>gi|26553706|ref|NP_757640.1| Zn-dependent protease [Mycoplasma penetrans HF-2] >gi|26453713|dbj|BAC44044.1| predicted Zn-dependent protease [Mycoplasma penetrans HF-2] (245 aa)
Score = 1179, Expect = 1.2e-127, Identities = 233/233 (100%), Positives = 233/233 (100%)
  Q:    13 AIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPFIQIGDSFLTILKNMVFYNAWTTGPKAPGTSFGSVAEVGGARWNKFQPITTSNS 245
           AIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPFIQIGDSFLTILKNMVFYNAWTTGPKAPGTSFGSVAEVGGARWNKFQPITTSNS
  S:    13 AIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPFIQIGDSFLTILKNMVFYNAWTTGPKAPGTSFGSVAEVGGARWNKFQPITTSNS 245
>gi|157363520|ref|YP_001470287.1| peptidase M50 [Thermotoga lettingae TMO] >gi|157314124|gb|ABV33223.1| peptidase M50 [Thermotoga lettingae TMO] (495 aa)
Score = 182, Expect = 4.9e-12, Identities = 34/73 (46%), Positives = 51/73 (69%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           + VI+ LL ++  +T+HE+GHF+FAK+F V+V EFAIG GPK+Y K+     F INL PI  +VR+  +  ++
  S:     1 MFVIYFLLILVGIITVHELGHFIFAKIFGVDVLEFAIGFGPKLYEKKGKKTAFRINLFPIGGYVRLAGEDPME 73
>gi|31544297|ref|NP_852875.1| protease [Mycoplasma gallisepticum R] >gi|31541141|gb|AAP56443.1| predicted protease [Mycoplasma gallisepticum R] (273 aa)
Score = 180, Expect = 9.5e-12, Identities = 66/222 (29%), Positives = 102/222 (45%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIM--AFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNN---NSNPFIQIGDSFLTILKNMVFYNAWTTGPKAPGTSFGSVAEVGGA 232
           + +I+  LT+HE GH++FA+++KV+VKEF+IGIGP ++S  +   K  ++   I+  AFV ++S K  Q++  + D   K                                       YN YL           K   T  ++EV  W+Q++I  GGIF N + FG+F  I     +N   + + F +  D F+ + K  V Y AW   PK      G +   GGA
  S:    19 VFSIITTLTVHEFGHYIFARIYKVHVKEFSIGIGPTLFSFYWHKKKMIVSFRAILAGAFVMLESTKLRQIY--IDDPNAK--------------------------------------TYNFYLMP---------KPKNTHALEEVGYWKQILIMIGGIFANFLCFGIFLGIYAAIYSNAVLDLSKFFR--DIFINLGKGFVLYEAWK--PK----DMGEIIPGGGA 188
>gi|150020165|ref|YP_001305519.1| peptidase M50 [Thermosipho melanesiensis BI429] >gi|149792686|gb|ABR30134.1| peptidase M50 [Thermosipho melanesiensis BI429] (496 aa)
Score = 165, Expect = 4.9e-10, Identities = 31/63 (49%), Positives = 42/63 (66%)
  Q:     8 IFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I  +L  M  + +HE GHF+FAK+FKV V EF+IG GP I+ KQF    F IN++P   +VR+
  S:    10 ISFILVFMFVVVVHEFGHFLFAKIFKVTVLEFSIGFGPAIFKKQFKETLFKINVIPFGGYVRL 72
>gi|148269182|ref|YP_001243642.1| peptidase M50 [Thermotoga petrophila RKU-1] >gi|170287844|ref|YP_001738082.1| peptidase M50 [Thermotoga sp. RQ2] >gi|147734726|gb|ABQ46066.1| peptidase M50 [Thermotoga petrophila RKU-1] >gi|170175347|gb|ACB08399.1| peptidase M50 [Thermotoga sp. RQ2] (501 aa)
Score = 161, Expect = 1.3e-09, Identities = 28/66 (42%), Positives = 47/66 (71%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +++++ +L +   + +HE+GH++FA+LFKV V EFAIG GPKI+S +     F +N+ PI  +VR+
  S:     1 MVIVYFILILTGVIMVHELGHYLFARLFKVKVLEFAIGFGPKIFSVKGRETTFRLNVFPIGGYVRM 66
>gi|15643652|ref|NP_228698.1| hypothetical protein TM0890 [Thermotoga maritima MSB8] >gi|20978859|sp|Q9WZZ2|Y890_THEMA Putative zinc metalloprotease TM_0890 >gi|4981425|gb|AAD35971.1|AE001754_8 conserved hypothetical protein [Thermotoga maritima MSB8] (501 aa)
Score = 161, Expect = 1.4e-09, Identities = 28/66 (42%), Positives = 47/66 (71%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +++++ +L +   + +HE+GH++FA+LFKV V EFAIG GPKI+S +     F +N+ PI  +VR+
  S:     1 MVIVYFILILTGVIMVHELGHYLFARLFKVKVLEFAIGFGPKIFSVKGRETTFRLNVFPIGGYVRM 66
>gi|182417566|ref|ZP_02948891.1| RIP metalloprotease RseP [Clostridium butyricum 5521] >gi|182378579|gb|EDT76107.1| RIP metalloprotease RseP [Clostridium butyricum 5521] (337 aa)
Score = 158, Expect = 3.0e-09, Identities = 35/79 (44%), Positives = 51/79 (64%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-------IDSKKSLQVFGELR 83
           + +I  +LA  V + +HE+GHF  AK+  V V+EF+IG+GPKI+SKQ    K+SI L PI  +V        +D ++S      LR
  S:     1 MYIILAILAFGVLIFVHELGHFALAKINGVRVEEFSIGMGPKIFSKQGKETKYSIGLFPIGGYVSMMGEEQAVDDERSFSAKSPLR 86
>gi|154249633|ref|YP_001410458.1| putative membrane-associated zinc metalloprotease [Fervidobacterium nodosum Rt17-B1] >gi|154153569|gb|ABS60801.1| putative membrane-associated zinc metalloprotease [Fervidobacterium nodosum Rt17-B1] (495 aa)
Score = 156, Expect = 6.4e-09, Identities = 29/64 (45%), Positives = 41/64 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +I  L   M  + +HE GHF+FA+LF V V EFAIG GP+I+ K+     F IN+ P+  +VR+
  S:     7 IISFLAVFMFIVVVHEFGHFLFARLFGVKVHEFAIGFGPEIFRKKGKKTDFRINIFPLGGYVRL 70
>gi|154500378|ref|ZP_02038416.1| hypothetical protein BACCAP_04045 [Bacteroides capillosus ATCC 29799] >gi|150270883|gb|EDM98166.1| hypothetical protein BACCAP_04045 [Bacteroides capillosus ATCC 29799] (372 aa)
Score = 154, Expect = 9.8e-09, Identities = 32/70 (45%), Positives = 50/70 (71%)
  Q:     5 LLVIFILLAI-MVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKK 74
           +++++IL+AI M GL I  HE+GHFV AK   V V EFAIG+GP+I+ +Q    +++I L PI  F  ++ ++
  S:     1 MIIVYILIAILMFGLLIAVHELGHFVAAKAVGVKVNEFAIGMGPRIFHRQKGETEYTIRLFPIGGFCAMEGEE 73
>gi|118580467|ref|YP_901717.1| putative membrane-associated zinc metalloprotease [Pelobacter propionicus DSM 2379] >gi|118503177|gb|ABK99659.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Pelobacter propionicus DSM 2379] (372 aa)
Score = 154, Expect = 1.1e-08, Identities = 24/66 (36%), Positives = 48/66 (72%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + VI+ ++A+ V + +HE+GHF+FAKLF V V++F++G GPK++ +Q    ++ ++  P+  +V++
  S:     1 MTVIYAIIALGVLIFVHELGHFIFAKLFNVKVEKFSLGFGPKLFGRQIGETEYLLSAFPLGGYVKM 66
>gi|150016080|ref|YP_001308334.1| putative membrane-associated zinc metalloprotease [Clostridium beijerinckii NCIMB 8052] >gi|149902545|gb|ABR33378.1| putative membrane-associated zinc metalloprotease [Clostridium beijerinckii NCIMB 8052] (336 aa)
Score = 153, Expect = 1.1e-08, Identities = 29/66 (43%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +I  +LA  V + +HE+GHF  AKL  V V+EF+IG+GPKI+S Q    ++S+ L PI  +V++
  S:     1 MYIILAILAFGVLIIVHELGHFTLAKLNGVRVEEFSIGMGPKIFSNQGKETQYSLRLFPIGGYVKM 66
>gi|163839392|ref|YP_001623797.1| M50 family membrane endopeptidase [Renibacterium salmoninarum ATCC 33209] >gi|162952868|gb|ABY22383.1| membrane endopeptidase, M50 family [Renibacterium salmoninarum ATCC 33209] (458 aa)
Score = 153, Expect = 1.1e-08, Identities = 49/173 (28%), Positives = 81/173 (46%)
  Q:     1 VGLFLL-VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV---------RIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL 173
           V LF+L V+F+ + I+V + +HE+GH V AKLFKV V  + IG GP I+SK+    ++ I  +P   +V         ++D        G L+   +   D+                   K G+  K +T   RA  +  +   D+   F +          +P W+++II  GG   N ++
  S:     3 VLLFILGVLFVAIGIVVSIALHEVGHLVPAKLFKVRVTRYMIGFGPTIWSKKKGETEYGIKAIPAGGYVAMIGMYPPNKVDGSVRPSSTGLLQTLAESRGDKV------------------KTGRFEKLAT-EARAIAHEEVGPEDQDRVFYK----------LPVWKKIIIMLGGPAMNFVI 156
>gi|116669961|ref|YP_830894.1| peptidase M50 [Arthrobacter sp. FB24] >gi|116610070|gb|ABK02794.1| peptidase M50 [Arthrobacter sp. FB24] (443 aa)
Score = 151, Expect = 2.2e-08, Identities = 28/70 (40%), Positives = 47/70 (67%)
  Q:     1 VGLFLL-VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V LF+L V+F+ + I V + +HE+GH V AKLFKV V ++ IG GP ++SK+    ++ +  +P+  +V +
  S:     4 VILFILGVVFVAIGIAVSIALHEVGHLVPAKLFKVRVTKYMIGFGPTLWSKRRGETEYGVKAIPLGGYVSM 74
>gi|169350435|ref|ZP_02867373.1| hypothetical protein CLOSPI_01203 [Clostridium spiroforme DSM 1552] >gi|169292755|gb|EDS74888.1| hypothetical protein CLOSPI_01203 [Clostridium spiroforme DSM 1552] (359 aa)
Score = 151, Expect = 2.4e-08, Identities = 32/68 (47%), Positives = 47/68 (69%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L  +++FIL+  +V L +HE+GHFV AKLF V   EF+IG+GPK++SK+    ++ I  LPI  FV +
  S:     4 LINIIVFILILGIVVL-VHELGHFVTAKLFGVYCSEFSIGMGPKLFSKKIGETEYEIRALPIGGFVSM 70
>gi|45644747|gb|AAS73135.1| predicted membrane-associated Zn-dependent proteases 1 [uncultured marine gamma proteobacterium EBAC20E09] (449 aa)
Score = 150, Expect = 2.7e-08, Identities = 30/87 (34%), Positives = 59/87 (67%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKE 89
           +++L   +LL ++V  TIHE GHF+FA++FKV+V+ F+IG+GP  Y K   +  +F+++ +P+  +V + + K +++  E+  +  +E
  S:     5 IYILAFAVLLGVLV--TIHEFGHFIFARMFKVHVQRFSIGMGPVFYKKYDKHGTEFALSAIPLGGYVSMITNKLIELEPEISQQLTEE 90
>gi|187934318|ref|YP_001885464.1| RIP metalloprotease RseP [Clostridium botulinum B str. Eklund 17B] >gi|187722471|gb|ACD23692.1| RIP metalloprotease RseP [Clostridium botulinum B str. Eklund 17B] (339 aa)
Score = 150, Expect = 2.7e-08, Identities = 29/60 (48%), Positives = 41/60 (68%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +LA  V + +HE+GHF  AKL  V V+EFAIG+GPK++SK+     +S+ L PI  FV +
  S:    10 ILAFSVLIIVHELGHFTLAKLNGVRVEEFAIGMGPKVFSKKGKETTYSLRLFPIGGFVNM 69
>gi|188588698|ref|YP_001920611.1| RIP metalloprotease RseP [Clostridium botulinum E3 str. Alaska E43] >gi|188498979|gb|ACD52115.1| RIP metalloprotease RseP [Clostridium botulinum E3 str. Alaska E43] (342 aa)
Score = 150, Expect = 2.8e-08, Identities = 29/60 (48%), Positives = 41/60 (68%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +LA  V + +HE+GHF  AKL  V V+EFAIG+GPK++SK+     +S+ L PI  FV +
  S:    13 ILAFSVLIIVHELGHFTLAKLNGVRVEEFAIGMGPKVFSKKGKETTYSLRLFPIGGFVNM 72
>gi|119961823|ref|YP_947311.1| zinc metalloprotease [Arthrobacter aurescens TC1] >gi|119948682|gb|ABM07593.1| zinc metalloprotease [Arthrobacter aurescens TC1] (443 aa)
Score = 149, Expect = 3.7e-08, Identities = 28/70 (40%), Positives = 46/70 (65%)
  Q:     1 VGLFLL-VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V LF+L V+F+ + + V + +HE+GH V AKLFKV V ++ IG GP ++SK+    ++    LP+  +V +
  S:     4 VLLFILGVVFVAIGVAVSIALHEVGHLVPAKLFKVRVTKYMIGFGPTLWSKKKGETEYGFKALPLGGYVSM 74
>gi|34764302|ref|ZP_00145139.1| Membrane metalloprotease [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27885922|gb|EAA23261.1| Membrane metalloprotease [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (318 aa)
Score = 147, Expect = 6.2e-08, Identities = 29/63 (46%), Positives = 45/63 (71%)
  Q:     9 FILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           F++  +M+GL I  HE+GHF+ AKLFK+ V EF+IG+GP+++S    N  +S   +PI  +V I+
  S:     3 FLIAVVMLGLIIFVHELGHFLTAKLFKMPVSEFSIGMGPQVFSVDTKNTAYSFRAIPIGGYVNIE 67
>gi|15895072|ref|NP_348421.1| membrane-associated Zn-dependent protease [Clostridium acetobutylicum ATCC 824] >gi|20978827|sp|Q97I57|Y1796_CLOAB Putative zinc metalloprotease CA_C1796 >gi|15024768|gb|AAK79761.1|AE007688_10 Predicted membrane-associated Zn-dependent protease [Clostridium acetobutylicum ATCC 824] (339 aa)
Score = 147, Expect = 6.6e-08, Identities = 33/72 (45%), Positives = 47/72 (65%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI--DSKKS 75
           F  ++  +LA  V + IHE+GHFV AKL  V V+EFAIG+GPK+   +    ++SI  LPI  +V++  D  KS
  S:     3 FFNIVIAILAFGVLILIHELGHFVLAKLNDVKVEEFAIGMGPKLLGIKGKETQYSIRALPIGGYVKMLGDESKS 76
>gi|191163088|ref|ZP_03024965.1| membrane-associated zinc metalloprotease [Geobacter sp. M21] >gi|190995871|gb|EDV71322.1| membrane-associated zinc metalloprotease [Geobacter sp. M21] (354 aa)
Score = 146, Expect = 8.7e-08, Identities = 24/64 (37%), Positives = 45/64 (70%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++F ++A+   +  HE+GHF+FAK F V V++F++G GPKIY K+    ++ ++ LP+  +V++
  S:     3 ILFAIIALGALIFFHELGHFLFAKAFGVGVEKFSLGFGPKIYGKKVGETEYLLSALPLGGYVKM 66
>gi|116491011|ref|YP_810555.1| peptidase RseP [Oenococcus oeni PSU-1] >gi|116091736|gb|ABJ56890.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Oenococcus oeni PSU-1] (421 aa)
Score = 146, Expect = 9.1e-08, Identities = 63/188 (33%), Positives = 97/188 (51%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI-DSKKSLQVFGELRDEYQKEADEYYLQHK-EILDGCEKYITIEKNGQLRKQSTWHVRAKYN---SYLKKIDKYANFSRKIDGTL------IIDEVPK---------WQQLIIYFGGIFFNLIL-FGLFY-----LIQVTALNNNSNP 191
           F  +I  ++   V +TIHE GHF  AK F V V EF+IG+GPKI+        + I +LP+  +V +  + +  +   ELR     +  ++  QH    +D  E  IT   N QL + S   +  K +      ++  +   F    D  +      II   PK         W+Q+++ F G F N +L F LF+     LI+V   N+  NP
  S:     3 FASIIAFIIVFGVIVTIHEFGHFFVAKKFGVVVYEFSIGMGPKIFGTNKNGTNYVIRILPVGGYVLMAGADQDNEYLNELRPGKVVKI-KFANQHTVNFIDISEDPIT--ANEQLMRISAIDINDKLSIKGVIDEETKRELQFELAPDTKVRAGEDRIIQIAPKDRQLPNISLWKQILVSFAGPFMNFVLAFVLFFALAFSLIKVPVSNSQINP 213
>gi|169342690|ref|ZP_02863731.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens C str. JGS1495] >gi|169299196|gb|EDS81266.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens C str. JGS1495] (335 aa)
Score = 145, Expect = 1.1e-07, Identities = 26/66 (39%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +IF LLA    + +HE+GHF+ AKL  + V+EFAIG+GPK++  +    ++++ +LP   FV++
  S:     1 MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPFGGFVKM 66
>gi|18310675|ref|NP_562609.1| hypothetical protein CPE1693 [Clostridium perfringens str. 13] >gi|168208110|ref|ZP_02634115.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens E str. JGS1987] >gi|168214474|ref|ZP_02640099.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens CPE str. F4969] >gi|182627142|ref|ZP_02954857.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens D str. JGS1721] >gi|20978812|sp|Q8XJR2|Y1693_CLOPE Putative zinc metalloprotease CPE1693 >gi|18145356|dbj|BAB81399.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|170660604|gb|EDT13287.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens E str. JGS1987] >gi|170714027|gb|EDT26209.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens CPE str. F4969] >gi|177907479|gb|EDT70145.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens D str. JGS1721] (335 aa)
Score = 145, Expect = 1.1e-07, Identities = 26/66 (39%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +IF LLA    + +HE+GHF+ AKL  + V+EFAIG+GPK++  +    ++++ +LP   FV++
  S:     1 MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPFGGFVKM 66
>gi|110801002|ref|YP_696380.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens ATCC 13124] >gi|168211419|ref|ZP_02637044.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens B str. ATCC 3626] >gi|110675649|gb|ABG84636.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens ATCC 13124] >gi|170710590|gb|EDT22772.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens B str. ATCC 3626] (335 aa)
