKDLNAVNIEGAERIIEGTARSMGIKVE 140
>gi|11467549|ref|NP_043695.1| ribosomal protein L11 [Odontella sinensis] >gi|1350605|sp|P49549|RK11_ODOSI Chloroplast 50S ribosomal protein L11 >gi|1185244|emb|CAA91727.1| 50S ribosomal protein L11 [Odontella sinensis] (141 aa)
Score = 222, Expect = 4.4e-17, Identities = 52/132 (39%), Positives = 81/132 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT + K+ L  G+A P    GP L   G+N+  F K++N +T DK G +IP  I+ ++D+S+TF +KT P ++LL  AA IK G+       V +I++ +  EIA  KL D N     + +++V G+A+ MGI I
  S:     4 KITALIKLALPAGKATPAPPVGPALGQHGVNIAAFCKEYNAKTTDKTGLIIPVEISVYEDRSYTFILKTPPASVLLANAAKIKKGSSTPNRVNVGSITKSQLEEIASIKLPDLNTTKISSAMKIVEGTARNMGISI 139
>gi|29840453|ref|NP_829559.1| 50S ribosomal protein L11 [Chlamydophila caviae GPIC] >gi|50403583|sp|Q822I7|RL11_CHLCV 50S ribosomal protein L11 >gi|29834802|gb|AAP05437.1| ribosomal protein L11 [Chlamydophila caviae GPIC] (141 aa)
Score = 222, Expect = 4.4e-17, Identities = 49/135 (36%), Positives = 86/135 (63%)
  Q:     8 DPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           + ++ ++ K+ + GG+A P    GP L + G+N+  F K+FN  T+D+ G+++P +IT + DK+FTF  K  PV+ L+KKA N++ G+K      V  +++ +   IA+ K+ D +    ++  RMV G+A+ MGI +E
  S:     3 NKKVIKLIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFTFITKQPPVSSLIKKALNLESGSKIPNRNKVGKLTQAQVTAIAEQKMKDMDVVLLDSAKRMVEGTARSMGIDVE 141
>gi|145220412|ref|YP_001131121.1| 50S ribosomal protein L11 [Prosthecochloris vibrioformis DSM 265] >gi|189040972|sp|A4SGL0|RL11_PROVI 50S ribosomal protein L11 >gi|145206576|gb|ABP37619.1| LSU ribosomal protein L11P [Prosthecochloris vibrioformis DSM 265] (141 aa)
Score = 222, Expect = 4.5e-17, Identities = 54/133 (40%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF KQFN +T+ + G +IP +IT + DKSFTF  KT P  +LL K A ++ G+       V T++RE+  +IA+ K  D NA D      M+ G+A+ MGI IE
  S:     4 KVIGFIKLQIPAGGANPAPPVGPALGQKGVNIMEFCKQFNAKTQSEAGMIIPVVITVYTDKSFTFITKTPPAAVLLLKEAGLQKGSGEPNRNKVGTVTREQVKKIAELKKPDLNAFDLRGAEEMIMGTARSMGIVIE 140
>gi|78221835|ref|YP_383582.1| 50S ribosomal protein L11 [Geobacter metallireducens GS-15] >gi|118597245|sp|Q39Y17|RL11_GEOMG 50S ribosomal protein L11 >gi|78193090|gb|ABB30857.1| LSU ribosomal protein L11P [Geobacter metallireducens GS-15] (140 aa)
Score = 222, Expect = 4.7e-17, Identities = 52/132 (39%), Positives = 80/132 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+ +  G+A P    GP L   G+N+ EF K FN +T+   G + P +IT + D+SF+F  K  P+++L+KKA  I+ G+       V T++ E+  EIA  K+ D NA   EA +R V G+A+ MG++I
  S:     4 KITGYIKLQIPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQGDEGTITPVVITVYADRSFSFITKVPPMSVLIKKAVGIESGSSVPNKNKVGTLTAEQVKEIAVKKMPDMNAASLEAAMRTVEGTARSMGVEI 139
>gi|42814|emb|CAA23621.1| rplK (L11) [Escherichia coli] (142 aa)
Score = 222, Expect = 5.0e-17, Identities = 57/133 (42%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ISR +  EIA+TK  D    D EA+ R + GSA+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGSARSMGLVVE 141
>gi|84515192|ref|ZP_01002555.1| ribosomal protein L11 [Loktanella vestfoldensis SKA53] >gi|84511351|gb|EAQ07805.1| ribosomal protein L11 [Loktanella vestfoldensis SKA53] (141 aa)
Score = 222, Expect = 5.0e-17, Identities = 53/133 (39%), Positives = 82/133 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  + K+ +  G AKP    GP L   GIN+ EF K FN +T D   +   P +IT + DKSFTFEIKT P +  +KKAA +  G+K     T  +I+ ++  EIA+ K+ D NA   E  ++++ GSA+ MG++++
  S:     4 KVMGMLKLQVAAGNAKPSPPVGPALGQRGINIMEFCKAFNAKTADMEKDAPCPTVITYYADKSFTFEIKTPPASYYIKKAAKLASGSKTPGRATAGSITAKQVREIAEAKMKDLNATSIEGAMQIIMGSARSMGVEVK 141
>gi|94266154|ref|ZP_01289866.1| Ribosomal protein L11 [delta proteobacterium MLMS-1] >gi|93453269|gb|EAT03718.1| Ribosomal protein L11 [delta proteobacterium MLMS-1] (141 aa)
Score = 221, Expect = 5.7e-17, Identities = 55/132 (41%), Positives = 79/132 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I    K+ +  G+A P    GP L   G+N+ EF K FN +T+ +   +IP +IT + DKSFTF  KT PV+ +L K   +K G+ + K E VA I R+K  EIA+ K+ D N  D E  + +V G+AK  GI +
  S:     4 KIQGYIKLQIPAGKANPSPPVGPALGQHGVNIMEFCKAFNAKTQAEGDTIIPVVITVYVDKSFTFITKTPPVSTMLFKELALKKGSSHPKRERVAKIDRDKIREIAEKKMPDLNCYDIEQAMAIVEGTAKSCGITV 139
>gi|86158013|ref|YP_464798.1| 50S ribosomal protein L11 [Anaeromyxobacter dehalogenans 2CP-C] >gi|163768268|ref|ZP_02175265.1| ribosomal protein L11 [Anaeromyxobacter sp. K] >gi|167459099|ref|ZP_02325291.1| ribosomal protein L11 [Anaeromyxobacter dehalogenans 2CP-1] >gi|123723012|sp|Q2II82|RL11_ANADE 50S ribosomal protein L11 >gi|85774524|gb|ABC81361.1| LSU ribosomal protein L11P [Anaeromyxobacter dehalogenans 2CP-C] >gi|167414584|gb|EDR81329.1| ribosomal protein L11 [Anaeromyxobacter dehalogenans 2CP-1] >gi|196172529|gb|ACG73502.1| ribosomal protein L11 [Anaeromyxobacter sp. K] (148 aa)
Score = 221, Expect = 6.0e-17, Identities = 61/134 (45%), Positives = 84/134 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFN--DQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV------GAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++T   K+ L  G+A P    GP L   G+N+ EF KQFN   Q + K   +IP IIT ++D+SFTF +KT P  +LLKKAA +        GA     E V  ++R++  +IAKTK+ D  A   EA +R V G+A  MGI+I G
  S:     3 KVTGQIKLQLPAGKANPAPPVGPALGQHGVNIMEFCKQFNAATQAQAKEALIIPVIITVYQDRSFTFVLKTPPAAILLKKAAGLHTEKKKGSGAHKPGKEKVGQVTRKQVEQIAKTKMQDMTAGTLEAAMRTVEGTALSMGIEIVG 148
>gi|37913001|gb|AAR05330.1| ribosomal protein L11 [uncultured marine alpha proteobacterium HOT2C01] (142 aa)
Score = 221, Expect = 6.3e-17, Identities = 54/126 (42%), Positives = 83/126 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTK-DKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  GQA P    GP L   GIN+ +F K FND++K ++ G ++P ++T F DKSFT +IK  P +  +K+A  IK G+K    + + TIS ++  EIA+ KL D NAN  +  ++++ GSAK MGI++
  S:    10 KLQVPAGQANPSPPVGPALGQRGINIMDFCKMFNDKSKSEQPGVMLPVVVTYFTDKSFTMDIKLPPASFFIKEALKIKKGSKEPGRDIIKTISIKQCEEIAEKKLKDLNANTVDQGVKIIVGSAKSMGIEV 140
>gi|82546325|ref|YP_410272.1| 50S ribosomal protein L11 [Shigella boydii Sb227] >gi|118597293|sp|Q31U14|RL11_SHIBS 50S ribosomal protein L11 >gi|81247736|gb|ABB68444.1| 50S ribosomal subunit protein L11 [Shigella boydii Sb227] (142 aa)
Score = 221, Expect = 6.6e-17, Identities = 57/133 (42%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK GA     + V  ISR +  EIA+TK  D    D EA+ R + G+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGAGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE 141
>gi|85706806|ref|ZP_01037897.1| ribosomal protein L11 [Roseovarius sp. 217] >gi|85668599|gb|EAQ23469.1| ribosomal protein L11 [Roseovarius sp. 217] (141 aa)
Score = 221, Expect = 6.7e-17, Identities = 53/127 (41%), Positives = 79/127 (62%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  GQA P    GP L   GIN+ EF K FN +T D + G   P +I+ ++DKSF   IKT P +  LKKAA ++ G+K     T   ++  +  EIA+ K  D NAND +A ++++ GSA+ MGI+++
  S:    10 KLQVKAGQANPSPPVGPALGQRGINIMEFCKAFNAKTADLEPGAPCPTVISYYQDKSFELAIKTPPASYYLKKAAKLQSGSKTPGRATAGNVTIAQVREIAEAKWKDLNANDIDAAMQIILGSARSMGIEVK 141
>gi|15612190|ref|NP_223842.1| 50S ribosomal protein L11 [Helicobacter pylori J99] >gi|15645816|ref|NP_207993.1| 50S ribosomal protein L11 [Helicobacter pylori 26695] >gi|108563566|ref|YP_627882.1| 50S ribosomal protein L11 [Helicobacter pylori HPAG1] >gi|188527989|ref|YP_001910676.1| 50S ribosomal protein L11 [Helicobacter pylori Shi470] >gi|54039085|sp|P66053|RL11_HELPJ 50S ribosomal protein L11 >gi|54041815|sp|P66052|RL11_HELPY 50S ribosomal protein L11 >gi|118597248|sp|Q1CS64|RL11_HELPH 50S ribosomal protein L11 >gi|2314364|gb|AAD08248.1| ribosomal protein L11 (rpl11) [Helicobacter pylori 26695] >gi|4155722|gb|AAD06703.1| 50S RIBOSOMAL PROTEIN L11 [Helicobacter pylori J99] >gi|107837339|gb|ABF85208.1| ribosomal protein L11 [Helicobacter pylori HPAG1] >gi|188144229|gb|ACD48646.1| 50S ribosomal protein L11 [Helicobacter pylori Shi470] (141 aa)
Score = 220, Expect = 6.8e-17, Identities = 53/126 (42%), Positives = 81/126 (64%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  G+A P    GP L   G+N+ EF K FN++TKD     IP IIT ++DKSFTF  K  PVT L+KKA+ ++ G+ N     +A ++ ++  EIA+ K+ D N +  EA  ++V GSA+ MG+++
  S:    10 KLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNERTKDMGSFNIPVIITVYQDKSFTFITKKPPVTDLIKKASGVEKGSDNPLKNKIAKLTHKQVEEIAQLKMEDLNTSTMEAAKKIVMGSARSMGVEV 139
>gi|73666798|ref|YP_302814.1| 50S ribosomal protein L11 [Ehrlichia canis str. Jake] >gi|72393939|gb|AAZ68216.1| LSU ribosomal protein L11P [Ehrlichia canis str. Jake] (147 aa)
Score = 220, Expect = 7.0e-17, Identities = 58/128 (45%), Positives = 83/128 (64%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKD-----KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           I+K+NL+   G+A PGP++AS+    GI M +F K+FND T       K G+++   I+ + DKS++F I  +PV+ LLKKAA I  GA N   + V  +      EIAK K+ D NA+  EA  +MV G+A  MGI +
  S:     6 ISKINLMIEAGKANPGPKIASVLGPRGIPMPKFCKEFNDITSSEGNQYKVGDLVTARISIYNDKSYSFTISDSPVSYLLKKAAAIDKGAVNPGKDNVGKVKMSDIYEIAKRKMSDMNADTVEAAAKMVIGTASSMGIVV 144
>gi|57240973|ref|ZP_00368921.1| ribosomal protein L11 [Campylobacter lari RM2100] >gi|57018592|gb|EAL55366.1| ribosomal protein L11 [Campylobacter lari RM2100] (141 aa)
Score = 220, Expect = 7.0e-17, Identities = 51/115 (44%), Positives = 69/115 (60%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           GP L   G+N+ EF K FN++TKD  G  IP +IT + DKSFTF  K  P T L+KKAA I  GA N     V  +++ + LEI   K+ D N  D E   +++ GSA+ MG++I
  S:    25 GPALGQQGVNIMEFCKAFNERTKDMAGFNIPVVITVYADKSFTFITKQPPATDLIKKAAGISKGADNPLKNKVGKLTKAQVLEIVDKKIADMNTKDREQAAKIIMGSARSMGVEI 139
>gi|56416542|ref|YP_153616.1| 50S ribosomal protein L11 [Anaplasma marginale str. St. Maries] >gi|56387774|gb|AAV86361.1| 50S ribosomal protein L11 [Anaplasma marginale str. St. Maries] (147 aa)
Score = 220, Expect = 7.2e-17, Identities = 49/129 (37%), Positives = 87/129 (67%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKDK-----NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++++NL+   G+A PGP++AS+    GI M +F K+FND T  +      G+++   I+ + D S++F +  +PV+ LLKKAA +  G+ +   E+  +I   + ++IA+ K+ D NA+  E  ++MV G+AK MG+ +E
  S:     7 LSRINLVIEAGKAMPGPKVASVLGPRGIPMPKFCKEFNDATSAQGVPYETGDLVTARISVYADNSYSFSVSDSPVSFLLKKAAGVTKGSSSPGKESCTSIKMSEVVKIAERKMADMNADSVECAVKMVVGTAKSMGMTVE 146
>gi|94497193|ref|ZP_01303765.1| ribosomal protein L11 [Sphingomonas sp. SKA58] >gi|94423298|gb|EAT08327.1| ribosomal protein L11 [Sphingomonas sp. SKA58] (143 aa)
Score = 220, Expect = 7.3e-17, Identities = 55/132 (41%), Positives = 78/132 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+ +  G A P    GP L   G+N+ EF K FN  T K   G  +P IIT + D+SF+F  K  P T L+KKA N+K G+K         I+R +  EIA+ K+ D NAND +A  +++ GSA+ MG+ +
  S:     4 KITGYIKLQVPAGAANPSPPIGPALGQRGVNIMEFCKAFNASTDKMDKGTPLPTIITVYADRSFSFVTKMPPATYLIKKAINLKSGSKEPGKAVAGKITRAQLAEIAQVKMPDLNANDIDAATKIIEGSARAMGLDV 140
>gi|162421454|ref|YP_001607192.1| 50S ribosomal protein L11 [Yersinia pestis Angola] >gi|162354269|gb|ABX88217.1| ribosomal protein L11 [Yersinia pestis Angola] (142 aa)
Score = 220, Expect = 8.1e-17, Identities = 54/134 (40%), Positives = 80/134 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++  +  EIA+TK  D   +D EA++R + G+A  MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGVPNKDKVGKVTSAQVREIAETKAADMTGSDVEAMMRSIEGTAHSMGLVVEG 142
>gi|90581317|ref|ZP_01237114.1| 50S ribosomal protein L11 [Vibrio angustum S14] >gi|90437556|gb|EAS62750.1| 50S ribosomal protein L11 [Vibrio angustum S14] (142 aa)
Score = 220, Expect = 8.1e-17, Identities = 55/128 (42%), Positives = 77/128 (60%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   G+N+ EF K FN +T   + G   P +IT + D+SFTF  KT P  +LL KAA +K G+    TE V T++  +  EIA+TK  D    D EA+ R +AG+A+ MG+ +EG
  S:    10 KLQVAAGMANPSPPVGPALGQHGVNIMEFCKAFNAKTDSVEKGLPTPVVITVYSDRSFTFVTKTPPAAVLLLKAAGLKSGSGRPNTEKVGTVTDAQIQEIAETKAADMTGADIEAMKRSIAGTARSMGLVVEG 142
>gi|15618001|ref|NP_224285.1| 50S ribosomal protein L11 [Chlamydophila pneumoniae CWL029] >gi|15835612|ref|NP_300136.1| 50S ribosomal protein L11 [Chlamydophila pneumoniae J138] >gi|16752967|ref|NP_445240.1| 50S ribosomal protein L11 [Chlamydophila pneumoniae AR39] >gi|33241412|ref|NP_876353.1| 50S ribosomal protein L11 [Chlamydophila pneumoniae TW-183] >gi|6647755|sp|Q9Z9A4|RL11_CHLPN 50S ribosomal protein L11 >gi|4376335|gb|AAD18230.1| L11 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|7189612|gb|AAF38506.1| ribosomal protein L11 [Chlamydophila pneumoniae AR39] >gi|8978450|dbj|BAA98287.1| L11 ribosomal protein [Chlamydophila pneumoniae J138] >gi|33235920|gb|AAP98010.1| ribosomal protein L11 [Chlamydophila pneumoniae TW-183] (141 aa)
Score = 220, Expect = 8.6e-17, Identities = 51/133 (38%), Positives = 84/133 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ +I K+ + GG+A P    GP L + G+N+  F K+FN  T+DK G+++P +IT + DK+FTF  K  PV+ L+KK  N++ G+K      V  +++ +   IA+ K+ D +    E+  RMV G+A+ MGI +E
  S:     5 KVIKIIKLQIPGGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDKPGDLLPVVITVYADKTFTFITKQPPVSSLIKKTLNLESGSKIPNRNKVGKLTQAQVEAIAEQKMKDMDIVLLESAKRMVEGTARSMGIDVE 141
>gi|71066446|ref|YP_265173.1| 50S ribosomal protein L11 [Psychrobacter arcticus 273-4] >gi|118597277|sp|Q4FQG9|RL11_PSYA2 50S ribosomal protein L11 >gi|71039431|gb|AAZ19739.1| LSU ribosomal protein L11P [Psychrobacter arcticus 273-4] (143 aa)
Score = 219, Expect = 9.1e-17, Identities = 57/135 (42%), Positives = 79/135 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+  F K+FN  T ++  G  IP  IT + DKSFTF +K+ P   LL+KAA I  G+    T  V  + R +  EI KTK  D  A D +A +R +AG+A+ MGI +EGV
  S:     4 KIDGYIKLQVPAGKANPSPPIGPALGQKGVNIMAFCKEFNAATSNQEPGLPIPTEITVYSDKSFTFIMKSPPAAYLLRKAAGIAKGSGTPNTAKVGKVDRAQLEEIVKTKDADLTAADLDAAIRTIAGTARSMGITVEGV 143
>gi|86739282|ref|YP_479682.1| 50S ribosomal protein L11P [Frankia sp. CcI3] >gi|118597162|sp|Q2JFI9|RL11_FRASC 50S ribosomal protein L11 >gi|86566144|gb|ABD09953.1| LSU ribosomal protein L11P [Frankia sp. CcI3] (144 aa)
Score = 219, Expect = 9.4e-17, Identities = 51/121 (42%), Positives = 75/121 (61%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
            G+A P    GP L   G+N+ EF KQ+N  T+ + G V+P  IT + D+SFTF  KT P   L+ KAA ++ G+     + VA ++  +  EIA+TKL D NA   EA  +++AG+A+ MGI +
  S:    18 AGKATPAPPVGPALGQHGVNIMEFCKQYNAATESQAGNVVPVEITVYDDRSFTFVTKTPPAARLILKAAGVEKGSGTPHRDKVAKLTTAQIREIAQTKLPDLNATSIEAAEKIIAGTARSMGITV 142
>gi|57238899|ref|YP_180035.1| 50S ribosomal protein L11 [Ehrlichia ruminantium str. Welgevonden] >gi|58578831|ref|YP_197043.1| 50S ribosomal protein L11 [Ehrlichia ruminantium str. Welgevonden] >gi|58616888|ref|YP_196087.1| 50S ribosomal protein L11 [Ehrlichia ruminantium str. Gardel] >gi|57160978|emb|CAH57884.1| 50S ribosomal protein L11 [Ehrlichia ruminantium str. Welgevonden] >gi|58416500|emb|CAI27613.1| 50S ribosomal protein L11 [Ehrlichia ruminantium str. Gardel] >gi|58417457|emb|CAI26661.1| 50S ribosomal protein L11 [Ehrlichia ruminantium str. Welgevonden] (147 aa)
Score = 219, Expect = 1.0e-16, Identities = 56/129 (43%), Positives = 85/129 (65%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKD-----KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++K+NL+   G+A PGP++AS+    GI M +F K+FND T       K G+V+   I+ + DKS++F I  +PV  LLKKAA +  G+ N   ++V  +      EIAK K+ D NA+  +A ++MV G+A  MGI +E
  S:     6 VSKINLMIEAGKANPGPKIASVLGPRGIPMPKFCKEFNDITSSAGNQYKVGDVVTARISIYNDKSYSFTISDSPVPYLLKKAAAVDKGSVNPGKDSVGKVKMSAIYEIAKRKMSDMNADTVDAAVKMVIGTASSMGIIVE 145
>gi|15612972|ref|NP_241275.1| 50S ribosomal protein L11 [Bacillus halodurans C-125] >gi|54038995|sp|Q9KFR8|RL11B_BACHD 50S ribosomal protein L11-2 >gi|10173022|dbj|BAB04128.1| 50S ribosomal protein L11 [Bacillus halodurans C-125] (141 aa)
Score = 219, Expect = 1.0e-16, Identities = 53/132 (40%), Positives = 80/132 (60%)
  Q:    11 ITRIAKVNLIGGQAKP---GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           I +I  +NL  G+A P   G  LA  GIN+  F  Q+N+ TK + G V+P  IT ++D+SF  ++KT P   LLKK A ++ GA     E V +I+ ++   IA+ KL D N    +  ++++AG+A+ MGI IE
  S:     5 IKQIVTINLEAGKANPAKVGKDLAPTGINLLGFCNQYNEMTKLQLGLVVPAKITIYEDRSFNVKLKTPPAAFLLKKYAGVEKGAAQPGKEVVGSITTQQLRTIAEIKLPDLNTTSIDRAMKIIAGTARNMGINIE 139
>gi|15804573|ref|NP_290614.1| 50S ribosomal protein L11 [Escherichia coli O157:H7 EDL933] >gi|15834160|ref|NP_312933.1| 50S ribosomal protein L11 [Escherichia coli O157:H7 str. Sakai] >gi|16131813|ref|NP_418410.1| 50S ribosomal subunit protein L11 [Escherichia coli str. K-12 substr. MG1655] >gi|16762304|ref|NP_457921.1| 50S ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767403|ref|NP_463018.1| 50S ribosomal protein L11 [Salmonella typhimurium LT2] >gi|26250753|ref|NP_756793.1| 50S ribosomal protein L11 [Escherichia coli CFT073] >gi|29143792|ref|NP_807134.1| 50S ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|30064734|ref|NP_838905.1| 50S ribosomal protein L11 [Shigella flexneri 2a str. 2457T] >gi|56415976|ref|YP_153051.1| 50S ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182603|ref|YP_219020.1| 50S ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|74314477|ref|YP_312896.1| 50S ribosomal protein L11 [Shigella sonnei Ss046] >gi|82778842|ref|YP_405191.1| 50S ribosomal protein L11 [Shigella dysenteriae Sd197] >gi|89110056|ref|AP_003836.1| 50S ribosomal subunit protein L11 [Escherichia coli W3110] >gi|91212812|ref|YP_542798.1| 50S ribosomal protein L11 [Escherichia coli UTI89] >gi|110644318|ref|YP_672048.1| 50S ribosomal protein L11 [Escherichia coli 536] >gi|110807833|ref|YP_691353.1| 50S ribosomal protein L11 [Shigella flexneri 5 str. 8401] >gi|157155677|ref|YP_001465475.1| 50S ribosomal protein L11 [Escherichia coli E24377A] >gi|157163451|ref|YP_001460769.1| 50S ribosomal protein L11 [Escherichia coli HS] >gi|161505370|ref|YP_001572482.1| 50S ribosomal protein L11 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|167554343|ref|ZP_02348084.1| hypothetical protein Sentente_27883 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167995346|ref|ZP_02576436.1| hypothetical protein Sententer_01000082_0100028130 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168234519|ref|ZP_02659577.1| hypothetical protein Sententerica_26302 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168467919|ref|ZP_02701756.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478219|ref|ZP_02707242.1| hypothetical protein Salmoentericaenterica_26511 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168777406|ref|ZP_02802413.1| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4196] >gi|170022014|ref|YP_001726968.1| ribosomal protein L11 [Escherichia coli ATCC 8739] >gi|170083443|ref|YP_001732763.1| 50S ribosomal subunit protein L11 [Escherichia coli str. K12 substr. DH10B] >gi|170681035|ref|YP_001746367.1| ribosomal protein L11 [Escherichia coli SMS-3-5] >gi|170770140|ref|ZP_02904593.1| ribosomal protein L11 [Escherichia albertii TW07627] >gi|187732123|ref|YP_001882668.1| ribosomal protein L11 [Shigella boydii CDC 3083-94] >gi|188491868|ref|ZP_02999138.1| ribosomal protein L11 [Escherichia coli 53638] >gi|189010200|ref|ZP_02805373.2| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4076] >gi|189402697|ref|ZP_02784210.2| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4401] >gi|189403599|ref|ZP_02796460.2| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4486] >gi|189405433|ref|ZP_02815348.2| ribosomal protein L11 [Escherichia coli O157:H7 str. EC869] >gi|194443215|ref|YP_002043401.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448263|ref|YP_002048136.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469003|ref|ZP_03074987.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734746|ref|YP_002117052.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195939608|ref|ZP_03084990.1| 50S ribosomal protein L11 [Escherichia coli O157:H7 str. EC4024] >gi|67471996|sp|P0A7J7|RL11_ECOLI 50S ribosomal protein L11 >gi|123342225|sp|Q0SY17|RL11_SHIF8 50S ribosomal protein L11 >gi|166982107|sp|A7ZUJ6|RL11_ECO24 50S ribosomal protein L11 >gi|166982108|sp|A8A782|RL11_ECOHS 50S ribosomal protein L11 >gi|189040958|sp|B1IUR4|RL11_ECOLC 50S ribosomal protein L11 >gi|189040977|sp|A9MHF7|RL11_SALAR 50S ribosomal protein L11 >gi|67471997|sp|P0A7J8|RL11_ECOL6 50S ribosomal protein L11 >gi|67471998|sp|P0A7J9|RL11_ECO57 50S ribosomal protein L11 >gi|67471999|sp|P0A7K0|RL11_SALTY 50S ribosomal protein L11 >gi|67472000|sp|P0A7K1|RL11_SALTI 50S ribosomal protein L11 >gi|75505419|sp|Q57H73|RL11_SALCH 50S ribosomal protein L11 >gi|81678031|sp|Q5PK81|RL11_SALPA 50S ribosomal protein L11 >gi|118597160|sp|Q0TA82|RL11_ECOL5 50S ribosomal protein L11 >gi|118597161|sp|Q1R5U7|RL11_ECOUT 50S ribosomal protein L11 >gi|118597294|sp|Q32AF5|RL11_SHIDS 50S ribosomal protein L11 >gi|118597295|sp|Q3YV01|RL11_SHISS 50S ribosomal protein L11 >gi|25295154|pir||AI0933 50S ribosomal chain protein L11 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|116666600|pdb|1VS6|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666652|pdb|1VS8|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|12518905|gb|AAG59179.1|AE005629_8 50S ribosomal subunit protein L11 [Escherichia coli O157:H7 EDL933] >gi|26111184|gb|AAN83367.1|AE016770_167 50S ribosomal protein L11 [Escherichia coli CFT073] >gi|2367334|gb|AAC76957.1| 50S ribosomal subunit protein L11 [Escherichia coli str. K-12 substr. MG1655] >gi|6960354|gb|AAF33514.1| 100% identity over 141 amino acids to E. coli 50S ribosomal subunit protein L11 (RPLK or RELC) (SW:P02409; P76778) contains similarity to Pfam domain PF00298 (Ribosomal_L11), Score=295.5, E=6.4e-85, N=1 [Salmonella typhimurium LT2] >gi|13364382|dbj|BAB38329.1| 50S ribosomal subunit protein L11 [Escherichia coli O157:H7 str. Sakai] >gi|16422707|gb|AAL22977.1| 50 S ribosomal subunit protein L11 [Salmonella typhimurium LT2] >gi|16504608|emb|CAD09491.1| 50S ribosomal subunit protein L11 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139427|gb|AAO70994.1| 50S ribosomal subunit protein L11 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|30042994|gb|AAP18716.1| 50S ribosomal subunit protein L11 [Shigella flexneri 2a str. 2457T] >gi|56130233|gb|AAV79739.1| 50S ribosomal subunit protein L11 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62130236|gb|AAX67939.1| 50S ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|73857954|gb|AAZ90661.1| 50S ribosomal subunit protein L11 [Shigella sonnei Ss046] >gi|81242990|gb|ABB63700.1| 50S ribosomal subunit protein L11 [Shigella dysenteriae Sd197] >gi|85676087|dbj|BAE77337.1| 50S ribosomal subunit protein L11 [Escherichia coli W3110] >gi|91074386|gb|ABE09267.1| 50S ribosomal subunit protein L11 [Escherichia coli UTI89] >gi|110345910|gb|ABG72147.1| 50S ribosomal protein L11 [Escherichia coli 536] >gi|110617381|gb|ABF06048.1| 50S ribosomal subunit protein L11 [Shigella flexneri 5 str. 8401] >gi|157069131|gb|ABV08386.1| ribosomal protein L11 [Escherichia coli HS] >gi|157077707|gb|ABV17415.1| ribosomal protein L11 [Escherichia coli E24377A] >gi|160866717|gb|ABX23340.1| hypothetical protein SARI_03515 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|169756942|gb|ACA79641.1| ribosomal protein L11 [Escherichia coli ATCC 8739] >gi|169891278|gb|ACB04985.1| 50S ribosomal subunit protein L11 [Escherichia coli str. K12 substr. DH10B] >gi|170121022|gb|EDS89953.1| ribosomal protein L11 [Escherichia albertii TW07627] >gi|170518753|gb|ACB16931.1| ribosomal protein L11 [Escherichia coli SMS-3-5] >gi|187429115|gb|ACD08389.1| ribosomal protein L11 [Shigella boydii CDC 3083-94] >gi|187767351|gb|EDU31195.1| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4196] >gi|188487067|gb|EDU62170.1| ribosomal protein L11 [Escherichia coli 53638] >gi|189001713|gb|EDU70699.1| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4076] >gi|189354219|gb|EDU72638.1| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4401] >gi|189359771|gb|EDU78190.1| ribosomal protein L11 [Escherichia coli O157:H7 str. EC4486] >gi|189370170|gb|EDU88586.1| ribosomal protein L11 [Escherichia coli O157:H7 str. EC869] >gi|194401878|gb|ACF62100.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194406567|gb|ACF66786.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455367|gb|EDX44206.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710248|gb|ACF89469.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195629025|gb|EDX48417.1| ribosomal protein L11 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (142 aa)
Score = 219, Expect = 1.1e-16, Identities = 56/133 (42%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ISR +  EIA+TK  D    D EA+ R + G+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE 141
>gi|23336711|ref|ZP_00121909.1| COG0080: Ribosomal protein L11 [Bifidobacterium longum DJO10A] >gi|23465852|ref|NP_696455.1| 50S ribosomal protein L11 [Bifidobacterium longum NCC2705] >gi|189440485|ref|YP_001955566.1| Ribosomal protein L11 [Bifidobacterium longum DJO10A] >gi|38605329|sp|Q8G4T4|RL11_BIFLO 50S ribosomal protein L11 >gi|23326551|gb|AAN25091.1| 50S ribosomal protein L11 [Bifidobacterium longum NCC2705] >gi|189428920|gb|ACD99068.1| Ribosomal protein L11 [Bifidobacterium longum DJO10A] (143 aa)
Score = 219, Expect = 1.1e-16, Identities = 55/132 (41%), Positives = 90/132 (68%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +++ + K+ +  G+A P    GP L S G+N+ +F K +N QT+DK G+VIP  IT ++D+SFTF +KT P   LLKKAA ++ G +N  T  V ++++ +  EIA+ K+ D +A D EA ++++ G+A+ MGI +
  S:     6 KVSALIKLQIQAGKANPAPPLGPALGSHGVNIMDFCKAYNAQTQDKMGQVIPVEITVYEDRSFTFVLKTPPAAALLKKAAGVEKGTENPLTHKVGSVTKAQVREIAEIKMEDLSARDIEAGMKIIEGTARSMGITV 141
>gi|15605040|ref|NP_219824.1| 50S ribosomal protein L11 [Chlamydia trachomatis D/UW-3/CX] >gi|76789041|ref|YP_328127.1| 50S ribosomal protein L11 [Chlamydia trachomatis A/HAR-13] >gi|6919959|sp|O84321|RL11_CHLTR 50S ribosomal protein L11 >gi|119390737|sp|Q3KM43|RL11_CHLTA 50S ribosomal protein L11 >gi|3328736|gb|AAC67912.1| L11 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX] >gi|76167571|gb|AAX50579.1| LSU ribosomal protein L11P [Chlamydia trachomatis A/HAR-13] (141 aa)
Score = 218, Expect = 1.3e-16, Identities = 47/122 (38%), Positives = 79/122 (64%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GG+A P    GP L + G+N+  F K+FN  T+D+ G+++P +IT + DK+F+F +K +PV+ L+KKA  ++ G+K      V  ++R +   IA+ K+ D +    E+  RMV G+A+ MG+ +E
  S:    16 GGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFSFVMKQSPVSSLIKKALGLESGSKIPNRNKVGKLTRAQITVIAEQKMKDMDVVLLESAERMVEGTARSMGVDVE 141
>gi|33357908|pdb|1P85|G Chain G, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357936|pdb|1P86|G Chain G, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754091|pdb|2AW4|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754147|pdb|2AWB|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138099|pdb|2I2T|I Chain I, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138153|pdb|2I2V|I Chain I, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|119390353|pdb|2J28|I Chain I, Model Of E. Coli Srp Bound To 70s Rncs >gi|157836047|pdb|2QOV|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 50s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836099|pdb|2QOX|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 50s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836151|pdb|2QOZ|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 50s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836203|pdb|2QP1|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 50s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429722|pdb|2QAM|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 50s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429774|pdb|2QAO|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 50s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429832|pdb|2QBA|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 50s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429884|pdb|2QBC|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 50s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429936|pdb|2QBE|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The First 70s Ribosome, With Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429989|pdb|2QBG|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The Second 70s Ribosome, With Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430042|pdb|2QBI|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The First 70s Ribosome, With Gentamicin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430095|pdb|2QBK|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The Second 70s Ribosome, With Gentamicin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431395|pdb|2Z4L|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The First 70s Ribosome, With Paromomycin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431448|pdb|2Z4N|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 50s Subunit Of The Second 70s Ribosome, With Paromomycin And Rrf Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988739|pdb|2VHM|I Chain I, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 1 Of 4) >gi|168988770|pdb|2VHN|I Chain I, Structure Of Pdf Binding Helix In Complex With The Ribosome. (Part 2 Of 4) >gi|169404631|pdb|2RDO|I Chain I, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound (141 aa)
Score = 218, Expect = 1.3e-16, Identities = 56/133 (42%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ISR +  EIA+TK  D    D EA+ R + G+A+ MG+ +E
  S:     3 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE 140
>gi|132650|sp|P09763|RL11_SERMA 50S ribosomal protein L11 >gi|47256|emb|CAA31095.1| unnamed protein product [Serratia marcescens] (142 aa)
Score = 218, Expect = 1.3e-16, Identities = 54/133 (40%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++R +  EIA+TK  D   +D EA+ R + G+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTRAQVREIAETKAADMTGSDVEAMTRSIEGTARSMGLVVE 141
>gi|15835210|ref|NP_296969.1| 50S ribosomal protein L11 [Chlamydia muridarum Nigg] >gi|13878739|sp|Q9PK76|RL11_CHLMU 50S ribosomal protein L11 >gi|7190631|gb|AAF39425.1| ribosomal protein L11 [Chlamydia muridarum Nigg] (141 aa)
Score = 218, Expect = 1.4e-16, Identities = 47/122 (38%), Positives = 78/122 (63%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GG+A P    GP L + G+N+  F K+FN  T+D+ G+++P +IT + DK+F+F +K  PV+ L+KKA  ++ G+K      V  ++R +   IA+ K+ D +    E+  RMV G+A+ MG+ +E
  S:    16 GGKANPAPPIGPALGAAGVNIMGFCKEFNAATQDRPGDLLPVVITVYSDKTFSFVMKQPPVSSLIKKALGLESGSKIPNRNKVGKLARAQITAIAEQKMKDMDVVLLESAERMVEGTARSMGVDVE 141
>gi|58038865|ref|YP_190829.1| 50S ribosomal protein L11 [Gluconobacter oxydans 621H] >gi|81672728|sp|Q5FTX3|RL11_GLUOX 50S ribosomal protein L11 >gi|58001279|gb|AAW60173.1| LSU ribosomal protein L11P [Gluconobacter oxydans 621H] (144 aa)
Score = 218, Expect = 1.4e-16, Identities = 54/126 (42%), Positives = 82/126 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKN-SKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  G+A P    GP L   G+N+ +F K+FN +T+  + G  IP +ITA+ D++F+F  KT P T  L KAA I  G++   K+  V +++  +  EIA+TK  D NAND +  +RM+AGSAK MG+ +
  S:    10 KLQIPAGKANPSPPVGPALGQRGLNIMQFCKEFNAKTQQLEPGMPIPVVITAYADRTFSFITKTPPNTYFLLKAAKISKGSQTVGKSAAVGSVTTAQLREIAETKFKDMNANDIDGAVRMLAGSAKSMGLNV 141
>gi|18311399|ref|NP_563333.1| 50S ribosomal protein L11 [Clostridium perfringens str. 13] >gi|110801130|ref|YP_697106.1| 50S ribosomal protein L11 [Clostridium perfringens ATCC 13124] >gi|110803824|ref|YP_699675.1| 50S ribosomal protein L11 [Clostridium perfringens SM101] >gi|169344027|ref|ZP_02865016.1| ribosomal protein L11 [Clostridium perfringens C str. JGS1495] >gi|38605392|sp|Q8XHR4|RL11_CLOPE 50S ribosomal protein L11 >gi|118597149|sp|Q0TMN4|RL11_CLOP1 50S ribosomal protein L11 >gi|118597150|sp|Q0SQD2|RL11_CLOPS 50S ribosomal protein L11 >gi|18146083|dbj|BAB82123.1| 50S ribosomal protein L11 [Clostridium perfringens str. 13] >gi|110675777|gb|ABG84764.1| ribosomal protein L11 [Clostridium perfringens ATCC 13124] >gi|110684325|gb|ABG87695.1| ribosomal protein L11 [Clostridium perfringens SM101] >gi|169297851|gb|EDS79947.1| ribosomal protein L11 [Clostridium perfringens C str. JGS1495] (141 aa)
Score = 218, Expect = 1.5e-16, Identities = 49/132 (37%), Positives = 82/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T + K+ L  G+A P    GP L   G+N+  F K+FN +T DK G +IP +IT ++D+SF+F +KT P  +L+KK   ++ G+       V  I++E+  +IA+ K+ D NA   E  + M+ G+A+ MG+ +
  S:     4 KVTGMIKLQLPAGKATPAPPVGPALGQHGVNIMGFCKEFNAKTADKAGLIIPVVITVYQDRSFSFILKTPPAAVLIKKELGLESGSGVPNRTKVGNITKEQIRKIAELKMPDLNAATIETAMSMIEGTARSMGVVV 139
>gi|46446234|ref|YP_007599.1| 50S ribosomal protein L11 [Candidatus Protochlamydia amoebophila UWE25] >gi|56404797|sp|Q6MDM5|RL11_PARUW 50S ribosomal protein L11 >gi|46399875|emb|CAF23324.1| probable 50S ribosomal protein L11 [Candidatus Protochlamydia amoebophila UWE25] (142 aa)
Score = 217, Expect = 1.6e-16, Identities = 53/132 (40%), Positives = 82/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++ ++ K+ +  G+A P    GP L + G+N+  F K+FN +T+   G+V+P +IT + DKSF+F  K  PV  LLKKA  I  G+     + VA I+R +A +IA+ K+ D NA D E    +V G+A+ MGI +
  S:     4 KVVKVIKLQIPAGKANPAPPIGPALGAAGVNIMAFCKEFNAKTQAMAGDVLPTLITVYHDKSFSFITKKPPVAELLKKAKGIAKGSGVPNRDKVAKITRSEARKIAEEKIQDMNAADLEMATNIVLGTARSMGIDL 139
>gi|11467314|ref|NP_043171.1| ribosomal protein L11 [Cyanophora paradoxa] >gi|1350604|sp|P48126|RK11_CYAPA Cyanelle 50S ribosomal protein L11 >gi|1016115|gb|AAA81202.1| ribosomal protein L11 (141 aa)
Score = 217, Expect = 1.6e-16, Identities = 51/132 (38%), Positives = 82/132 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++  I K+ L  G+A P    GP L   G++   F K++N +T DK G VIP  IT + D+S++F +KT P ++L+ KAA+++ G+     + V +I++ +  +IAK K  D N  + EA  R+V G+A+ MGI I
  S:     4 KVIAIIKIVLPAGKATPAPPVGPALGPYGVSSVNFCKEYNAKTADKGGLVIPAEITVYDDRSYSFVLKTPPASVLIAKAASVEKGSGEPNRKKVGSITKAQLEQIAKVKFPDLNTQNLEAASRIVEGTARNMGITI 139
>gi|16123888|ref|NP_407201.1| 50S ribosomal protein L11 [Yersinia pestis CO92] >gi|22124395|ref|NP_667818.1| 50S ribosomal protein L11 [Yersinia pestis KIM] >gi|45442868|ref|NP_994407.1| 50S ribosomal protein L11 [Yersinia pestis biovar Microtus str. 91001] >gi|51594634|ref|YP_068825.1| 50S ribosomal protein L11 [Yersinia pseudotuberculosis IP 32953] >gi|108809614|ref|YP_653530.1| 50S ribosomal protein L11 [Yersinia pestis Antiqua] >gi|108810381|ref|YP_646148.1| 50S ribosomal protein L11 [Yersinia pestis Nepal516] >gi|145600992|ref|YP_001165068.1| 50S ribosomal protein L11 [Yersinia pestis Pestoides F] >gi|153949970|ref|YP_001402815.1| 50S ribosomal protein L11 [Yersinia pseudotuberculosis IP 31758] >gi|153997215|ref|ZP_02022322.1| 50S ribosomal protein L11 [Yersinia pestis CA88-4125] >gi|165928313|ref|ZP_02224145.1| ribosomal protein L11 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165938215|ref|ZP_02226774.1| ribosomal protein L11 [Yersinia pestis biovar Orientalis str. IP275] >gi|166012052|ref|ZP_02232950.1| ribosomal protein L11 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214407|ref|ZP_02240442.1| ribosomal protein L11 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402429|ref|ZP_02307889.1| ribosomal protein L11 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422934|ref|ZP_02314687.1| ribosomal protein L11 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426814|ref|ZP_02318567.1| ribosomal protein L11 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170022593|ref|YP_001719098.1| ribosomal protein L11 [Yersinia pseudotuberculosis YPIII] >gi|186893635|ref|YP_001870747.1| ribosomal protein L11 [Yersinia pseudotuberculosis PB1/+] >gi|166230949|sp|A4TS33|RL11_YERPP 50S ribosomal protein L11 >gi|166982409|sp|A7FNI7|RL11_YERP3 50S ribosomal protein L11 >gi|38605409|sp|Q8ZAP1|RL11_YERPE 50S ribosomal protein L11 >gi|56404763|sp|Q66FQ6|RL11_YERPS 50S ribosomal protein L11 >gi|118597360|sp|Q1C1T7|RL11_YERPA 50S ribosomal protein L11 >gi|118597361|sp|Q1CN82|RL11_YERPN 50S ribosomal protein L11 >gi|21957176|gb|AAM84069.1|AE013648_11 50S ribosomal subunit protein L11 [Yersinia pestis KIM] >gi|45437734|gb|AAS63284.1| 50S ribosomal protein L11 [Yersinia pestis biovar Microtus str. 91001] >gi|51587916|emb|CAH19519.1| 50S ribosomal protein L11 [Yersinia pseudotuberculosis IP 32953] >gi|108774029|gb|ABG16548.1| LSU ribosomal protein L11P [Yersinia pestis Nepal516] >gi|108781527|gb|ABG15585.1| LSU ribosomal protein L11P [Yersinia pestis Antiqua] >gi|115349367|emb|CAL22338.1| 50S ribosomal protein L11 [Yersinia pestis CO92] >gi|145212688|gb|ABP42095.1| LSU ribosomal protein L11P [Yersinia pestis Pestoides F] >gi|149289323|gb|EDM39402.1| 50S ribosomal protein L11 [Yersinia pestis CA88-4125] >gi|152961465|gb|ABS48926.1| ribosomal protein L11 [Yersinia pseudotuberculosis IP 31758] >gi|165913876|gb|EDR32494.1| ribosomal protein L11 [Yersinia pestis biovar Orientalis str. IP275] >gi|165919652|gb|EDR36985.1| ribosomal protein L11 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989047|gb|EDR41348.1| ribosomal protein L11 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204411|gb|EDR48891.1| ribosomal protein L11 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166957145|gb|EDR55166.1| ribosomal protein L11 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048209|gb|EDR59617.1| ribosomal protein L11 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054196|gb|EDR64021.1| ribosomal protein L11 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749127|gb|ACA66645.1| ribosomal protein L11 [Yersinia pseudotuberculosis YPIII] >gi|186696661|gb|ACC87290.1| ribosomal protein L11 [Yersinia pseudotuberculosis PB1/+] (142 aa)
Score = 217, Expect = 1.8e-16, Identities = 53/134 (39%), Positives = 80/134 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++  +  EIA+TK  D   +D +A++R + G+A  MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGVPNKDKVGKVTSAQVREIAETKAADMTGSDVDAMMRSIEGTAHSMGLVVEG 142
>gi|68171884|ref|ZP_00545210.1| Ribosomal protein L11, bacterial [Ehrlichia chaffeensis str. Sapulpa] >gi|88657759|ref|YP_507744.1| 50S ribosomal protein L11 [Ehrlichia chaffeensis str. Arkansas] >gi|67998695|gb|EAM85421.1| Ribosomal protein L11, bacterial [Ehrlichia chaffeensis str. Sapulpa] >gi|88599216|gb|ABD44685.1| ribosomal protein L11 [Ehrlichia chaffeensis str. Arkansas] (147 aa)
Score = 217, Expect = 1.8e-16, Identities = 57/128 (44%), Positives = 83/128 (64%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKD-----KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++K+NL+   G+A PGP++AS+    GI M +F K+FND T       K G+++   I+ + DKS++F I  +PV+ LLKKAA I  G+ N   + V  I      EIAK K+ D NA+  EA  +MV G+A  MGI +
  S:     6 VSKINLMIEAGKANPGPKIASVLGPRGIPMPKFCKEFNDITSGEGKQYKVGDLVTARISIYNDKSYSFTISDSPVSYLLKKAAAIDKGSVNPGKDNVGKIKMSAVYEIAKRKMSDMNADTVEAAAKMVIGTASSMGIVV 144