Score = 145, Expect = 1.1e-07, Identities = 26/66 (39%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +IF LLA    + +HE+GHF+ AKL  + V+EFAIG+GPK++  +    ++++ +LP   FV++
  S:     1 MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPFGGFVKM 66
>gi|168216980|ref|ZP_02642605.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens NCTC 8239] >gi|182380975|gb|EDT78454.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens NCTC 8239] (335 aa)
Score = 145, Expect = 1.1e-07, Identities = 26/66 (39%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +IF LLA    + +HE+GHF+ AKL  + V+EFAIG+GPK++  +    ++++ +LP   FV++
  S:     1 MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPFGGFVKM 66
>gi|126699746|ref|YP_001088643.1| putative membrane-associated protease [Clostridium difficile 630] >gi|168715717|ref|ZP_02747994.1| putative membrane-associated protease [Clostridium difficile QCD-63q42] >gi|196124030|ref|ZP_03115779.1| putative membrane-associated protease [Clostridium difficile ATCC 43255] >gi|115251183|emb|CAJ69014.1| putative membrane-associated protease [Clostridium difficile 630] (334 aa)
Score = 145, Expect = 1.2e-07, Identities = 31/74 (41%), Positives = 49/74 (66%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQV 78
           ++   IL +I+V   IHE+GHF+FAK   + V EF+IG+GPKIYS +  + ++SI  LPI  +V ++ +   Q+
  S:     3 IIAALILFSIIV--LIHELGHFIFAKRSGIKVNEFSIGMGPKIYSVK-KDTEYSIRALPIGGYVSMEGEDEEQI 73
>gi|167756905|ref|ZP_02429032.1| hypothetical protein CLORAM_02454 [Clostridium ramosum DSM 1402] >gi|167703080|gb|EDS17659.1| hypothetical protein CLORAM_02454 [Clostridium ramosum DSM 1402] (359 aa)
Score = 145, Expect = 1.2e-07, Identities = 32/68 (47%), Positives = 46/68 (67%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L  +V+FIL+  +V L IHE+GHF+ AK F V   EF+IG+GPKI+S++    ++ I  LPI  FV +
  S:     4 LINIVVFILILGIVVL-IHELGHFITAKSFGVYCSEFSIGMGPKIFSRKKGETEYEIRALPIGGFVSM 70
>gi|110803066|ref|YP_698980.1| membrane-associated zinc metalloprotease, putative [Clostridium perfringens SM101] >gi|110683567|gb|ABG86937.1| membrane-associated zinc metalloprotease, putative [Clostridium perfringens SM101] (335 aa)
Score = 145, Expect = 1.2e-07, Identities = 26/66 (39%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +IF LLA    + +HE+GHF+ AKL  + V+EFAIG+GPK++  +    ++++ +LP   FV++
  S:     1 MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPFGGFVKM 66
>gi|196165381|ref|ZP_03125912.1| putative membrane-associated protease [Clostridium difficile QCD-23m63] (334 aa)
Score = 145, Expect = 1.2e-07, Identities = 31/74 (41%), Positives = 49/74 (66%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQV 78
           ++   IL +I+V   IHE+GHF+FAK   + V EF+IG+GPKIYS +  + ++SI  LPI  +V ++ +   Q+
  S:     3 IIAALILFSIIV--LIHELGHFIFAKRSGIKVNEFSIGMGPKIYSVK-KDTEYSIRALPIGGYVSMEGEDEEQI 73
>gi|145954159|ref|ZP_01803166.1| hypothetical protein CdifQ_04002465 [Clostridium difficile QCD-32g58] >gi|168694296|ref|ZP_02726573.1| putative membrane-associated protease [Clostridium difficile QCD-37x79] >gi|168725638|ref|ZP_02757915.1| putative membrane-associated protease [Clostridium difficile QCD-76w55] >gi|168730673|ref|ZP_02762950.1| putative membrane-associated protease [Clostridium difficile QCD-97b34] >gi|196160704|ref|ZP_03121265.1| putative membrane-associated protease [Clostridium difficile CIP 107932] (334 aa)
Score = 145, Expect = 1.2e-07, Identities = 31/74 (41%), Positives = 49/74 (66%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQV 78
           ++   IL +I+V   IHE+GHF+FAK   + V EF+IG+GPKIYS +  + ++SI  LPI  +V ++ +   Q+
  S:     3 IIAALILFSIIV--LIHELGHFIFAKRSGIKVNEFSIGMGPKIYSVK-KDTEYSIRALPIGGYVSMEGEDEEQI 73
>gi|166031000|ref|ZP_02233829.1| hypothetical protein DORFOR_00681 [Dorea formicigenerans ATCC 27755] >gi|166029267|gb|EDR48024.1| hypothetical protein DORFOR_00681 [Dorea formicigenerans ATCC 27755] (343 aa)
Score = 144, Expect = 1.3e-07, Identities = 26/61 (42%), Positives = 42/61 (68%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAF 67
           +IF +L     +  HE+GHF  AKL  ++V+EFAIG+GP ++SK++    ++++LLPI  F
  S:     3 IIFAILIFSFIVFFHELGHFTLAKLNGIDVQEFAIGMGPTLFSKEYKGTVYAVHLLPIGGF 63
>gi|158313021|ref|YP_001505529.1| peptidase M50 [Frankia sp. EAN1pec] >gi|158108426|gb|ABW10623.1| peptidase M50 [Frankia sp. EAN1pec] (393 aa)
Score = 144, Expect = 1.5e-07, Identities = 26/73 (35%), Positives = 43/73 (58%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           L ++  +LA+ V + +HE GHFV A+ F +    F +G GP ++SKQ    ++ I  +P   FV+I+   SL+
  S:     4 LGIVAFVLALFVSVVLHEAGHFVTARYFGMKASRFFVGFGPTLWSKQRGETEYGIKAIPAGGFVKIEGMTSLE 76
>gi|169178185|ref|ZP_02839619.1| peptidase M50 [Arthrobacter chlorophenolicus A6] >gi|169013956|gb|EDS60538.1| peptidase M50 [Arthrobacter chlorophenolicus A6] (417 aa)
Score = 144, Expect = 1.5e-07, Identities = 26/70 (37%), Positives = 46/70 (65%)
  Q:     1 VGLFLL-VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V LF+L V+F+ + I   + +HE+GH V AKLFKV V ++ IG GP ++S++    ++ +  +P+  +V +
  S:     4 VLLFILGVVFVAIGIAASIALHEVGHLVPAKLFKVRVTKYMIGFGPTLWSRRKGETEYGVKAIPLGGYVSM 74
>gi|145618639|ref|ZP_01774696.1| putative membrane-associated zinc metalloprotease [Geobacter bemidjiensis Bem] >gi|144945017|gb|EDJ80085.1| putative membrane-associated zinc metalloprotease [Geobacter bemidjiensis Bem] >gi|197088482|gb|ACH39753.1| membrane-associated zinc metalloprotease [Geobacter bemidjiensis Bem] (354 aa)
Score = 144, Expect = 1.6e-07, Identities = 23/64 (35%), Positives = 45/64 (70%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++F ++A+   +  HE+GHF+FAK F V V++F++G GPKIY ++    ++ ++ LP+  +V++
  S:     3 ILFAIIALGALIFFHELGHFLFAKAFGVGVEKFSLGFGPKIYGRKIGETEYLLSALPLGGYVKM 66
>gi|169827161|ref|YP_001697319.1| putative zinc metalloprotease Lmo1318 [Lysinibacillus sphaericus C3-41] >gi|168991649|gb|ACA39189.1| Putative zinc metalloprotease Lmo1318 [Lysinibacillus sphaericus C3-41] (420 aa)
Score = 144, Expect = 1.6e-07, Identities = 29/61 (47%), Positives = 42/61 (68%)
  Q:    10 ILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I   ++ GL +  HE+GHF+FAK   + V+EFAIG+GPKIY +      ++I LLPI  +VR+
  S:     5 IAFILIFGLLVFFHELGHFLFAKRAGILVREFAIGMGPKIYGRTHGETMYTIRLLPIGGYVRM 67
>gi|169191238|ref|ZP_02851104.1| membrane-associated zinc metalloprotease [Paenibacillus sp. JDR-2] >gi|169002152|gb|EDS49049.1| membrane-associated zinc metalloprotease [Paenibacillus sp. JDR-2] (421 aa)
Score = 143, Expect = 1.6e-07, Identities = 30/64 (46%), Positives = 44/64 (68%)
  Q:     7 VIFI-LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           VIF+ +L   V +TIHE GH+ FAK   + V+EFAIG GPK++S +    +F++ L+P   FVR+
  S:     6 VIFMTVLVFFVIVTIHEWGHYFFAKRAGILVREFAIGFGPKLFSIKRGETRFTLRLVPAGGFVRM 70
>gi|160947399|ref|ZP_02094566.1| hypothetical protein PEPMIC_01333 [Peptostreptococcus micros ATCC 33270] >gi|158446533|gb|EDP23528.1| hypothetical protein PEPMIC_01333 [Peptostreptococcus micros ATCC 33270] (343 aa)
Score = 143, Expect = 1.7e-07, Identities = 29/65 (44%), Positives = 43/65 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAF 67
           + + +I  LL  MV + +HE GHF+FAK  K+ V EF++G+GPKI+ KQ  +  +SI  LP+  F
  S:     1 MIIKIIIALLVFMVVVVVHEFGHFIFAKRAKIKVNEFSVGMGPKIFGKQRGDTLYSIRALPLGGF 65
>gi|160944140|ref|ZP_02091370.1| hypothetical protein FAEPRAM212_01642 [Faecalibacterium prausnitzii M21/2] >gi|158444816|gb|EDP21820.1| hypothetical protein FAEPRAM212_01642 [Faecalibacterium prausnitzii M21/2] (370 aa)
Score = 143, Expect = 1.8e-07, Identities = 28/70 (40%), Positives = 46/70 (65%)
  Q:     6 LVIFILLAIMVG---LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKS 75
            +I IL A++V    + IHE GHF+ AKL  + V EF+IG+GP ++ K     ++S+  LP+  FV ++ ++S
  S:     3 FIITILAALLVFSAVIAIHEFGHFIVAKLCGIQVNEFSIGMGPVLWKKNHKGTQYSLRALPVGGFVALEGEES 75
>gi|28572265|ref|NP_789045.1| metalloprotease [Tropheryma whipplei TW08/27] >gi|28410396|emb|CAD66782.1| putative metalloprotease [Tropheryma whipplei TW08/27] (374 aa)
Score = 143, Expect = 1.9e-07, Identities = 26/69 (37%), Positives = 46/69 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
            FL V+ IL+ + + + +HE+GH + AK F V V+++AIG GP ++S +     +S NLLP+  +V+++
  S:     2 FFLGVLIILIFVYIAVALHELGHMLPAKYFGVPVQKYAIGFGPSLFSFKKRETSYSFNLLPLGGYVQLE 70
>gi|126654117|ref|ZP_01725935.1| membrane-associated zinc metalloprotease, putative [Bacillus sp. B14905] >gi|126589397|gb|EAZ83547.1| membrane-associated zinc metalloprotease, putative [Bacillus sp. B14905] (420 aa)
Score = 142, Expect = 2.2e-07, Identities = 28/61 (45%), Positives = 42/61 (68%)
  Q:    10 ILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I   ++ GL +  HE+GHF+FAK   + V+EFAIG+GPKIY +      +++ LLPI  +VR+
  S:     5 IAFILIFGLLVFFHELGHFLFAKRAGILVREFAIGMGPKIYGRTHGETMYTVRLLPIGGYVRM 67
>gi|28493055|ref|NP_787216.1| membrane-associated Zn-dependent protease-like protein [Tropheryma whipplei str. Twist] >gi|28476095|gb|AAO44185.1| membrane-associated Zn-dependent protease-like protein [Tropheryma whipplei str. Twist] (375 aa)
Score = 142, Expect = 2.3e-07, Identities = 26/69 (37%), Positives = 46/69 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
            FL V+ IL+ + + + +HE+GH + AK F V V+++AIG GP ++S +     +S NLLP+  +V+++
  S:     3 FFLGVLIILVFVYIAVALHELGHMLPAKYFGVPVQKYAIGFGPSLFSFKKRETSYSFNLLPLGGYVQLE 71
>gi|116495062|ref|YP_806796.1| membrane-associated Zn-dependent protease 1 [Lactobacillus casei ATCC 334] >gi|191638565|ref|YP_001987731.1| Probable protease eep [Lactobacillus casei] >gi|116105212|gb|ABJ70354.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Lactobacillus casei ATCC 334] >gi|190712867|emb|CAQ66873.1| Probable protease eep [Lactobacillus casei BL23] (413 aa)
Score = 142, Expect = 2.3e-07, Identities = 57/184 (30%), Positives = 93/184 (50%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYY--LQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKK--IDKYANFSRKI--------DGTLIIDE---------------VPKWQQLIIYFGGIFFN-------LILFGLFYLIQVTALNNN 188
            +VIF +L +     +HE GHF FAK   + V+EF+IG+GPK+++    N  +++ LLP+  +VR+               +Q E DE         IL+   K + I  + +        V+      +K   I+ Y N             D T+I ++                P W++L++ F G   N        I++GLF+ +QV  LN N
  S:     7 FIVIFCILVV-----VHEFGHFYFAKRSGILVREFSIGMGPKLWASHKNNTTYTLRLLPLGGYVRMAG-------------WQDEEDEIKPGTMLSLILNDQGKVVRINASDKTTLAGGMPVQVSRVDLVKDLVIEGYPNGDETALQTWQVDHDATIIEEDGTEVQIAPEDVQFQNAPVWRRLLVNFAGPMNNFLLAILAFIIYGLFFGVQV--LNTN 204
>gi|168187914|ref|ZP_02622549.1| RIP metalloprotease RseP [Clostridium botulinum C str. Eklund] >gi|169294243|gb|EDS76376.1| RIP metalloprotease RseP [Clostridium botulinum C str. Eklund] (345 aa)
Score = 142, Expect = 2.6e-07, Identities = 34/101 (33%), Positives = 55/101 (54%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           + + L VIF++++  + + IHE GHF  AKL  V V+EFAIG+GPK++  +     ++  ++PI  +V++         GE  DE     DE    +K  L
  S:     1 MNILLNVIFVIVSFSILIIIHEFGHFALAKLNGVKVEEFAIGMGPKLFGIRGKETLYAFRVIPIGGYVKM--------LGEGEDEEVPVDDERSFSNKSPL 93
>gi|148323020|gb|EDK88270.1| M50A family metalloprotease [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (339 aa)
Score = 142, Expect = 2.6e-07, Identities = 28/63 (44%), Positives = 44/63 (69%)
  Q:     9 FILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           F++  +M+GL I  HE+GHF+ AKLFK+ V EF+IG+GP+++S       +S   +PI  +V I+
  S:     3 FLIAVVMLGLIIFVHELGHFLTAKLFKMPVSEFSIGMGPQVFSVDTNKTAYSFRAIPIGGYVNIE 67
>gi|167759669|ref|ZP_02431796.1| hypothetical protein CLOSCI_02028 [Clostridium scindens ATCC 35704] >gi|167662700|gb|EDS06830.1| hypothetical protein CLOSCI_02028 [Clostridium scindens ATCC 35704] (343 aa)
Score = 141, Expect = 2.9e-07, Identities = 28/58 (48%), Positives = 44/58 (75%)
  Q:    10 ILLAIMVGLTI---HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAF 67
           I+LAI++   I   HE+GHFV AK   ++V+EFAIG+GP +YS+++   K+++ +LPI  F
  S:     3 IILAILIFSFIVFFHELGHFVLAKKNGIDVEEFAIGMGPLLYSREYKGTKYAVRILPIGGF 63
>gi|188996823|ref|YP_001931074.1| membrane-associated zinc metalloprotease [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931890|gb|ACD66520.1| membrane-associated zinc metalloprotease [Sulfurihydrogenibium sp. YO3AOP1] (439 aa)
Score = 141, Expect = 3.3e-07, Identities = 30/90 (33%), Positives = 55/90 (61%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ--VFGELRDEYQKEADEYY 94
           +L   I+L +++  TIHE GHF+FA++F V V+ F+IG GP I+  +    ++ I L+P+  +V++  + S+   V GE+  E   +   ++
  S:     3 ILAFLIMLGVLI--TIHEFGHFLFARMFGVKVETFSIGFGPPIFRWKGKETEYQIALIPLGGYVKMYGEDSMTEPVQGEVNKEAYNDPRSFH 92
>gi|19704657|ref|NP_604219.1| membrane metalloprotease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|20978806|sp|P58819|Y1322_FUSNN Putative zinc metalloprotease FN1322 >gi|19714963|gb|AAL95518.1| Membrane metalloprotease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (339 aa)
Score = 141, Expect = 3.4e-07, Identities = 28/63 (44%), Positives = 44/63 (69%)
  Q:     9 FILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           F++  +M+GL I  HE+GHF+ AKLFK+ V EF+IG+GP+++S       +S   +PI  +V I+
  S:     3 FLIAVVMLGLIIFVHELGHFLTAKLFKMPVSEFSIGMGPQVFSVDTKKTTYSFRAIPIGGYVNIE 67
>gi|69246858|ref|ZP_00604150.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Enterococcus faecium DO] >gi|68195039|gb|EAN09502.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Enterococcus faecium DO] (422 aa)
Score = 140, Expect = 3.9e-07, Identities = 30/66 (45%), Positives = 43/66 (65%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           +L   I+  I+V   +HE GHF FAK   + V+EFAIG+GPKIY  Q  +   +++ LLPI  +VR+
  S:     4 ILTFIIVFGILV--IVHEFGHFFFAKRSGILVREFAIGMGPKIYGHQAKDGTTYTLRLLPIGGYVRM 68
>gi|134102437|ref|YP_001108098.1| PDZ/DHR/GLGF [Saccharopolyspora erythraea NRRL 2338] >gi|133915060|emb|CAM05173.1| PDZ/DHR/GLGF [Saccharopolyspora erythraea NRRL 2338] (427 aa)
Score = 140, Expect = 4.3e-07, Identities = 44/169 (26%), Positives = 78/169 (46%)
  Q:     5 LLVIFILLAIMVGLTI----HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHV-----RAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL 173
           +LV+  +L   VGL +    HE+GH ++AKLF V V ++ +G G  I+S++    ++ + L+P+  ++R+     + +F   +DE      EY                    G+    S W       R      ++  D +  F ++            W+++I+ FGG F NLIL