>gi|29653578|ref|NP_819270.1| ribosomal protein L11 [Coxiella burnetii RSA 493] >gi|161831381|ref|YP_001596171.1| ribosomal protein L11 [Coxiella burnetii RSA 331] >gi|164686032|ref|ZP_01946582.2| ribosomal protein L11 [Coxiella burnetii 'MSU Goat Q177'] >gi|165918630|ref|ZP_02218716.1| ribosomal protein L11 [Coxiella burnetii RSA 334] >gi|189040955|sp|A9NAL0|RL11_COXBR 50S ribosomal protein L11 >gi|38605226|sp|Q83ET4|RL11_COXBU 50S ribosomal protein L11 >gi|29540840|gb|AAO89784.1| ribosomal protein L11 [Coxiella burnetii RSA 493] >gi|161763248|gb|ABX78890.1| ribosomal protein L11 [Coxiella burnetii RSA 331] >gi|164601587|gb|EAX32791.2| ribosomal protein L11 [Coxiella burnetii 'MSU Goat Q177'] >gi|165917658|gb|EDR36262.1| ribosomal protein L11 [Coxiella burnetii RSA 334] (145 aa)
Score = 217, Expect = 1.9e-16, Identities = 57/136 (41%), Positives = 83/136 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKK-AANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           +IT   ++ +  G+A P    GP L   G+N+ EF + FN  TK+ + G   P IIT + D++F+F  KT P ++LLKK     K G+    TE V   +R++  EIAK K  D  A D EA +R +AG+A+ MGI +EGV+
  S:     4 KITGYIRLQIKAGEANPSPPVGPALGQHGVNIREFCESFNTATKNIEKGLPTPVIITVYADRTFSFITKTPPASVLLKKFVLKGKSGSARPNTEKVGKATRQQLEEIAKMKTPDLTAADLEAAIRTIAGTARSMGIDVEGVE 145
>gi|71892330|ref|YP_278064.1| 50S ribosomal subunit protein L11 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|118597137|sp|Q492B5|RL11_BLOPB 50S ribosomal protein L11 >gi|71796436|gb|AAZ41187.1| 50S ribosomal subunit protein L11 [Candidatus Blochmannia pennsylvanicus str. BPEN] (143 aa)
Score = 216, Expect = 2.0e-16, Identities = 54/133 (40%), Positives = 80/133 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ +  G A P    GP L   G+N+ EF K FN+ T   + G  IP +IT + D+SF+F  KT P ++LLKKAANI+ G++      V  IS  +  EIAK K VD    + E++ R + G+A+ +G+K+E
  S:     5 KIKAYIKLQISAGAANPSPPIGPALGQQGVNIIEFCKAFNENTAQLETGLPIPVVITVYSDRSFSFITKTPPASILLKKAANIQSGSEKPNIINVGKISSAQIYEIAKIKAVDMTGANIESISRSIIGTARSIGLKVE 142
>gi|24115268|ref|NP_709778.1| 50S ribosomal protein L11 [Shigella flexneri 2a str. 301] >gi|33301502|sp|Q83PC3|RL11_SHIFL 50S ribosomal protein L11 >gi|24054561|gb|AAN45485.1| 50S ribosomal subunit protein L11 [Shigella flexneri 2a str. 301] (142 aa)
Score = 216, Expect = 2.3e-16, Identities = 55/133 (41%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ISR +  +IA+TK  D    D EA+ R + G+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQQIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE 141
>gi|21672332|ref|NP_660399.1| 50S ribosomal protein L11 [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25054992|sp|Q8KA66|RL11_BUCAP 50S ribosomal protein L11 >gi|21622934|gb|AAM67610.1| 50S ribosomal protein L11 [Buchnera aphidicola str. Sg (Schizaphis graminum)] (142 aa)
Score = 216, Expect = 2.3e-16, Identities = 57/133 (42%), Positives = 82/133 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ +  G A P    GP L   G+N+ EF K FN  T++ + G  IP I+T + D+SFTF  KT P ++LLKKAA IK G+   K ET   I++ +  EIAKTK  D    + E+++R + G+AK MG+ +E
  S:     4 KIQSYIKLQVAAGMANPSPPIGPALGQKGVNIMEFCKLFNKTTENVEKGLPIPVIVTVYSDRSFTFITKTPPASVLLKKAAGIKSGSSKPKIETTGKITKLQIEEIAKTKKNDMTGLNIESMMRSIEGTAKSMGLIVE 141
>gi|93007005|ref|YP_581442.1| 50S ribosomal protein L11 [Psychrobacter cryohalolentis K5] >gi|118597278|sp|Q1Q8P5|RL11_PSYCK 50S ribosomal protein L11 >gi|92394683|gb|ABE75958.1| LSU ribosomal protein L11P [Psychrobacter cryohalolentis K5] (143 aa)
Score = 216, Expect = 2.5e-16, Identities = 56/135 (41%), Positives = 79/135 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+  F K+FN  T ++  G  IP  IT + DKSFTF +K+ P   LL+KAA I  G+    T  V  + R +  +I KTK  D  A D +A +R +AG+A+ MGI +EGV
  S:     4 KIDGYIKLQVPAGKANPSPPIGPALGQKGVNIMAFCKEFNAATSNQEPGLPIPTEITVYSDKSFTFIMKSPPAAYLLRKAAGIAKGSGTPNTAKVGKVDRAQLEDIVKTKDADLTAADLDAAVRTIAGTARSMGITVEGV 143
>gi|396322|gb|AAC43081.1| 50S ribosomal subunit protein L11 [Escherichia coli] (142 aa)
Score = 215, Expect = 2.8e-16, Identities = 55/133 (41%), Positives = 77/133 (57%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ISR +  EIA+TK  D    D EA+ R + G+ + MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTXRSMGLVVE 141
>gi|30023112|ref|NP_834743.1| 50S ribosomal protein L11 [Bacillus cereus ATCC 14579] >gi|30023115|ref|NP_834746.1| 50S ribosomal protein L11 [Bacillus cereus ATCC 14579] >gi|50403573|sp|Q812H1|RL11B_BACCR 50S ribosomal protein L11-2/L11-3 >gi|29898672|gb|AAP11944.1| LSU ribosomal protein L11P [Bacillus cereus ATCC 14579] >gi|29898675|gb|AAP11947.1| LSU ribosomal protein L11P [Bacillus cereus ATCC 14579] (141 aa)
Score = 215, Expect = 3.1e-16, Identities = 48/133 (36%), Positives = 81/133 (60%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++ ++ K+ L  G+A P P + ++    G+N+    K++N  T+ + G +IP  IT ++D+SF+ +IKT PV  LLK+ A I  G+       + +I+ EK  EIA+ K  D NA   EA +R + G+A+ MGI ++
  S:     4 KVLKVVKIQLPAGKANPAPPVGTVLGPTGVNIMMVCKEYNALTQGQAGMIIPAEITIYEDRSFSMKIKTAPVAELLKREAGISKGSGEPNKSKIGSITEEKLREIAEYKFPDMNAASVEAAMRTIEGTARSMGITVQ 140
>gi|85058108|ref|YP_453810.1| 50S ribosomal protein L11 [Sodalis glossinidius str. 'morsitans'] >gi|118597297|sp|Q2NWS0|RL11_SODGM 50S ribosomal protein L11 >gi|84778628|dbj|BAE73405.1| 50S ribosomal protein L11 [Sodalis glossinidius str. 'morsitans'] (142 aa)
Score = 215, Expect = 3.3e-16, Identities = 54/133 (40%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++  +  EIA+TK  D    D EA+ R +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSAQVREIAETKAADMTGADVEAMSRSIAGTARSMGLVVE 141
>gi|37912940|gb|AAR05272.1| ribosomal protein L11 [uncultured marine gamma proteobacterium EB000-45B06] >gi|40063167|gb|AAR38004.1| ribosomal protein L11 [uncultured marine bacterium 562] (142 aa)
Score = 215, Expect = 3.3e-16, Identities = 49/133 (36%), Positives = 83/133 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  I K+ +  G A P    GP L  +G+N+ +F   FN +T+  + G  +P +IT ++DKSFTF +KT P  +L+KK   I  G+     E V  ++R +  +IAK K  D N+ND +A + ++AG+A+ MG++++
  S:     4 KVANILKLQIPAGGANPSPPVGPALGQVGVNIMDFCNAFNAETQSAEKGMPLPVVITVYEDKSFTFVVKTPPAAVLIKKILGIAKGSGEPNREKVGKLTRAQLEDIAKQKEPDLNSNDIDAAVLIIAGTARSMGVEVD 141
>gi|78188331|ref|YP_378669.1| 50S ribosomal protein L11 [Chlorobium chlorochromatii CaD3] >gi|118597145|sp|Q3ATP9|RL11_CHLCH 50S ribosomal protein L11 >gi|78170530|gb|ABB27626.1| LSU ribosomal protein L11P [Chlorobium chlorochromatii CaD3] (141 aa)
Score = 215, Expect = 3.3e-16, Identities = 53/133 (39%), Positives = 77/133 (57%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF KQFN +T+   G +IP +IT + DKSFTF  KT P  +LL K AN K G+       V T++ E+  +IA+ K+ D NA D      M+ G+A+ MGI ++
  S:     4 KVIGFIKLQIPAGGANPAPPVGPALGQKGVNIMEFCKQFNAKTQADAGTIIPVVITVYSDKSFTFITKTPPAPVLLLKEANQKKGSGEPNRNKVGTVTGEQVRKIAELKMPDLNAVDLAGAEAMIRGTARSMGIVVQ 140
>gi|132648|sp|P10055|RL11_PROVU 50S ribosomal protein L11 >gi|45925|emb|CAA31097.1| unnamed protein product [Proteus vulgaris] (142 aa)
Score = 214, Expect = 3.6e-16, Identities = 55/127 (43%), Positives = 77/127 (60%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT   D+SFTF  KT P  +LLKKAA +K G+     E V  I+  +  EIA+TK  D    D EA++R +AG+A+ MG+ +E
  S:    10 KLQVSAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESVEKGLPIPVVITVIADRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKEKVGKITSAQVREIAETKAADLTGADVEAMMRSIAGTARSMGLVVE 141
>gi|85710268|ref|ZP_01041333.1| ribosomal protein L11 [Erythrobacter sp. NAP1] >gi|85688978|gb|EAQ28982.1| ribosomal protein L11 [Erythrobacter sp. NAP1] (143 aa)
Score = 214, Expect = 3.7e-16, Identities = 51/132 (38%), Positives = 78/132 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I    K+ +  G A P    GP L   G+N+ EF K FN  T+D +    IP  IT + D+SFTF  K+ P + +LKKAA +K G+      +  TI + +  EIA+ K+ D NAND +  ++++ GSA+ MG+ +
  S:     4 KIEGYIKLQVPAGTANPSPPIGPALGQRGVNIMEFCKAFNAATQDLEKNAPIPTTITVYADRSFTFTYKSPPASYMLKKAAKLKSGSSEPGKTSAGTIKQSQVKEIAEAKMADLNANDIDQAMKIIEGSARSMGLDV 140
>gi|76799122|ref|ZP_00781309.1| ribosomal protein L11 [Streptococcus agalactiae 18RS21] >gi|76585526|gb|EAO62097.1| ribosomal protein L11 [Streptococcus agalactiae 18RS21] (106 aa)
Score = 214, Expect = 4.1e-16, Identities = 46/102 (45%), Positives = 69/102 (67%)
  Q:    40 FTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           FTK+FN +T D+ G +IP +I+ ++DKSF F  KT P  +LLKKAA ++ G+       VATI+R +  EIA+TK+ D NA + E+ +RM+ G+A+ MG  +
  S:     3 FTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGEPNKTKVATITRAQVQEIAETKMPDLNAANLESAMRMIEGTARSMGFTV 104
>gi|38605134|sp|P60104|RL11_PRB01 50S ribosomal protein L11 >gi|34112955|gb|AAQ62400.1| Ribosomal protein L11 [uncultured marine gamma proteobacterium EBAC31A08] (142 aa)
Score = 214, Expect = 4.3e-16, Identities = 48/133 (36%), Positives = 83/133 (62%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++  I K+ +  G A P    GP L  +G+N+ +F   FN +T+  + G  +P +IT ++DKSFTF +KT P  +L++K   I  G+     E V  ++R +  +IAK K  D N+ND +A + ++AG+A+ MG++++
  S:     4 KVANILKLQIPAGGANPSPPVGPALGQVGVNIMDFCNAFNAETQSAEKGMPLPVVITVYEDKSFTFVVKTPPAAVLIRKILGIAKGSGEPNREKVGKLTRAQLEDIAKQKEPDLNSNDIDAAVLIIAGTARSMGVEVD 141
>gi|68536953|ref|YP_251658.1| 50S ribosomal protein L11 [Corynebacterium jeikeium K411] >gi|118597152|sp|Q4JT17|RL11_CORJK 50S ribosomal protein L11 >gi|68264552|emb|CAI38040.1| 50S ribosomal protein L11 [Corynebacterium jeikeium K411] (146 aa)
Score = 213, Expect = 5.3e-16, Identities = 55/133 (41%), Positives = 87/133 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++T + K+ +  GQA P    GP L + G+N+ EFTK +N  T+ + G ++P  IT ++D+SF F++KT P   LL KAA I+ G+    T+ V +++ ++  EIA TK  D NAND EA   ++AG+A+ MGI ++
  S:     5 KVTGLIKLQIQAGQATPAPPVGPALGAHGVNIVEFTKAYNAATEAQRGNIVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGIQKGSGVPHTDKVGSVTWDQCKEIATTKKEDLNANDIEAGAAIIAGTARSMGITVK 141
>gi|15965097|ref|NP_385450.1| 50S ribosomal protein L11 [Sinorhizobium meliloti 1021] >gi|38605419|sp|Q92QI1|RL11_RHIME 50S ribosomal protein L11 >gi|15074277|emb|CAC45923.1| Probable 50S ribosomal protein L11 [Sinorhizobium meliloti 1021] (142 aa)
Score = 213, Expect = 5.4e-16, Identities = 52/128 (40%), Positives = 78/128 (60%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  T++ + G  IP +IT ++DKSFTF +K  PV+  LK+ A ++ G+K        +IS+ +   IA+ K+ D NA D +  + MV GSA+ MG+++ G
  S:    10 KLQVKAGSANPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGMPIPVVITYYQDKSFTFVMKQPPVSYFLKREAKVQAGSKTPGKAKAGSISKAQIRTIAEAKMKDLNAADIDGAMAMVEGSARSMGLEVTG 142
>gi|15616667|ref|NP_239879.1| 50S ribosomal protein L11 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11134505|sp|P57150|RL11_BUCAI 50S ribosomal protein L11 >gi|25295143|pir||E84934 50S ribosomal protein L11 [imported] - Buchnera sp. (strain APS) >gi|10038730|dbj|BAB12765.1| 50S ribosomal protein L11 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (142 aa)
Score = 212, Expect = 6.4e-16, Identities = 56/134 (41%), Positives = 83/134 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +I    K+ +  G A P    GP L   G+N+ EF K FN +T++ + G  IP IIT + D+SFTF  KT P ++LLKK + IK G+  +K+E +  I+R +  EIA  K  D   ++ E ++R + G+AK MG+ IEG
  S:     4 KIQSYIKLQVSAGAANPSPPIGPALGQKGVNIMEFCKLFNKKTENIEKGLPIPVIITVYSDRSFTFITKTPPASVLLKKLSGIKKGSSKNKSEKIGKINRSQIKEIAIIKNNDMTGSNIENMMRSIEGTAKSMGLIIEG 142
>gi|50119179|ref|YP_048346.1| 50S ribosomal protein L11 [Pectobacterium atrosepticum SCRI1043] >gi|56404773|sp|Q6DAN4|RL11_ERWCT 50S ribosomal protein L11 >gi|49609705|emb|CAG73138.1| 50S ribosomal protein L11 [Erwinia carotovora subsp. atroseptica SCRI1043] (142 aa)
Score = 212, Expect = 6.8e-16, Identities = 52/133 (39%), Positives = 80/133 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G   P +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++  +  EIA+TK  D   +D +A++R +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPTPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSAQVREIAETKAADMTGSDVDAMVRSIAGTARSMGLVVE 141
>gi|11465493|ref|NP_045116.1| ribosomal protein L11 [Cyanidium caldarium] >gi|38605521|sp|Q9TM01|RK11_CYACA Chloroplast 50S ribosomal protein L11 >gi|6466396|gb|AAF12978.1|AF022186_101 unknown; 50S ribosomal protein L11 [Cyanidium caldarium] (141 aa)
Score = 212, Expect = 6.9e-16, Identities = 51/133 (38%), Positives = 82/133 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ L  G+A P    GP L   G+N+  F K++N +T+++ G +IP  I  ++DKSFTF +KT P ++LLK+A  I+   K  + E V +IS ++   IAK K+ + N  D    ++++ G+AK MGI +E
  S:     4 KIITTVKLALPAGKATPAPPVGPALGQHGVNIMMFVKEYNARTEEQKGSIIPAEIQIYEDKSFTFILKTPPASILLKQATGIEKATKAPRREQVGSISYKEIQNIAKIKINELNTKDLSKAIKIIEGTAKNMGISVE 140
>gi|148653837|ref|YP_001280930.1| 50S ribosomal protein L11 [Psychrobacter sp. PRwf-1] >gi|172048573|sp|A5WH39|RL11_PSYWF 50S ribosomal protein L11 >gi|148572921|gb|ABQ94980.1| LSU ribosomal protein L11P [Psychrobacter sp. PRwf-1] (143 aa)
Score = 211, Expect = 7.7e-16, Identities = 56/135 (41%), Positives = 79/135 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +I    K+ +  G+A P    GP L   G+N+  F K+FN  T   + G  IP  IT + DKSFTF +K+ P   LL+KAA I  G+    T  V  ++R +  EI +TK  D  A D +A +R +AG+A+ MGI +EGV
  S:     4 KIDGYIKLQVPAGKANPSPPIGPALGQKGVNIMAFCKEFNAATASMEPGLPIPTEITVYADKSFTFIMKSPPAAFLLRKAAGIAKGSGVPNTTKVGKVTRAQLEEIVQTKNADLTAADLDAAVRTIAGTARSMGIDVEGV 143
>gi|77957016|ref|ZP_00821085.1| COG0080: Ribosomal protein L11 [Yersinia bercovieri ATCC 43970] >gi|77960656|ref|ZP_00824518.1| COG0080: Ribosomal protein L11 [Yersinia mollaretii ATCC 43969] >gi|123440671|ref|YP_001004664.1| 50S ribosomal protein L11 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166230948|sp|A1JIH6|RL11_YERE8 50S ribosomal protein L11 >gi|122087632|emb|CAL10414.1| 50S ribosomal protein L11 [Yersinia enterocolitica subsp. enterocolitica 8081] (142 aa)
Score = 211, Expect = 7.8e-16, Identities = 52/134 (38%), Positives = 79/134 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V T++  +  EIA+TK  D      + ++R + G+A+ MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGTVTSAQVREIAETKAADMTGASIDDMMRSIEGTARSMGLVVEG 142
>gi|148263130|ref|YP_001229836.1| 50S ribosomal protein L11 [Geobacter uraniireducens Rf4] >gi|189040961|sp|A5GAX7|RL11_GEOUR 50S ribosomal protein L11 >gi|146396630|gb|ABQ25263.1| LSU ribosomal protein L11P [Geobacter uraniireducens Rf4] (140 aa)
Score = 211, Expect = 8.1e-16, Identities = 49/132 (37%), Positives = 80/132 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +IT   K+ +  G+A P    GP L   G+N+ EF K FN +T+ + G + P +IT F D+SF+F  KT P ++L+KKA  I+ G+       V  +++++  EIA  K+ D NA   E  ++ + G+A+ MG++I
  S:     4 KITGYIKLQIPAGKANPSPPIGPALGQHGVNIMEFCKAFNAKTQAEEGTITPVVITVFADRSFSFITKTPPASVLIKKALGIESGSSVPNKNKVGKLTKDQVKEIAAKKMPDLNAASLETAMKTIEGTARSMGVEI 139
>gi|77972253|ref|ZP_00827825.1| COG0080: Ribosomal protein L11 [Yersinia frederiksenii ATCC 33641] (142 aa)
Score = 210, Expect = 9.8e-16, Identities = 52/134 (38%), Positives = 79/134 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V T++  +  EIA+TK  D      + ++R + G+A+ MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGTVTGAQVREIAETKAADMTGASIDDMMRSIEGTARSMGLVVEG 142
>gi|50083575|ref|YP_045085.1| 50S ribosomal protein L11 [Acinetobacter sp. ADP1] >gi|56404778|sp|Q6FF94|RL11_ACIAD 50S ribosomal protein L11 >gi|49529551|emb|CAG67263.1| 50S ribosomal protein L11 [Acinetobacter sp. ADP1] (142 aa)
Score = 210, Expect = 1.0e-15, Identities = 56/133 (42%), Positives = 81/133 (60%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ +  G+A P    GP L   G+N+  F K+FN  T K + G  IP +IT + DKSFTF +KT P ++LLKKAA I+ G+       V  ++R +  EIA TK  D    D +A +R +AGSA+ MG+++E
  S:     4 KIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKLEVGLPIPVVITVYNDKSFTFIMKTPPASILLKKAAGIQKGSSVPNKTKVGKLTRAQLEEIATTKEPDLTGADLDARVRTIAGSARSMGLEVE 141
>gi|83594031|ref|YP_427783.1| 50S ribosomal protein L11 [Rhodospirillum rubrum ATCC 11170] >gi|118597286|sp|Q2RQU9|RL11_RHORT 50S ribosomal protein L11 >gi|83576945|gb|ABC23496.1| LSU ribosomal protein L11P [Rhodospirillum rubrum ATCC 11170] (142 aa)
Score = 209, Expect = 1.3e-15, Identities = 52/132 (39%), Positives = 81/132 (61%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I    K+ +  G+A P    GP L   G+N+ EF K FN  T+  + G  IP +ITA+ D++FT+  KT P+T  LKKAA I  G+      +  T++ E+  +IA+ K+ D N+   EA ++MV GSA+ MG+++
  S:     4 KIIGYIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAATQGLEPGMPIPVVITAYGDRTFTYITKTPPMTYFLKKAAGIGKGSTTPGKGSAGTVTMEQVRDIAEKKMPDLNSPTIEAAVQMVVGSARSMGLQV 140
>gi|37524444|ref|NP_927788.1| 50S ribosomal protein L11 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|38605133|sp|P60103|RL11_PHOLL 50S ribosomal protein L11 >gi|36783868|emb|CAE12730.1| ribosomal protein L11 [Photorhabdus luminescens subsp. laumondii TTO1] (142 aa)
Score = 209, Expect = 1.3e-15, Identities = 52/134 (38%), Positives = 78/134 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++  +  EIA+TK  D      +A++R + G+A+ MG+ +EG
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSAQIREIAETKAADMTGASVDAMMRSIEGTARSMGLVVEG 142
>gi|116625381|ref|YP_827537.1| 50S ribosomal protein L11P [Solibacter usitatus Ellin6076] >gi|122252315|sp|Q01SW8|RL11_SOLUE 50S ribosomal protein L11 >gi|116228543|gb|ABJ87252.1| LSU ribosomal protein L11P [Solibacter usitatus Ellin6076] (142 aa)
Score = 209, Expect = 1.4e-15, Identities = 51/132 (38%), Positives = 81/132 (61%)
  Q:    10 RITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQT--KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           ++T   K+ +  G+A P P + +     G+N+ +F K +N +T  KD+ G +IP +IT + D+SFTF  KT PV +L+K+A  I  G+       V  I++ +  EIAK KL D N  D +A +R V G+A+ MG+ +
  S:     4 KVTAQVKLQIPAGKATPAPPVGTALGPQGVNIMDFCKAYNAKTSGKDQEGLIIPVVITIYSDRSFTFITKTPPVPVLIKRAVAIAKGSPEPHKTKVGKITQAQVEEIAKIKLPDLNCFDLDAAMRSVRGTARSMGVDV 141
>gi|83858577|ref|ZP_00952099.1| LSU ribosomal protein L11P [Oceanicaulis alexandrii HTCC2633] >gi|83853400|gb|EAP91252.1| LSU ribosomal protein L11P [Oceanicaulis alexandrii HTCC2633] (142 aa)
Score = 209, Expect = 1.6e-15, Identities = 52/121 (42%), Positives = 77/121 (63%)
  Q:    21 GGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNS-KTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
            G A P    GP L   G+N+ EF K FN +T++ + G  IP  IT ++DKSFTF  KT P +  LKKAA ++ G+  + K   +AT++  +  EIA+ K  D NAND +A  +++ GSA+ MG ++
  S:    15 AGAANPSPPIGPALGQRGVNIMEFCKAFNAKTQEMEKGMPIPTTITVYQDKSFTFITKTAPASFFLKKAAKVQKGSGEAGKAAPIATVTAAQCREIAEAKFKDLNANDLDAATKIIEGSARSMGFEV 141
>gi|146278580|ref|YP_001168739.1| 50S ribosomal protein L11 [Rhodobacter sphaeroides ATCC 17025] >gi|166230918|sp|A4WVM0|RL11_RHOS5 50S ribosomal protein L11 >gi|145556821|gb|ABP71434.1| LSU ribosomal protein L11P [Rhodobacter sphaeroides ATCC 17025] (150 aa)
Score = 209, Expect = 1.6e-15, Identities = 57/128 (44%), Positives = 84/128 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIK-VGAKNSKT-------ETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   G+N+  F K+FN +T D + G   P IIT ++DKSF+ E+KT P + LLKKAA +  VG +N          E   T++  +  +IA+ K+ D NAND EA ++++ GSAK  GI+++G
  S:    10 KLQVKAGQANPSPPVGPALGQRGLNIMAFVKEFNAKTADLEPGTPTPVIITYYQDKSFSLELKTPPASFLLKKAAGLAPVGKRNRPKGSAKPGREVAGTVAVAQIRKIAEAKMKDLNANDVEAAMQIILGSAKSCGIEVKG 150
>gi|15889254|ref|NP_354935.1| 50S ribosomal protein L11 [Agrobacterium tumefaciens str. C58] >gi|54039102|sp|Q8UE04|RL11_AGRT5 50S ribosomal protein L11 >gi|15157084|gb|AAK87720.1| 50S Ribosomal Protein L11 [Agrobacterium tumefaciens str. C58] (143 aa)
Score = 207, Expect = 2.6e-15, Identities = 56/128 (43%), Positives = 79/128 (61%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKN-SKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  T++ + G  IP +IT ++DKSFTF +K  P+T  LKK A I  G+K   K   V +I++ +   IA+ K+ D NA D E  + MV GSA+ MG+++ G
  S:    10 KLQVKAGSANPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGMPIPVVITYYQDKSFTFAMKQPPMTYWLKKEAKITSGSKTPGKGAKVGSITKAQVKTIAEAKMKDLNAADIEGAMAMVEGSARAMGLEVVG 143
>gi|52840563|ref|YP_094362.1| 50S ribosomal protein L11 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54293310|ref|YP_125725.1| 50S ribosomal protein L11 [Legionella pneumophila str. Lens] >gi|54296354|ref|YP_122723.1| 50S ribosomal protein L11 [Legionella pneumophila str. Paris] >gi|148361064|ref|YP_001252271.1| 50S ribosomal protein L11 [Legionella pneumophila str. Corby] >gi|166230149|sp|A5IHS5|RL11_LEGPC 50S ribosomal protein L11 >gi|61214775|sp|Q5WZM3|RL11_LEGPL 50S ribosomal protein L11 >gi|61214784|sp|Q5X870|RL11_LEGPA 50S ribosomal protein L11 >gi|61214809|sp|Q5ZYQ4|RL11_LEGPH 50S ribosomal protein L11 >gi|52627674|gb|AAU26415.1| 50S ribosomal protein L11 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53750139|emb|CAH11531.1| 50S ribosomal protein L11 [Legionella pneumophila str. Paris] >gi|53753142|emb|CAH14589.1| 50S ribosomal protein L11 [Legionella pneumophila str. Lens] >gi|148282837|gb|ABQ56925.1| hypothetical protein LPC_3025 [Legionella pneumophila str. Corby] (144 aa)
Score = 206, Expect = 3.0e-15, Identities = 57/130 (43%), Positives = 83/130 (63%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           K+ +  G+A P    GP L   G+N+ EF K FN  T+  + G  IP +IT + D+SFTF  KT P ++LLKKAA I+ G+    T+ VA ++  +  EIAK K  D  A D  A +R +AG+A+ MGI++EG++
  S:    10 KLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAATQQMEQGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVSQLEEIAKVKKPDLTAADLAAAVRSIAGTARSMGIEVEGLE 144
>gi|32034813|ref|ZP_00134925.1| COG0080: Ribosomal protein L11 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|33152871|ref|NP_874224.1| 50S ribosomal protein L11 [Haemophilus ducreyi 35000HP] >gi|126209182|ref|YP_001054407.1| 50S ribosomal protein L11 [Actinobacillus pleuropneumoniae L20] >gi|190151047|ref|YP_001969572.1| 50S ribosomal protein L11 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166230095|sp|A3N316|RL11_ACTP2 50S ribosomal protein L11 >gi|34588123|sp|O32613|RL11_HAEDU 50S ribosomal protein L11 >gi|33149096|gb|AAP96613.1| 50S ribosomal protein L11 [Haemophilus ducreyi 35000HP] >gi|126097974|gb|ABN74802.1| 50S ribosomal protein L11 [Actinobacillus pleuropneumoniae L20] >gi|189916178|gb|ACE62430.1| 50S ribosomal protein L11 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (142 aa)
Score = 205, Expect = 4.7e-15, Identities = 51/133 (38%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKA  IK G+     + V T+++E+  +IA+TK  D      E  ++ +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAVGIKSGSGKPNKDKVGTVTQEQLRQIAETKAADMTGATIETKMKSIAGTARSMGLIVE 141
>gi|15603608|ref|NP_246682.1| 50S ribosomal protein L11 [Pasteurella multocida subsp. multocida str. Pm70] >gi|38605463|sp|Q9CK85|RL11_PASMU 50S ribosomal protein L11 >gi|12722158|gb|AAK03827.1| RpL11 [Pasteurella multocida subsp. multocida str. Pm70] (142 aa)
Score = 204, Expect = 5.1e-15, Identities = 51/133 (38%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++ E+  +IA+TK  D   +  E  ++ +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVITVYADRSFTFITKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLEQVRQIAETKAADMTGSSIETKMKSIAGTARSMGLVVE 141
>gi|47570857|ref|ZP_00241392.1| ribosomal protein L11 [Bacillus cereus G9241] >gi|47552475|gb|EAL10991.1| ribosomal protein L11 [Bacillus cereus G9241] (98 aa)
Score = 203, Expect = 7.8e-15, Identities = 48/96 (50%), Positives = 63/96 (65%)
  Q:    47 QTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +T D+ G +IP  IT F+D+SFTF  KT P  +LLKK A I+ G+       VAT+ R+K  EIA+TK+ D NA   EA +RMV G+A+ MGI IE
  S:     2 RTADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIE 97
>gi|86357293|ref|YP_469185.1| 50S ribosomal protein L11 [Rhizobium etli CFN 42] >gi|118597281|sp|Q2K9M8|RL11_RHIEC 50S ribosomal protein L11 >gi|86281395|gb|ABC90458.1| 50S ribosomal protein L11 [Rhizobium etli CFN 42] (143 aa)
Score = 202, Expect = 9.9e-15, Identities = 54/128 (42%), Positives = 78/128 (60%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKN-SKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G A P    GP L   GIN+ EF K FN  T++ + G  IP +IT ++DKSFTF +K  PV+  LKK A I  G+K   K     T+++ +   IA+ K+ D NA D E  + M+ GSA+ MG+++ G
  S:    10 KLQVKAGSANPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGMPIPVVITYYQDKSFTFAMKQPPVSYWLKKEAKITSGSKTPGKGAKAGTLTKAQIKTIAEAKMKDLNAADIEGAMAMIEGSARAMGLEVVG 143
>gi|77462247|ref|YP_351751.1| 50S ribosomal protein L11 [Rhodobacter sphaeroides 2.4.1] >gi|126461109|ref|YP_001042223.1| 50S ribosomal protein L11 [Rhodobacter sphaeroides ATCC 17029] >gi|126461123|ref|YP_001042237.1| 50S ribosomal protein L11 [Rhodobacter sphaeroides ATCC 17029] >gi|119364581|sp|Q3J5T4|RL11_RHOS4 50S ribosomal protein L11 >gi|77386665|gb|ABA77850.1| LSU ribosomal protein L11P [Rhodobacter sphaeroides 2.4.1] >gi|126102773|gb|ABN75451.1| LSU ribosomal protein L11P [Rhodobacter sphaeroides ATCC 17029] >gi|126102787|gb|ABN75465.1| LSU ribosomal protein L11P [Rhodobacter sphaeroides ATCC 17029] (150 aa)
Score = 201, Expect = 1.1e-14, Identities = 54/128 (42%), Positives = 84/128 (65%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIK-VGAKNSKT-------ETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  GQA P    GP L   G+N+  F K+FN ++ D + G   P IIT ++DKSF+ E+KT P + +LKKAA +  VG +N          E   +++  +  +IA+ K+ D NAND EA ++++ GSAK  GI+++G
  S:    10 KLQVKAGQANPSPPVGPALGQRGLNIMAFVKEFNAKSADLEPGTPTPVIITYYQDKSFSLELKTPPASFMLKKAAGLAPVGKRNRPKGSTKPGREVAGSVTVAQIRKIAEAKMKDLNANDVEAAMQIILGSAKSCGIEVKG 150
>gi|33520004|ref|NP_878836.1| 50S ribosomal subunit protein L11 [Candidatus Blochmannia floridanus] >gi|38605188|sp|Q7VRP3|RL11_BLOFL 50S ribosomal protein L11 >gi|33504350|emb|CAD83243.1| 50S ribosomal subunit protein L11 [Candidatus Blochmannia floridanus] (146 aa)
Score = 200, Expect = 1.6e-14, Identities = 46/116 (39%), Positives = 73/116 (62%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           GP L   GIN+ +F K FN +T D + G ++P +IT + D+SF+F IKT     LLKKAA IK G++  K  +V  +   +  EIAK KL+D  + + E+  + + G+A+ +G+++E
  S:    27 GPALGQQGINIMKFCKDFNTRTADFEMGLILPVVITVYVDRSFSFVIKTPTAVFLLKKAAGIKSGSEKPKCVSVGKVLISQIYEIAKIKLIDMTSLNLESASKSIMGTARSIGLEVE 143
>gi|53733304|ref|ZP_00156344.2| COG0080: Ribosomal protein L11 [Haemophilus influenzae R2866] >gi|145635402|ref|ZP_01791104.1| 50S ribosomal protein L11 [Haemophilus influenzae PittAA] >gi|145637444|ref|ZP_01793103.1| 50S ribosomal protein L11 [Haemophilus influenzae PittHH] >gi|145638568|ref|ZP_01794177.1| 50S ribosomal protein L11 [Haemophilus influenzae PittII] >gi|145640493|ref|ZP_01796077.1| 50S ribosomal protein L11 [Haemophilus influenzae R3021] >gi|148827708|ref|YP_001292461.1| 50S ribosomal protein L11 [Haemophilus influenzae PittGG] >gi|166230142|sp|A5UH22|RL11_HAEIG 50S ribosomal protein L11 >gi|145267408|gb|EDK07410.1| 50S ribosomal protein L11 [Haemophilus influenzae PittAA] >gi|145269390|gb|EDK09334.1| 50S ribosomal protein L11 [Haemophilus influenzae PittHH] >gi|145272163|gb|EDK12071.1| 50S ribosomal protein L11 [Haemophilus influenzae PittII] >gi|145275079|gb|EDK14941.1| 50S ribosomal protein L11 [Haemophilus influenzae 22.4-21] >gi|148718950|gb|ABR00078.1| 50S ribosomal protein L11 [Haemophilus influenzae PittGG] (142 aa)
Score = 200, Expect = 1.7e-14, Identities = 50/133 (37%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++ ++  +IA+TK  D      E  ++ +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLDQVRQIAETKAADMTGASIETKMKSIAGTARSMGLVVE 141
>gi|52424262|ref|YP_087399.1| 50S ribosomal protein L11 [Mannheimia succiniciproducens MBEL55E] >gi|56404760|sp|Q65W46|RL11_MANSM 50S ribosomal protein L11 >gi|52306314|gb|AAU36814.1| RplK protein [Mannheimia succiniciproducens MBEL55E] (142 aa)
Score = 199, Expect = 1.9e-14, Identities = 50/133 (37%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA +K G+     E V  ++ ++  +IA+TK  D      E  ++ +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKEKVGKVTLDQVRQIAETKAADMTGATIETKMKSIAGTARSMGLVVE 141
>gi|46581328|ref|YP_012136.1| 50S ribosomal protein L11 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120601493|ref|YP_965893.1| 50S ribosomal protein L11 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166230132|sp|A1VAK0|RL11_DESVV 50S ribosomal protein L11 >gi|50403575|sp|P62433|RL11_DESVH 50S ribosomal protein L11 >gi|46450750|gb|AAS97396.1| ribosomal protein L11 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120561722|gb|ABM27466.1| LSU ribosomal protein L11P [Desulfovibrio vulgaris subsp. vulgaris DP4] (140 aa)
Score = 199, Expect = 2.1e-14, Identities = 47/127 (37%), Positives = 76/127 (59%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           K+ +  G A P    GP L   G+N+  F K+FN +T ++ G + P +IT + D+SF+F  KT P ++LL KAA ++ G+       V +++  +  EIA  K+ D  A D EA  R + G+A+ MGI+++
  S:    10 KLQIPAGAANPSPPVGPALGQHGLNIMAFCKEFNAKTMEQKGMITPVVITVYADRSFSFITKTPPASVLLIKAAKLEKGSGEPNRNKVGSVTMAQVEEIAALKMPDLTAKDLEAAKRNILGTARSMGIEVK 140
>gi|152977732|ref|YP_001343361.1| 50S ribosomal protein L11 [Actinobacillus succinogenes 130Z] >gi|171472912|sp|A6VKC9|RL11_ACTSZ 50S ribosomal protein L11 >gi|150839455|gb|ABR73426.1| ribosomal protein L11 [Actinobacillus succinogenes 130Z] (142 aa)
Score = 199, Expect = 2.1e-14, Identities = 50/133 (37%), Positives = 79/133 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  +++++  +IA+TK  D      E  ++ +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTQDQIRQIAETKAADMTGATIETKMKSIAGTARSMGLVVE 141
>gi|16272461|ref|NP_438675.1| 50S ribosomal protein L11 [Haemophilus influenzae Rd KW20] >gi|53733052|ref|ZP_00155510.2| COG0080: Ribosomal protein L11 [Haemophilus influenzae R2846] >gi|68249114|ref|YP_248226.1| 50S ribosomal protein L11 [Haemophilus influenzae 86-028NP] >gi|145633531|ref|ZP_01789260.1| 50S ribosomal protein L11 [Haemophilus influenzae 3655] >gi|148825207|ref|YP_001289960.1| 50S ribosomal protein L11 [Haemophilus influenzae PittEE] >gi|166230141|sp|A5U9X6|RL11_HAEIE 50S ribosomal protein L11 >gi|1172953|sp|P44351|RL11_HAEIN 50S ribosomal protein L11 >gi|81336480|sp|Q4QN31|RL11_HAEI8 50S ribosomal protein L11 >gi|1573500|gb|AAC22175.1| ribosomal protein L11 (rpL11) [Haemophilus influenzae Rd KW20] >gi|68057313|gb|AAX87566.1| 50S ribosomal protein L11 [Haemophilus influenzae 86-028NP] >gi|144985900|gb|EDJ92508.1| 50S ribosomal protein L11 [Haemophilus influenzae 3655] >gi|148715367|gb|ABQ97577.1| 50S ribosomal protein L11 [Haemophilus influenzae PittEE] (142 aa)
Score = 198, Expect = 2.7e-14, Identities = 50/133 (37%), Positives = 78/133 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           ++    K+ +  G A P    GP L   G+N+ EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ++ ++  +IA+TK  D      E  ++ +AG+A+ MG+ +E
  S:     4 KVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNARTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLDQVRQIAETKAADMTGATIETKMKSIAGTARSMGLVVE 141
>gi|157825316|ref|YP_001493036.1| 50S ribosomal protein L11 [Rickettsia akari str. Hartford] >gi|166230919|sp|A8GMA3|RL11_RICAH 50S ribosomal protein L11 >gi|157799274|gb|ABV74528.1| 50S ribosomal protein L11 [Rickettsia akari str. Hartford] (145 aa)
Score = 197, Expect = 3.2e-14, Identities = 53/127 (41%), Positives = 78/127 (61%)
  Q:    17 VNLI--GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTET-VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +NLI   G A P    GP L    +N+  F  +FN+ TKD + G  +P +IT ++D SF+F+IKT P +  LKK A I  G+  +K E  V  ++ +   EIAK K+ D N  D EA  +++ GSA  MG+++ G
  S:    10 INLIIPAGGATPAPPIGPALGQRKVNIKTFCDEFNNSTKDMDKGVPLPTLITVYEDSSFSFKIKTPPASYFLKKYAKITKGSSATKKEAVVGKVTMDDCREIAKLKMPDLNTKDIEAATKIICGSAASMGLEVVG 144
>gi|83312243|ref|YP_422507.1| ribosomal protein L11 [Magnetospirillum magneticum AMB-1] >gi|82947084|dbj|BAE51948.1| Ribosomal protein L11 [Magnetospirillum magneticum AMB-1] (108 aa)
Score = 196, Expect = 4.1e-14, Identities = 49/103 (47%), Positives = 67/103 (65%)
  Q:    39 EFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKN-SKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           EF K FN QT+  + G  IP +ITA+ D++FTF  KT PV+  LKKAA +  G+    K  TV  ++  +  EIA+ K+VD NAND EA   M+ GSA+ MG+K+
  S:     2 EFCKAFNAQTQALEPGMPIPVVITAYSDRTFTFVTKTPPVSYFLKKAAAVSKGSTTPGKGATVGEVTMAQIREIAEKKMVDLNANDVEAASTMIVGSARSMGLKV 106
>gi|15639229|ref|NP_218677.1| 50S ribosomal protein L11 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025470|ref|YP_001933242.1| ribosomal protein L11 [Treponema pallidum subsp. pallidum SS14] >gi|6093999|sp|O83265|RL11_TREPA 50S ribosomal protein L11 >gi|3322507|gb|AAC65225.1| ribosomal protein L11 (rplK) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018045|gb|ACD70663.1| ribosomal protein L11 [Treponema pallidum subsp. pallidum SS14] (146 aa)
Score = 196, Expect = 4.7e-14, Identities = 56/139 (40%), Positives = 91/139 (65%)
  Q:     4 VAFKDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +A K   +T+I K+    G+A P    GP L   G++  +F +QFND+TK  + G V+P ++T + DKSF+F +KT P  +L++KA  I+ G+ NS  + VA +S  +  EIA+ KL D +A   +A  R++AG+A+ MG+++E
  S:     1 MAAKKKVVTQI-KLQCPAGKATPAPPVGPALGPHGVSAPQFVQQFNDRTKSMEPGLVVPVVVTVYSDKSFSFVLKTPPAAVLIRKACGIEKGSTNSVKQKVARLSLAQLTEIAQVKLPDMSALTLDAAKRIIAGTARSMGVEVE 143
>gi|67459542|ref|YP_247166.1| 50S ribosomal protein L11 [Rickettsia felis URRWXCal2] >gi|75536053|sp|Q4UKD0|RL11_RICFE 50S ribosomal protein L11 >gi|67005075|gb|AAY62001.1| 50S ribosomal protein L11 [Rickettsia felis URRWXCal2] (145 aa)
Score = 194, Expect = 8.0e-14, Identities = 52/127 (40%), Positives = 78/127 (61%)
  Q:    17 VNLI--GGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTET-VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +NLI   G A P    GP L    +N+  F  +FN+ TKD + G  +P +IT ++D SF+F+IKT P +  LKK A I  G+  +K E  V  ++ +   EIAK K+ D N  D EA  +++ GSA  +G+++ G
  S:    10 INLIIPAGGATPAPPIGPALGQRKVNIKTFCDEFNNSTKDTEKGVPLPTLITVYEDSSFSFKIKTPPASYFLKKYARITKGSSATKKEAVVGKVTMDDCREIAKLKMPDLNTKDIEAATKIICGSAASIGLEVVG 144
>gi|40786357|dbj|BAD07007.1| 50S ribosomal protein L11 [Onion yellows phytoplasma] (113 aa)
Score = 192, Expect = 1.5e-13, Identities = 46/106 (43%), Positives = 68/106 (64%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKL 115
           ++ +  K+ +  G+A P    GP L    +N+  F  QFN+ TKD+ G VIP II+ ++D++FTF  KT P + LLKKAA I+ G+ N+    VATI+ ++  EIA  KL
  S:     4 KVVKTVKLQIPAGKANPAPPVGPALGQAQVNIPAFCSQFNETTKDQMGFVIPVIISVYEDRTFTFVTKTPPASDLLKKAAKIESGSANASQTKVATITHKQVEEIANLKL 113
>gi|32491267|ref|NP_871521.1| hypothetical protein WGLp518 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|54039099|sp|Q8D237|RL11_WIGBR 50S ribosomal protein L11 >gi|25166474|dbj|BAC24664.1| rplK [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (142 aa)
Score = 192, Expect = 1.5e-13, Identities = 52/133 (39%), Positives = 76/133 (57%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           +I    K+ +  G A P    GP L   G+N+ EF K FN +T   + +  IP II+ + D++F+F  KT P    LK+AANIK G+ N K + +  IS  K  EIAK K  D   +   ++ + + G+AK MG+ IE
  S:     4 KIKAYVKLQIKAGSANPSPPIGPALGQQGVNIIEFCKSFNAKTNKIDKDTPIPVIISVYNDRTFSFITKTPPTAFFLKQAANIKSGSDNPKNKKIGKISIFKINEIAKKKSPDMTGSTLNSISKSIIGTAKSMGLSIE 141
>gi|15892100|ref|NP_359814.1| 50S ribosomal protein L11 [Rickettsia conorii str. Malish 7] >gi|34580869|ref|ZP_00142349.1| 50S ribosomal protein L11 [Rickettsia sibirica 246] >gi|157828051|ref|YP_001494293.1| 50S ribosomal protein L11 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932748|ref|YP_001649537.1| 50S ribosomal protein L11 [Rickettsia rickettsii str. Iowa] >gi|167471287|ref|ZP_02335991.1| LSU ribosomal protein L11P [Rickettsia africae ESF-5] >gi|166230922|sp|A8GQW0|RL11_RICRS 50S ribosomal protein L11 >gi|189040974|sp|B0BWA5|RL11_RICRO 50S ribosomal protein L11 >gi|54039103|sp|Q92J90|RL11_RICCN 50S ribosomal protein L11 >gi|15619224|gb|AAL02715.1| 50S ribosomal protein L11 [Rickettsia conorii str. Malish 7] >gi|28262254|gb|EAA25758.1| 50S ribosomal protein L11 [Rickettsia sibirica 246] >gi|157800532|gb|ABV75785.1| 50S ribosomal protein L11 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907835|gb|ABY72131.1| LSU ribosomal protein L11P [Rickettsia rickettsii str. Iowa] (145 aa)
Score = 190, Expect = 2.0e-13, Identities = 46/117 (39%), Positives = 70/117 (59%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTET-VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           GP L    +N+  F K FND T+  + G  +P +IT ++D SF+F+IKT P +  LKK A I  G+  +K E  V  ++ +   EIAK K+ D N  + EA  +++ GSA  MG+++ G
  S:    26 GPALGQRKVNIAAFCKDFNDATQGMEKGIPLPTVITVYEDSSFSFKIKTPPASYFLKKYAKITKGSSATKKEAVVGKVTMDDCREIAKLKMPDLNTKNIEAATKIICGSAASMGLEVVG 144
>gi|27904551|ref|NP_777677.1| 50S ribosomal protein L11 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|38258553|sp|Q89B16|RL11_BUCBP 50S ribosomal protein L11 >gi|27903948|gb|AAO26782.1| 50S ribosomal protein L11 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (146 aa)
Score = 190, Expect = 2.6e-13, Identities = 50/126 (39%), Positives = 76/126 (60%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           K+ +  G A P    GP L   GIN+ EF K FN +T + + G  IP IIT + DKSF+F  KT P ++LLKKAA I  G+       V TI+ ++ L+IA+ K +D   ++ + + + + G+A  +G+ I
  S:    10 KLQVSAGTANPSPPIGPALGQKGINIMEFCKAFNTRTNNLEKGLPIPTIITVYSDKSFSFITKTPPASVLLKKAAGITKGSSKPNQNKVGTITMQQILDIAQIKKIDMTGSNIDNISKSIIGTANSIGLII 140
>gi|11498149|ref|NP_069374.1| 50S ribosomal protein L11P (rpl11P) [Archaeoglobus fulgidus DSM 4304] >gi|3914670|sp|O29712|RL11_ARCFU 50S ribosomal protein L11P >gi|2650083|gb|AAB90697.1| LSU ribosomal protein L11P (rpl11P) [Archaeoglobus fulgidus DSM 4304] (157 aa)
Score = 188, Expect = 4.5e-13, Identities = 46/136 (33%), Positives = 75/136 (55%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           + ++ +V + GGQA PGP L      +G+N+ +   + N+ TKD  G  +P  I    D+SF  E+   PV+ L+K+   I+ GA N   E V  ++ E+ L IA+ K   + +   + V++ V G+   MGI +EG  P
  S:     1 MVQVVEVLVPGGQASPGPPLGPAIGPLGLNVKQVVDKINEATKDYEGLSVPVKIIVKDDRSFEIEVGIPPVSALIKRELGIEKGASNPGREVVGNLTMEQLLNIARIKRQQSLSYTLKEVVKEVLGTCNSMGITVEGKSP 140
>gi|161617285|ref|YP_001591250.1| hypothetical protein SPAB_05136 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|161366649|gb|ABX70417.1| hypothetical protein SPAB_05136 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (107 aa)
Score = 187, Expect = 5.3e-13, Identities = 47/104 (45%), Positives = 63/104 (60%)
  Q:    39 EFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           EF K FN +T   + G  IP +IT + D+SFTF  KT P  +LLKKAA IK G+     + V  ISR +  EIA+TK  D    D EA+ R + G+A+ MG+ +E
  S:     2 EFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE 106