  S:     1 MLVVLGILIFFVGLLLSIAWHELGHLMWAKLFGVKVTQYMVGFGRTIWSRKKGETEYGLKLIPLGGYIRM-----IGMFPPKKDE------EY--------------------GRTASSSPWRTMIEDARQAVAEEVRPEDAHRQFYQR----------KPWKRVIVMFGGPFMNLIL 137
>gi|153954049|ref|YP_001394814.1| protease [Clostridium kluyveri DSM 555] >gi|146346930|gb|EDK33466.1| Predicted protease [Clostridium kluyveri DSM 555] (336 aa)
Score = 140, Expect = 4.5e-07, Identities = 27/66 (40%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +I  ++A  V + IHE+GHF+ AKL  V V+EF+IG+GPK++  +    ++ I LLPI  +V++
  S:     1 MYIILAIIAFGVLIIIHELGHFILAKLNGVKVEEFSIGMGPKLFGIKGKETEYLIKLLPIGGYVKM 66
>gi|160903369|ref|YP_001568950.1| membrane-associated zinc metalloprotease [Petrotoga mobilis SJ95] >gi|160361013|gb|ABX32627.1| membrane-associated zinc metalloprotease [Petrotoga mobilis SJ95] (507 aa)
Score = 139, Expect = 4.7e-07, Identities = 28/75 (37%), Positives = 48/75 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           + L +I+ L+ I V + +HE GHF+FAK+FK  V+EF+IG GP ++        F  N++P+  +VR+  ++ L+
  S:     3 VLLSIIWFLIIISVIVVVHEFGHFIFAKIFKTRVEEFSIGFGPALFKIPGKETTFRFNIIPLGGYVRLAGEEVLE 77
>gi|118443163|ref|YP_878215.1| membrane-associated zinc metalloprotease, putative [Clostridium novyi NT] >gi|118133619|gb|ABK60663.1| membrane-associated zinc metalloprotease, putative [Clostridium novyi NT] (345 aa)
Score = 139, Expect = 4.9e-07, Identities = 27/70 (38%), Positives = 45/70 (64%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + + L +IF++LA    + IHE GHF  AKL  V V+EFAIG+GPK++  +     ++  ++PI  +V++
  S:     1 MNVLLNIIFVILAFSALVIIHEFGHFALAKLNGVKVEEFAIGMGPKLFGIKGKETLYAFRIIPIGGYVKM 70
>gi|148265746|ref|YP_001232452.1| putative membrane-associated zinc metalloprotease [Geobacter uraniireducens Rf4] >gi|146399246|gb|ABQ27879.1| putative membrane-associated zinc metalloprotease [Geobacter uraniireducens Rf4] (355 aa)
Score = 139, Expect = 5.6e-07, Identities = 25/66 (37%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L +I  ++A+   + IHE+GHF+FAKLF V V++F++G GPKI  K+    ++ ++  P+  +V++
  S:     2 LSIISAIIALGALIFIHELGHFIFAKLFGVGVEKFSLGFGPKIVGKKVGETEYLLSAFPLGGYVKM 67
>gi|89098603|ref|ZP_01171485.1| hypothetical protein B14911_00400 [Bacillus sp. NRRL B-14911] >gi|89086565|gb|EAR65684.1| hypothetical protein B14911_00400 [Bacillus sp. NRRL B-14911] (425 aa)
Score = 138, Expect = 6.1e-07, Identities = 26/50 (52%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GHFVFAK   +  +EFAIG GPK++S +     ++I LLPI  FVR+
  S:    18 HELGHFVFAKRAGILCREFAIGFGPKVFSHKKGETVYTIRLLPIGGFVRM 67
>gi|29840204|ref|NP_829310.1| zinc protease [Chlamydophila caviae GPIC] >gi|29834552|gb|AAP05188.1| zinc protease [Chlamydophila caviae GPIC] (622 aa)
Score = 138, Expect = 6.7e-07, Identities = 26/65 (40%), Positives = 43/65 (66%)
  Q:     6 LVIFILLAIMVGLT--IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++ FIL A+ +G+   IHE+GH + AK   + V+ F+IG GP +Y K+  NI++ + + P   +VRI
  S:     3 IIYFILAALALGVLVLIHELGHLLAAKSVGMTVESFSIGFGPALYKKKIRNIEYRVGVFPFGGYVRI 69
>gi|194335258|ref|YP_002017052.1| membrane-associated zinc metalloprotease [Pelodictyon phaeoclathratiforme BU-1] >gi|194307735|gb|ACF42435.1| membrane-associated zinc metalloprotease [Pelodictyon phaeoclathratiforme BU-1] (453 aa)
Score = 138, Expect = 7.4e-07, Identities = 50/196 (25%), Positives = 83/196 (42%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIG---PKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL-----FGLFYLIQVTALNNNSNPFIQIGDSFLTI 202
           V F ++AI + +T HE+GHF+ AKLF + V +F IG      +I+ K+    ++ I + P+  +V+I           + DE                       +++ N Q      W  RAK                           P WQ+LI+  GG+  NLIL     FG+ +++     + N+  F++ G  F T+
  S:     7 VFFFIVAIFILVTAHELGHFLTAKLFGMRVDKFYIGFDFWEKRIWRKKIGETEYGIGVFPLGGYVKI---------AGMVDE-----------------------SLDTNFQGSDPQPWEFRAK---------------------------PVWQRLIVLAGGVTMNLILAAVIFFGITFVLGEARTSVNTPAFVEKGSVFETM 151
>gi|189425771|ref|YP_001952948.1| membrane-associated zinc metalloprotease [Geobacter lovleyi SZ] >gi|189422030|gb|ACD96428.1| membrane-associated zinc metalloprotease [Geobacter lovleyi SZ] (376 aa)
Score = 138, Expect = 7.6e-07, Identities = 23/86 (26%), Positives = 52/86 (60%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEA 90
           ++V+  ++ + + + +HE+GHF+ AK   V V++F++G GPK++ +Q    ++ I+  P+  +V++  +        +  EY++EA
  S:     1 MIVVNFIIVLGILIFVHELGHFLVAKWMGVKVEKFSLGFGPKLFGRQIGETEYLISAFPLGGYVKMFGEGGFSEIEMIEQEYEREA 86
>gi|117928730|ref|YP_873281.1| peptidase M50 [Acidothermus cellulolyticus 11B] >gi|117649193|gb|ABK53295.1| peptidase M50 [Acidothermus cellulolyticus 11B] (413 aa)
Score = 137, Expect = 8.6e-07, Identities = 22/68 (32%), Positives = 43/68 (63%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + L +I  ++A+++ + +HE GHF FA+LF +   +F +G GP ++S++    ++ I  +P   FV+I
  S:     2 MVLGIIAFVVALLISVLLHEAGHFAFARLFGMKATQFFVGFGPTLWSRKKGETEYGIKAIPAGGFVKI 69
>gi|160880753|ref|YP_001559721.1| membrane-associated zinc metalloprotease [Clostridium phytofermentans ISDg] >gi|160429419|gb|ABX42982.1| membrane-associated zinc metalloprotease [Clostridium phytofermentans ISDg] (430 aa)
Score = 137, Expect = 8.7e-07, Identities = 26/58 (44%), Positives = 41/58 (70%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPI 64
           +I  LL   V +T HE+GHF+ AK   + V EF+IG+GP+++SK + + ++S+ LLPI
  S:     3 IIVALLIFGVIITFHELGHFLLAKKNGIVVTEFSIGMGPRLFSKVYHDTRYSLKLLPI 60
>gi|62185057|ref|YP_219842.1| putative metalloprotease [Chlamydophila abortus S26/3] >gi|62148124|emb|CAH63881.1| putative metalloprotease [Chlamydophila abortus S26/3] (622 aa)
Score = 137, Expect = 9.6e-07, Identities = 26/65 (40%), Positives = 43/65 (66%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++ FIL A+ +G+ +  HE+GH + AK   + V+ F+IG GP +Y K+  NI++ I + P   +VRI
  S:     3 IIYFILAALALGVLVLVHELGHLLAAKSVGMAVESFSIGFGPTLYKKKIGNIEYRIGIFPFGGYVRI 69
>gi|119717427|ref|YP_924392.1| peptidase M50 [Nocardioides sp. JS614] >gi|119538088|gb|ABL82705.1| peptidase M50 [Nocardioides sp. JS614] (453 aa)
Score = 137, Expect = 9.7e-07, Identities = 46/178 (25%), Positives = 85/178 (47%)
  Q:     3 LFLL--VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL-FGLFYLI 180
           LF L  V+  ++AI+V + +HE+GH + AK F   V ++ IG GP ++SK+    ++ +  +P+  +V+I         G L    ++ ADE  +      DG +     + N  +  Q     RA     ++  D    F +          +P W+++++  GG   NL++ F +F+ I
  S:     4 LFYLLGVVIFVVAILVSIGLHELGHMIPAKRFGGKVTQYFIGFGPTVWSKRVGETEWGVKAIPLGGYVKI--------VGMLPPGAEEIADEVTVD----ADGNQVVRVRKSNTGMFTQLISDARAAEWETIRPEDSERLFYK----------MPWWKKVVVMAGGPTVNLLIAFTIFWGI 162
>gi|153202159|ref|ZP_01943788.1| hypothetical protein LMSG_00642 [Listeria monocytogenes HPB2262] >gi|133735442|gb|EBA37140.1| hypothetical protein LMSG_00642 [Listeria monocytogenes HPB2262] (420 aa)
Score = 137, Expect = 1.0e-06, Identities = 35/106 (33%), Positives = 62/106 (58%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQK--EADEYYLQHKEILDGCEKYITIE 111
           +   I    + GL +  HE+GHF+FAK   + VK+F+IG GPKI++ +    +++I LLPI  +VR+  +   ++  EL+  Y+   E        K I++G ++Y+  +
  S:     1 MTTIIAFIFVFGLIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKETQYTIRLLPIGGYVRMAGEDGEEI--ELKPGYRVGLELTPEETVSKIIVNGKDQYVNAQ 108
>gi|47093942|ref|ZP_00231679.1| membrane-associated zinc metalloprotease, putative [Listeria monocytogenes str. 4b H7858] >gi|167453946|ref|ZP_02320169.1| hypothetical protein LmonocytoFSL_09135 [Listeria monocytogenes FSL J2-064] >gi|47017680|gb|EAL08476.1| membrane-associated zinc metalloprotease, putative [Listeria monocytogenes str. 4b H7858] (420 aa)
Score = 136, Expect = 1.0e-06, Identities = 35/106 (33%), Positives = 62/106 (58%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQK--EADEYYLQHKEILDGCEKYITIE 111
           +   I    + GL +  HE+GHF+FAK   + VK+F+IG GPKI++ +    +++I LLPI  +VR+  +   ++  EL+  Y+   E        K I++G ++Y+  +
  S:     1 MTTIIAFIFVFGLIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKETQYTIRLLPIGGYVRMAGEDGEEI--ELKPGYRVGLELTPEETVSKIIVNGKDQYVNAQ 108
>gi|46907544|ref|YP_013933.1| membrane-associated zinc metalloprotease, putative [Listeria monocytogenes str. 4b F2365] >gi|46880812|gb|AAT04110.1| putative membrane-associated zinc metalloprotease [Listeria monocytogenes str. 4b F2365] (420 aa)
Score = 136, Expect = 1.0e-06, Identities = 35/106 (33%), Positives = 62/106 (58%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQK--EADEYYLQHKEILDGCEKYITIE 111
           +   I    + GL +  HE+GHF+FAK   + VK+F+IG GPKI++ +    +++I LLPI  +VR+  +   ++  EL+  Y+   E        K I++G ++Y+  +
  S:     1 MTTIIAFIFVFGLIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKETQYTIRLLPIGGYVRMAGEDGEEI--ELKPGYRVGLELTPEETVSKIIVNGKDQYVNAQ 108
>gi|16803358|ref|NP_464843.1| hypothetical protein lmo1318 [Listeria monocytogenes EGD-e] >gi|47096943|ref|ZP_00234520.1| membrane-associated zinc metalloprotease, putative [Listeria monocytogenes str. 1/2a F6854] >gi|153179389|ref|ZP_01932608.1| hypothetical protein LMMG_00281 [Listeria monocytogenes F6900] >gi|153183681|ref|ZP_01934498.1| hypothetical protein LMOG_00368 [Listeria monocytogenes J0161] >gi|153190721|ref|ZP_01938084.1| hypothetical protein LMPG_00853 [Listeria monocytogenes J2818] >gi|20978814|sp|Q8Y7G3|Y1318_LISMO Putative zinc metalloprotease Lmo1318 >gi|16410734|emb|CAC99396.1| lmo1318 [Listeria monocytogenes] >gi|47014703|gb|EAL05659.1| membrane-associated zinc metalloprotease, putative [Listeria monocytogenes str. 1/2a F6854] >gi|126943333|gb|EBA21054.1| hypothetical protein LMOG_00368 [Listeria monocytogenes J0161] >gi|127765705|gb|EBA26050.1| hypothetical protein LMPG_00853 [Listeria monocytogenes J2818] >gi|133732874|gb|EBA34572.1| hypothetical protein LMMG_00281 [Listeria monocytogenes F6900] (420 aa)
Score = 136, Expect = 1.0e-06, Identities = 35/106 (33%), Positives = 62/106 (58%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQK--EADEYYLQHKEILDGCEKYITIE 111
           +   I    + GL +  HE+GHF+FAK   + VK+F+IG GPKI++ +    +++I LLPI  +VR+  +   ++  EL+  Y+   E        K I++G ++Y+  +
  S:     1 MTTIIAFIFVFGLIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKETQYTIRLLPIGGYVRMAGEDGEEI--ELKPGYRVGLELTPEETVSKIIVNGKDQYVNAQ 108
>gi|114566425|ref|YP_753579.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337360|gb|ABI68208.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (343 aa)
Score = 136, Expect = 1.1e-06, Identities = 27/64 (42%), Positives = 41/64 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++  LL I V +  HE GHFV A+   + V EFAIG GPK++S +   + +S+ L+P+  FVR+
  S:     4 ILITLLIIAVLILAHEWGHFVVARRIGIPVYEFAIGFGPKVFSWKRNGVIYSLRLIPLGGFVRM 67
>gi|16800423|ref|NP_470691.1| hypothetical protein lin1355 [Listeria innocua Clip11262] >gi|20978824|sp|Q92C36|Y1355_LISIN Putative zinc metalloprotease Lin1355 >gi|16413828|emb|CAC96586.1| lin1355 [Listeria innocua] (420 aa)
Score = 136, Expect = 1.1e-06, Identities = 35/106 (33%), Positives = 62/106 (58%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQK--EADEYYLQHKEILDGCEKYITIE 111
           +   I    + GL +  HE+GHF+FAK   + VK+F+IG GPKI++ +    +++I LLPI  +VR+  +   ++  EL+  Y+   E        K I++G ++Y+  +
  S:     1 MTTIIAFIFVFGLIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKETQYTIRLLPIGGYVRMAGEDGEEI--ELKPGYRVGLELTPEETVSKIIVNGKDQYVNAQ 108
>gi|89898372|ref|YP_515482.1| membrane-associated Zn-dependent proteases [Chlamydophila felis Fe/C-56] >gi|89331744|dbj|BAE81337.1| membrane-associated Zn-dependent proteases [Chlamydophila felis Fe/C-56] (620 aa)
Score = 136, Expect = 1.2e-06, Identities = 27/65 (41%), Positives = 42/65 (64%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +V FIL A+ +G+ +  HE+GH + AK   + V  F+IG GP +Y K+  NI++ I + P   +VRI
  S:     3 IVYFILAALALGVLVLVHELGHLLAAKSVGMAVDSFSIGFGPALYKKKIGNIEYRIGIFPFGGYVRI 69
>gi|116872749|ref|YP_849530.1| membrane-associated zinc metalloprotease, putative [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741627|emb|CAK20751.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (420 aa)
Score = 136, Expect = 1.3e-06, Identities = 35/106 (33%), Positives = 62/106 (58%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQK--EADEYYLQHKEILDGCEKYITIE 111
           +   I    + GL +  HE+GHF+FAK   + VK+F+IG GPKI++ +    +++I LLPI  +VR+  +   ++  EL+  Y+   E        K I++G ++Y+  +
  S:     1 MTTIIAFIFVFGLIVFFHELGHFLFAKRAGIMVKDFSIGFGPKIFAYRKKETQYTIRLLPIGGYVRMAGEDGEEI--ELKPGYRVGLELTPEETVSKIIVNGKDQYVNAQ 108
>gi|125973513|ref|YP_001037423.1| peptidase RseP [Clostridium thermocellum ATCC 27405] >gi|125713738|gb|ABN52230.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Clostridium thermocellum ATCC 27405] (424 aa)
Score = 136, Expect = 1.3e-06, Identities = 27/67 (40%), Positives = 45/67 (67%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           FLLVI     I++   IHE+GHF+ AKL  + V+EF++ +GPK++S       +++ L PI+A+V++
  S:     3 FLLVILAFDFIII---IHELGHFIVAKLSGIKVEEFSLFVGPKLFSVTIGETAYTLRLFPILAYVKM 66
>gi|15618259|ref|NP_224544.1| metalloprotease [Chlamydophila pneumoniae CWL029] >gi|4376618|gb|AAD18488.1| Metalloprotease [Chlamydophila pneumoniae CWL029] (621 aa)
Score = 136, Expect = 1.3e-06, Identities = 28/76 (36%), Positives = 46/76 (60%)
  Q:     6 LVIFILLAIMVGLT--IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           ++ FIL A+ +G+   IHE+GH V AK   + V+ F+IG GP ++ K+   I++ I  +P   +VRI   +  +  GE
  S:     3 IIYFILAALALGILVLIHELGHLVVAKAVGMAVESFSIGFGPALFKKRIGGIEYRIGCIPFGGYVRIRGMERTKEKGE 80
>gi|15835877|ref|NP_300401.1| metalloprotease [Chlamydophila pneumoniae J138] >gi|8978716|dbj|BAA98552.1| metalloprotease [Chlamydophila pneumoniae J138] (621 aa)
Score = 136, Expect = 1.3e-06, Identities = 28/76 (36%), Positives = 46/76 (60%)
  Q:     6 LVIFILLAIMVGLT--IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           ++ FIL A+ +G+   IHE+GH V AK   + V+ F+IG GP ++ K+   I++ I  +P   +VRI   +  +  GE
  S:     3 IIYFILAALALGILVLIHELGHLVVAKAVGMAVESFSIGFGPALFKKRIGGIEYRIGCIPFGGYVRIRGMERTKEKGE 80
>gi|16752698|ref|NP_444965.1| zinc protease [Chlamydophila pneumoniae AR39] >gi|33241684|ref|NP_876625.1| putative metalloproteinase [Chlamydophila pneumoniae TW-183] >gi|20978848|sp|Q9K275|Y344_CHLPN Putative zinc metalloprotease CPn_0344/CP_0416/CPj0344/CpB0350 >gi|7189341|gb|AAF38260.1| zinc protease [Chlamydophila pneumoniae AR39] >gi|33236193|gb|AAP98282.1| putative metalloproteinase [Chlamydophila pneumoniae TW-183] (621 aa)
Score = 136, Expect = 1.3e-06, Identities = 28/76 (36%), Positives = 46/76 (60%)
  Q:     6 LVIFILLAIMVGLT--IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           ++ FIL A+ +G+   IHE+GH V AK   + V+ F+IG GP ++ K+   I++ I  +P   +VRI   +  +  GE
  S:     3 IIYFILAALALGILVLIHELGHLVVAKAVGMAVESFSIGFGPALFKKRIGGIEYRIGCIPFGGYVRIRGMERTKEKGE 80
>gi|149183491|ref|ZP_01861920.1| hypothetical protein BSG1_18785 [Bacillus sp. SG-1] >gi|148848803|gb|EDL63024.1| hypothetical protein BSG1_18785 [Bacillus sp. SG-1] (422 aa)
Score = 135, Expect = 1.4e-06, Identities = 53/180 (29%), Positives = 90/180 (50%)
  Q:     3 LFLLVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKE--ADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIID----EVPKW----------QQLIIYFGGIFFNLIL-FGLFYLIQV 182
           +F L   I   ++ G  +  HE+GH +FAK   +  +EFAIG GPK++S + +   ++I LLP+  FVR+  +    +  +++  Y+     +E     K +L+  +KY  I       +QS    +     Y    D+   F    D  +I D    ++  W          Q+ +  F G  FN IL F +F L+ +
  S:     2 VFYLQTVIAFIVIFGALVFFHELGHLIFAKRAGIMCREFAIGFGPKVFSYKKSETTYTIRLLPLGGFVRMAGEDPEMI--DIKPGYRVGLILNEDETIQKIVLNNKDKYPNIRVVEV--EQSDLEHKLFIRGYEDGEDELKTFPISRDAMIIEDGIETQIAPWDRQFASKTLGQRAMAIFAGPLFNFILAFFIFLLVGI 196
>gi|15606963|ref|NP_214345.1| hypothetical protein aq_1964 [Aquifex aeolicus VF5] >gi|20978802|sp|O67776|Y1964_AQUAE Putative zinc metalloprotease aq_1964 >gi|2984213|gb|AAC07743.1| hypothetical protein aq_1964 [Aquifex aeolicus VF5] (429 aa)
Score = 135, Expect = 1.5e-06, Identities = 26/66 (39%), Positives = 43/66 (65%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L+   IL+ ++V   +HE GHF+ AKLF+V V+ F+IG GP I+ +Q+    + I  LP+  +V++
  S:     3 LIAFLILIGVLV--WVHEFGHFLMAKLFRVKVEIFSIGFGPPIFRRQWGETVYQIAALPLGGYVKL 66
>gi|39997012|ref|NP_952963.1| membrane-associated zinc metalloprotease, putative [Geobacter sulfurreducens PCA] >gi|39983900|gb|AAR35290.1| membrane-associated zinc metalloprotease, putative [Geobacter sulfurreducens PCA] (355 aa)
Score = 135, Expect = 1.5e-06, Identities = 28/76 (36%), Positives = 50/76 (65%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           I+L I++   +HE+GHF+FAKLF V V++F++G GPK+  K+    ++ I+  P+  +V++  + +    GEL +E
  S:     9 IVLGILI--FVHELGHFIFAKLFGVGVEKFSLGFGPKLIGKKVGETEYLISAFPLGGYVKMVGEGAE---GELSEE 79
>gi|167575878|ref|ZP_02368752.1| zinc protease, putative [Borrelia valaisiana VS116] (433 aa)
Score = 135, Expect = 1.5e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEAFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|192812881|ref|ZP_03041547.1| membrane-associated zinc metalloprotease [Geobacillus sp. Y412MC10] >gi|192798209|gb|EDV74723.1| membrane-associated zinc metalloprotease [Geobacillus sp. Y412MC10] (424 aa)
Score = 135, Expect = 1.5e-06, Identities = 25/65 (38%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +V   +L   V +T+HE GH+ FA+   + V+EFAIG GPK++S +    +F++ LLP   + R+
  S:     6 VVFLTVLMFFVIVTVHEWGHYYFARRAGILVREFAIGFGPKLFSYKRHETQFTLRLLPFGGYARM 70
>gi|188586062|ref|YP_001917607.1| membrane-associated zinc metalloprotease [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350749|gb|ACB85019.1| membrane-associated zinc metalloprotease [Natranaerobius thermophilus JW/NM-WN-LF] (338 aa)
Score = 135, Expect = 1.6e-06, Identities = 33/88 (37%), Positives = 49/88 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEA 90
           ++ ++IF LL  M     HE GHF+ AKL KV+V EFA+G GPK+   Q    K+S+ ++P+  + R+         GE  DE  +E 
  S:     5 IYSIIIFGLLIFM-----HEFGHFIIAKLNKVSVLEFAMGFGPKLVGFQKGETKYSLRIIPLGGYCRMK--------GEDPDESDEEG 79
>gi|170782223|ref|YP_001710556.1| putative metalloprotease [Clavibacter michiganensis subsp. sepedonicus] >gi|169156792|emb|CAQ01955.1| putative metalloprotease [Clavibacter michiganensis subsp. sepedonicus] (482 aa)
Score = 135, Expect = 1.6e-06, Identities = 24/69 (34%), Positives = 45/69 (65%)
  Q:     2 GLFLL---VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           G+FL    V+ I++ + V + +HE+GH V AKLF V V ++ IG GP I+S++    ++ +  +P+  ++ +
  S:    11 GVFLYILGVLIIVVGVAVSIGLHEVGHLVPAKLFGVRVTQYMIGFGPTIFSRRKGETEYGVKAIPLGGYISM 82
>gi|148273341|ref|YP_001222902.1| M50 family zinc metalloprotease [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831271|emb|CAN02227.1| putative zinc metalloprotease, family M50 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (472 aa)
Score = 135, Expect = 1.6e-06, Identities = 24/69 (34%), Positives = 45/69 (65%)
  Q:     2 GLFLL---VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           G+FL    V+ I++ + V + +HE+GH V AKLF V V ++ IG GP I+S++    ++ +  +P+  ++ +
  S:     3 GVFLYILGVLIIVVGVAVSIGLHEVGHLVPAKLFGVRVTQYMIGFGPTIFSRRKGETEYGVKAIPLGGYISM 74
>gi|57234847|ref|YP_181116.1| membrane-associated zinc metalloprotease, putative [Dehalococcoides ethenogenes 195] >gi|57225295|gb|AAW40352.1| membrane-associated zinc metalloprotease, putative [Dehalococcoides ethenogenes 195] (345 aa)
Score = 135, Expect = 1.6e-06, Identities = 24/69 (34%), Positives = 42/69 (60%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           + L ++  L+   + +  HE+GHF  AK   V V+EF  G  PKI+ ++F   ++S+N LP+  FV+++
  S:     1 MLLTIVSFLIIFSIVVISHELGHFFSAKAIGVKVEEFGFGYPPKIFGRKFGQTEYSLNWLPLGGFVKVE 69
>gi|164687913|ref|ZP_02211941.1| hypothetical protein CLOBAR_01558 [Clostridium bartlettii DSM 16795] >gi|164602326|gb|EDQ95791.1| hypothetical protein CLOBAR_01558 [Clostridium bartlettii DSM 16795] (374 aa)
Score = 135, Expect = 1.6e-06, Identities = 24/54 (44%), Positives = 38/54 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKK 74
           HE GHF+ AK   V V EF+IG+GPKIYS++    ++S+ +LPI  +V ++ ++
  S:    17 HEFGHFLLAKKNGVTVHEFSIGMGPKIYSREKNGTEYSLRILPIGGYVSMEGEE 70
>gi|167750043|ref|ZP_02422170.1| hypothetical protein EUBSIR_01011 [Eubacterium siraeum DSM 15702] >gi|167657064|gb|EDS01194.1| hypothetical protein EUBSIR_01011 [Eubacterium siraeum DSM 15702] (410 aa)
Score = 134, Expect = 1.8e-06, Identities = 26/52 (50%), Positives = 34/52 (65%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           +HE GHF  AKL K+ VKEFAIG+GPK++ K+     F+   LPI   V +D
  S:    19 VHEFGHFTVAKLCKMKVKEFAIGMGPKLFKKRIGETVFAFKALPIGGSVMLD 70
>gi|150390443|ref|YP_001320492.1| putative membrane-associated zinc metalloprotease [Alkaliphilus metalliredigens QYMF] >gi|149950305|gb|ABR48833.1| putative membrane-associated zinc metalloprotease [Alkaliphilus metalliredigens QYMF] (347 aa)
Score = 134, Expect = 1.8e-06, Identities = 30/73 (41%), Positives = 46/73 (63%)
  Q:     1 VGLFLLVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           +G  L++  ++  I+ GL I  HE+GHF  AKL  + V EFAIG+GPK         K+S+ LLP+  +VR++ +
  S:     8 IGGVLIMTAVVAIIVFGLLIFFHELGHFGVAKLVGIKVHEFAIGMGPKFLQFTKGETKYSLRLLPLGGYVRMEGE 82
>gi|94263222|ref|ZP_01287039.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [delta proteobacterium MLMS-1] >gi|93456440|gb|EAT06560.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [delta proteobacterium MLMS-1] (357 aa)
Score = 134, Expect = 1.8e-06, Identities = 28/61 (45%), Positives = 41/61 (67%)
  Q:    10 ILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I   I++GL I  HE+GHF+FAKLFKV V  F++G GPK+ S+Q    ++ I   P+  +V +
  S:     5 ISFIIVLGLLIFVHELGHFLFAKLFKVKVLTFSLGFGPKLASRQAGETEYRIGAFPLGGYVNM 67
>gi|154506083|ref|ZP_02042821.1| hypothetical protein RUMGNA_03625 [Ruminococcus gnavus ATCC 29149] >gi|153793582|gb|EDN76002.1| hypothetical protein RUMGNA_03625 [Ruminococcus gnavus ATCC 29149] (344 aa)
Score = 134, Expect = 1.9e-06, Identities = 22/44 (50%), Positives = 32/44 (72%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPI 64
           HE+GHF  AKL  + V EF++G+GP ++ K+F   KFS+ LLP+
  S:    17 HELGHFTLAKLNGIRVDEFSLGMGPTLFGKEFKGTKFSLKLLPL 60
>gi|15594464|ref|NP_212252.1| zinc protease, putative [Borrelia burgdorferi B31] >gi|20978801|sp|O51145|Y118_BORBU Putative zinc metalloprotease BB_0118 >gi|2688012|gb|AAC66514.1| zinc protease, putative [Borrelia burgdorferi B31] (437 aa)
Score = 134, Expect = 1.9e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     5 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 90
>gi|51598381|ref|YP_072569.1| zinc protease, putative [Borrelia garinii PBi] >gi|51572952|gb|AAU06977.1| zinc protease, putative [Borrelia garinii PBi] (433 aa)
Score = 134, Expect = 2.0e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|195948172|ref|ZP_03089358.1| zinc protease, putative [Borrelia garinii PBr] (433 aa)
Score = 134, Expect = 2.0e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|189501891|ref|YP_001957608.1| hypothetical protein Aasi_0469 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497332|gb|ACE05879.1| hypothetical protein Aasi_0469 [Candidatus Amoebophilus asiaticus 5a2] (438 aa)
Score = 134, Expect = 2.2e-06, Identities = 47/185 (25%), Positives = 77/185 (41%)
  Q:     3 LFLLVIFIL-LAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNN 187
           L +++ F+L L+I+VG  IHE+GH +FAKLF + V+ + IG  PKI+  ++   ++ I  LP+   V+I           + DE                       +++ N   +    W  R+K                           P WQ+L++  GGI FN +   L Y+    AL +
  S:     4 LIMIIQFVLGLSIIVG--IHELGHMLFAKLFGMRVESYTIGFPPKIFRFKWGETEYGIGALPLGGSVKI---------AGMIDE-----------------------SLDTNHLSQAPQPWEFRSK---------------------------PAWQRLLVMLGGIIFNTVSGLLIYICITLALGD 128
>gi|163762555|ref|ZP_02169620.1| Cobyrinic acid a,c-diamide synthase [Bacillus selenitireducens MLS10] >gi|160357294|gb|EDP83942.1| Cobyrinic acid a,c-diamide synthase [Bacillus selenitireducens MLS10] (418 aa)
Score = 134, Expect = 2.3e-06, Identities = 26/66 (39%), Positives = 41/66 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            + + ++ A++V  +IHE GH VFAK   +  +EFAIG GPK++S Q     ++I   P+  FVR+
  S:     4 FIAVIVIFAVLV--SIHEWGHLVFAKRAGILCREFAIGFGPKLFSFQRNETVYTIRAFPLGGFVRM 67
>gi|88855350|ref|ZP_01130014.1| zinc metalloprotease [marine actinobacterium PHSC20C1] >gi|88815257|gb|EAR25115.1| zinc metalloprotease [marine actinobacterium PHSC20C1] (439 aa)
Score = 133, Expect = 2.4e-06, Identities = 25/66 (37%), Positives = 43/66 (65%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           L +LV+ + LA+ +GL  HEIGH + AKLF V V ++ IG GP I+S++    ++ +  +P+  ++
  S:     6 LGILVVVVGLAVSIGL--HEIGHLLPAKLFGVRVSQYMIGFGPTIFSRKRGETEYGVKAIPLGGYI 69
>gi|163791591|ref|ZP_02185992.1| zinc-dependent protease, membrane associated (putative) [Carnobacterium sp. AT7] >gi|159873140|gb|EDP67243.1| zinc-dependent protease, membrane associated (putative) [Carnobacterium sp. AT7] (424 aa)
Score = 133, Expect = 2.4e-06, Identities = 27/66 (40%), Positives = 42/66 (63%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++   I+ +I+V    HE GH+ FAK   + V+EFAIG GPKI+S +     F+I +LP+  +VR+
  S:     5 IITFIIVFSILV--IFHEFGHYYFAKKAGILVREFAIGFGPKIFSYRKGETTFTIRILPVGGYVRM 68
>gi|195958809|ref|ZP_03095018.1| zinc protease, putative [Borrelia sp. SV1] (433 aa)
Score = 133, Expect = 2.4e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|195960573|ref|ZP_03096778.1| zinc protease, putative [Borrelia burgdorferi 64b] (433 aa)
Score = 133, Expect = 2.6e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|195955338|ref|ZP_03094031.1| zinc protease, putative [Borrelia burgdorferi CA-11.2a] (433 aa)
Score = 133, Expect = 2.6e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|195941856|ref|ZP_03087238.1| zinc protease, putative [Borrelia burgdorferi 80a] >gi|195950722|ref|ZP_03091819.1| zinc protease, putative [Borrelia burgdorferi 29805] (433 aa)
Score = 133, Expect = 2.6e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|167931789|ref|ZP_02518876.1| zinc protease, putative [Borrelia burgdorferi 156a] >gi|167933588|ref|ZP_02520663.1| zinc protease, putative [Borrelia burgdorferi ZS7] >gi|167943771|ref|ZP_02530845.1| zinc protease, putative [Borrelia burgdorferi Bol26] >gi|168692466|ref|ZP_02725258.1| zinc protease, putative [Borrelia burgdorferi 94a] (433 aa)
Score = 133, Expect = 2.6e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|168526390|ref|ZP_02720029.1| zinc protease, putative [Borrelia burgdorferi 118a] >gi|168579952|ref|ZP_02723940.1| zinc protease, putative [Borrelia burgdorferi 72a] (433 aa)
Score = 133, Expect = 2.6e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|160915166|ref|ZP_02077379.1| hypothetical protein EUBDOL_01174 [Eubacterium dolichum DSM 3991] >gi|158432965|gb|EDP11254.1| hypothetical protein EUBDOL_01174 [Eubacterium dolichum DSM 3991] (356 aa)
Score = 133, Expect = 2.6e-06, Identities = 27/62 (43%), Positives = 40/62 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +I+ +L + V + +HE GH + AK F V  KEF+IG+GP I+ +Q    ++SI  LPI  FV
  S:     7 LIYFILILSVIVIVHEFGHLIAAKKFGVYCKEFSIGMGPVIWKRQKGETQWSIRALPIGGFV 68
>gi|195949921|ref|ZP_03091021.1| zinc protease, putative [Borrelia burgdorferi WI91-23] (433 aa)
Score = 133, Expect = 2.7e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|170016988|ref|YP_001727907.1| membrane-associated Zn-dependent protease [Leuconostoc citreum KM20] >gi|169803845|gb|ACA82463.1| Predicted membrane-associated Zn-dependent protease [Leuconostoc citreum KM20] (418 aa)
Score = 133, Expect = 2.8e-06, Identities = 29/80 (36%), Positives = 50/80 (62%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR---IDSKKSLQVFGELRDEY 86
           VI  +    V +T+HE GHF+ AK   V V+EFAIG+GPK+ + +  +  ++I +LP+  +VR   +D +  L+    +R ++
  S:     6 VIAFIFIFGVLVTVHEFGHFIVAKKSGVLVREFAIGMGPKLLNWRRNHTTYTIRILPVGGYVRMAGMDEEADLEAGQRIRLQF 88
>gi|118726341|ref|ZP_01574968.1| putative membrane-associated zinc metalloprotease [Clostridium cellulolyticum H10] >gi|118664220|gb|EAV70855.1| putative membrane-associated zinc metalloprotease [Clostridium cellulolyticum H10] (428 aa)
Score = 133, Expect = 2.9e-06, Identities = 24/68 (35%), Positives = 45/68 (66%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKK 74
           ++  +LA+   + IHE+GHF+ AK F V V EF++ +GPKI+S       +S+ L+P+  +V+++ ++
  S:     3 ILLAILALSFLIIIHELGHFLVAKAFNVRVNEFSLFMGPKIFSFVRGETTYSLRLIPLGGYVKMEGEE 70
>gi|195962523|ref|ZP_03098728.1| zinc protease, putative [Borrelia spielmanii A14S] (433 aa)
Score = 133, Expect = 2.9e-06, Identities = 30/88 (34%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  N ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILLGGYCKLKGFDHLE--KELKVNKELEADK 86
>gi|116617799|ref|YP_818170.1| membrane-associated Zn-dependent protease [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096646|gb|ABJ61797.1| Predicted membrane-associated Zn-dependent protease [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (417 aa)