>gi|51473335|ref|YP_067092.1| 50S ribosomal protein L11 [Rickettsia typhi str. Wilmington] >gi|56404767|sp|Q68XN2|RL11_RICTY 50S ribosomal protein L11 >gi|51459647|gb|AAU03610.1| 50S ribosomal protein L11 [Rickettsia typhi str. Wilmington] (145 aa)
Score = 186, Expect = 6.3e-13, Identities = 45/117 (38%), Positives = 68/117 (58%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTET-VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           GP L    +N+  F K FND T   + G  +P +IT + D SF+F++KT P +  LKK A I  G+  +K E  V  ++ +   EIAK K+ D N  + EA  +++ GSA  MG+++ G
  S:    26 GPALGQRKVNIAAFCKDFNDATNGMEKGVPLPTVITVYDDNSFSFKVKTPPASYFLKKYAKITKGSSATKKEAMVGKVTLDACREIAKLKISDLNTKNIEAATKIICGSAASMGLEVVG 144
>gi|15604012|ref|NP_220527.1| 50S ribosomal protein L11 [Rickettsia prowazekii str. Madrid E] >gi|6225956|sp|Q9ZE24|RL11_RICPR 50S ribosomal protein L11 >gi|3860703|emb|CAA14604.1| 50S RIBOSOMAL PROTEIN L11 (rplK) [Rickettsia prowazekii] (145 aa)
Score = 186, Expect = 7.5e-13, Identities = 45/117 (38%), Positives = 69/117 (58%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTET-VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           GP L    +N+  F K FND T   + G  +P +IT ++D SF+F++KT P +  LKK A I  G+  +K E  V  ++ +   EIAK K+ D N  + EA  +++ GSA  MG+++ G
  S:    26 GPALGQRKVNIAAFCKDFNDATNGMEKGVPLPTVITVYEDSSFSFKVKTPPASYFLKKYAKITKGSSATKKEAMVGKVTIDDCREIAKLKISDLNTKNIEAATKIICGSAASMGLEVVG 144
>gi|91205972|ref|YP_538327.1| 50S ribosomal protein L11 [Rickettsia bellii RML369-C] >gi|157826664|ref|YP_001495728.1| 50S ribosomal protein L11 [Rickettsia bellii OSU 85-389] >gi|166230920|sp|A8GV20|RL11_RICB8 50S ribosomal protein L11 >gi|118597288|sp|Q1RHC6|RL11_RICBR 50S ribosomal protein L11 >gi|91069516|gb|ABE05238.1| 50S ribosomal protein L11 [Rickettsia bellii RML369-C] >gi|157801968|gb|ABV78691.1| 50S ribosomal protein L11 [Rickettsia bellii OSU 85-389] (144 aa)
Score = 186, Expect = 7.6e-13, Identities = 51/127 (40%), Positives = 77/127 (60%)
  Q:    17 VNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTET-VATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +N+  G+A   P + S      +N+ EF K FN  T+  + G  +P +IT + DKSFTF +KT P + L+KK A +K G+  +K E  V  I+ +   EIAK K+ D N  D +A  +++ GSA  MGI++ G
  S:    11 LNVNAGEATAAPPIGSTLGQRKVNIMEFCKAFNAATQSIEKGTPLPTVITIYVDKSFTFIVKTPPASYLIKKYAKVKKGSGATKKEAVVGKITMDDCREIAKLKMPDLNTKDIKAATKIICGSAASMGIEVVG 143
>gi|86742793|ref|YP_483193.1| 50S ribosomal protein L11P [Frankia sp. CcI3] >gi|86569655|gb|ABD13464.1| LSU ribosomal protein L11P [Frankia sp. CcI3] (165 aa)
Score = 182, Expect = 1.9e-12, Identities = 43/134 (32%), Positives = 76/134 (56%)
  Q:    10 RITRIAKVNLIGGQA---KPGPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           +++ + ++   GG A   K G  L + G+N+    K+FN+ +   +G  +   ++ F+D+SF   +K+   T LL +AA ++ G+     E    ++  +  EIAK KL D N +  EA  ++VAG+A+ MGIK+ G
  S:    29 KLSAVVRIQQEGGNANVAKIGQALGTYGVNIVGVMKEFNEASAIHHGLQVSADVSIFEDRSFELSVKSPATTSLLLQAAGVRKGSPRPHAEHAGAVTVSQLREIAKVKLPDLNVDSMEAAEKIVAGTARSMGIKVTG 165
>gi|11466497|ref|NP_044746.1| ribosomal protein L11 [Reclinomonas americana] >gi|22001920|sp|O21234|RM11_RECAM Mitochondrial 60S ribosomal protein L11 >gi|2258327|gb|AAD11861.1| ribosomal protein L11 [Reclinomonas americana] (145 aa)
Score = 181, Expect = 2.8e-12, Identities = 48/131 (36%), Positives = 76/131 (58%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD---KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIK 140
           +I    ++ +  G+A P    GP L   G+N+ +F K+FN++ K    K+G  +P IIT + DK+F+F++KT  +T  +KK   I  GA     E    I      EIA+ K +D+N  D +++ + + GS K MGIK
  S:     3 KIIGFIRLEIESGKASPSPPVGPALGLRGVNIMQFCKEFNNRCKQLNIKDGVPVPTIITVYDDKTFSFKMKTPSITYFIKKHLEISKGASKPGKENFLNIDIRSLYEIAEIKKIDSNL-DIKSICKSLIGSVKSMGIK 139
>gi|58584908|ref|YP_198481.1| 50S ribosomal protein L11 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419224|gb|AAW71239.1| Ribosomal protein L11 [Wolbachia endosymbiont strain TRS of Brugia malayi] (146 aa)
Score = 179, Expect = 4.4e-12, Identities = 48/128 (37%), Positives = 80/128 (62%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKDKN-----GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           IAK+NL+   G+A PGP++AS+    GI + +F + FN  T   N     G+++   I+   D+S  F +   PV  LLK+ A +   + N   E VA +     ++IA+ K+VD   ++E++ ++MV G+AK MGI++
  S:     5 IAKINLLMEAGKAVPGPKIASVLGPRGIPVPKFCEAFNKVTSTANANYKVGDLVTVRISIKDDRSHDFTVSGPPVAYLLKQEAKLSKSSSNPGKELVAKLPMSAIIKIARYKMVDMKVDNEDSAVKMVIGTAKSMGIEV 143
>gi|73668160|ref|YP_304175.1| 50S ribosomal protein L11P [Methanosarcina barkeri str. Fusaro] >gi|118597255|sp|Q46EU7|RL11_METBF 50S ribosomal protein L11P >gi|72395322|gb|AAZ69595.1| LSU ribosomal protein L11P [Methanosarcina barkeri str. Fusaro] (161 aa)
Score = 179, Expect = 4.7e-12, Identities = 44/135 (32%), Positives = 76/135 (56%)
  Q:    11 ITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           +T I +  + GG+A PGP     L  +G+N+ E  ++ N++T+D NG  +P  +     K+   E+ T P   L+ K   I+ G+ N+ +E V  IS  +  +IA+ K  D  + D +A ++ V G+   MG+ +EGV+
  S:     1 MTSIVEALVPGGKANPGPPLGPALGPLGVNIKEVVEKINEKTRDYNGMQVPVKVIVDDKKNVEIEVGTPPTASLIMKELGIQKGSGNAGSEVVGNISISQVAKIARMKKEDVLSYDLKATMKEVMGTCVPMGVTVEGVE 139
>gi|58383599|ref|XP_312637.2| AGAP002332-PA [Anopheles gambiae str. PEST] >gi|55242461|gb|EAA07476.2| AGAP002332-PA [Anopheles gambiae str. PEST] (196 aa)
Score = 178, Expect = 5.7e-12, Identities = 53/136 (38%), Positives = 78/136 (57%)
  Q:    16 KVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVD-TNA-NDEEAVLRMVAGSAKQMGIKI-EGVDPVVHKD 151
           + N+  G A  GP L  +    GIN+  F K FN++TK+ K G  +PC +    D+++   I + P T LLK+AA I+ GA +   E    I+R+   EIAK KL D  NA    E + + + G A+  GI+I   +DP  +KD
  S:    25 RTNIPAGMAVAGPPLGPMLGQRGINIAAFCKDFNERTKEIKEGIPLPCRVAVTSDRAYELTIHSPPATFLLKQAAGIQRGAMSPGKEIAGKITRKHLYEIAKIKLQDPPNALLTLEHMCKALVGVARTCGIEIVNELDPAEYKD 168
>gi|42519938|ref|NP_965853.1| 50S ribosomal protein L11 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58699177|ref|ZP_00373994.1| ribosomal protein L11 [Wolbachia endosymbiont of Drosophila ananassae] >gi|54039078|sp|P62444|RL11_WOLPM 50S ribosomal protein L11 >gi|42409675|gb|AAS13787.1| ribosomal protein L11 [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58534307|gb|EAL58489.1| ribosomal protein L11 [Wolbachia endosymbiont of Drosophila ananassae] (146 aa)
Score = 177, Expect = 7.1e-12, Identities = 47/128 (36%), Positives = 80/128 (62%)
  Q:    14 IAKVNLI--GGQAKPGPQLASI----GINMGEFTKQFNDQTKDKN-----GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +AK+NL+   G+A PGP++AS+    GI + +F + FN  T   N     G+++   I+   D+S  F +   PV  LLK+ A +   + N   E VA +     +++AK K+VD   ++E++ ++MV G+AK MGI++
  S:     5 VAKINLLMEAGKAVPGPKIASVLGPRGIPVPKFCEAFNKVTSAANANYKVGDLVTVRISIKDDRSHDFTVSGPPVAYLLKQEAKLSKSSGNPGKELVAKLPMSAIIKVAKCKMVDMKVDNEDSAVKMVVGTAKSMGIEV 143
>gi|84490054|ref|YP_448286.1| 50S ribosomal protein L11P [Methanosphaera stadtmanae DSM 3091] >gi|118597259|sp|Q2NEW0|RL11_METST 50S ribosomal protein L11P >gi|84373373|gb|ABC57643.1| 50S ribosomal protein L11P [Methanosphaera stadtmanae DSM 3091] (160 aa)
Score = 175, Expect = 1.2e-11, Identities = 48/125 (38%), Positives = 67/125 (53%)
  Q:    21 GGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPCIITAFKD-KSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           GG+A PGP L      +GINM +  ++ N +T D  G  +P  ITA  D K F   I T P T L+     I+ G+    TE  A  S E+A ++A+ K  D  AND +   + V G+   MGI ++G D
  S:    12 GGKATPGPPLGPAIGPLGINMMQVVEEINKKTADFGGMKVPVKITADMDTKDFEISIGTPPTTALVLDELGIESGSHEPGTEVAADFSVEQAFKVARMKFDDLLANDYKHATKEVIGTCVSMGINVQGKD 141
>gi|82571793|gb|AAI10215.1| Mitochondrial ribosomal protein L11 [Bos taurus] (192 aa)
Score = 175, Expect = 1.4e-11, Identities = 48/137 (35%), Positives = 79/137 (57%)
  Q:     5 AFKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
           A + P    + +  L  GQA PGP L  I    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+N+  E    ++ +   EIA+ K  D     ++    +V+R + GSA+ +GI++
  S:    10 ALRKPEAEGVIRTILRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARNTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRV 155
>gi|62460560|ref|NP_001014932.1| mitochondrial ribosomal protein L11 [Bos taurus] >gi|190352209|sp|Q2YDI0|RM11_BOVIN 39S ribosomal protein L11, mitochondrial precursor (L11mt) (MRP-L11) >gi|61553313|gb|AAX46385.1| mitochondrial ribosomal protein L11 isoform a [Bos taurus] (192 aa)
Score = 174, Expect = 1.5e-11, Identities = 48/137 (35%), Positives = 79/137 (57%)
  Q:     5 AFKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
           A + P    + +  L  GQA PGP L  I    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+N+  E    ++ +   EIA+ K  D     ++    +V+R + GSA+ +GI++
  S:    10 ALRKPEAEGVIRTILRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARNTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRV 155
>gi|91773884|ref|YP_566576.1| 50S ribosomal protein L11P [Methanococcoides burtonii DSM 6242] >gi|118597256|sp|Q12UQ0|RL11_METBU 50S ribosomal protein L11P >gi|91712899|gb|ABE52826.1| LSU ribosomal protein L11P [Methanococcoides burtonii DSM 6242] (161 aa)
Score = 172, Expect = 2.9e-11, Identities = 43/126 (34%), Positives = 70/126 (55%)
  Q:    21 GGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GG+A PGP     L  +G+N+ +  ++ N++TKD NG  +P  +    DKS   E+ T P + L+ K  NI+ G+  S T  V  +   +  +IA+ K  D  +   +A ++ V G+   MG+ IE +DP
  S:    11 GGKANPGPPLGPALGPLGVNIKDVIEKINEKTKDYNGMQVPVKVIVNDDKSVEIEVGTPPTSALILKELNIEKGSGESGTVVVGNLEIAQVAKIARMKKDDILSYSLKAAIKEVMGTCVPMGVTIENLDP 140
>gi|85372840|ref|YP_456902.1| 50S ribosomal protein L11 [Erythrobacter litoralis HTCC2594] >gi|123293821|sp|Q2NDY6|RL11_ERYLH 50S ribosomal protein L11 >gi|84785923|gb|ABC62105.1| ribosomal protein L11 [Erythrobacter litoralis HTCC2594] (143 aa)
Score = 171, Expect = 3.7e-11, Identities = 52/132 (39%), Positives = 79/132 (59%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTK--DKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           +I    K+ +  G A P    GP L   G+N+ EF K FN  T   +KN  V P +IT + D+SF+F  K    T L+KKAA IK G+  +   +  TI + +  EIA+TK+ D NAND +  ++++ GS + MG+++
  S:     4 KIDGYIKLMVPAGTANPSPPLGPALGQRGVNIMEFCKAFNAATDGMEKNAPV-PTVITVYADRSFSFVTKQPTATYLIKKAAKIKKGSGETGKVSAGTIKQSQVKEIAETKMPDLNANDIDQAMKIIEGSCRAMGLEV 140
>gi|20093063|ref|NP_619138.1| 50S ribosomal protein L11P [Methanosarcina acetivorans C2A] >gi|38605376|sp|Q8TI82|RL11_METAC 50S ribosomal protein L11P >gi|19918387|gb|AAM07618.1| ribosomal protein L11p [Methanosarcina acetivorans C2A] (161 aa)
Score = 170, Expect = 4.3e-11, Identities = 41/134 (30%), Positives = 75/134 (55%)
  Q:    11 ITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +T I +  + GG+A PGP     L  +G+N+ E  ++ N++T+D NG  +P  +     K+   E+ T P   L+ K   I+ G+ N+ +E V  ++  +  ++A+ K  D  + D +A ++ V GS   MG+ +EG+
  S:     1 MTSIVEALVPGGKANPGPPLGPALGPLGVNIKEVVEKINEKTRDYNGMQVPVKVIVDDKKNVEIEVGTPPTASLVMKELGIQKGSGNAGSEVVGNLTISQVAKVARMKKEDVLSYDLKAAMKEVMGSCVPMGVNVEGM 138
>gi|20094260|ref|NP_614107.1| 50S ribosomal protein L11P [Methanopyrus kandleri AV19] >gi|38605379|sp|Q8TX52|RL11_METKA 50S ribosomal protein L11P >gi|19887297|gb|AAM02037.1| Ribosomal protein L11 [Methanopyrus kandleri AV19] (166 aa)
Score = 169, Expect = 6.8e-11, Identities = 42/126 (33%), Positives = 70/126 (55%)
  Q:    21 GGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GG+A PGP     L  +G+N+ E  ++ N +TKD  G  +P  II   + + F  ++ + P + ++K    I  GA   + ETV  +S E+ ++IAK K  D  + D +   + + G+   MG+ +EG DP
  S:    12 GGKADPGPPLGPALGPLGVNIQEVVEEINRKTKDFKGMEVPVKIIVDTETREFEVKVGSPPTSAIIKSELGIDKGAHEPRHETVGDLSMEQVIKIAKMKFDDLLSYDLKTAAKEILGTCGSMGVTVEGKDP 142
>gi|2267573|gb|AAB63583.1| ribosomal protein L11 [Haemophilus ducreyi] (106 aa)
Score = 169, Expect = 7.1e-11, Identities = 41/104 (39%), Positives = 63/104 (60%)
  Q:    39 EFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           EF K FN +T+  + G  IP +IT + D+SFTF  KT P  +LLKK   IK G+     + V T+++E+  +IA+TK  D      E  ++ +AG+A+ MG+ +E
  S:     1 EFCKAFNARTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKRVGIKSGSGKPNKDKVGTVTQEQLRQIAETKAADMTGATIETKMKSIAGTARSMGLIVE 105
>gi|7572936|emb|CAA60718.1| ribosomal protein L11 [Arabidopsis thaliana] (222 aa)
Score = 168, Expect = 7.8e-11, Identities = 48/148 (32%), Positives = 77/148 (52%)
  Q:     7 KDPRITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVVHKDGKK 154
           K  ++  + K+ L  G+A P    GP L S G+N+  F K +N +T DK G +IP  IT F  ++     +   +     K   ++ G+K+ + + V  I+ +    IA  KL D N    E+ +R++AG+A  MGI I   DP + +  KK
  S:    70 KAKKVVGVIKLALEAGKATPAPPVGPALGSKGVNIMAFCKDYNARTADKAGYIIPVEITVFDIRASRLFSRPRLLRFCCLKLQGVEKGSKDPQQDKVGVITIDHVRTIAAEKLPDLNCTTIESAMRIIAGTAANMGIDI---DPPILEPKKK 218
>gi|21227113|ref|NP_633035.1| 50S ribosomal protein L11P [Methanosarcina mazei Go1] >gi|38605366|sp|Q8PY53|RL11_METMA 50S ribosomal protein L11P >gi|20905442|gb|AAM30707.1| LSU ribosomal protein L11P [Methanosarcina mazei Go1] (161 aa)
Score = 168, Expect = 7.9e-11, Identities = 41/134 (30%), Positives = 75/134 (55%)
  Q:    11 ITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           +T I +  + GG+A PGP     L  +G+N+ E  ++ N++T+D NG  +P  +     K+   E+ T P   L+ K   I+ G+ N+ +E V  ++  +  +IA+ K  D  + D +A ++ V G+   MG+ +EG+
  S:     1 MTSIVEALVPGGKANPGPPLGPALGPLGVNIKEVVEKINEKTRDYNGMQVPVKVIVDDKKNVEIEVGTPPTASLVMKELGIQKGSGNAGSEVVGNLTIPQVAKIARMKKEDVLSYDLKATMKEVMGTCVPMGVNVEGM 138
>gi|148225108|ref|NP_001088909.1| hypothetical protein LOC496259 [Xenopus laevis] >gi|56788740|gb|AAH88796.1| LOC496259 protein [Xenopus laevis] (192 aa)
Score = 166, Expect = 1.3e-10, Identities = 50/121 (41%), Positives = 70/121 (57%)
  Q:    21 GGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVA----GSAKQMGIKI 141
            GQA PGP L  I    GI +G+F K+FND+TKD K G  +P  I    D+++  +I   PV+  LK AA I+ GA  +  E    ++ ++  EIA  K  D     ++  LR V     GSAK +GIK+
  S:    26 AGQAAPGPPLGPILGQRGIPIGQFCKEFNDKTKDIKEGIPLPVKIFVKPDRTYDLKIGQPPVSYFLKAAAGIEKGASQTGHEIAGIVTLKQLYEIALVKSQDEAFVIQDMQLRDVVKSIMGSAKSLGIKV 155
>gi|71033335|ref|XP_766309.1| 60S ribosomal protein L11 [Theileria parva strain Muguga] >gi|68353266|gb|EAN34026.1| 60S ribosomal protein L11, putative [Theileria parva] (177 aa)
Score = 164, Expect = 2.1e-10, Identities = 40/118 (33%), Positives = 66/118 (55%)
  Q:    24 AKPGPQ----LASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTN--ANDEEAVLRMVAGSAKQMGIKI 141
           AKP P     L  +GINM EF K+FN++TK+    V +  +IT   D S+ F ++T      L++ A + +G+ N K E V  ++ ++   IAK K +D          + + + G+A  MGI++
  S:    15 AKPSPSIGQTLGPLGINMAEFCKKFNERTKEIRPNVPVQVLITTHHDNSYKFSLRTPSSQWFLRRIARVPMGSSNPKHEIVGNVTLKEVYHIAKCKCMDPQLIGTPLYVICKRIIGTANAMGIRV 139
>gi|55742212|ref|NP_001006974.1| mitochondrial ribosomal protein L11 [Rattus norvegicus] >gi|81889859|sp|Q5XIE3|RM11_RAT 39S ribosomal protein L11, mitochondrial precursor (L11mt) (MRP-L11) >gi|54035565|gb|AAH83740.1| Mitochondrial ribosomal protein L11 [Rattus norvegicus] (203 aa)
Score = 164, Expect = 2.2e-10, Identities = 45/136 (33%), Positives = 77/136 (56%)
  Q:     6 FKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
            K P    + +  +  GQA PGP L  I    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    ++  LK AA I+ GA+ +  E    +S +   EIA+ K  D     ++    +++R + GSA+ +GI++
  S:    11 LKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFIKPDRTFELKIGQPTISYFLKAAAGIEKGARQTGKEVAGLVSLKHVYEIARVKAKDEAFAMQDVPLSSIVRSIIGSARSLGIRV 155
>gi|72014263|ref|XP_786047.1| PREDICTED: similar to mitochondrial ribosomal protein L11 [Strongylocentrotus purpuratus] >gi|115935925|ref|XP_001177254.1| PREDICTED: similar to mitochondrial ribosomal protein L11 [Strongylocentrotus purpuratus] (192 aa)
Score = 164, Expect = 2.4e-10, Identities = 45/121 (37%), Positives = 66/121 (54%)
  Q:    21 GGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAND--EEAVLRMVAGSAKQMGIKI 141
            G A PGP L  +    G+ +G+F K FN++TK  K+G  +P  I    D+++  +  T PV+  LK+AA +K GA     +    IS +   EIA  K  D N      + + +M  GSA  MGIK+
  S:    30 AGSAVPGPPLGPVLGQRGVAIGQFCKDFNEKTKHIKDGIPLPSKIYINPDRTYNIKFTTPPVSYFLKQAAGMKKGAYQPGQQEFGVISLKHIYEIALIKSQDENMEGLPMDHICKMAIGSAHSMGIKV 157
>gi|15679673|ref|NP_276790.1| 50S ribosomal protein L11P [Methanothermobacter thermautotrophicus str. Delta H] >gi|3122664|sp|O27715|RL11_METTH 50S ribosomal protein L11P >gi|2622809|gb|AAB86151.1| ribosomal protein L12 (E.coli ) [Methanothermobacter thermautotrophicus str. Delta H] (160 aa)
Score = 163, Expect = 3.4e-10, Identities = 42/126 (33%), Positives = 69/126 (54%)
  Q:    21 GGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GG+A PGP L      +GINM +  ++ N +T D  G  +P  II     + F  E+ T P T L+     ++ G+++   + +A IS E+ L+IA+ K     +ND +  ++ + G+   MGI + G DP
  S:    12 GGKATPGPPLGPAIGPLGINMMQVVEEINRKTADFEGMKVPVKIIVDTDTRDFEVEVGTPPTTALIMDELKLEKGSQDPGMDKIADISMEQVLKIARMKFDALLSNDYKRAVKEIMGTCVSMGITVNGKDP 142
>gi|148230040|ref|NP_001085117.1| hypothetical protein LOC432190 [Xenopus laevis] >gi|47939793|gb|AAH72251.1| MGC82344 protein [Xenopus laevis] (192 aa)
Score = 161, Expect = 4.7e-10, Identities = 50/135 (37%), Positives = 75/135 (55%)
  Q:     7 KDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVA----GSAKQMGIKI 141
           K   +  + +  +  GQA PGP L  I    GI +G+F K+FND+TK+ K G  +P  I+   D+++  +I   PV+  LK AA I+ GA  +  E    ++ ++  EIA  K  D      +  LR V     GSAK +GIK+
  S:    12 KKANVAGVIRALVRAGQAAPGPPLGPILGQRGIPIGQFCKEFNDKTKELKEGIPLPVKISVKPDRTYDLKIGQPPVSYFLKAAAGIEKGASQTGHEIAGMVTLKQLYEIALVKSQDEPFVMRDMQLRDVVKSIMGSAKSLGIKV 155
>gi|76802860|ref|YP_330955.1| 50S ribosomal protein L11P [Natronomonas pharaonis DSM 2160] >gi|119390738|sp|Q3INI5|RL11_NATPD 50S ribosomal protein L11P >gi|76558725|emb|CAI50318.1| ribosomal protein L11 [Natronomonas pharaonis DSM 2160] (163 aa)
Score = 161, Expect = 6.0e-10, Identities = 42/130 (32%), Positives = 66/130 (50%)
  Q:    16 KVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           +V + GGQA PGP    +L    +++     + NDQT+  +G  +P  I    D SF  ++   P   L+K   + + G+     E VA +S E+   +A+ KL D  A D     + VAG+   +G+ IEG D
  S:     6 EVLVAGGQADPGPPLGPELGPTPVDVQAVVNEINDQTEAFDGTEVPVTIDYDDDGSFDIDVGVPPTAALIKDELDFETGSGEPNEEFVADMSAEQLKTVAEQKLPDLLAYDTRNAAKEVAGTCVSLGVTIEGED 139
>gi|15790197|ref|NP_280021.1| 50S ribosomal protein L11P [Halobacterium sp. NRC-1] >gi|169235926|ref|YP_001689126.1| ribosomal protein L11 [Halobacterium salinarum R1] >gi|132646|sp|P05969|RL11_HALSA 50S ribosomal protein L11P >gi|43452|emb|CAA33178.1| unnamed protein product [Halobacterium salinarum] >gi|10580653|gb|AAG19501.1| 50S ribosomal protein L11P [Halobacterium sp. NRC-1] >gi|167726992|emb|CAP13778.1| ribosomal protein L11 [Halobacterium salinarum R1] (163 aa)
Score = 160, Expect = 6.2e-10, Identities = 43/130 (33%), Positives = 66/130 (50%)
  Q:    16 KVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           +V + GGQA PGP    +L    +++    ++ NDQT+  +G  +P  I    D SF+ E+   P   L+K  A    G+   +   VA +S E+   IA+ K  D  A D     + VAG+   +G+ IEG D
  S:     6 EVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTEAFDGTEVPVTIEYEDDGSFSIEVGVPPTAALVKDEAGFDTGSGEPQENFVADLSIEQLKTIAEQKKPDLLAYDARNAAKEVAGTCASLGVTIEGED 139