Score = 132, Expect = 3.3e-06, Identities = 30/84 (35%), Positives = 48/84 (57%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR---IDSKKSLQVFGELRDEYQKEA 90
           +I  +    V +T+HE GHF  AK   V V+EFAIG+GPK+ S    +  ++I +LP+  +VR   +D +  L     LR  + ++ 
  S:     6 IIAFIFVFGVLVTVHEFGHFFVAKKSGVLVREFAIGMGPKLLSWNRNHTAYTIRILPVGGYVRMAGMDEEPDLDAGQRLRLTFNEQG 92
>gi|163815215|ref|ZP_02206592.1| hypothetical protein COPEUT_01375 [Coprococcus eutactus ATCC 27759] >gi|158449410|gb|EDP26405.1| hypothetical protein COPEUT_01375 [Coprococcus eutactus ATCC 27759] (365 aa)
Score = 132, Expect = 3.3e-06, Identities = 23/61 (37%), Positives = 42/61 (68%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAF 67
           +I I+L   V +  HE+GHF+ AK+  + VKEF++G+GPK++S +    ++S+ L+P+  +
  S:     3 IILIILVFGVIIFFHELGHFIVAKMNHITVKEFSMGLGPKLFSFKKKETQYSLRLIPLGGY 63
>gi|162447991|ref|YP_001621123.1| M50 family metallopeptidase [Acholeplasma laidlawii PG-8A] >gi|161986098|gb|ABX81747.1| membrane-associated metallopeptidase, M50 family [Acholeplasma laidlawii PG-8A] (515 aa)
Score = 132, Expect = 3.4e-06, Identities = 25/73 (34%), Positives = 46/73 (63%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           V +   +I  LL + V ++IHE+GHF+FAK   + + EF+IG+GP+I +K   + K++   +P+  +V +  +
  S:     7 VSILTNLILFLLVLTVIISIHELGHFLFAKRAGILIHEFSIGMGPQIVAKTKGDTKYAFRAIPLGGYVSMSGE 79
>gi|86160000|ref|YP_466785.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85776511|gb|ABC83348.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Anaeromyxobacter dehalogenans 2CP-C] (561 aa)
Score = 132, Expect = 3.5e-06, Identities = 30/73 (41%), Positives = 47/73 (64%)
  Q:     4 FLLVIFILLAIMVGLT-IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI---DSKKSL 76
            LL I  ++ ++ GL  +HE+GHFV AKL  V V  F+IG GP+++  Q    ++ I LLP+  +V++   D  +SL
  S:     4 LLLKIGSIVLLLGGLIFVHELGHFVVAKLMGVKVVRFSIGFGPRLFGVQRGETEYRIALLPLGGYVKMAGDDPSESL 80
>gi|28210955|ref|NP_781899.1| membrane metalloprotease [Clostridium tetani E88] >gi|28203394|gb|AAO35836.1| membrane metalloprotease [Clostridium tetani E88] (340 aa)
Score = 132, Expect = 3.5e-06, Identities = 28/78 (35%), Positives = 49/78 (62%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           F+ +I  LLA  + + +HE+GHF  AKL  V V+EF+IG+GPKI+  +    ++ I  LPI  ++++  ++  + + E
  S:     3 FINIIGALLAFSLLVLVHELGHFTLAKLNGVAVEEFSIGMGPKIWGFKKGETEYVIKALPIGGYIKMLGEEGEETYDE 80
>gi|78222471|ref|YP_384218.1| peptidase RseP [Geobacter metallireducens GS-15] >gi|78193726|gb|ABB31493.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Geobacter metallireducens GS-15] (355 aa)
Score = 132, Expect = 3.7e-06, Identities = 24/61 (39%), Positives = 42/61 (68%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I+L I++   +HE GHF+FAKLF V V++F++G GPK+  K+    ++ I+  P+  +V++
  S:     9 IVLGILI--FVHEFGHFLFAKLFGVGVEKFSLGFGPKLIGKKMGETEYLISAFPLGGYVKM 67
>gi|163812496|ref|ZP_02204167.1| peptidase M50 [Dehalococcoides sp. VS] >gi|157403873|gb|EDO69922.1| peptidase M50 [Dehalococcoides sp. VS] (345 aa)
Score = 132, Expect = 3.8e-06, Identities = 23/69 (33%), Positives = 42/69 (60%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           + L ++  L+   + +  HE+GHF  AK   V V+EF  G  PKI+ ++F   ++++N LP+  FV+++
  S:     1 MLLTIVSFLIIFSIVVISHELGHFFSAKAIGVKVEEFGFGYPPKIFGRKFGQTEYTLNWLPLGGFVKVE 69
>gi|126646686|ref|ZP_01719196.1| membrane-associated zinc metalloprotease [Algoriphagus sp. PR1] >gi|126576734|gb|EAZ80982.1| membrane-associated zinc metalloprotease [Algoriphagus sp. PR1] (439 aa)
Score = 132, Expect = 3.8e-06, Identities = 48/181 (26%), Positives = 72/181 (39%)
  Q:    12 LAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPF 192
           L+I+VGL  HE+GH + AK+F + V++F+IG  PKI   Q+   ++SI  +P+  FV+I       +  E  D  Q  A+                              W  RAK                           P WQ+LI+  GGI  N+I   + +++ V   NN    F
  S:    14 LSILVGL--HELGHLLTAKMFGMRVEKFSIGFPPKIAGFQWGETEYSIGAIPLGGFVKISG-----MVDESMDTEQLAAEP---------------------------QPWEFRAK---------------------------PAWQRLIVMLGGIIVNVITGIIIFVVMV--YNNGETYF 131
>gi|167456862|ref|ZP_02323078.1| membrane-associated zinc metalloprotease [Anaeromyxobacter dehalogenans 2CP-1] >gi|167416685|gb|EDR83396.1| membrane-associated zinc metalloprotease [Anaeromyxobacter dehalogenans 2CP-1] (561 aa)
Score = 131, Expect = 4.0e-06, Identities = 27/67 (40%), Positives = 43/67 (64%)
  Q:     4 FLLVIFILLAIMVGLT-IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            LL I  ++ ++ GL  +HE+GHFV AKL  V V  F+IG GP+++  Q    ++ I LLP+  +V++
  S:     4 LLLKIGSIVLLLGGLIFVHELGHFVVAKLMGVKVVRFSIGFGPRLFGVQRGETEYRIALLPLGGYVKM 71
>gi|124515075|gb|EAY56586.1| putative membrane-associated Zn-dependent protease 1 [Leptospirillum sp. Group II UBA] (354 aa)
Score = 131, Expect = 4.4e-06, Identities = 27/78 (34%), Positives = 48/78 (61%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKKSLQVFGELRD 84
           V+  +L I V + +HE+GHF+ A+ F V +++F+IG GPKI+S+     ++ +  +P+  +V+ +      QV  E RD
  S:     4 VLSFILVIGVLIVVHEMGHFLVARKFGVKIEKFSIGFGPKIFSRTVGETEYRLAWIPLGGYVKMLGENDPEQVSPEERD 82
>gi|110601148|ref|ZP_01389347.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Geobacter sp. FRC-32] >gi|110548144|gb|EAT61371.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Geobacter sp. FRC-32] (356 aa)
Score = 131, Expect = 4.7e-06, Identities = 24/64 (37%), Positives = 42/64 (65%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           VI  ++A+   + IHE+GHF+FAK F V V +F++G GPKI  K+    ++ ++  P+  +V++
  S:     4 VISAIIALGALIFIHELGHFIFAKWFGVGVDKFSLGFGPKIIGKKIGETEYLLSAFPLGGYVKM 67
>gi|147668997|ref|YP_001213815.1| peptidase M50 [Dehalococcoides sp. BAV1] >gi|146269945|gb|ABQ16937.1| peptidase M50 [Dehalococcoides sp. BAV1] (345 aa)
Score = 131, Expect = 4.8e-06, Identities = 23/69 (33%), Positives = 42/69 (60%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           + L V+  L+   + +  HE+GHF  AK   V V+EF  G  P+I+ ++F   ++++N LP+  FV+++
  S:     1 MLLTVVSFLIIFSIVVISHELGHFFTAKAIGVKVEEFGFGYPPRIFGRKFGQTEYTLNWLPLGGFVKVE 69
>gi|73748215|ref|YP_307454.1| putative membrane-associated zinc metalloprotease [Dehalococcoides sp. CBDB1] >gi|73659931|emb|CAI82538.1| putative membrane-associated zinc metalloprotease [Dehalococcoides sp. CBDB1] (345 aa)
Score = 131, Expect = 4.9e-06, Identities = 23/69 (33%), Positives = 42/69 (60%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           + L V+  L+   + +  HE+GHF  AK   V V+EF  G  P+I+ ++F   ++++N LP+  FV+++
  S:     1 MLLTVVSFLIIFSIVVISHELGHFFTAKAIGVKVEEFGFGYPPRIFGRKFGQTEYTLNWLPLGGFVKVE 69
>gi|56419791|ref|YP_147109.1| hypothetical protein GK1256 [Geobacillus kaustophilus HTA426] >gi|81675856|sp|Q5L0J5|RASP_GEOKA Zinc metalloprotease rasP (Regulating anti-sigma-W factor activity protease) (Regulating alternative sigma factor protease) >gi|56379633|dbj|BAD75541.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (421 aa)
Score = 131, Expect = 4.9e-06, Identities = 32/79 (40%), Positives = 48/79 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK-------KSLQVFGELRDEYQKEADEYYLQHKE 99
           HE+GH + AK   +  +EFAIG GPK++S +     ++I LLP+  FVR+  +       K  QV G L DE   + ++  L HK+
  S:    22 HELGHLLLAKRAGILCREFAIGFGPKVFSFKKNETVYTIRLLPLGGFVRMAGEDPETIELKRGQVVGLLLDE-SGQVEKIVLNHKD 106
>gi|83814616|ref|YP_445960.1| membrane-associated zinc metalloprotease, putative [Salinibacter ruber DSM 13855] >gi|83756010|gb|ABC44123.1| membrane-associated zinc metalloprotease, putative [Salinibacter ruber DSM 13855] (480 aa)
Score = 131, Expect = 5.1e-06, Identities = 20/70 (28%), Positives = 45/70 (64%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V +    +++LLA+ + + +HE+GHF+ AK F + V+ F+IG  P ++ + + + ++++   P+  +V+I
  S:     5 VSVLTSTLWVLLALTILVFVHELGHFLTAKYFDMRVERFSIGFPPTLFGRTYGDTEYAVGATPLGGYVKI 74
>gi|110598268|ref|ZP_01386543.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Chlorobium ferrooxidans DSM 13031] >gi|110340076|gb|EAT58576.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Chlorobium ferrooxidans DSM 13031] (453 aa)
Score = 130, Expect = 5.2e-06, Identities = 48/194 (24%), Positives = 80/194 (41%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIG---IGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNN-----SNPFIQIGDSFLTI 202
           F +LAI + +T HE+GHF+ AKLF + V +F IG      +++ K+    ++ + + P+  +V+I           + DE                       +++ N Q  K   W  RAK                           P WQ+LI+  GG+  N+IL  L ++     L  +     S  F++ G  F T+
  S:     9 FFILAIFILVTAHELGHFLTAKLFGMRVDKFYIGFDFFDMRLWKKKIGETEYGVGVFPLGGYVKI---------AGMVDE-----------------------SLDTNFQNTKPEPWEFRAK---------------------------PAWQRLIVLAGGVAMNMILATLIFIGLTLVLGESRTSIKSPAFVEKGSVFETM 151
>gi|110004376|emb|CAK98714.1| hypothetical membrane-associated zinc metallopeptidase transmembrane protein [Spiroplasma citri] (449 aa)
Score = 130, Expect = 5.2e-06, Identities = 32/73 (43%), Positives = 47/73 (64%)
  Q:     1 VGLFLL--VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           VG+ +L  VI +++ +M+ +TIHE  HF+ AKL    V EFAIG GPKI+S      ++SI + P   +V I S+
  S:     3 VGMVVLGFVIGVIILLML-VTIHEFAHFIIAKLAGAYVYEFAIGFGPKIFSWGKKETRYSIRIFPFGGYVYIASQ 76
>gi|42519366|ref|NP_965296.1| protease eep [Lactobacillus johnsonii NCC 533] >gi|41583654|gb|AAS09262.1| probable protease eep [Lactobacillus johnsonii NCC 533] (418 aa)
Score = 130, Expect = 5.9e-06, Identities = 24/66 (36%), Positives = 42/66 (63%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +L+  ++  I+V   +HE GHF+ AK   + V+EF+IG+GPK++ K      ++I  LP+  +VR+
  S:     4 ILIFLVVFGILV--FVHEFGHFIVAKKCGILVREFSIGMGPKLFQKMRAKTTYTIRWLPLGGYVRL 67
>gi|73662815|ref|YP_301596.1| putative protease [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495330|dbj|BAE18651.1| putative protease [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (428 aa)
Score = 130, Expect = 6.3e-06, Identities = 26/70 (37%), Positives = 42/70 (60%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +   + +I  ++   V +T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     1 MSFLVTIISFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|116629464|ref|YP_814636.1| membrane-associated Zn-dependent protease 1 [Lactobacillus gasseri ATCC 33323] >gi|116095046|gb|ABJ60198.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Lactobacillus gasseri ATCC 33323] (418 aa)
Score = 130, Expect = 6.6e-06, Identities = 24/66 (36%), Positives = 42/66 (63%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +L+  ++  I+V   +HE GHF+ AK   + V+EF+IG+GPK++ K      ++I  LP+  +VR+
  S:     4 ILIFLVVFGILV--FVHEFGHFIVAKKCGILVREFSIGMGPKLFQKMRAKTTYTIRWLPLGGYVRL 67
>gi|89895284|ref|YP_518771.1| hypothetical protein DSY2538 [Desulfitobacterium hafniense Y51] >gi|89334732|dbj|BAE84327.1| hypothetical protein [Desulfitobacterium hafniense Y51] (363 aa)
Score = 129, Expect = 6.9e-06, Identities = 30/69 (43%), Positives = 41/69 (59%)
  Q:     2 GLFLLVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           G F LV  I +    GL   IHE+GHF+ A+L  + V EFA G GPKI   Q     +S+ L+P+  FV++
  S:     6 GGFSLVSAIAVVFAFGLLVMIHELGHFIVARLNGIKVLEFAFGFGPKIIGFQGKETAYSLRLIPLGGFVKL 76
>gi|23099047|ref|NP_692513.1| hypothetical protein OB1592 [Oceanobacillus iheyensis HTE831] >gi|81746394|sp|Q8EQU7|RASP_OCEIH Zinc metalloprotease rasP (Regulating anti-sigma-W factor activity protease) (Regulating alternative sigma factor protease) >gi|22777275|dbj|BAC13548.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (424 aa)
Score = 129, Expect = 6.9e-06, Identities = 27/64 (42%), Positives = 40/64 (62%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V+  +L   V ++IHE GH +FAK   + V+EFAIG GPKI+S       ++I L+P   +VR+
  S:     4 VVAFILMFGVLVSIHEWGHLIFAKRAGMLVREFAIGFGPKIFSFTKNETLYTIRLIPAGGYVRV 67
>gi|158320552|ref|YP_001513059.1| putative membrane-associated zinc metalloprotease [Alkaliphilus oremlandii OhILAs] >gi|158140751|gb|ABW19063.1| putative membrane-associated zinc metalloprotease [Alkaliphilus oremlandii OhILAs] (334 aa)
Score = 129, Expect = 6.9e-06, Identities = 33/96 (34%), Positives = 50/96 (52%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           +V  I+  I+V   IHE+GHF  AKL  + V EFA+G+GPK+      +  +SI LLP+  +V+++             E +K  DE     K +L
  S:     5 IVAIIVFGILV--FIHELGHFTVAKLVGIKVHEFALGMGPKLIYTTKGDTLYSIRLLPLGGYVKMEG------------EDEKSEDERSFNKKPVL 86
>gi|163782861|ref|ZP_02177857.1| hypothetical protein HG1285_16036 [Hydrogenivirga sp. 128-5-R1-1] >gi|159881982|gb|EDP75490.1| hypothetical protein HG1285_16036 [Hydrogenivirga sp. 128-5-R1-1] (439 aa)
Score = 129, Expect = 7.1e-06, Identities = 23/57 (40%), Positives = 40/57 (70%)
  Q:    14 IMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++VG  I  HE+GHF+ AKLF V V+ F++G GP I++K+F    + +  +P+  +V++
  S:     9 VLVGFLIWFHELGHFLIAKLFGVKVEVFSVGFGPPIFAKRFGETLYQVAAIPLGGYVKL 67
>gi|161507688|ref|YP_001577642.1| enhanced expression of pheromone protein eep [Lactobacillus helveticus DPC 4571] >gi|160348677|gb|ABX27351.1| Enhanced expression of pheromone protein eep [Lactobacillus helveticus DPC 4571] (418 aa)
Score = 129, Expect = 7.3e-06, Identities = 57/178 (32%), Positives = 93/178 (52%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI----DSKK---SLQVFGELRDE---YQKEADEYYLQHKEILDGCEKYITIE-------KNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLII--------DEVPKWQQLIIYFGGIFFNLILFGLFYLI 180
           L  L++F LL       +HE GHF+ AK   + V+EF+IG+GPK++  +     ++I  LP+  +VR+    D  K    + V  +L D+    + +A E  +  + I     K   ++       +NG   K  T+HV    N     I+K        +GT +I        +E   WQ+L   F G F N++L  + +LI
  S:     5 LIFLIVFGLLVF-----VHEFGHFIVAKKSGILVQEFSIGMGPKLFQIRRNPTIYTIRWLPLGGYVRLAGSDDESKLDPGMTVILQLNDQDEVVRIDASESDMSIEGIPVQVTKADLVDDLIIEGYENGDENKPVTYHV----NHDATIIEK--------NGTELIIAPRDTQFNEAKVWQKLATNFAGPFMNILLGFVVFLI 190
>gi|169839798|ref|ZP_02872986.1| Membrane metalloprotease [candidate division TM7 single-cell isolate TM7a] (94 aa)
Score = 129, Expect = 7.5e-06, Identities = 26/51 (50%), Positives = 35/51 (68%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           HE+GHF  AK F + V EFAIG+GPKI+S +     +SI +LP+  FV I+
  S:    19 HELGHFATAKYFGMPVTEFAIGMGPKIFSVKKKETVYSIRILPLGGFVNIE 69