>gi|15237029|ref|NP_195274.1| MRPL11 (MITOCHONDRIAL RIBOSOMAL PROTEIN L11); structural constituent of ribosome [Arabidopsis thaliana] >gi|5830791|emb|CAB54877.1| ribosomal protein L11 homolog [Arabidopsis thaliana] >gi|7270500|emb|CAB80265.1| ribosomal protein L11 homolog [Arabidopsis thaliana] >gi|21618064|gb|AAM67114.1| ribosomal protein L11-like protein [Arabidopsis thaliana] >gi|98961097|gb|ABF59032.1| At4g35490 [Arabidopsis thaliana] >gi|110740709|dbj|BAE98455.1| ribosomal protein L11 homolog [Arabidopsis thaliana] (155 aa)
Score = 160, Expect = 6.6e-10, Identities = 47/126 (37%), Positives = 68/126 (53%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQT-KDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           ++ +  G A+P    GP L    +N+  F K FN +T K K    +   ITAFKD SF F +K+  V+  +KKAA +  G+      +V T+S     EIAK K  D        E++ + + G+A  MGIKI
  S:    18 RLTVPAGGARPAPPVGPALGQYRLNLMAFCKDFNARTQKYKPDTPMAVTITAFKDNSFEFTVKSPTVSWYIKKAAGVDKGSTRPGHLSVTTLSVRHVYEIAKVKQTDPFCQYMPLESICKSIIGTANSMGIKI 150
>gi|62857641|ref|NP_001016785.1| mitochondrial ribosomal protein L11 [Xenopus tropicalis] >gi|89273898|emb|CAJ83490.1| mitochondrial ribosomal protein L11 [Xenopus tropicalis] >gi|134023847|gb|AAI35339.1| Mitochondrial ribosomal protein L11 [Xenopus tropicalis] (192 aa)
Score = 159, Expect = 8.9e-10, Identities = 49/121 (40%), Positives = 69/121 (57%)
  Q:    21 GGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVA----GSAKQMGIKI 141
            GQA PGP L  I    GI +G+F K+FN++TKD K G  +P  I    D+++  +I   PV+  LK AA I+ GA  +  E    ++ ++  EIA  K  D      +  LR V     GSAK +GIK+
  S:    26 AGQAAPGPPLGPILGQRGIPIGQFCKEFNEKTKDIKEGIPLPVKIFVKPDRTYDMKIGQPPVSYFLKAAAGIEKGAAQTGHEIAGMVTLKQLYEIALVKSQDEAFIMRDMPLRDVVKCIMGSAKSLGIKV 155
>gi|13384980|ref|NP_079829.1| mitochondrial ribosomal protein L11 [Mus musculus] >gi|22001924|sp|Q9CQF0|RM11_MOUSE 39S ribosomal protein L11, mitochondrial precursor (L11mt) (MRP-L11) >gi|12833045|dbj|BAB22366.1| unnamed protein product [Mus musculus] >gi|12845691|dbj|BAB26856.1| unnamed protein product [Mus musculus] >gi|13559369|dbj|BAB40844.1| mitochondrial ribosomal protein L11 (L11mt) [Mus musculus] >gi|28436842|gb|AAH46750.1| Mitochondrial ribosomal protein L11 [Mus musculus] >gi|74191057|dbj|BAE39368.1| unnamed protein product [Mus musculus] >gi|148669238|gb|EDL01185.1| mitochondrial ribosomal protein L11 [Mus musculus] (192 aa)
Score = 159, Expect = 9.4e-10, Identities = 47/136 (34%), Positives = 77/136 (56%)
  Q:     6 FKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
            K P    + +  +  GQA PGP L  I    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+++  E    +S +   EIA  K  D     ++    +V+R + GSA+ +GI++
  S:    11 LKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFIKPDRTFELKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVSLKHVYEIACVKAKDDAFAMQDVPLSSVVRSIIGSARSLGIRV 155
>gi|62083501|gb|AAX62475.1| mitochondrial ribosomal protein L11 [Lysiphlebus testaceipes] (196 aa)
Score = 158, Expect = 1.1e-09, Identities = 50/131 (38%), Positives = 70/131 (53%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI-EGVDP 146
           + N+  G A P    GPQL    IN+  F K FN++T   K G  +P  +  F DK++   I   P T  LK+AA I+ GA NS  E    I+ +   EIA  K  D        E +++M  G A+ +GIKI + +DP
  S:    25 RTNIPAGLANPSPPLGPQLGQRNINIANFIKDFNEKTAHIKQGIPLPVRVKVFPDKTYDLVIHQPPTTYFLKQAAGIQRGAMNSGKEVAGKITLKHLYEIAVIKSQDPPMALFTLEQIVQMFVGIARTVGIKIVKDLDP 163
>gi|7705618|ref|NP_057134.1| mitochondrial ribosomal protein L11 isoform a [Homo sapiens] >gi|55636509|ref|XP_522076.1| PREDICTED: mitochondrial ribosomal protein L11 isoform 2 [Pan troglodytes] >gi|22001931|sp|Q9Y3B7|RM11_HUMAN 39S ribosomal protein L11, mitochondrial precursor (L11mt) (MRP-L11) >gi|4929695|gb|AAD34108.1|AF151871_1 CGI-113 protein [Homo sapiens] >gi|13436470|gb|AAH05002.1| Mitochondrial ribosomal protein L11 [Homo sapiens] >gi|13559367|dbj|BAB40843.1| mitochondrial ribosomal protein L11 (L11mt) [Homo sapiens] >gi|119594935|gb|EAW74529.1| mitochondrial ribosomal protein L11, isoform CRA_d [Homo sapiens] >gi|158261191|dbj|BAF82773.1| unnamed protein product [Homo sapiens] (192 aa)
Score = 158, Expect = 1.3e-09, Identities = 43/137 (31%), Positives = 77/137 (56%)
  Q:     5 AFKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
             + P +  + +  +  G A PGP L  +    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+ +  E    ++ +   EIA+ K  D     ++    +V+R + GSA+ +GI++
  S:    10 GLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRV 155
>gi|27526323|emb|CAD44853.1| ribosomal protein L11 [Echinococcus multilocularis] (185 aa)
Score = 157, Expect = 1.4e-09, Identities = 46/126 (36%), Positives = 64/126 (50%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDT--NANDEEAVLRMVAGSAKQMGIKI 141
           K+ +   QAKP    GPQL    IN+  F K FN++TK  K G  IPC I    D+S+  +I   P   LL+ AA  K GA    TE    ++ +   EIA  K  D        +A+   +   A +MGI++
  S:    26 KMYIPAQQAKPAPPLGPQLGKRNINIANFCKDFNERTKHIKPGVPIPCTIIVNPDRSYQLQISHPPSQFLLRMAAGTKKGAATPGTEVSGQLTLKHIYEIAVLKSEDAALRTTSLQAICASLIAEAHRMGIEV 158
>gi|45185086|ref|NP_982803.1| ABL144Cp [Ashbya gossypii ATCC 10895] >gi|44980722|gb|AAS50627.1| ABL144Cp [Ashbya gossypii ATCC 10895] (149 aa)
Score = 155, Expect = 2.5e-09, Identities = 51/128 (39%), Positives = 71/128 (55%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTE----TVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           + K+ +  GQA P    GP L S GI   +F K+FN +T     G  IP +IT   D+SFTFE+K+ P   LL +A N + G      +    T+  +S +   EIAK K  D      D E +++ V G AK MGI +
  S:     9 LVKLIVGAGQAAPSPPVGPALGSKGIKAMDFCKEFNARTASYTPGVPIPVLITIKPDRSFTFEMKSPPTGYLLLRALNQEKGHGKPNIKKPEGTLGELSLKHIYEIAKIKKADGRHTYLDMENIVKSVVGVAKSMGIAV 147
>gi|57099649|ref|XP_533221.1| PREDICTED: similar to 39S ribosomal protein L11, mitochondrial precursor (L11mt) (MRP-L11) [Canis familiaris] (192 aa)
Score = 154, Expect = 3.0e-09, Identities = 45/137 (32%), Positives = 77/137 (56%)
  Q:     5 AFKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
           A + P    + +  +  GQA  GP L  I    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+ +  E    ++ +   EIA+ K  D     ++    +V+R + GSA+ +GI++
  S:    10 ALRKPEAGGVIRTIVRAGQAMTGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIAQVKAQDEAFALQDVPLSSVVRSIIGSARSLGIRV 155
>gi|58263422|ref|XP_569121.1| 60s ribosomal protein l19, mitochondrial precursor [Cryptococcus neoformans var. neoformans JEC21] >gi|134108398|ref|XP_777150.1| hypothetical protein CNBB3810 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50259835|gb|EAL22503.1| hypothetical protein CNBB3810 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57223771|gb|AAW41814.1| 60s ribosomal protein l19, mitochondrial precursor, putative [Cryptococcus neoformans var. neoformans JEC21] (145 aa)
Score = 154, Expect = 3.3e-09, Identities = 45/129 (34%), Positives = 72/129 (55%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTN--ANDEEAVLRMVAGSAKQMGIKI 141
           +I K+ +  G+A P    GP L + G+   +F K+FN +T      + IP +IT   D++F+F  +T PV+ LLKK   I  G+          +S +   EIAK K +D +  A   E V R V G+A+ +G+++
  S:     8 QIVKIIVPAGKAAPTPPVGPALGARGVKAMDFCKEFNAKTAHYQTSLPIPTMITINPDRTFSFATRTPPVSYLLKKTTGIDKGSGQGMKVKTGQVSLKHVYEIAKIKCMDEDLKAVGLERVARGVVGTARSLGLEV 143
>gi|62897785|dbj|BAD96832.1| mitochondrial ribosomal protein L11 isoform a variant [Homo sapiens] (192 aa)
Score = 154, Expect = 3.7e-09, Identities = 43/137 (31%), Positives = 76/137 (55%)
  Q:     5 AFKDPRITRIAKVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
             + P    + +  +  G A PGP L  +    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+ +  E    ++ +   EIA+ K  D     ++    +V+R + GSA+ +GI++
  S:    10 GLRKPEAGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRV 155
>gi|169779137|ref|XP_001824033.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83772772|dbj|BAE62900.1| unnamed protein product [Aspergillus oryzae] (153 aa)
Score = 153, Expect = 4.6e-09, Identities = 48/129 (37%), Positives = 75/129 (58%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV------GAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           +I K+ +  GQA P    GP L S G+   +F K+FN +T   N G  +P  +T   D+SFTF+++T   T LL +AAN++       GA N   E V  +S +   EIA+ K  +T  +    + + + V   AK +GI++
  S:    10 QIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHINTGVPVPARVTVRPDRSFTFDLRTPTTTWLLLQAANVEPRKNRIRGAMNPGHEIVGKVSLKHVYEIAQIKHSETRLSGLSLQGLCKSVIAQAKSIGIQV 151
>gi|84998532|ref|XP_953987.1| ribosomal protein L11, putative [Theileria annulata strain Ankara] >gi|65304985|emb|CAI73310.1| ribosomal protein L11, putative [Theileria annulata] (177 aa)
Score = 152, Expect = 5.2e-09, Identities = 39/118 (33%), Positives = 64/118 (54%)
  Q:    24 AKPGPQ----LASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTN--ANDEEAVLRMVAGSAKQMGIKI 141
           AKP P     L  +GINM +F K+FN++TK     V +  +IT   D S+ F ++T      L++ A + +G+   K E V  ++ ++   IAK K +D          + + + G+A  MGIK+
  S:    15 AKPSPSIGQTLGPLGINMADFCKKFNERTKTIRPNVPVQVLITTHHDNSYKFSLRTPSSQWFLRRIARVPMGSSKPKHEIVGNVTLKEVYHIAKCKCMDPQLIGTPLYVICKRIIGTANAMGIKV 139
>gi|91086019|ref|XP_972971.1| PREDICTED: similar to 39S ribosomal protein L11, mitochondrial [Tribolium castaneum] (195 aa)
Score = 152, Expect = 6.0e-09, Identities = 47/131 (35%), Positives = 69/131 (52%)
  Q:    16 KVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDE--EAVLRMVAGSAKQMGIK-IEGVDP 146
           + N+  G A  GP L  +    GIN+  F K FN++TKD K G  +P  +T   D+S+   I   PV   LK+AA I+  A     E    ++ +   EIAK K VD        + + +MV G A+  GI+ +  +DP
  S:    24 RTNIPAGMAAAGPPLGPMLGQRGINIAAFCKDFNEKTKDIKEGIPLPTRVTVNPDRSYELVINKPPVVFFLKQAAGIQRAAMEPGKEIAGKVTLKHVYEIAKLKSVDPTLETRSLDDLCQMVCGIARSCGIEVVRDLDP 162
>gi|50423889|ref|XP_460529.1| hypothetical protein DEHA0F04136g [Debaryomyces hansenii CBS767] >gi|49656198|emb|CAG88843.1| unnamed protein product [Debaryomyces hansenii CBS767] (143 aa)
Score = 152, Expect = 6.0e-09, Identities = 43/112 (38%), Positives = 64/112 (57%)
  Q:    30 LASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           L S G+   +F K+FN +T + + G  IPC++T   D+SFTFE+K+ P + LL KAA  K G+       V  +S +   EIAK K  D      D +A+   V  +A+ +G+KI
  S:    27 LGSKGVKAIDFCKEFNARTGNYQPGIPIPCLLTIKPDRSFTFEMKSPPTSWLLLKAAQAKKGSDKPTHNIVGEVSLKHVYEIAKIKKTDDRHKEVDLQAICGAVILTAEAVGVKI 141
>gi|62738581|pdb|1Y39|A Chain A, Co-Evolution Of Protein And Rna Structures Within A Highly Conserved Ribosomal Domain >gi|62738582|pdb|1Y39|B Chain B, Co-Evolution Of Protein And Rna Structures Within A Highly Conserved Ribosomal Domain (76 aa)
Score = 152, Expect = 6.0e-09, Identities = 37/75 (49%), Positives = 48/75 (64%)
  Q:    68 FTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           FTF  KT P  +LLKKAA I+ G+       VATI R+K  EIA+ K+ D NA   EA +RM+ G+A+ MGI +E
  S:     1 FTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARNMGIVVE 75
>gi|21465588|pdb|1HC8|A Chain A, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex >gi|21465589|pdb|1HC8|B Chain B, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex (76 aa)
Score = 152, Expect = 6.2e-09, Identities = 37/75 (49%), Positives = 48/75 (64%)
  Q:    68 FTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           FTF  KT P  +LLKKAA I+ G+       VATI R+K  EIA+ K+ D NA   EA +RM+ G+A+ MGI +E
  S:     1 FTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVE 75
>gi|15668549|ref|NP_247347.1| 50S ribosomal protein L11P [Methanocaldococcus jannaschii DSM 2661] >gi|1710482|sp|P54030|RL11_METJA 50S ribosomal protein L11P >gi|1591080|gb|AAB98362.1| LSU ribosomal protein L11P (rplK) [Methanocaldococcus jannaschii DSM 2661] (161 aa)
Score = 152, Expect = 6.3e-09, Identities = 41/133 (30%), Positives = 72/133 (54%)
  Q:    14 IAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           + +V + GG+A  GP L      +G+N+ +  K+ N++TKD  G  +P  +I   + + F  E+   P T L+KK   I+  A   + E V  ++ E+ ++IAK K     +   +  ++ V G+   MG+ +EG DP
  S:     5 VVEVLVTGGRATAGPPLGPAIGPLGVNVMQVVKEINEKTKDYEGMQVPVKVIVDTETRKFEIEVGIPPTTALIKKELGIETAAHEPRHEVVGNLTLEQVIKIAKMKKDAMLSYTLKNAVKEVLGTCGSMGVTVEGKDP 142
>gi|15823668|dbj|BAB69029.1| mitochondrial ribosomal protein L11 [Triticum aestivum] (154 aa)
Score = 152, Expect = 6.7e-09, Identities = 40/115 (34%), Positives = 61/115 (53%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           GP L    +N+  F K FN +T+    E  +   +TA+KD +F F +K+  V+  LKKAA ++  +       V ++S     EIAK K  D        EA+ + + G+AK MGI+I
  S:    33 GPALGFYRLNLMAFCKDFNARTQKYKAETPMQVTLTAYKDSTFEFVVKSPSVSWFLKKAAGVETASSRPGHNMVTSLSLRHVYEIAKLKQSDPFCKHMSLEALCKSIIGTAKSMGIEI 150
>gi|70997441|ref|XP_753468.1| mitochondrial ribosomal protein L11 [Aspergillus fumigatus Af293] >gi|66851104|gb|EAL91430.1| mitochondrial ribosomal protein L11, putative [Aspergillus fumigatus Af293] >gi|159126802|gb|EDP51918.1| mitochondrial ribosomal protein L11, putative [Aspergillus fumigatus A1163] (153 aa)
Score = 151, Expect = 7.2e-09, Identities = 48/129 (37%), Positives = 74/129 (57%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV------GAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           +I K+ +  GQA P    GP L S G+   +F K+FN +T   N G  IP  +T   D+SFTF+I+T   T LL +AAN++       GA     E +  +S +   EIAK K  +T  +    + + + +   AK +GI++
  S:    10 QIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHINPGVPIPARVTVRPDRSFTFDIRTPTTTYLLLQAANVEPRKNRIRGAMRPGHEIIGKVSLKHVYEIAKIKQSETRLSGLSLQGLCKSIMAQAKSIGIQV 151
>gi|50306925|ref|XP_453438.1| unnamed protein product [Kluyveromyces lactis] >gi|49642572|emb|CAH00534.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (149 aa)
Score = 151, Expect = 8.6e-09, Identities = 49/128 (38%), Positives = 73/128 (57%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKAL----EIAKTKLVDTN--ANDEEAVLRMVAGSAKQMGIKI 141
           I K+ +  GQA P    GP L S GI   +F K+FN +T + + G  IP +I    D++F+FE+K+ P   LL KA +++ G           +  E +L    EIAK K  D    A + E +++ + G AK MGIK+
  S:     9 IVKLIVGAGQAAPSPPVGPALGSKGIKAIDFCKEFNARTANFQPGTPIPVLINIKPDRTFSFEMKSPPTGYLLLKALSLEKGHGQPNISNPDNVCGELSLKHIYEIAKIKKTDGRHAALELEGIVKSIIGVAKSMGIKV 147
>gi|57641353|ref|YP_183831.1| 50S ribosomal protein L11P [Thermococcus kodakarensis KOD1] >gi|73914069|sp|Q5JH34|RL11_PYRKO 50S ribosomal protein L11P >gi|57159677|dbj|BAD85607.1| LSU ribosomal protein L11P [Thermococcus kodakarensis KOD1] (165 aa)
Score = 150, Expect = 9.8e-09, Identities = 42/136 (30%), Positives = 74/136 (54%)
  Q:    11 ITRIAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPC--IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           + ++ +V + GG+A PGP L      +G+N+ +   + N  TK+  G  +P   I+   K K+F  E+   P + L+KK   I  G+  +       ++ E+ ++IAK K+    A + +A  + V G+A  MG+ +EG DP
  S:     1 MAQVVEVLVEGGKASPGPPLGPAIGPLGLNVKQVVDEINKATKEFEGMQVPVKIIVEDPKKKTFRIEVGIPPTSQLIKKELGIPKGSSEAGHTPAGNLTMEQVIKIAKMKIDQMLAPNLKAAAKEVIGTALSMGVTVEGKDP 142
>gi|115482420|ref|NP_001064803.1| Os10g0466200 [Oryza sativa (japonica cultivar-group)] >gi|13489191|gb|AAK27825.1|AC022457_28 putative ribosomal protein L11 [Oryza sativa (japonica cultivar-group)] >gi|31432576|gb|AAP54191.1| ribosomal protein L11 containing protein, expressed [Oryza sativa (japonica cultivar-group)] >gi|113639412|dbj|BAF26717.1| Os10g0466200 [Oryza sativa (japonica cultivar-group)] >gi|125575082|gb|EAZ16366.1| hypothetical protein OsJ_030575 [Oryza sativa (japonica cultivar-group)] (155 aa)
Score = 150, Expect = 1.0e-08, Identities = 40/115 (34%), Positives = 61/115 (53%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           GP L    +N+  F K FN +T+    E  +   +TA+KD +F F +K+  V+  LKKAA I+  +       V+++S     EIAK K  D        EA+ + + G+A  MGI+I
  S:    34 GPALGFYRLNLMAFCKDFNARTQKYKAETPMQVTLTAYKDSTFEFVVKSPSVSWFLKKAAGIETASGRPGHTVVSSLSLRHVYEIAKLKQSDPYCKHMSLEALCKSIIGTANSMGIEI 151
>gi|46202852|ref|ZP_00052496.2| COG0080: Ribosomal protein L11 [Magnetospirillum magnetotacticum MS-1] (100 aa)
Score = 150, Expect = 1.1e-08, Identities = 37/82 (45%), Positives = 52/82 (63%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGA 91
           +I    K+ +  G+A P    GP L   G+N+ EF K FN QT+  + G  IP +ITA+ D++FTF  KT PV+  LKKAA +  G+
  S:     4 KIVGYVKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAQTQALEPGMPIPVVITAYSDRTFTFVTKTPPVSYFLKKAAAVSTGS 90
>gi|55378198|ref|YP_136048.1| 50S ribosomal protein L11P [Haloarcula marismortui ATCC 43049] >gi|132647|sp|P14122|RL11_HALMA 50S ribosomal protein L11P (Hmal11) >gi|50513478|pdb|1S72|I Chain I, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution >gi|66360792|pdb|1YHQ|I Chain I, Crystal Structure Of Azithromycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui >gi|66360825|pdb|1YI2|I Chain I, Crystal Structure Of Erythromycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui >gi|66360858|pdb|1YIJ|I Chain I, Crystal Structure Of Telithromycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui >gi|66360891|pdb|1YIT|I Chain I, Crystal Structure Of Virginiamycin M And S Bound To The 50s Ribosomal Subunit Of Haloarcula Marismortui >gi|66360924|pdb|1YJ9|I Chain I, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui Containing A Three Residue Deletion In L22 >gi|66360957|pdb|1YJN|I Chain I, Crystal Structure Of Clindamycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui >gi|66360990|pdb|1YJW|I Chain I, Crystal Structure Of Quinupristin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui >gi|83753154|pdb|1VQ4|I Chain I, The Structure Of The Transition State Analogue "daa" Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753186|pdb|1VQ5|I Chain I, The Structure Of The Transition State Analogue "raa" Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753218|pdb|1VQ6|I Chain I, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753250|pdb|1VQ7|I Chain I, The Structure Of The Transition State Analogue "dca" Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753281|pdb|1VQ8|I Chain I, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic Sparsomycin Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753313|pdb|1VQ9|I Chain I, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic Sparsomycin Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753344|pdb|1VQK|I Chain I, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of The Ribosomal Subunit Of Haloarcula Marismortui >gi|83753375|pdb|1VQL|I Chain I, The Structure Of The Transition State Analogue "dcsn" Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753406|pdb|1VQM|I Chain I, The Structure Of The Transition State Analogue "dan" Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753438|pdb|1VQN|I Chain I, The Structure Of Cc-Hpmn And Cca-Phe-Cap-Bio Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|83753469|pdb|1VQO|I Chain I, The Structure Of Ccpmn Bound To The Large Ribosomal Subunit Haloarcula Marismortui >gi|83753501|pdb|1VQP|I Chain I, The Structure Of The Transition State Analogue "rap" Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui >gi|145580232|pdb|2OTL|I Chain I, Girodazole Bound To The Large Subunit Of Haloarcula Marismortui >gi|171848845|pdb|2QA4|I Chain I, A More Complete Structure Of The The L7L12 STALK OF THE Haloarcula Marismortui 50s Large Ribosomal Subunit >gi|188596010|pdb|3CC2|I Chain I, The Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution With Rrna Sequence For The 23s Rrna And Genome-Derived Sequences For R-Proteins >gi|188596041|pdb|3CC4|I Chain I, Co-Crystal Structure Of Anisomycin Bound To The 50s Ribosomal Subunit >gi|188596072|pdb|3CC7|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation C2487u >gi|188596103|pdb|3CCE|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation U2535a >gi|188596134|pdb|3CCJ|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation C2534u >gi|188596165|pdb|3CCL|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation U2535c. Density For Anisomycin Is Visible But Not Included In Model. >gi|188596196|pdb|3CCM|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation G2611u >gi|188596227|pdb|3CCQ|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation A2488u >gi|188596258|pdb|3CCR|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation A2488c. Density For Anisomycin Is Visible But Not Included In The Model. >gi|188596289|pdb|3CCS|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation G2482a >gi|188596320|pdb|3CCU|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation G2482c >gi|188596351|pdb|3CCV|I Chain I, Structure Of Anisomycin Resistant 50s Ribosomal Subunit: 23s Rrna Mutation G2616a >gi|188596382|pdb|3CD6|I Chain I, Co-Cystal Of Large Ribosomal Subunit Mutant G2616a With Cc- Puromycin >gi|43603|emb|CAA35793.1| unnamed protein product [Haloarcula marismortui] >gi|55230923|gb|AAV46342.1| 50S ribosomal protein L11P [Haloarcula marismortui ATCC 43049] (162 aa)
Score = 149, Expect = 1.4e-08, Identities = 37/126 (29%), Positives = 64/126 (50%)
  Q:    21 GGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GG+A PGP    +L    +++    ++ NDQT   +G  +P  +    D SF  E+   P   L+K  A  + G+   + + VA +S ++  +IA+ K  D  + D     + V G+   +G+ IEG +P
  S:    11 GGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENP 140
>gi|50540178|ref|NP_001002556.1| hypothetical protein LOC436829 [Danio rerio] >gi|49901112|gb|AAH76246.1| Zgc:92770 [Danio rerio] (196 aa)
Score = 149, Expect = 1.5e-08, Identities = 44/120 (36%), Positives = 67/120 (55%)
  Q:    22 GQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDT----NANDEEAVLRMVAGSAKQMGIKI 141
           GQA PGP L  I    GI +G F K FN++TKD K G  +P  I    D+++  +I    V+  LK+AA I+ GA  +  E    ++     EIA+ K  D          + V++ + GSA+ +GI++
  S:    27 GQAAPGPPLGPILGQKGIPIGAFCKDFNERTKDLKEGIPLPVKINVKPDRTYDLKIGQPTVSYFLKQAAGIEKGAGKTGHEIAGMVTVRAVYEIARVKSQDECFKLRDTTMQNVVKSIIGSARSLGIQV 155
>gi|38605473|sp|Q9HL70|RL11_THEAC 50S ribosomal protein L11P (156 aa)
Score = 149, Expect = 1.5e-08, Identities = 39/120 (32%), Positives = 65/120 (54%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKT--TPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GP L  +G+N+ +  K+ N++TK+  G  +P  IT    ++  +EI     P + LLKK   I+ GA   K       + ++ +++AKTK+    A+D +A    V G+   MGI ++G DP
  S:    21 GPALGPLGLNVAQVVKEINEKTKEFQGMRVPVTITVVDPETKKYEITVGIPPTSALLKKKLGIEKGAAKRKEAIAGNATLDQIVDVAKTKMASMLASDLKAATLEVLGTCVSMGINVDGKDP 142
>gi|16081490|ref|NP_393840.1| 50S ribosomal protein L11P [Thermoplasma acidophilum DSM 1728] >gi|10639533|emb|CAC11505.1| probable 50S ribosomal protein L11 [Thermoplasma acidophilum] (152 aa)
Score = 149, Expect = 1.5e-08, Identities = 39/120 (32%), Positives = 65/120 (54%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKT--TPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GP L  +G+N+ +  K+ N++TK+  G  +P  IT    ++  +EI     P + LLKK   I+ GA   K       + ++ +++AKTK+    A+D +A    V G+   MGI ++G DP
  S:    17 GPALGPLGLNVAQVVKEINEKTKEFQGMRVPVTITVVDPETKKYEITVGIPPTSALLKKKLGIEKGAAKRKEAIAGNATLDQIVDVAKTKMASMLASDLKAATLEVLGTCVSMGINVDGKDP 138
>gi|88601954|ref|YP_502132.1| ribosomal protein L11 [Methanospirillum hungatei JF-1] >gi|118597258|sp|Q2FQ31|RL11_METHJ 50S ribosomal protein L11P >gi|88187416|gb|ABD40413.1| LSU ribosomal protein L11P [Methanospirillum hungatei JF-1] (158 aa)
Score = 148, Expect = 1.5e-08, Identities = 41/136 (30%), Positives = 69/136 (50%)
  Q:    11 ITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           +  + +V + GG+A  GP     L  +GIN+     + N +T   NG  +P  +   + K+FT  +   P T L+ K A ++ G+    T+ V  +  E A+ IAK KL D  + D +  ++ V G+   +GI + G  P
  S:     1 MAEVVEVLVPGGKATAGPPLGPALGPLGINVKAVVDEINKKTASFNGMQVPVRVEVDEKKNFTISVGIPPTTALIMKEAGVEKGSGEPNTKIVGDVPLEAAVTIAKMKLDDMLSYDLKNAVKEVVGTCVSLGITVSGKKP 140
>gi|157777378|ref|XP_001666755.1| hypothetical protein CBG15344 [Caenorhabditis briggsae AF16] >gi|187027247|emb|CAP33673.1| Hypothetical protein CBG15344 [Caenorhabditis briggsae] (195 aa)
Score = 148, Expect = 1.7e-08, Identities = 43/116 (37%), Positives = 66/116 (56%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKIE 142
           GPQL   G+N+  F K+FN +T   K G  +P  IT   D+++  EI T   T +LK+AA I  G K+SK E V  ++ +   EIAK K  D      + E + RM+  + + +GI+++
  S:    39 GPQLGQRGLNVANFCKEFNKETGHFKQGVPLPTRITVKPDRTYDLEICTPTTTWMLKQAAGIGRG-KSSKDEIVGKLTVKHLYEIAKVKSRDKALQHVELEHICRMLIKTCRTLGIEVQ 156
>gi|17551818|ref|NP_498923.1| B0303.15 [Caenorhabditis elegans] >gi|465702|sp|P34264|RM11_CAEEL Probable 39S ribosomal protein L11, mitochondrial precursor >gi|156201|gb|AAA27905.1| Hypothetical protein B0303.15 [Caenorhabditis elegans] (195 aa)
Score = 148, Expect = 1.8e-08, Identities = 48/125 (38%), Positives = 69/125 (55%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDE--EAVLRMVAGSAKQMGIKIE--GVDPVVHKD 151
           GPQL   G+N+  F K+FN +T   K G  +P  IT   D+++  EI T   T LLK+AA I  G K SK E V  ++ +   EIAK K  D        E + RM+  + + +GI ++   +DPV  K+
  S:    39 GPQLGQRGLNVANFCKEFNKETGHFKQGVPLPTRITVKPDRTYDLEICTPTTTWLLKQAAGIGRG-KASKDEIVGKLTVKHLYEIAKIKSRDKALQHVPLEQICRMLIKTCRTLGIDVQYHDLDPVELKE 167
>gi|119174414|ref|XP_001239568.1| conserved hypothetical protein [Coccidioides immitis RS] >gi|90298354|gb|EAS27985.1| conserved hypothetical protein [Coccidioides immitis RS] (154 aa)
Score = 147, Expect = 2.1e-08, Identities = 45/129 (34%), Positives = 73/129 (56%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV------GAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           +I K+ +  GQA P    GP L S G+   +F K+FN +T   N G  +P  +T   D+SFTFE++T   + LL +AA +        G  N   E++ ++S +   EIAK K  +   +    E + + V   AK +G+++
  S:    11 QIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHINPGVPVPARVTVRPDRSFTFELRTPATSWLLLQAARVDERAGRLRGGGNPGHESIGSVSLKHVYEIAKIKQSEIRLSGLSLEGLCKSVIAQAKSIGLEV 152
>gi|19115007|ref|NP_594095.1| mitochondrial ribosomal protein subunit L19 [Schizosaccharomyces pombe] >gi|74665573|sp|Q9UTK2|RM19_SCHPO 60S ribosomal protein L19, mitochondrial precursor >gi|6523777|emb|CAB62417.1| mitochondrial ribosomal protein subunit L19 [Schizosaccharomyces pombe] (144 aa)
Score = 147, Expect = 2.5e-08, Identities = 43/130 (33%), Positives = 71/130 (54%)
  Q:    12 TRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE--AVLRMVAGSAKQMGIKI 141
           T I K+ +  G+A P    GP L + G+   +F K+FN +T        +PC IT    ++FTF I T P + L+ K  +++ G+ +   +    +S +   EIAK K  D +    E  ++ + V G+AK MG+K+
  S:     6 TTIIKLIVPAGKATPTPPIGPALGARGLKSIDFCKEFNARTAGWMPNTPVPCKITVTPQRTFTFTIHTPPTSWLISKTLDLEKGSSSPLHDIKGQLSLKHIYEIAKLKSTDPSLQGIELLSLCKSVIGTAKSMGVKV 142
>gi|18978363|ref|NP_579720.1| 50S ribosomal protein L11P [Pyrococcus furiosus DSM 3638] >gi|38605380|sp|Q8TZK0|RL11_PYRFU 50S ribosomal protein L11P >gi|18894197|gb|AAL82115.1| LSU ribosomal protein L11P; (rpl11P) [Pyrococcus furiosus DSM 3638] (164 aa)
Score = 146, Expect = 2.6e-08, Identities = 44/134 (32%), Positives = 72/134 (53%)
  Q:    13 RIAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++ +V + GG+A PGP L      +G+N+ +   + N+ TKD  G  +P  II     K F  E+   P + L+KK   ++ G+   K   V  ++ E+ ++IAK K     A   +A  + V G+A  MG+ +EG DP
  S:     4 QVVEVLVEGGKATPGPPLGPAIGPLGLNVKQVVDKINEATKDFAGMQVPVKIIVDPVTKQFEIEVGVPPTSQLIKKELGLEKGSGEPKHNIVGNLTMEQVIKIAKMKKDQMLALTLKAAAKEVIGTALSMGVTVEGKDP 142
>gi|68474222|ref|XP_718820.1| likely mitochondrial ribosomal protein (E. coli L11) [Candida albicans SC5314] >gi|68474393|ref|XP_718736.1| likely mitochondrial ribosomal protein (E. coli L11) [Candida albicans SC5314] >gi|46440521|gb|EAK99826.1| likely mitochondrial ribosomal protein (E. coli L11) [Candida albicans SC5314] >gi|46440610|gb|EAK99914.1| likely mitochondrial ribosomal protein (E. coli L11) [Candida albicans SC5314] (143 aa)
Score = 146, Expect = 2.6e-08, Identities = 44/112 (39%), Positives = 66/112 (58%)
  Q:    30 LASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDT--NANDEEAVLRMVAGSAKQMGIKI 141
           L S G+   +F K+FN +T   N G  IP II    D++FTFE+K+ P + LL KAA ++ G+  +  E V  +S +   EIAK K  D    + D +A++  V  +AK +GIK+
  S:    27 LGSKGVKAIDFCKEFNARTAIYNQGVPIPVIIQVKPDRTFTFEMKSPPTSWLLMKAAGVEKGSGKALKEPVGEVSLKHIWEIAKIKKTDDRHKSVDLKAIVGSVISTAKVVGIKV 141
>gi|41614898|ref|NP_963396.1| hypothetical protein NEQ101 [Nanoarchaeum equitans Kin4-M] >gi|54039079|sp|P62446|RL11_NANEQ 50S ribosomal protein L11P >gi|40068622|gb|AAR38957.1| NEQ101 [Nanoarchaeum equitans Kin4-M] (160 aa)
Score = 145, Expect = 3.7e-08, Identities = 43/128 (33%), Positives = 68/128 (53%)
  Q:    19 LIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           + GG+A PGP     L+   IN G+   + N  TK+  G  +P  II   + K +   +   P + LL KAA +  G + +  E V  +S +  +EIAK K+     +  +A ++ V G+A+  GIK+E  DP
  S:    10 VTGGKATPGPPIGPALSPFKINPGKVVAEINKLTKEYEGLPVPVEIIINPETKEYKIIVGLPPTSALLMKAAGVTRGPQRTVHEWVGNVSMKDVVEIAKKKIDSMPTSSLKAAVKSVLGTARATGIKVENKDP 142
>gi|157829799|pdb|1ACI|A Chain A, L11 Ribosomal Protein Rna Binding Domain, Nmr, 20 Structures >gi|157831112|pdb|1FOW|A Chain A, Nmr Structure Of L11-C76, The C-Terminal Domain Of 50s Ribosomal Protein L11, Minimized Average Structure >gi|157831113|pdb|1FOX|A Chain A, Nmr Structure Of L11-C76, The C-Terminal Domain Of 50s Ribosomal Protein L11, 33 Structures >gi|157831114|pdb|1FOY|A Chain A, The Rna Binding Domain Of Ribosomal Protein L11: Three- Dimensional Structure Of The Rna-Bound Form Of The Protein, Nmr, Minimized Average Structure >gi|157834968|pdb|2FOW|A Chain A, The Rna Binding Domain Of Ribosomal Protein L11: Three- Dimensional Structure Of The Rna-Bound Form Of The Protein, Nmr, 26 Structures (76 aa)
Score = 145, Expect = 3.7e-08, Identities = 36/74 (48%), Positives = 47/74 (63%)
  Q:    69 TFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           TF  KT P  +LLKKAA I+ G+       VATI R+K  EIA+ K+ D NA   EA +RM+ G+A+ MGI +E
  S:     2 TFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVE 75
>gi|14589964|ref|NP_142024.1| 50S ribosomal protein L11P [Pyrococcus horikoshii OT3] >gi|6093998|sp|O57779|RL11_PYRHO 50S ribosomal protein L11P >gi|3256386|dbj|BAA29069.1| 164aa long hypothetical 50S ribosomal protein L11 [Pyrococcus horikoshii OT3] (164 aa)
Score = 145, Expect = 4.3e-08, Identities = 43/136 (31%), Positives = 73/136 (53%)
  Q:    13 RIAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDPVV 148
           ++ +V + GG+A PGP L      +G+N+ +   + N+ TK+  G  +P  II     K F  E+   P + L+KK   ++ G+   K   V  ++ E+ ++IAK K     A   +A  + V G+A  MG+ +EG DP +
  S:     4 QVVEVLVEGGKATPGPPLGPAIGPLGLNVKQVVDKINEATKEFAGMQVPVKIIVDPVTKQFEIEVGVPPTSQLIKKELGLEKGSGEPKHNIVGNLTMEQVIKIAKMKRSQMLALTLKAAAKEVIGTALSMGVTVEGKDPRI 144
>gi|6324144|ref|NP_014214.1| Mitochondrial ribosomal protein of the large subunit; Mrpl19p [Saccharomyces cerevisiae] >gi|1730814|sp|P53875|RM19_YEAST 54S ribosomal protein L19, mitochondrial precursor (YmL19) >gi|1302170|emb|CAA96078.1| unnamed protein product [Saccharomyces cerevisiae] >gi|151944356|gb|EDN62634.1| YmL19 [Saccharomyces cerevisiae YJM789] >gi|190409164|gb|EDV12429.1| 60S ribosomal protein L19, mitochondrial precursor [Saccharomyces cerevisiae RM11-1a] (158 aa)
Score = 144, Expect = 5.0e-08, Identities = 48/128 (37%), Positives = 73/128 (57%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVG-------------AKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           I K+ +  GQA P    GP L S GI   +F K+FN ++ + + G  +P +IT   D++FTFE+K+ P   LL KA  +  G                  T  +  +S +   EIAK K  D   +  + E +++ + G AK MGIK+
  S:     9 IVKLIVGAGQAAPSPPVGPALGSKGIKAIDFCKEFNARSANYQPGVPVPVLITIKPDRTFTFEMKSPPTGYLLLKALKMDKGHGQPNVGTMLGSAPAKGPTRALGELSLKHVYEIAKIKKSDERHSLLEMEGIVKSIVGVAKSMGIKV 156
>gi|85079273|ref|XP_956317.1| hypothetical protein NCU04336 [Neurospora crassa OR74A] >gi|28917376|gb|EAA27081.1| hypothetical protein NCU04336 [Neurospora crassa OR74A] (158 aa)
Score = 144, Expect = 5.6e-08, Identities = 47/131 (35%), Positives = 71/131 (54%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKN-GEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV-------GAKNSKTETVATISREKALEIAKTKLVDTNAND--EEAVLRMVAGSAKQMGIKI 141
           + ++ K+ +  GQA P    GP L S GI   +F K+FN +T   N G  +P  +T   D+SF F+++T   + LL  AA   +       GA N   E V T+S +   EIAK K  +   +    E + R V   A+ +GI +
  S:    12 VEQVVKLIVGAGQASPSPPVGPALGSKGIKSMDFCKEFNARTAHINTGTPMPVRVTVRPDRSFHFDVRTPHTSWLLLNAAEAPIGKGGKRKGASNPGKEVVGTVSLKHVYEIAKIKQSELRLSGLPLEGLCRAVIYQARSIGINV 156
>gi|14520219|ref|NP_125693.1| 50S ribosomal protein L11P [Pyrococcus abyssi GE5] >gi|13124482|sp|Q9V2S3|RL11_PYRAB 50S ribosomal protein L11P >gi|5457434|emb|CAB48925.1| rpl11P LSU ribosomal protein L11P [Pyrococcus abyssi GE5] (164 aa)
Score = 143, Expect = 5.7e-08, Identities = 43/134 (32%), Positives = 72/134 (53%)
  Q:    13 RIAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPC-IITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++ +V + GG+A PGP L      +G+N+ +   + N+ TK+  G  +P  II     K F  E+   P + L+KK   ++ G+   K   V  ++ E+ ++IAK K     A   +A  + V G+A  MG+ +EG DP
  S:     4 QVVEVLVEGGKATPGPPLGPAIGPLGLNVKQVVDKINEATKEFAGMQVPVKIIVDPVTKQFEIEVGVPPTSQLIKKELGLEKGSGEPKHNIVGNLTMEQVIKIAKMKRNQMLALTLKAAAKEVIGTALSMGVTVEGKDP 142
>gi|68074081|ref|XP_678955.1| ribosomal protein L11 [Plasmodium berghei strain ANKA] >gi|83273774|ref|XP_729546.1| ribosomal protein L11 [Plasmodium yoelii yoelii str. 17XNL] >gi|23487646|gb|EAA21111.1| putative ribosomal protein L11 [Plasmodium yoelii yoelii] >gi|56499579|emb|CAI04664.1| ribosomal protein L11, putative [Plasmodium berghei] (178 aa)
Score = 143, Expect = 6.3e-08, Identities = 40/131 (30%), Positives = 73/131 (55%)
  Q:    11 ITRIAKVNLI--GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDE--EAVLRMVAGSAKQMGIKI 141
           ++RI + NLI   G  KP    G  L  +GINM  F K+FN++TK  +  V I   +    D+++ F ++T  V   +++ A + + +   K + V  I+  +   IAK K +D    +   +++ + + G+ + MGIK+
  S:     1 MSRIGRFNLIVLAGSPKPSASIGQTLGPLGINMMTFFKEFNERTKSISKNVPIQVTLEPLNDRTYRFYLRTPTVVWFIRRCARVPIFSYAPKHKIVGAITLSEVFHIAKCKRMDPPLINMSIKSICKYIIGTCQSMGIKV 140
>gi|85544272|pdb|2BCW|A Chain A, Coordinates Of The N-Terminal Domain Of Ribosomal Protein L11,C-Terminal Domain Of Ribosomal Protein L7L12 AND A Portion Of The G' Domain Of Elongation Factor G, As Fitted Into Cryo-Em Map Of An Escherichia Coli 70sEf- GGdpFusidic Acid Complex (65 aa)
Score = 142, Expect = 8.5e-08, Identities = 31/59 (52%), Positives = 42/59 (71%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKT 74
           K+ L  G+A P    GP L   G+N+ EF K+FN +T DK G ++P +IT ++DKSFTF IKT
  S:     3 KLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKT 65
>gi|70949841|ref|XP_744295.1| ribosomal protein L11 [Plasmodium chabaudi chabaudi] >gi|56524189|emb|CAH77637.1| ribosomal protein L11, putative [Plasmodium chabaudi] (178 aa)
Score = 141, Expect = 9.7e-08, Identities = 41/131 (31%), Positives = 73/131 (55%)
  Q:    11 ITRIAKVNLI--GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDE--EAVLRMVAGSAKQMGIKI 141
           ++RI + NLI   G  KP    G  L  +GINM  F K+FN++TK  +  V I   +    D+++ F ++T  V   ++K A + + +   K + V  I+  +   IAK K +D    +   +++ + + G+ + MGIK+
  S:     1 MSRIGRFNLIVLAGSPKPSASIGQTLGPLGINMMTFFKEFNERTKSISKNVPIQVTLEPLNDRTYRFYLRTPTVVWFIRKCARVPMFSYAPKHKIVGAITLSEVFHIAKCKRMDPPLINMSIKSICKYIIGTCQSMGIKV 140
>gi|45358996|ref|NP_988553.1| ribosomal protein L11 [Methanococcus maripaludis S2] >gi|50403579|sp|P62445|RL11_METMP 50S ribosomal protein L11P >gi|45047871|emb|CAF30989.1| Ribosomal protein L11 [Methanococcus maripaludis S2] (159 aa)
Score = 141, Expect = 1.0e-07, Identities = 39/134 (29%), Positives = 73/134 (54%)
  Q:    13 RIAKVNLIGGQAKPGPQLAS----IGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDK-SFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           ++ ++ + GG+A  GP L      +G+N+ +  ++ N+ TKD  G  +P  +    DK +F  E+   P + L+KK   I+ G++  K +    I+ E+ ++IAK K     A + +   + V G+   +GI +EG+ P
  S:     4 QVVEILVSGGKATAGPPLGPAIGPLGVNIMQVVQKINNMTKDYEGMSVPVKVIVDTDKRTFEVEVGIPPASALIKKEIGIEKGSQEPKHQVAGNITMEQIVKIAKMKQDAMLAYNLKNASKEVVGTCVSVGISVEGMTP 142
>gi|730523|sp|P41200|RL11_HALVO 50S ribosomal protein L11P (L11E) >gi|313016|emb|CAA41722.1| ribosomal protein L11e [Haloferax volcanii] (159 aa)
Score = 141, Expect = 1.0e-07, Identities = 37/125 (29%), Positives = 62/125 (49%)
  Q:    21 GGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVD 145
           GG+A PGP    +L    +++ +     NDQT   +G  +P  +    D SF+ E+   P   L+K       G+   +   VA +S E+  ++A+ K  D  + D +   + VAG+   +G+ IEG D
  S:    11 GGKANPGPPLGPELGPTPVDVQDVVNDINDQTAAFDGMEVPVTVEYDDDGSFSIEVGVPPTAALIKDEVGFDTGSGEPQENFVADMSIEQLKKVAEQKSSDLLSYDLKNASKEVAGTCASLGVTIEGED 139
>gi|67515669|ref|XP_657720.1| hypothetical protein AN0116.2 [Aspergillus nidulans FGSC A4] >gi|40746138|gb|EAA65294.1| hypothetical protein AN0116.2 [Aspergillus nidulans FGSC A4] (153 aa)
Score = 140, Expect = 1.6e-07, Identities = 47/129 (36%), Positives = 72/129 (55%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKV------GAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           +I K+ +  GQA P    GP L S G+   +F K+FN +T     G  IP  +T   D+SF F+++T   T LL +AA ++       GA+    E +  IS +   EIAK K  +T  +    E + + V   AK +GI++
  S:    10 QIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHITTGVPIPARVTVRPDRSFHFDLRTPTTTYLLLQAAKVEPRKNRIRGAQRPGHEFIGKISLKHVYEIAKIKQSETRLSGLSLEGLCKSVMAQAKSVGIQV 151
>gi|25306272|ref|NP_733934.1| mitochondrial ribosomal protein L11 isoform b [Homo sapiens] >gi|114638709|ref|XP_001171575.1| PREDICTED: mitochondrial ribosomal protein L11 isoform 1 [Pan troglodytes] >gi|80478617|gb|AAI08278.1| Mitochondrial ribosomal protein L11 [Homo sapiens] >gi|119594937|gb|EAW74531.1| mitochondrial ribosomal protein L11, isoform CRA_f [Homo sapiens] (166 aa)
Score = 139, Expect = 1.9e-07, Identities = 39/120 (32%), Positives = 69/120 (57%)
  Q:    22 GQAKPGPQLASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEE----AVLRMVAGSAKQMGIKI 141
           G+A  G +    G+++ +F K+FN++TKD K G  +P  I    D++F  +I    V+  LK AA I+ GA+ +  E    ++ +   EIA+ K  D     ++    +V+R + GSA+ +GI++
  S:     5 GRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRV 129
>gi|47225296|emb|CAG09796.1| unnamed protein product [Tetraodon nigroviridis] (154 aa)
Score = 138, Expect = 2.4e-07, Identities = 39/108 (36%), Positives = 61/108 (56%)
  Q:    34 GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTN----ANDEEAVLRMVAGSAKQMGIKI 141
           GI +G+F K FN++TK+ K G  +P  I    D+++  +I    V+  LK+AA I  GA  +  ET   +S     EIA+ K  D       +  E V++ + GSA+ +GIK+
  S:     3 GIPIGQFCKDFNEKTKELKEGIPLPIKIHVKPDRTYDLKIGQPTVSYFLKQAAGIAKGAGKTGHETAGVVSVRAVYEIAQVKAQDECFKMWNSSMETVVKCIIGSARSLGIKV 115
>gi|46123653|ref|XP_386380.1| hypothetical protein FG06204.1 [Gibberella zeae PH-1] (156 aa)
Score = 138, Expect = 2.6e-07, Identities = 48/131 (36%), Positives = 71/131 (54%)
  Q:    11 ITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDK-NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKT-------ETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           + +I K+ +  GQA P    GP L S G+   +F K+FN +T     G   PC +T   D+SFTF+++T   + LL  A    +G K  +        ETV TI+ +   EIAK K  +   +    E + R V   AK +GI +