>gi|21282874|ref|NP_645962.1| hypothetical protein MW1145 [Staphylococcus aureus subsp. aureus MW2] >gi|49486101|ref|YP_043322.1| hypothetical protein SAS1196 [Staphylococcus aureus subsp. aureus MSSA476] >gi|38605593|sp|Q8NWZ4|Y1145_STAAW Putative zinc metalloprotease MW1145 >gi|81649414|sp|Q6G9V1|Y1196_STAAS Putative zinc metalloprotease SAS1196 >gi|21204313|dbj|BAB95010.1| conserved hypotehtical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244544|emb|CAG42973.1| putative membrane protein [Staphylococcus aureus subsp. aureus MSSA476] (428 aa)
Score = 129, Expect = 7.8e-06, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           LV  I   I+ G+  T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     4 LVTIIAFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|15924252|ref|NP_371786.1| putative zinc metalloprotease yluc [Staphylococcus aureus subsp. aureus Mu50] >gi|15926845|ref|NP_374378.1| hypothetical protein SA1105 [Staphylococcus aureus subsp. aureus N315] >gi|148267752|ref|YP_001246695.1| putative membrane-associated zinc metalloprotease [Staphylococcus aureus subsp. aureus JH9] >gi|150393811|ref|YP_001316486.1| putative membrane-associated zinc metalloprotease [Staphylococcus aureus subsp. aureus JH1] >gi|156979583|ref|YP_001441842.1| hypothetical protein SAHV_1252 [Staphylococcus aureus subsp. aureus Mu3] >gi|54040032|sp|P63333|Y1105_STAAN Putative zinc metalloprotease SA1105 >gi|54042339|sp|P63332|Y1262_STAAM Putative zinc metalloprotease SAV1262 >gi|13701062|dbj|BAB42357.1| conserved hypotehtical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247032|dbj|BAB57424.1| putative zinc metalloprotease yluc [Staphylococcus aureus subsp. aureus Mu50] >gi|147740821|gb|ABQ49119.1| putative membrane-associated zinc metalloprotease [Staphylococcus aureus subsp. aureus JH9] >gi|149946263|gb|ABR52199.1| putative membrane-associated zinc metalloprotease [Staphylococcus aureus subsp. aureus JH1] >gi|156721718|dbj|BAF78135.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (428 aa)
Score = 129, Expect = 7.8e-06, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           LV  I   I+ G+  T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     4 LVTIIAFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|49483425|ref|YP_040649.1| hypothetical protein SAR1238 [Staphylococcus aureus subsp. aureus MRSA252] >gi|81651261|sp|Q6GHH3|Y1238_STAAR Putative zinc metalloprotease SAR1238 >gi|49241554|emb|CAG40240.1| putative membrane protein [Staphylococcus aureus subsp. aureus MRSA252] (428 aa)
Score = 129, Expect = 8.2e-06, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           LV  I   I+ G+  T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     4 LVTIIAFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|111114940|ref|YP_709558.1| zinc protease, putative [Borrelia afzelii PKo] >gi|167942868|ref|ZP_02529942.1| zinc protease, putative [Borrelia afzelii ACA-1] >gi|110890214|gb|ABH01382.1| zinc protease, putative [Borrelia afzelii PKo] (433 aa)
Score = 129, Expect = 8.3e-06, Identities = 29/88 (32%), Positives = 55/88 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + ++F +LA+   + IHE+GHF+FAKLFKV V+ F++GIGP I   +  + ++ ++ + +  + ++     L+   EL+   + EAD+
  S:     1 MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINSTEYRLSPIILGGYCKLKGFDHLE--KELKANKELEADK 86
>gi|82750863|ref|YP_416604.1| zinc metalloprotease [Staphylococcus aureus RF122] >gi|82656394|emb|CAI80813.1| probable zinc metalloprotease [Staphylococcus aureus RF122] (428 aa)
Score = 129, Expect = 8.7e-06, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           LV  I   I+ G+  T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     4 LVTIIAFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|57651832|ref|YP_186138.1| membrane-associated zinc metalloprotease, putative [Staphylococcus aureus subsp. aureus COL] >gi|151221384|ref|YP_001332206.1| hypothetical protein NWMN_1172 [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509428|ref|YP_001575087.1| M50 family peptidase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727929|ref|ZP_02760206.1| M50 family peptidase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|81694637|sp|Q5HGG9|Y1281_STAAC Putative zinc metalloprotease SACOL1281 >gi|57286018|gb|AAW38112.1| membrane-associated zinc metalloprotease, putative [Staphylococcus aureus subsp. aureus COL] >gi|150374184|dbj|BAF67444.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368237|gb|ABX29208.1| M50 family peptidase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (428 aa)
Score = 128, Expect = 8.8e-06, Identities = 29/65 (44%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           LV  I   I+ G+  T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     4 LVTIIAFIIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|77919510|ref|YP_357325.1| putative membrane-associated Zn-dependent protease [Pelobacter carbinolicus DSM 2380] >gi|77545593|gb|ABA89155.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Pelobacter carbinolicus DSM 2380] (446 aa)
Score = 128, Expect = 8.9e-06, Identities = 26/75 (34%), Positives = 45/75 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           +L + V + +HE+GHF+ AK  +V V +F++G GPK++S+     ++ I L+P+  +V        Q+ GE  DE
  S:     8 ILMLGVLVFVHELGHFLVAKWCRVKVLKFSLGFGPKLFSRTLGETEYKICLIPLGGYV--------QMLGEGNDE 74
>gi|5714510|gb|AAD47948.1|AF152237_1 Eep [Enterococcus faecalis] (422 aa)
Score = 128, Expect = 9.2e-06, Identities = 28/66 (42%), Positives = 44/66 (66%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           ++   I+  I+V   +HE GHF FAK   + V+EFAIG+GPKI++ +  +   ++I LLPI  +VR+
  S:     4 IITFIIVFGILV--LVHEFGHFYFAKRAGILVREFAIGMGPKIFAHRGKDGTTYTIRLLPIGGYVRM 68
>gi|29376877|ref|NP_816031.1| membrane-associated zinc metalloprotease, putative [Enterococcus faecalis V583] >gi|30179788|sp|Q9RPP2|EEP_ENTFA Probable protease eep >gi|29344342|gb|AAO82101.1| membrane-associated zinc metalloprotease, putative [Enterococcus faecalis V583] (422 aa)
Score = 128, Expect = 9.8e-06, Identities = 28/66 (42%), Positives = 44/66 (66%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           ++   I+  I+V   +HE GHF FAK   + V+EFAIG+GPKI++ +  +   ++I LLPI  +VR+
  S:     4 IITFIIVFGILV--LVHEFGHFYFAKRAGILVREFAIGMGPKIFAHRGKDGTTYTIRLLPIGGYVRM 68
>gi|112148453|gb|ABI13546.1| probable protease [Lactobacillus helveticus CNRZ32] (425 aa)
Score = 128, Expect = 1.0e-05, Identities = 57/178 (32%), Positives = 93/178 (52%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI----DSKK---SLQVFGELRDE---YQKEADEYYLQHKEILDGCEKYITIE-------KNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLII--------DEVPKWQQLIIYFGGIFFNLILFGLFYLI 180
           L  L++F LL       +HE GHF+ AK   + V+EF+IG+GPK++  +     ++I  LP+  +VR+    D  K    + V  +L D+    + +A E  +  + I     K   ++       +NG   K  T+HV    N     I+K        +GT +I        +E   WQ+L   F G F N++L  + +LI
  S:    12 LIFLIVFGLLVF-----VHEFGHFIVAKKSGILVQEFSIGMGPKLFQIRRNPTIYTIRWLPLGGYVRLAGSDDESKLDPGMTVILQLNDQDEVVRIDASESDMPIEGIPVQVTKADLVDDLIIEGYENGDENKPVTYHV----NHDATIIEK--------NGTELIIAPRDTQFNEAKVWQKLATNFAGPFMNILLGFVVFLI 197
>gi|70726653|ref|YP_253567.1| hypothetical protein SH1652 [Staphylococcus haemolyticus JCSC1435] >gi|68447377|dbj|BAE04961.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (428 aa)
Score = 128, Expect = 1.1e-05, Identities = 25/67 (37%), Positives = 41/67 (61%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            + ++  ++   V +T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:     4 LITIVSFMIVFGVLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKNETLYTIRLLPVGGYVRM 70
>gi|187605332|ref|ZP_02991530.1| membrane-associated zinc metalloprotease [Exiguobacterium sp. AT1b] >gi|187482578|gb|EDU20584.1| membrane-associated zinc metalloprotease [Exiguobacterium sp. AT1b] (416 aa)
Score = 127, Expect = 1.2e-05, Identities = 27/65 (41%), Positives = 40/65 (61%)
  Q:     6 LVIFILLAIMVG--LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +  FI + +M G  +++HE GH V AK   +   EFAIG GPKI S +     ++I LLPI  +V++
  S:     1 MTTFIAIVLMFGVLISVHEWGHLVMAKRAGILCHEFAIGFGPKIVSFRKNETLYTIRLLPIGGYVKM 67
>gi|19553218|ref|NP_601220.1| membrane-associated Zn-dependent protease 1 [Corynebacterium glutamicum ATCC 13032] >gi|62390854|ref|YP_226256.1| membrane-embedded Zn-dependent protease [Corynebacterium glutamicum ATCC 13032] >gi|21324785|dbj|BAB99408.1| Predicted membrane-associated Zn-dependent proteases 1 [Corynebacterium glutamicum ATCC 13032] >gi|41326193|emb|CAF20355.1| Predicted membrane-embedded Zn-dependent protease [Corynebacterium glutamicum ATCC 13032] (404 aa)
Score = 127, Expect = 1.2e-05, Identities = 22/67 (32%), Positives = 38/67 (56%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            L V+   L I V + +HE GHF+ A++F + V+ F IG GP +++K+     + +  +P+  F  I
  S:     5 LLGVVLFFLGIAVTIALHEWGHFITARIFGMKVRRFFIGFGPTVFAKRRGETVYGLKAIPVGGFCDI 71
>gi|78485623|ref|YP_391548.1| putative membrane-associated zinc metallopeptidase [Thiomicrospira crunogena XCL-2] >gi|78363909|gb|ABB41874.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Thiomicrospira crunogena XCL-2] (456 aa)
Score = 127, Expect = 1.2e-05, Identities = 26/81 (32%), Positives = 46/81 (56%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           + L   ++  ++A+ + +TIHE GH++ A+LF + V  F+IG G  IY KQ    +F I  +P+  +V+   ++   V  E
  S:     1 MALLWSILGFIIAMGLLVTIHEWGHYIVARLFNIKVTHFSIGFGKPIYVKQKGETQFQIGSIPLGGYVKFADEREGNVAQE 81
>gi|109645629|ref|ZP_01369549.1| putative membrane-associated zinc metalloprotease [Desulfitobacterium hafniense DCB-2] >gi|109643578|gb|EAT53131.1| putative membrane-associated zinc metalloprotease [Desulfitobacterium hafniense DCB-2] (354 aa)
Score = 127, Expect = 1.3e-05, Identities = 25/63 (39%), Positives = 39/63 (61%)
  Q:     8 IFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I ++ A  + + IHE+GHF+ A+L  + V EFA G GPKI   Q     +S+ L+P+  FV++
  S:     5 IAVVFAFGLLVMIHELGHFIVARLNGIKVLEFAFGFGPKIIGFQGKETAYSLRLIPLGGFVKL 67
>gi|145295918|ref|YP_001138739.1| hypothetical protein cgR_1843 [Corynebacterium glutamicum R] >gi|140845838|dbj|BAF54837.1| hypothetical protein [Corynebacterium glutamicum R] (404 aa)
Score = 127, Expect = 1.3e-05, Identities = 22/67 (32%), Positives = 38/67 (56%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            L V+   L I V + +HE GHF+ A++F + V+ F IG GP +++K+     + +  +P+  F  I
  S:     5 LLGVVLFFLGIAVTIALHEWGHFITARIFGMKVRRFFIGFGPTVFAKRRGETVYGLKAIPVGGFCDI 71
>gi|118475534|ref|YP_892035.1| RIP metalloprotease RseP [Campylobacter fetus subsp. fetus 82-40] >gi|118414760|gb|ABK83180.1| RIP metalloprotease RseP [Campylobacter fetus subsp. fetus 82-40] (370 aa)
Score = 127, Expect = 1.3e-05, Identities = 24/66 (36%), Positives = 41/66 (62%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSL 76
           +LAI   +  HE+GHF+ A+ F V V  F+IG G KIY+K+  N  + ++ +P+  +V++  +  L
  S:    26 ILAISFLIFFHELGHFLVARFFGVKVNTFSIGFGEKIYTKRVGNTDYCLSAIPLGGYVQLKGQDDL 91
>gi|167770613|ref|ZP_02442666.1| hypothetical protein ANACOL_01959 [Anaerotruncus colihominis DSM 17241] >gi|167667208|gb|EDS11338.1| hypothetical protein ANACOL_01959 [Anaerotruncus colihominis DSM 17241] (341 aa)
Score = 127, Expect = 1.4e-05, Identities = 28/68 (41%), Positives = 46/68 (67%)
  Q:     6 LVIFILLAIMV-GLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           +V  +++AI+V GL I  HE+GHF   KL  + V EFA+G+GP ++S+     K+S+  LPI  +V ++ +
  S:     3 VVFQVIVAILVFGLLIFVHELGHFTVGKLSGMRVNEFALGMGPVLWSRTRGETKYSLRALPIGGYVSVEGE 73
>gi|85859437|ref|YP_461639.1| membrane metalloprotease [Syntrophus aciditrophicus SB] >gi|85722528|gb|ABC77471.1| membrane metalloprotease [Syntrophus aciditrophicus SB] (366 aa)
Score = 126, Expect = 1.5e-05, Identities = 23/70 (32%), Positives = 47/70 (67%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +GL ++ + ILL +++   +HE GHF+ AK   V V +F++G GPK+ S++    ++ ++L+P+  +V++
  S:     2 IGLSIISVVILLGVLI--FVHEFGHFIAAKYSGVGVLKFSLGFGPKLISRKIGETEYLLSLIPLGGYVKL 69
>gi|149178955|ref|ZP_01857532.1| probable metalloproteinase [Planctomyces maris DSM 8797] >gi|148842229|gb|EDL56615.1| probable metalloproteinase [Planctomyces maris DSM 8797] (463 aa)
Score = 126, Expect = 1.6e-05, Identities = 23/60 (38%), Positives = 42/60 (70%)
  Q:    11 LLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++A+ +GL I  HE+GHF  AK   V V+ F+IG GP IYS ++   +++++++P   +V++
  S:    22 MVALGLGLVIFFHELGHFAVAKWCNVKVERFSIGFGPIIYSFKYGETEYALSIIPFGGYVKM 83
>gi|196173887|gb|ACG74860.1| membrane-associated zinc metalloprotease [Anaeromyxobacter sp. K] (561 aa)
Score = 126, Expect = 1.6e-05, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:     4 FLLVIFILLAIMVGLT-IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            LL I  ++ ++ GL  +HE+GHFV AKL  V V  F+IG GP+++       ++ I LLP+  +V++
  S:     4 LLLKIGSIVLLLGGLIFVHELGHFVVAKLMGVKVVRFSIGFGPRLFGVHRGETEYRIALLPLGGYVKM 71
>gi|171324510|ref|ZP_02913024.1| membrane-associated zinc metalloprotease [Geobacillus sp. WCH70] >gi|171089552|gb|EDT35880.1| membrane-associated zinc metalloprotease [Geobacillus sp. WCH70] (419 aa)
Score = 126, Expect = 1.6e-05, Identities = 23/50 (46%), Positives = 34/50 (68%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH +FAK   +  +EFAIG GPK++S +     ++I LLP+  FVR+
  S:    18 HELGHLIFAKRAGILCREFAIGFGPKVFSFKKNETVYTIRLLPLGGFVRM 67
>gi|75760865|ref|ZP_00740879.1| Membrane endopeptidase, M50 family [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491649|gb|EAO54851.1| Membrane endopeptidase, M50 family [Bacillus thuringiensis serovar israelensis ATCC 35646] (197 aa)
Score = 126, Expect = 1.7e-05, Identities = 35/87 (40%), Positives = 50/87 (57%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ-----KEADEYYLQHKEILDGCEKY 107
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+  + +  V  EL+   +      E DE     K + DG EKY
  S:    22 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRMAGEDADTV--ELKPGKKVGLVLNEKDEVV---KLVFDGYEKY 108
>gi|163784323|ref|ZP_02179229.1| hypothetical protein HG1285_04548 [Hydrogenivirga sp. 128-5-R1-1] >gi|159880408|gb|EDP74006.1| hypothetical protein HG1285_04548 [Hydrogenivirga sp. 128-5-R1-1] (439 aa)
Score = 126, Expect = 1.7e-05, Identities = 25/70 (35%), Positives = 45/70 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSL 76
           VI  L+ + V +TIHE+GHF+FAK+F V ++ F+IG G  I+  +     + + L+P+  +V++  + S+
  S:     4 VIAFLIMLGVLITIHELGHFLFAKMFGVKIEVFSIGFGKPIFRWKGKETVYQVALVPLGGYVKMYGEDSM 73
>gi|42782911|ref|NP_980158.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus ATCC 10987] >gi|42738838|gb|AAS42766.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus ATCC 10987] (420 aa)