  S:    10 VDQIVKLIVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHIITGTPTPCRVTVRPDRSFTFDVRTPQTSWLLLNAVEAPMGKKGKRKGAGKPGHETVGTITLKHVYEIAKIKQSELRLSGLSLEGLCRAVIFQAKSIGIDV 154
>gi|17737961|ref|NP_524351.1| mitochondrial ribosomal protein L11 CG3351-PA [Drosophila melanogaster] >gi|22001929|sp|Q9VFJ2|RM11_DROME 39S ribosomal protein L11, mitochondrial precursor (L11mt) >gi|7299888|gb|AAF55063.1| CG3351-PA [Drosophila melanogaster] >gi|20151771|gb|AAM11245.1| RE67638p [Drosophila melanogaster] (196 aa)
Score = 138, Expect = 2.7e-07, Identities = 46/140 (32%), Positives = 70/140 (50%)
  Q:    10 RITRIAKV--NLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIK-IEGVDPVVH 149
           R+T  +K+  N+  G A  GP L  +     IN+  F K FN +T + K G  +PC I+   D+S+   I   P T  LK+AA I+ G      E    I+ +   EIA  K+ D        + +  M+   A+  GIK +  +DP  +
  S:    17 RVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNAKTAEMKEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNVLLTMQQMCEMLISIARTCGIKVVREIDPAAY 166
>gi|67925193|ref|ZP_00518561.1| Ribosomal protein L11 [Crocosphaera watsonii WH 8501] >gi|67852952|gb|EAM48343.1| Ribosomal protein L11 [Crocosphaera watsonii WH 8501] (77 aa)
Score = 137, Expect = 3.4e-07, Identities = 30/70 (42%), Positives = 46/70 (65%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTM 79
           ++  + K+ L  G+A P    GP L   G+N+  F K++N +T DK G VIP  I+ F+D+SFTF +KT P ++
  S:     4 KVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTSDKAGMVIPVQISVFEDRSFTFVLKTPPASV 77
>gi|15242133|ref|NP_199974.1| ribosomal protein L11 family protein [Arabidopsis thaliana] >gi|9758203|dbj|BAB08677.1| 50S ribosomal protein L11-like [Arabidopsis thaliana] (182 aa)
Score = 135, Expect = 5.7e-07, Identities = 32/78 (41%), Positives = 49/78 (62%)
  Q:    65 DKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIE 142
           D+SFTF +KT P + LL KAA +K G+K+ K   V  I+ ++  +IA+ KL + N     + +R +AG+A  MGI I+
  S:    92 DQSFTFILKTPPTSFLLLKAAGVKKGSKDPKQIKVGMITIDQVRKIAEVKLPELNCTTIVSTMRTIAGTAGNMGIDID 169
>gi|125773955|ref|XP_001358236.1| GA17398-PA [Drosophila pseudoobscura] >gi|195143903|ref|XP_002012936.1| GL23859 [Drosophila persimilis] >gi|54637972|gb|EAL27374.1| GA17398-PA [Drosophila pseudoobscura] >gi|194101879|gb|EDW23922.1| GL23859 [Drosophila persimilis] (196 aa)
Score = 135, Expect = 5.7e-07, Identities = 47/140 (33%), Positives = 71/140 (50%)
  Q:    10 RITRIAKV--NLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKDK-NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVD-TNA-NDEEAVLRMVAGSAKQMGIK-IEGVDPVVH 149
           R+T  +K+  N+  G A  GP L  +     IN+  F K FN +T +   G  +PC I+   D+S+   I   P T  LK+AA I+ G      E    I+ +   EIA  K+ D  NA    + +  M+   A+  GIK +  +DP  +
  S:    17 RVTHTSKLKTNIPAGMAAAGPPLGPMLGQRAINIAAFCKDFNTKTAEMIEGVPLPCRISVNSDRSYDLAIHHPPATFFLKQAAGIQRGTMTPGKEVAGMITLKHLYEIAAIKIQDPPNALLSMQQMCEMLISIARTCGIKVVRDLDPAAY 166
>gi|116754719|ref|YP_843837.1| ribosomal protein L11 [Methanosaeta thermophila PT] >gi|121693041|sp|A0B923|RL11_METTP 50S ribosomal protein L11P >gi|116666170|gb|ABK15197.1| LSU ribosomal protein L11P [Methanosaeta thermophila PT] (159 aa)
Score = 135, Expect = 5.9e-07, Identities = 34/118 (28%), Positives = 64/118 (54%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGV 144
           GP L  +G+N+     + N+ TKD NG  +P  I       F  E+ T P + LL K A ++ G+ + K   V  IS ++ +++A+ K  +  +++ ++ +  + G+   +GIKI+G+
  S:    21 GPALGPLGVNVAAVVAKINELTKDLNGMQVPVKIIVKSRTEFEIEVGTPPTSALLLKEAGVEKGSGDKKN-FVGDISMDQVIKVAEIKRKNLLSSNLKSAVSEIVGTCGTLGIKIDGL 137
>gi|50291545|ref|XP_448205.1| unnamed protein product [Candida glabrata] >gi|49527516|emb|CAG61156.1| unnamed protein product [Candida glabrata] (149 aa)
Score = 135, Expect = 6.2e-07, Identities = 43/112 (38%), Positives = 62/112 (55%)
  Q:    30 LASIGINMGEFTKQFNDQTKD-KNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKN----SKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           L S GI   +F K+FN +T   + G  IP +IT   D+SFTFE+K+ P   LL KA   + G        K +T+  +S +   EIAK K  D+     D   +++ +   AK MGIK+
  S:    29 LGSKGIKAIDFCKEFNARTASYQPGVPIPVLITIRPDRSFTFEMKSPPTGYLLLKALGAEKGHGQPNILQKEKTLGELSLKHVYEIAKIKKTDSRHAMLDMPGIVKSIIAVAKSMGIKV 147
>gi|70607203|ref|YP_256073.1| 50S ribosomal protein L11P [Sulfolobus acidocaldarius DSM 639] >gi|464617|sp|P35025|RL11_SULAC 50S ribosomal protein L11P >gi|763027|emb|CAA41762.1| ribosomal protein L11 [Sulfolobus solfataricus] >gi|68567851|gb|AAY80780.1| 50S ribosomal protein L11P [Sulfolobus acidocaldarius DSM 639] (170 aa)
Score = 133, Expect = 8.8e-07, Identities = 41/135 (30%), Positives = 69/135 (51%)
  Q:    12 TRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCIITA-FKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           T+  K+ + GG AKPGP     L+ +G+N+ E  K+ ND T    G  +P  I      K +  ++     T LL KA N +  + +   + +  +  E+  +IA  K    +A    A ++ + G+A+ +GI +EG DP
  S:     3 TKTIKIMVEGGSAKPGPPLGPTLSQLGLNVQEVVKKINDVTAQFKGMSVPVTIEIDSSTKKYDIKVGVPTTTSLLLKAINAQEPSGDPAHKKIGNLDLEQIADIAIKKKPQLSAKTLTAAIKSLLGTARSIGITVEGKDP 142
>gi|116196858|ref|XP_001224241.1| hypothetical protein CHGG_05027 [Chaetomium globosum CBS 148.51] >gi|88180940|gb|EAQ88408.1| hypothetical protein CHGG_05027 [Chaetomium globosum CBS 148.51] (154 aa)
Score = 133, Expect = 8.8e-07, Identities = 45/129 (34%), Positives = 70/129 (54%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDK-NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANI-------KVGAKNSKTETVATISREKALEIAKTKLVDTNAN--DEEAVLRMVAGSAKQMGIKI 141
           ++ K+ +  GQA P    GP L S GI   +F K+FN +T+    G  +P  +T   D++F FE++T   + LL  AA         + GA N   E V T+S +   EIAK K  +   +    E + R +   +K +GI +
  S:    10 QVVKIIVGAGQASPSPPVGPALGSKGIKSMDFCKEFNARTQHLIAGTPMPVRVTVRGDRTFHFEVRTPQTSWLLLNAAEAPTGKKGKRKGASNPGKEIVGTLSLKHIYEIAKIKQSELRLSGLSLEGICRSIIYQSKSIGIAV 152
>gi|5107627|pdb|1QA6|A Chain A, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex >gi|5107628|pdb|1QA6|B Chain B, Crystal Structure Of A Conserved Ribosomal Protein-Rna Complex >gi|6137593|pdb|1C04|C Chain C, Identification Of Known Protein And Rna Structures In A 5 A Map Of The Large Ribosomal Subunit From Haloarcula Marismortui (67 aa)
Score = 133, Expect = 9.0e-07, Identities = 33/67 (49%), Positives = 43/67 (64%)
  Q:    73 KTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGI 139
           KT P  +LLKKAA I+ G+       VATI R+K  EIA+ K+ D NA   EA +RM+ G+A+ MGI
  S:     1 KTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGI 67
>gi|29027533|gb|AAO61990.1| rp L11 [Aster yellows phytoplasma] (80 aa)
Score = 132, Expect = 1.1e-06, Identities = 30/66 (45%), Positives = 44/66 (66%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLL 81
           K+ + GG A P    GP L + G+N+ +F KQ+N  T+   G+++P IIT + DKSF+F IK  PV+  L
  S:     9 KLQIKGGLANPAPPIGPALGAAGVNIMDFCKQYNLSTQKSKGKLLPVIITIYNDKSFSFLIKEPPVSKQL 78
>gi|73544571|ref|XP_848180.1| ribosomal protein L11, putative [Leishmania major strain Friedlin] >gi|70800131|gb|AAZ09972.1| ribosomal protein L11, putative [Leishmania major strain Friedlin] (346 aa)
Score = 132, Expect = 1.2e-06, Identities = 44/127 (34%), Positives = 65/127 (51%)
  Q:    21 GGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCI--ITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNS---KTETVATISREKALEIAKTKLVDTNANDE---EAVLRMVAGSAKQMGIKIEGVDPV 147
            G+A  GP    + + +G+   +F K FND+TK    + I  I  I  + DKS+ F I+  P    L +A   K G       +    A ++ E   EIAK K +     +    E  +R V G A++MGI I G+D V
  S:    59 AGKAATGPPVGQEFSKLGLKAMDFAKAFNDRTKPHFKDDIELIVRIQVYFDKSYIFRIEPPPTAWFLLRAIRKKRGETGPVVLRGNYCAYLTLEMCYEIAKMKQMSWGKVEYPPIEVRVRRVVGQARRMGIAIIGIDTV 197
>gi|11466627|ref|NP_066310.1| ribosomal protein L11 [Malawimonas jakobiformis] >gi|10178665|gb|AAG13677.1|AF295546_3 ribosomal protein L11 [Malawimonas jakobiformis] (143 aa)
Score = 132, Expect = 1.4e-06, Identities = 43/132 (32%), Positives = 70/132 (53%)
  Q:    10 RITRIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKT-KLVDTNANDEEAVLRMVAGSAKQMGIKI 141
           R   + KV +   +A P    GP     GIN+ +F+K+FN+ TK+   E+ IP  IT  K++S    IK    + ++KK  NI  G+  +K   ++ I  +   EI K     +   N+ +   +++  SAK MGI+I
  S:     4 RYKEVFKVTINANKASPTPPIGPMFGQRGINIMDFSKEFNNNTKEFKDEMPIPVEITLNKNRSILINIKKPKTSYIIKKLCNILKGSSQAKHSIISNIKIQHIYEIVKMLNKNNLTENEFKNECKVLMASAKSMGIEI 141
>gi|13541254|ref|NP_110942.1| 50S ribosomal protein L11P [Thermoplasma volcanium GSS1] >gi|38605428|sp|Q97BN1|RL11_THEVO 50S ribosomal protein L11P >gi|14324639|dbj|BAB59566.1| ribosomal protein large subunit L12 [Thermoplasma volcanium GSS1] (158 aa)
Score = 131, Expect = 1.6e-06, Identities = 36/120 (30%), Positives = 61/120 (50%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKT--TPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GP L  +G+N+ +  K+ N++TK+  G  +P  +T    ++  +EI     P + LLKK   ++ GA   K       + E+   +A  K+    A D ++ +  V G+   MGI +EG DP
  S:    21 GPALGPLGLNVAQVVKEINEKTKEFQGMQVPVTVTVIDPETKKYEITVGVPPTSALLKKELGLEKGASKKKEAVAGNATLEQIKNVAIKKMPSMLAKDLKSAVLEVLGTCVAMGINVEGKDP 142
>gi|39976005|ref|XP_369393.1| hypothetical protein MGG_06071 [Magnaporthe grisea 70-15] >gi|145011643|gb|EDJ96299.1| hypothetical protein MGG_06071 [Magnaporthe grisea 70-15] (157 aa)
Score = 129, Expect = 2.6e-06, Identities = 42/130 (32%), Positives = 72/130 (55%)
  Q:    13 RIAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDK-NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSK-------TETVATISREKALEIAKTKLVDT--NANDEEAVLRMVAGSAKQMGIKIE 142
           +I K+ +  GQA P    GP L S G+   +F K+FN +T     G   P  +    D++F+F+I+T   + LL  AA+  +G K  +        ETV T+S +   EIAK K  +   + +  E + + +    K +G++++
  S:    13 QIVKLLVGAGQASPSPPVGPALGSKGVKSMDFCKEFNARTAHIITGTPTPVRVVVRPDRTFSFDIRTPQTSWLLLNAADAPMGRKGKRKGTGLAGKETVGTVSLKHIYEIAKIKQTEMRLSGHSLEGLCKSIIYQCKSIGVEVK 156
>gi|124803673|ref|XP_001347786.1| ribosomal protein L11 [Plasmodium falciparum 3D7] >gi|23496037|gb|AAN35699.1|AE014837_41 ribosomal protein L11, putative [Plasmodium falciparum 3D7] (175 aa)
Score = 129, Expect = 3.0e-06, Identities = 42/131 (32%), Positives = 72/131 (54%)
  Q:    11 ITRIAKVNLI--GGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNAND--EEAVLRMVAGSAKQMGIKI 141
           ++RI + NLI   G AKP    G  L  +GINM  F K+FND+TK     V I   +    D+   F ++T  V   +++ A + + +  +K  TV +I+  +   IAK K +D    +   +++ + + G+   MGI++
  S:     1 MSRIGRFNLIVLSGTAKPSASIGQTLGPLGINMMTFFKEFNDRTKCIAKNVPIQVTLEPLNDR---FYLRTPTVVWFIRRCARVPMFSSMAKHNTVGSITLAEVFHIAKCKRMDPPLINLSLKSICKYIIGTCNSMGIRV 137
>gi|50551329|ref|XP_503138.1| hypothetical protein [Yarrowia lipolytica] >gi|49649006|emb|CAG81336.1| unnamed protein product [Yarrowia lipolytica CLIB122] (152 aa)
Score = 127, Expect = 4.1e-06, Identities = 44/128 (34%), Positives = 75/128 (58%)
  Q:    14 IAKVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDKNGEV-IPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGA---KNSKTETVATISREKALEIAKTKLVDTNANDE--EAVLRMVAGSAKQMGIKI 141
           I K+ +  G AKP    GP L S G+   +F K+FN +T      + IP ++T   D++F+FE+K+     LL +AA  + GA   K  + + V  +S +   E+AK K +D+   D+  E + + + G+A  +G++I
  S:    13 IVKIIVGAGAAKPQPPVGPVLGSKGVKAIDFCKEFNAKTAHYQDNIPIPVVLTIKPDRTFSFELKSPQTAFLLLRAAGAEKGAAKYKPGRDQPVGQLSLKHIYELAKIKKMDSRHKDQPLENICKSLCGTALSVGVEI 150
>gi|56755699|gb|AAW26028.1| SJCHGC09154 protein [Schistosoma japonicum] (206 aa)
Score = 126, Expect = 5.7e-06, Identities = 44/132 (33%), Positives = 70/132 (53%)
  Q:    16 KVNLIGGQAKP----GPQLASIGINMGEFTKQFNDQTKDK-NGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTN--ANDEEAVLRMVAGSAKQMGIKIEGVDPV 147
           K+ +   QA+P    GPQL    +N+  F K FN++TKD   G  +PC I+   D+S+   I       LL+ AA  K GA    TE    ++ +    IA+ K  D +    D + + +M+ G+A ++GI+I   D +
  S:    27 KIIIPAQQARPAPPLGPQLGRRNVNIANFCKDFNEKTKDVIEGIPMPCFISVKADRSYDLVISHPSSMHLLRMAAAAKKGAALPGTEVCGRLTLKHIYHIAELKKQDPHLMRRDLQMICKMLIGTAHRLGIEIVTQDDI 165
>gi|48477509|ref|YP_023215.1| 50S ribosomal protein L11P [Picrophilus torridus DSM 9790] >gi|56404793|sp|Q6L1Y0|RL11_PICTO 50S ribosomal protein L11P >gi|48430157|gb|AAT43022.1| large subunit ribosomal protein L11P [Picrophilus torridus DSM 9790] (155 aa)
Score = 126, Expect = 5.7e-06, Identities = 35/120 (29%), Positives = 62/120 (51%)
  Q:    27 GPQLASIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEI--KTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           GP L  +G+N+G+  K  N++TK+  G  +P  +      +  +EI     P + LLKK   I+ GA   K +     + E+  ++A++K     + + +  +  V GSA  +GI ++G DP
  S:    20 GPALGPLGLNLGQVVKDINEKTKNFAGMQVPVTVNVIDPATKKYEIIVGVPPTSALLKKELGIEKGASKKKEKIAGNATLEQIKKVAESKRSALLSYNMKGAVLEVLGSAVSLGITVDGRDP 141
>gi|3914677|sp|P96037|RL11_SULSO 50S ribosomal protein L11P >gi|1814427|gb|AAB99524.1| ribosomal protein L11 [Sulfolobus solfataricus] (170 aa)
Score = 124, Expect = 9.9e-06, Identities = 38/134 (28%), Positives = 66/134 (49%)
  Q:    13 RIAKVNLIGGQAKPGPQLA----SIGINMGEFTKQFNDQTKDKNGEVIPCIITA-FKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           +  K+ + GG  KPGP LA     +G+N+GE  K+ N+ T    G  +P  I      K +  ++     T LL K A     + +   + +  +S E+ ++IA  K         +A L+ + G+AK +G+ ++  DP
  S:     4 KTIKIMVEGGNVKPGPPLAPTLSQLGLNVGEVVKKLNEATSSFKGMSVPVTIEVDSSTKKYEIKVGIPTTTALLLKEAGASEPSGDPAHKKIGNLSLEQVIKIAIMKKPGLTTKSLKAALKSMLGTAKSIGLTVDNRDP 142
>gi|84043734|ref|XP_951657.1| ribosomal protein L11 [Trypanosoma brucei TREU927] >gi|84043754|ref|XP_951667.1| ribosomal protein L11 [Trypanosoma brucei TREU927] >gi|33348607|gb|AAQ15932.1| ribosomal protein L11, putative [Trypanosoma brucei] >gi|33348622|gb|AAQ15947.1| ribosomal protein L11, putative [Trypanosoma brucei] >gi|62359726|gb|AAX80157.1| ribosomal protein L11, putative [Trypanosoma brucei] >gi|62359736|gb|AAX80167.1| ribosomal protein L11, putative [Trypanosoma brucei] (342 aa)
Score = 124, Expect = 1.0e-05, Identities = 44/140 (31%), Positives = 69/140 (49%)
  Q:     6 FKDPRITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCI--ITAFKDKSFTFEIKTTPVTMLLKKAANIK---VGAKNSKTETVATISREKALEIAKTKLVDTNANDE---EAVLRMVAGSAKQMGIKIEGVD 145
           F   R+    +  +  G+A  GP    + + +G+   +F K FND+TK    E +  I  I  + DKS+ F I+  P    + +A   K    G    +    A ++ E A EIAK K +     +    E  +R V G A++MG+   GVD
  S:    44 FPGKRVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKVFNDRTKPHFKEDVELIVRIQVYFDKSYLFTIEPPPTAWFILRALRKKRRETGPVPLRGHYCALMTLEMAYEIAKMKPLCWGRPEYPLLETRVRRVVGQARRMGVCFIGVD 195
>gi|15897280|ref|NP_341885.1| 50S ribosomal protein L11P [Sulfolobus solfataricus P2] >gi|13813487|gb|AAK40675.1| LSU ribosomal protein L11AB (rpl11AB) [Sulfolobus solfataricus P2] (173 aa)
Score = 123, Expect = 1.2e-05, Identities = 38/134 (28%), Positives = 66/134 (49%)
  Q:    13 RIAKVNLIGGQAKPGPQLA----SIGINMGEFTKQFNDQTKDKNGEVIPCIITA-FKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           +  K+ + GG  KPGP LA     +G+N+GE  K+ N+ T    G  +P  I      K +  ++     T LL K A     + +   + +  +S E+ ++IA  K         +A L+ + G+AK +G+ ++  DP
  S:     7 KTIKIMVEGGNVKPGPPLAPTLSQLGLNVGEVVKKLNEATSSFKGMSVPVTIEVDSSTKKYEIKVGIPTTTALLLKEAGASEPSGDPAHKKIGNLSLEQVIKIAIMKKPGLTTKSLKAALKSMLGTAKSIGLTVDNRDP 145
>gi|15921652|ref|NP_377321.1| 50S ribosomal protein L11P [Sulfolobus tokodaii str. 7] >gi|54039104|sp|Q971J0|RL11_SULTO 50S ribosomal protein L11P >gi|15622439|dbj|BAB66430.1| 170aa long hypothetical 50S ribosomal protein L11 [Sulfolobus tokodaii str. 7] (170 aa)
Score = 122, Expect = 1.8e-05, Identities = 39/135 (28%), Positives = 66/135 (48%)
  Q:    12 TRIAKVNLIGGQAKPGPQLA----SIGINMGEFTKQFNDQTKDKNGEVIPCIITAFKD-KSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEGVDP 146
           T+  K+ + GG  KPGP LA     +G+N+GE  K+ ND T    G  +P  +    D K +  ++     T LL K AN    + +   + V  I  E  +++A  K     A   +A ++ + G+A  +G+ ++   P
  S:     3 TKSIKIVVEGGNVKPGPPLAPTLSQLGLNVGEVVKKINDATSQFKGMSVPVTLEVDTDTKKYEIKVGIPTTTSLLLKFANASEPSGDPAHKKVGDIKFEDIIQVAIMKKPQITAKTLKAAVKSILGTAHSIGLTVDKKSP 142
>gi|71661532|ref|XP_817786.1| ribosomal protein L11, putative [Trypanosoma cruzi strain CL Brener] >gi|70882998|gb|EAN95935.1| ribosomal protein L11, putative [Trypanosoma cruzi] (341 aa)
Score = 119, Expect = 4.1e-05, Identities = 42/140 (30%), Positives = 68/140 (48%)
  Q:     6 FKDPRITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCI--ITAFKDKSFTFEIKTTPVTMLLKKAANIK---VGAKNSKTETVATISREKALEIAKTKLVDTNANDE---EAVLRMVAGSAKQMGIKIEGVD 145
           F   R+    +  +  G+A  GP    + + +G+   +F K FND+TK    + +  I  I  + DKS+ + I+  P    + +A   K    G    +    A ++ E A EIAK K       +    E  +R V G A++MG+   GVD
  S:    44 FPGKRVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKSFNDRTKPHFKDDVELIVRIQVYFDKSYLYTIEPPPTAWFILRALRKKRRETGPVPIRGHYCALMTLEMAYEIAKMKPRSWGRPEYPLIETRVRRVVGQARRMGVCFVGVD 195
>gi|71661043|ref|XP_817548.1| ribosomal protein L11, putative [Trypanosoma cruzi strain CL Brener] >gi|71661069|ref|XP_817561.1| ribosomal protein L11, putative [Trypanosoma cruzi strain CL Brener] >gi|70882747|gb|EAN95697.1| ribosomal protein L11, putative [Trypanosoma cruzi] >gi|70882760|gb|EAN95710.1| ribosomal protein L11, putative [Trypanosoma cruzi] (341 aa)
Score = 119, Expect = 4.1e-05, Identities = 42/140 (30%), Positives = 68/140 (48%)
  Q:     6 FKDPRITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCI--ITAFKDKSFTFEIKTTPVTMLLKKAANIK---VGAKNSKTETVATISREKALEIAKTKLVDTNANDE---EAVLRMVAGSAKQMGIKIEGVD 145
           F   R+    +  +  G+A  GP    + + +G+   +F K FND+TK    + +  I  I  + DKS+ + I+  P    + +A   K    G    +    A ++ E A EIAK K       +    E  +R V G A++MG+   GVD
  S:    44 FPGKRVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKSFNDRTKPHFKDDVELIVRIQVYFDKSYLYAIEPPPTAWFILRALRKKRRETGPVPIRGHYCALMTLEMAYEIAKMKPRSWGRPEYPLIETRVRRVVGQARRMGVCFVGVD 195
>gi|71414154|ref|XP_809189.1| ribosomal protein L11, putative [Trypanosoma cruzi strain CL Brener] >gi|70873533|gb|EAN87338.1| ribosomal protein L11, putative [Trypanosoma cruzi] (341 aa)
Score = 119, Expect = 4.2e-05, Identities = 42/140 (30%), Positives = 68/140 (48%)
  Q:     6 FKDPRITRIAKVNLIGGQAKPGP----QLASIGINMGEFTKQFNDQTKDKNGEVIPCI--ITAFKDKSFTFEIKTTPVTMLLKKAANIK---VGAKNSKTETVATISREKALEIAKTKLVDTNANDE---EAVLRMVAGSAKQMGIKIEGVD 145
           F   R+    +  +  G+A  GP    + + +G+   +F K FND+TK    + +  I  I  + DKS+ + I+  P    + +A   K    G    +    A ++ E A EIAK K       +    E  +R V G A++MG+   GVD
  S:    44 FPGKRVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKSFNDRTKPHFKDDVELIVRIQVYFDKSYLYTIEPPPTAWFILRALRKKRRETGPVPIRGHYCALMTLEMAYEIAKMKPRSWGRPEYPLIETRVRRVVGQARRMGVCFVGVD 195
>gi|88608431|ref|YP_506560.1| ribosomal protein L11 [Neorickettsia sennetsu str. Miyayama] >gi|88600600|gb|ABD46068.1| ribosomal protein L11 [Neorickettsia sennetsu str. Miyayama] (140 aa)
Score = 118, Expect = 4.8e-05, Identities = 37/128 (28%), Positives = 64/128 (50%)
  Q:    16 KVNLIGGQAKPGPQLASI----GINMGEFTKQFNDQTKDKNGEVIPCIITAFKDKSFTFEIKTTPVTMLLKKAANIKVGAKNSKTETVATISREKALEIAKTKLVDTNANDEEAVLRMVAGSAKQMGIKIEG 143
           K+ +  G+A P P +AS     G+N+ +F +  N+ T    G  I   +  ++DK+F   ++    T ++K       G+       VA++ + K  EIA+  +   N  + +A +RMV G    MGIK+ G
  S:     9 KLRVPAGKASPTPAIASSLGPKGVNLMKFCQACNELTGALAGN-IRVRVLVYQDKTFDVVVRGKNSTDVIKSFLQFSKGSAAPGKSFVASVGQSKISEIARELIGCMNTRNFDAAVRMVTGKVASMGIKVSG 139