Score = 126, Expect = 1.7e-05, Identities = 35/87 (40%), Positives = 50/87 (57%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ-----KEADEYYLQHKEILDGCEKY 107
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+  + +  V  EL+   +      E DE     K + DG EKY
  S:    20 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRMAGEDADTV--ELKPGKKVGLVLNEKDEVV---KLVFDGYEKY 106
>gi|166986179|ref|ZP_02257434.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus AH187] (420 aa)
Score = 126, Expect = 1.7e-05, Identities = 35/87 (40%), Positives = 50/87 (57%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ-----KEADEYYLQHKEILDGCEKY 107
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+  + +  V  EL+   +      E DE     K + DG EKY
  S:    20 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRMAGEDADTV--ELKPGKKVGLVLNEKDEVV---KLVFDGYEKY 106
>gi|111225132|ref|YP_715926.1| hypothetical protein FRAAL5773 [Frankia alni ACN14a] >gi|111152664|emb|CAJ64405.1| Hypothetical zinc metalloprotease [Frankia alni ACN14a] (403 aa)
Score = 126, Expect = 1.7e-05, Identities = 22/65 (33%), Positives = 39/65 (60%)
  Q:    13 AIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           A++V + +HE GHFV A+ + +   +F +G GP I+S+Q    ++ I  +P   FV+I+    L+
  S:    21 ALLVSVVLHEGGHFVTARHYGLKASKFFVGFGPTIWSRQRGETEYGIKAIPAGGFVKIEGMTPLE 85
>gi|194467741|ref|ZP_03073727.1| membrane-associated zinc metalloprotease [Lactobacillus reuteri 100-23] >gi|194452594|gb|EDX41492.1| membrane-associated zinc metalloprotease [Lactobacillus reuteri 100-23] (424 aa)
Score = 126, Expect = 1.7e-05, Identities = 22/51 (43%), Positives = 36/51 (70%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +HE GH+ FAK   + V+EF+IG+GPKI+ K+     ++I +LP+  +VR+
  S:    18 VHEYGHYYFAKRAGILVREFSIGMGPKIWWKRKNGTTYTIRILPLGGYVRL 68
>gi|94986831|ref|YP_594764.1| membrane-associated Zn-dependent proteases 1 [Lawsonia intracellularis PHE/MN1-00] >gi|94731080|emb|CAJ54443.1| predicted membrane-associated Zn-dependent proteases 1 [Lawsonia intracellularis PHE/MN1-00] (374 aa)
Score = 126, Expect = 1.7e-05, Identities = 27/81 (33%), Positives = 51/81 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI------DSKKSLQVFGELRDE 85
           L V+ +L A++     HE+GHF+ A++  + VK F++G GPKI++      K+S++L+P+  +V +      D  K ++   ++ DE
  S:    15 LAVVVVLGALIF---FHELGHFMMARILGIGVKTFSLGFGPKIFTIGKRKTKYSLSLIPLGGYVSLAGEEDEDENKKIEQSSQITDE 98
>gi|116627139|ref|YP_819758.1| membrane-associated Zn-dependent protease 1 [Streptococcus thermophilus LMD-9] >gi|116100416|gb|ABJ65562.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Streptococcus thermophilus LMD-9] (420 aa)
Score = 126, Expect = 1.8e-05, Identities = 27/64 (42%), Positives = 41/64 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           +I  LL   V +  HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     4 IITFLLIFCVIVVFHEFGHFFFAKRSGILVREFAIGMGPKIFAHTGKDGTVYTIRILPLGGYVRM 68
>gi|168138550|ref|ZP_02581779.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus B4264] (420 aa)
Score = 126, Expect = 1.8e-05, Identities = 35/87 (40%), Positives = 50/87 (57%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ-----KEADEYYLQHKEILDGCEKY 107
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+  + +  V  EL+   +      E DE     K + DG EKY
  S:    20 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRMAGEDADTV--ELKPGKKVGLVLNEKDEVV---KLVFDGYEKY 106
>gi|47569098|ref|ZP_00239787.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus G9241] >gi|47554260|gb|EAL12622.1| membrane-associated zinc metalloprotease, putative [Bacillus cereus G9241] (420 aa)
Score = 126, Expect = 1.8e-05, Identities = 35/87 (40%), Positives = 50/87 (57%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ-----KEADEYYLQHKEILDGCEKY 107
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+  + +  V  EL+   +      E DE     K + DG EKY
  S:    20 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRMAGEDADTV--ELKPGKKVGLVLNEKDEVV---KLVFDGYEKY 106
>gi|55820297|ref|YP_138739.1| hypothetical protein stu0199 [Streptococcus thermophilus LMG 18311] >gi|55736282|gb|AAV59924.1| Conserved hypothetical, predicted membrane protein (TMS5) [Streptococcus thermophilus LMG 18311] (420 aa)
Score = 126, Expect = 1.8e-05, Identities = 27/64 (42%), Positives = 41/64 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           +I  LL   V +  HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     4 IITFLLIFCVIVVFHEFGHFFFAKRSGILVREFAIGMGPKIFAHTGKDGTVYTIRILPLGGYVRM 68
>gi|55822187|ref|YP_140628.1| putative processing of a peptide sex pheromone [Streptococcus thermophilus CNRZ1066] >gi|55738172|gb|AAV61813.1| conserved hypothetical protein, putative processing of a peptide sex pheromone [Streptococcus thermophilus CNRZ1066] (420 aa)
Score = 126, Expect = 1.8e-05, Identities = 27/64 (42%), Positives = 41/64 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           +I  LL   V +  HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     4 IITFLLIFCVIVVFHEFGHFFFAKRSGILVREFAIGMGPKIFAHTGKDGTVYTIRILPLGGYVRM 68
>gi|168335172|ref|ZP_02693278.1| putative membrane-associated zinc metalloprotease [Epulopiscium sp. 'N.t. morphotype B'] (342 aa)
Score = 126, Expect = 1.9e-05, Identities = 26/71 (36%), Positives = 45/71 (63%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           +++++  I+ A +V   +HE GHF+ AK   V V EFAIG+GPK++S +     ++I LLPI  +  ++ +
  S:     2 VYVIIFVIIFATIV--VVHEWGHFIAAKKCGVAVNEFAIGMGPKLWSTKKEETLYTIRLLPIGGYCAMEGE 70
>gi|184155196|ref|YP_001843536.1| zinc metalloprotease [Lactobacillus fermentum IFO 3956] >gi|183226540|dbj|BAG27056.1| zinc metalloprotease [Lactobacillus fermentum IFO 3956] (423 aa)
Score = 126, Expect = 1.9e-05, Identities = 20/51 (39%), Positives = 36/51 (70%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +HE GH+ FAK   + V+EF+IG+GPK++ ++     ++I +LP+  +VR+
  S:    18 VHEFGHYYFAKRAGILVREFSIGMGPKVWWRRSNGTTYTIRILPLGGYVRL 68
>gi|160940986|ref|ZP_02088325.1| hypothetical protein CLOBOL_05880 [Clostridium bolteae ATCC BAA-613] >gi|158436076|gb|EDP13843.1| hypothetical protein CLOBOL_05880 [Clostridium bolteae ATCC BAA-613] (349 aa)
Score = 126, Expect = 1.9e-05, Identities = 23/59 (38%), Positives = 41/59 (69%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLP 63
           L++  ++L I++   IHE GHF+FAKL  + V EF++G+GP+++S +    ++S  +LP
  S:     3 LIIAMLMLGIII--MIHEFGHFLFAKLNGIGVIEFSLGMGPRLFSFEKGGTRYSFKILP 59
>gi|163941558|ref|YP_001646442.1| putative membrane-associated zinc metalloprotease [Bacillus weihenstephanensis KBAB4] >gi|163863755|gb|ABY44814.1| putative membrane-associated zinc metalloprotease [Bacillus weihenstephanensis KBAB4] (418 aa)
Score = 126, Expect = 1.9e-05, Identities = 35/87 (40%), Positives = 50/87 (57%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ-----KEADEYYLQHKEILDGCEKY 107
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+  + +  V  EL+   +      E DE     K + DG EKY
  S:    18 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRMAGEDADTV--ELKPGKKVGLVLNEKDEVV---KLVFDGHEKY 104
>gi|162456171|ref|YP_001618538.1| membrane-associated protease [Sorangium cellulosum 'So ce 56'] >gi|161166753|emb|CAN98058.1| membrane-associated protease [Sorangium cellulosum 'So ce 56'] (572 aa)
Score = 126, Expect = 1.9e-05, Identities = 25/65 (38%), Positives = 42/65 (64%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L+ F LL  ++ + +HE+GHFV AK+F V V  F+IG GP++   +    ++ + LLP+  FV++
  S:    19 LLYFALLCSVL-IFVHELGHFVCAKIFGVKVLTFSIGFGPRVLRLRGRETEYCVALLPLGGFVKM 82
>gi|84498650|ref|ZP_00997407.1| zinc metalloprotease [Janibacter sp. HTCC2649] >gi|84381047|gb|EAP96933.1| zinc metalloprotease [Janibacter sp. HTCC2649] (454 aa)
Score = 125, Expect = 2.0e-05, Identities = 26/86 (30%), Positives = 51/86 (59%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI---------DSKKSLQV-----FGELRDEYQKEADE 92
           V+ +   +   + +HE+GH V AK F V V ++ +G GP ++S++    ++ I  +P+  ++R+         D    ++V     F +L DE +K + E
  S:    10 VLVLAFGVAASIALHEVGHLVPAKRFGVRVTQYMVGFGPTVWSRKRGETEYGIKAIPLGGYIRMIGMFPPRAGDDPTKMRVSSTGRFSQLADEARKASLE 109
>gi|146319616|ref|YP_001199328.1| membrane-associated Zn-dependent proteases 1 [Streptococcus suis 05ZYH33] >gi|146321814|ref|YP_001201525.1| membrane-associated Zn-dependent proteases 1 [Streptococcus suis 98HAH33] >gi|145690422|gb|ABP90928.1| Predicted membrane-associated Zn-dependent proteases 1 [Streptococcus suis 05ZYH33] >gi|145692620|gb|ABP93125.1| Predicted membrane-associated Zn-dependent proteases 1 [Streptococcus suis 98HAH33] (419 aa)
Score = 125, Expect = 2.0e-05, Identities = 29/66 (43%), Positives = 43/66 (65%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L  IFI   I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     5 LAFIFIFGVIVV---VHEFGHFYFAKKAGILVREFAIGMGPKIFAHTGKDGTLYTIRILPLGGYVRM 68
>gi|81176858|ref|ZP_00875832.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Streptococcus suis 89/1591] >gi|80976387|gb|EAP40000.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Streptococcus suis 89/1591] (419 aa)
Score = 125, Expect = 2.1e-05, Identities = 29/66 (43%), Positives = 43/66 (65%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L  IFI   I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     5 LAFIFIFGVIVV---VHEFGHFYFAKKAGILVREFAIGMGPKIFAHTGKDGTLYTIRILPLGGYVRM 68
>gi|58337541|ref|YP_194126.1| enhanced expression of pheromone protein eep [Lactobacillus acidophilus NCFM] >gi|58254858|gb|AAV43095.1| enhanced expression of pheromone protein eep [Lactobacillus acidophilus NCFM] (418 aa)
Score = 125, Expect = 2.2e-05, Identities = 56/178 (31%), Positives = 93/178 (52%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI----DSKK---SLQVFGELRDEYQ------KEAD------EYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLII--------DEVPKWQQLIIYFGGIFFNLILFGLFYLI 180
           L  LV+F LL       +HE GHF+ AK   + V+EF+IG+GPK++  +     ++I  LP+  +VR+    D  K    + V  +L D+ +       E+D         +   +++D  +  I   +NG      T+HV    N     I+K        +GT +I        ++   WQ+L   F G F N++L  + +LI
  S:     5 LIFLVVFGLLVF-----VHEFGHFIVAKKSGILVREFSIGMGPKLFQIRRNPTTYTIRWLPLGGYVRLAGSDDESKLDPGMTVVLQLNDKNEVIRIDASESDIPIEGIPVQVTKADLVD--DLIIEGYENGDENDPVTYHV----NHDATIIEK--------NGTELIIAPRDTQFNQANVWQKLATNFAGPFMNIVLGFVVFLI 190
>gi|15614983|ref|NP_243286.1| hypothetical protein BH2420 [Bacillus halodurans C-125] >gi|20978849|sp|Q9KA70|RASP_BACHD Zinc metalloprotease rasP (Regulating anti-sigma-W factor activity protease) (Regulating alternative sigma factor protease) >gi|10175040|dbj|BAB06139.1| BH2420 [Bacillus halodurans C-125] (420 aa)
Score = 125, Expect = 2.2e-05, Identities = 23/66 (34%), Positives = 41/66 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L+   ++  ++V  ++HE GH  FAK   +  +EFAIG GPK++S +     ++I L+P+  +VR+
  S:     4 LIAFLVMFGVLV--SVHEWGHLYFAKRAGILCREFAIGFGPKLFSWKRNETVYTIRLIPLGGYVRM 67
>gi|15604791|ref|NP_219575.1| metalloprotease [Chlamydia trachomatis D/UW-3/CX] >gi|76788785|ref|YP_327871.1| M50 family membrane endopeptidase [Chlamydia trachomatis A/HAR-13] >gi|20978772|sp|O84075|Y072_CHLTR Putative zinc metalloprotease CT_072 >gi|3328467|gb|AAC67663.1| Metalloprotease [Chlamydia trachomatis D/UW-3/CX] >gi|76167315|gb|AAX50323.1| membrane endopeptidase, M50 family [Chlamydia trachomatis A/HAR-13] (619 aa)
Score = 125, Expect = 2.4e-05, Identities = 23/65 (35%), Positives = 43/65 (66%)
  Q:     6 LVIFILLAIMVG--LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++ F+L A+ +G  + IHE+GH + AK   ++V+ F+IG GP +  K+  ++++ I  +P   +VRI
  S:     3 IIYFVLAALALGFLILIHELGHLLAAKAVGMSVESFSIGFGPALVRKKMGSVEYRIGAIPFGGYVRI 69
>gi|147677596|ref|YP_001211811.1| membrane-associated Zn-dependent protease 1 [Pelotomaculum thermopropionicum SI] >gi|146273693|dbj|BAF59442.1| predicted membrane-associated Zn-dependent protease 1 [Pelotomaculum thermopropionicum SI] (351 aa)
Score = 125, Expect = 2.4e-05, Identities = 24/67 (35%), Positives = 40/67 (59%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F+  IF+   ++     HE+GHF+ AKL  + V+EF++G GPKI+        +++  LP+  FVR+
  S:     4 FMASIFVFGMLIF---FHELGHFMLAKLVGIKVREFSLGFGPKIFGMHRGETAYNLRALPLGGFVRM 67
>gi|15834963|ref|NP_296722.1| hypothetical protein TC0344 [Chlamydia muridarum Nigg] >gi|20978855|sp|Q9PKW7|Y344_CHLMU Putative zinc metalloprotease TC_0344 >gi|7190385|gb|AAF39205.1| conserved hypothetical protein [Chlamydia muridarum Nigg] (619 aa)
Score = 125, Expect = 2.5e-05, Identities = 24/65 (36%), Positives = 42/65 (64%)
  Q:     6 LVIFILLAIMVG--LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++ F+L A+ +G  + IHE+GH + AK   + V+ F+IG GP +  K+  +I++ I  +P   +VRI
  S:     3 VIYFVLAALALGFLILIHELGHLLAAKAVGMTVESFSIGFGPALVRKKMGSIEYRIGAIPFGGYVRI 69
>gi|166154293|ref|YP_001654411.1| putative protease [Chlamydia trachomatis 434/Bu] >gi|166155168|ref|YP_001653423.1| putative protease [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930281|emb|CAP03767.1| putative protease [Chlamydia trachomatis 434/Bu] >gi|165931156|emb|CAP06721.1| putative protease [Chlamydia trachomatis L2b/UCH-1/proctitis] (619 aa)
Score = 125, Expect = 2.5e-05, Identities = 23/65 (35%), Positives = 43/65 (66%)
  Q:     6 LVIFILLAIMVG--LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++ F+L A+ +G  + IHE+GH + AK   ++V+ F+IG GP +  K+  ++++ I  +P   +VRI
  S:     3 IIYFVLAALALGFLILIHELGHLLAAKAVGMSVESFSIGFGPALVRKKIGSVEYRIGAIPFGGYVRI 69
>gi|33519743|ref|NP_878575.1| putative membrane-associated Zn-dependent protease [Candidatus Blochmannia floridanus] >gi|33504088|emb|CAD83349.1| membrane-associated Zn-dependent protease [Candidatus Blochmannia floridanus] (462 aa)
Score = 125, Expect = 2.5e-05, Identities = 25/70 (35%), Positives = 48/70 (68%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFT--NIKFSINLLPIMAFVRIDSK 73
           F  ++F +L I + +T+HE GHF+ A+ F V V++F+IG GP ++S Q    + ++ I+++P+  +V++  K
  S:     6 FWNIVFFILTISLLITVHECGHFLAARFFGVKVEKFSIGFGPIVWSWQANKDSTEYIISIIPLGGYVKLLDK 77
>gi|119952920|ref|YP_945129.1| membrane metalloprotease [Borrelia turicatae 91E135] >gi|119861691|gb|AAX17459.1| membrane metalloprotease [Borrelia turicatae 91E135] (427 aa)
Score = 125, Expect = 2.5e-05, Identities = 31/88 (35%), Positives = 54/88 (61%)
  Q:     5 LLVIFI-LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           ++ IF+ +LA    + IHE+GH  FAKLFKV V+ F+IGIGP ++  +  + ++  + + +  + ++   + L+   ELR   Q EAD+
  S:     1 MMYIFLSILAFTFIIFIHELGHLFFAKLFKVKVEVFSIGIGPSLFKFKIKDTEYRFSPIFLGGYCKLKGAEHLE--NELRLNRQLEADK 87
>gi|187778982|ref|ZP_02995455.1| hypothetical protein CLOSPO_02577 [Clostridium sporogenes ATCC 15579] >gi|187772607|gb|EDU36409.1| hypothetical protein CLOSPO_02577 [Clostridium sporogenes ATCC 15579] (336 aa)
Score = 124, Expect = 2.6e-05, Identities = 27/71 (38%), Positives = 46/71 (64%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI--DSKKS 75
           + +I  +LA  + + +HE GHF+ AK   + V+EF+IG+GPK+   +    ++ I LLPI  +V++  D +KS
  S:     1 MYIIAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKETEYLIKLLPIGGYVKMLGDEEKS 73
>gi|50842987|ref|YP_056214.1| membrane-spanning metalloprotease [Propionibacterium acnes KPA171202] >gi|50840589|gb|AAT83256.1| membrane-spanning metalloprotease [Propionibacterium acnes KPA171202] (426 aa)
Score = 124, Expect = 2.9e-05, Identities = 45/161 (27%), Positives = 66/161 (40%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGI 167
           ++F  L I++ + +HE GHF+ AK+F V V EF  G GPKI+S      ++    +P+  +VR+      +V     +   + ADE  +   E        IT    G+L                        FS K          P WQ+LII  GGI
  S:    11 IVFFGL-IILSVLLHECGHFIPAKIFGVKVTEFFAGFGPKIWSFTPGETEYGFKWIPLGGYVRLIGMYPAKVHHRHSNRLTRFADEARVAEVE-------GITDADQGRL------------------------FSDK----------PVWQRLIIMSGGI 129
>gi|50365103|ref|YP_053528.1| membrane associated Zn-dependent protease [Mesoplasma florum L1] >gi|50363659|gb|AAT75644.1| probable membrane associated Zn-dependent protease [Mesoplasma florum L1] (422 aa)
Score = 124, Expect = 2.9e-05, Identities = 25/54 (46%), Positives = 36/54 (66%)
  Q:    19 TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDS 72
           T+HE+GHF+ AKL K  V EFAIG GPK++  +     +S+ L+P+  +V I S
  S:    23 TLHELGHFIVAKLSKAYVFEFAIGFGPKLFVIKTKETWYSVRLIPLGGYVSIAS 76
>gi|108804242|ref|YP_644179.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Rubrobacter xylanophilus DSM 9941] >gi|108765485|gb|ABG04367.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Rubrobacter xylanophilus DSM 9941] (345 aa)
Score = 124, Expect = 3.1e-05, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + V+  LL ++  + IHE+GH + AK   V V EF IG GP ++ K+  +  +S  ++ +  F RI
  S:     1 MTVLVALLGLIFLIAIHELGHMLTAKALGVRVPEFGIGFGPALFKKKLGDTTYSFRIILLGGFARI 66
>gi|138894776|ref|YP_001125229.1| hypothetical protein GTNG_1110 [Geobacillus thermodenitrificans NG80-2] >gi|196247601|ref|ZP_03146303.1| membrane-associated zinc metalloprotease [Geobacillus sp. G11MC16] >gi|134266289|gb|ABO66484.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] >gi|196212385|gb|EDY07142.1| membrane-associated zinc metalloprotease [Geobacillus sp. G11MC16] (417 aa)
Score = 124, Expect = 3.2e-05, Identities = 29/79 (36%), Positives = 49/79 (62%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK-------KSLQVFGELRDEYQKEADEYYLQHKE 99
           HE+GH + AK   +  +EFAIG GPK++S +     +++ LLP+  FVR+  +       K  QV G L D+ + + ++  + HK+
  S:    18 HELGHLLLAKRAGILCREFAIGFGPKMFSFKKNETVYTVRLLPLGGFVRMAGEDPEMIELKRGQVVGLLLDD-EGQVEKIVINHKD 102
>gi|187917996|ref|YP_001883559.1| membrane metalloprotease [Borrelia hermsii DAH] >gi|119860844|gb|AAX16639.1| membrane metalloprotease [Borrelia hermsii DAH] (427 aa)
Score = 124, Expect = 3.2e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           + +   +LA    + IHE+GH +FAKLFKV V+ F+IGIGP ++  +    ++  + + +  + ++   + L+   EL+   Q EAD+
  S:     1 MYIFLSILAFTFIIFIHELGHLLFAKLFKVKVEVFSIGIGPSLFKIKIKETEYRFSPIFLGGYCKLKGSEHLE--NELKLNRQLEADK 86
>gi|108756877|ref|YP_630776.1| M50A family peptidase [Myxococcus xanthus DK 1622] >gi|108460757|gb|ABF85942.1| peptidase, M50A (S2P protease) subfamily [Myxococcus xanthus DK 1622] (555 aa)
Score = 124, Expect = 3.2e-05, Identities = 27/70 (38%), Positives = 43/70 (61%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +G F+    ILL ++V  T+HE+GHF+ AK   V V +F+IG GPK+        ++ I LLP+  +V++
  S:    17 IGFFV----ILLGVLV--TVHELGHFLVAKACGVKVLKFSIGFGPKLIGFTKGETEYQIALLPLGGYVKM 80
>gi|189485763|ref|YP_001956704.1| putative zinc metalloprotease [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287722|dbj|BAG14243.1| putative zinc metalloprotease [uncultured Termite group 1 bacterium phylotype Rs-D17] (350 aa)
Score = 124, Expect = 3.3e-05, Identities = 26/66 (39%), Positives = 41/66 (62%)
  Q:     5 LLVIFILLAIMVG----LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +I  +L+I VG    + IHE+GHF+ AK+ KV +  FA G GP +    +   K+ I ++P   FVR+
  S:     1 MTIILQILSITVGFGFLIFIHELGHFLAAKMCKVRILTFAFGFGPDLIKYTYNGTKYCIKIIPFGGFVRM 70
>gi|148543924|ref|YP_001271294.1| putative membrane-associated zinc metalloprotease [Lactobacillus reuteri F275] >gi|184153320|ref|YP_001841661.1| hypothetical protein LAR_0665 [Lactobacillus reuteri F275] >gi|148530958|gb|ABQ82957.1| putative membrane-associated zinc metalloprotease [Lactobacillus reuteri F275] >gi|183224664|dbj|BAG25181.1| conserved hypothetical protein [Lactobacillus reuteri F275] (424 aa)
Score = 124, Expect = 3.3e-05, Identities = 21/51 (41%), Positives = 36/51 (70%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +HE GH+ FAK   + V+EF+IG+GPKI+ ++     ++I +LP+  +VR+
  S:    18 VHEYGHYYFAKRAGILVREFSIGMGPKIWWRRKNGTTYTIRILPLGGYVRL 68
>gi|172057853|ref|YP_001814313.1| membrane-associated zinc metalloprotease [Exiguobacterium sibiricum 255-15] >gi|171990374|gb|ACB61296.1| membrane-associated zinc metalloprotease [Exiguobacterium sibiricum 255-15] (413 aa)
Score = 123, Expect = 3.5e-05, Identities = 26/65 (40%), Positives = 40/65 (61%)
  Q:     6 LVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +  FI + +M G+   +HE GH V AK   +  +EFAIG GPKI+S       +++ LLPI  +V++
  S:     1 MTTFISIVLMFGVLVAVHEWGHLVMAKRAGILCREFAIGFGPKIFSFFKNETLYTVRLLPIGGYVKM 67
>gi|86742255|ref|YP_482655.1| peptidase M50 [Frankia sp. CcI3] >gi|86569117|gb|ABD12926.1| peptidase M50 [Frankia sp. CcI3] (394 aa)
Score = 123, Expect = 3.5e-05, Identities = 21/66 (31%), Positives = 39/66 (59%)
  Q:    12 LAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           LA++V +  HE GHFV A+ + +   +F +G GP I+S++    ++ +  +P   FV+I+    L+
  S:    11 LALLVSVVAHEAGHFVTARHYGMKASKFFVGFGPTIWSRRRGETEYGVKAIPAGGFVKIEGMTPLE 76
>gi|27467856|ref|NP_764493.1| hypothetical protein SE0938 [Staphylococcus epidermidis ATCC 12228] >gi|57866744|ref|YP_188411.1| membrane-associated zinc metalloprotease, putative [Staphylococcus epidermidis RP62A] >gi|27315401|gb|AAO04535.1|AE016747_32 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57637402|gb|AAW54190.1| membrane-associated zinc metalloprotease, putative [Staphylococcus epidermidis RP62A] (428 aa)
Score = 123, Expect = 3.7e-05, Identities = 25/55 (45%), Positives = 36/55 (65%)
  Q:    16 VGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V +T+HE GH  FAK   +   EFAIG+GPKI+S +     ++I LLP+  +VR+
  S:    16 VLVTVHEYGHMFFAKRAGIMCPEFAIGMGPKIFSFRKDETLYTIRLLPVGGYVRM 70
>gi|72161152|ref|YP_288809.1| PDZ/DHR/GLGF [Thermobifida fusca YX] >gi|71914884|gb|AAZ54786.1| PDZ/DHR/GLGF [Thermobifida fusca YX] (450 aa)
Score = 123, Expect = 3.7e-05, Identities = 34/169 (20%), Positives = 76/169 (44%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEK--YITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL 173
           L ++ ++L ++  +  HE+GH V AKLF +   ++ +G G  ++S +  + ++ +  +P+  +VR+         G +      + D+   + + +++   +  Y+ +E   + R+                      F ++          P W++LI+ FGG F NL+L
  S:     8 LGIVLMILGLLFSIAWHELGHLVPAKLFGIRCTQYMVGFGKTLWSVKRGDTEYGLKAIPLGGYVRM--------VGMIPPAAPADPDKPMSRWRAMIEDAREASYVEVEPGDEDRQ----------------------FYQR----------PPWKRLIVMFGGPFMNLVL 138
>gi|195978862|ref|YP_002124106.1| membrane-associated Zinc metalloprotease [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975567|gb|ACG63093.1| membrane-associated Zinc metalloprotease [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (421 aa)
Score = 123, Expect = 4.0e-05, Identities = 25/53 (47%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        ++I LLP+  +VR+
  S:    15 VIVHEFGHFYFAKRSGILVREFAIGMGPKIFSHVDQQGTLYTIRLLPLGGYVRM 68
>gi|153815806|ref|ZP_01968474.1| hypothetical protein RUMTOR_02051 [Ruminococcus torques ATCC 27756] >gi|145846831|gb|EDK23749.1| hypothetical protein RUMTOR_02051 [Ruminococcus torques ATCC 27756] (343 aa)
Score = 123, Expect = 4.0e-05, Identities = 24/58 (41%), Positives = 37/58 (63%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLP 63
           ++I +LL   + +  HE+GHF+ AK   + V EF++G+GP +  KQ    KFS+ LLP
  S:     3 IIIAVLLFSFI-IIFHELGHFLLAKKNGIRVDEFSLGLGPTLLGKQIGETKFSLKLLP 59
>gi|24380150|ref|NP_722105.1| membrane-associated Zn-dependent protease [Streptococcus mutans UA159] >gi|24378151|gb|AAN59411.1|AE015006_4 putative Eep protein-like protein [Streptococcus mutans UA159] (419 aa)
Score = 123, Expect = 4.0e-05, Identities = 23/51 (45%), Positives = 37/51 (72%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           +HE GHF FA+   + V+EFAIG+GPKI++ Q  +   ++I +LP+  +VR+
  S:    17 VHEFGHFYFARKSGILVREFAIGMGPKIFAHQGKDGTAYTIRILPLGGYVRM 68
>gi|168184632|ref|ZP_02619296.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum Bf] >gi|182672313|gb|EDT84274.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum Bf] (336 aa)
Score = 123, Expect = 4.1e-05, Identities = 26/71 (36%), Positives = 46/71 (64%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI--DSKKS 75
           + ++  +LA  + + +HE GHF+ AK   + V+EF+IG+GPK+   +    ++ I LLPI  +V++  D +KS
  S:     1 MYIVAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKETEYLIKLLPIGGYVKMLGDEEKS 73
>gi|52080259|ref|YP_079050.1| intramembrane zinc metallopeptidase YluC [Bacillus licheniformis ATCC 14580] >gi|52785636|ref|YP_091465.1| YluC [Bacillus licheniformis ATCC 14580] >gi|81385555|sp|Q65JJ2|RASP_BACLD Zinc metalloprotease rasP (Regulating anti-sigma-W factor activity protease) (Regulating alternative sigma factor protease) >gi|52003470|gb|AAU23412.1| intramembrane zinc metallopeptidase YluC [Bacillus licheniformis ATCC 14580] >gi|52348138|gb|AAU40772.1| YluC [Bacillus licheniformis DSM 13] (419 aa)
Score = 123, Expect = 4.1e-05, Identities = 26/64 (40%), Positives = 38/64 (59%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           VI  +L     +  HE+GH + A+   +  +EFAIG GPKI+S +     ++I LLPI  FVR+
  S:     4 VIAFILIFGTLVFFHELGHLILAQRAGILCREFAIGFGPKIFSFKKNETVYTIRLLPIGGFVRM 67
>gi|169824426|ref|YP_001692037.1| membrane-associated Zn-dependent protease [Finegoldia magna ATCC 29328] >gi|167831231|dbj|BAG08147.1| membrane-associated Zn-dependent protease [Finegoldia magna ATCC 29328] (334 aa)
Score = 123, Expect = 4.3e-05, Identities = 21/53 (39%), Positives = 37/53 (69%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           HE GHF+ AK+  V+V EF+IG+GPK++ K+     +S+ LLP+  + +++ +
  S:    18 HEFGHFIVAKMNGVSVLEFSIGMGPKLFQKESNGTLYSLRLLPVGGYCQLEGE 70
>gi|148380381|ref|YP_001254922.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A str. ATCC 3502] >gi|153934239|ref|YP_001384600.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A str. ATCC 19397] >gi|153937005|ref|YP_001388116.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A str. Hall] >gi|153940499|ref|YP_001391723.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum F str. Langeland] >gi|168180695|ref|ZP_02615359.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum NCTC 2916] >gi|170756743|ref|YP_001781968.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum B1 str. Okra] >gi|148289865|emb|CAL83973.1| putative membrane-associated protease [Clostridium botulinum A str. ATCC 3502] >gi|152930283|gb|ABS35783.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A str. ATCC 19397] >gi|152932919|gb|ABS38418.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A str. Hall] >gi|152936395|gb|ABS41893.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum F str. Langeland] >gi|169121955|gb|ACA45791.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum B1 str. Okra] >gi|182668635|gb|EDT80614.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum NCTC 2916] (336 aa)
Score = 123, Expect = 4.3e-05, Identities = 26/71 (36%), Positives = 46/71 (64%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI--DSKKS 75
           + ++  +LA  + + +HE GHF+ AK   + V+EF+IG+GPK+   +    ++ I LLPI  +V++  D +KS
  S:     1 MYIVAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKETEYLIKLLPIGGYVKMLGDEEKS 73
>gi|90961541|ref|YP_535457.1| M50 family membrane endopeptidase [Lactobacillus salivarius UCC118] >gi|90820735|gb|ABD99374.1| Membrane endopeptidase, M50 family [Lactobacillus salivarius UCC118] (425 aa)
Score = 122, Expect = 4.4e-05, Identities = 22/51 (43%), Positives = 36/51 (70%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +HE GH+ FAK   + V+EF+IG+GPK++  +  +  ++I LLPI  +VR+
  S:    18 VHEFGHYFFAKKAGILVREFSIGMGPKLWFYRKNSTTYTIRLLPIGGYVRM 68
>gi|78187993|ref|YP_378331.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Chlorobium chlorochromatii CaD3] >gi|78170192|gb|ABB27288.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Chlorobium chlorochromatii CaD3] (453 aa)
Score = 122, Expect = 4.4e-05, Identities = 24/62 (38%), Positives = 43/62 (69%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGI---GPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + ++AI + +T HE+GHF+ AKLF + V++F IG      +++SKQ    ++ I L+P+  +V+I
  S:     6 YFIIAIFILVTAHELGHFLTAKLFGMRVEKFYIGFDFWNLRLWSKQIGETEYGIGLIPLGGYVKI 70
>gi|170759137|ref|YP_001787736.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A3 str. Loch Maree] >gi|169406126|gb|ACA54537.1| putative membrane-associated zinc metalloprotease [Clostridium botulinum A3 str. Loch Maree] (336 aa)
Score = 122, Expect = 4.6e-05, Identities = 26/71 (36%), Positives = 46/71 (64%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI--DSKKS 75
           + ++  +LA  + + +HE GHF+ AK   + V+EF+IG+GPK+   +    ++ I LLPI  +V++  D +KS
  S:     1 MYIVAAILAFGILVLVHEFGHFIMAKANGIKVEEFSIGMGPKLIGIKGKETEYLIKLLPIGGYVKMLGDEEKS 73
>gi|153006541|ref|YP_001380866.1| putative membrane-associated zinc metalloprotease [Anaeromyxobacter sp. Fw109-5] >gi|152030114|gb|ABS27882.1| putative membrane-associated zinc metalloprotease [Anaeromyxobacter sp. Fw109-5] (558 aa)
Score = 122, Expect = 4.6e-05, Identities = 22/59 (37%), Positives = 41/59 (69%)
  Q:    12 LAIMVG--LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +A+++G  + +HE+GHFV AK   V V  F+IG GP+++  +    ++ I+LLP+  +V++
  S:    11 IALLLGGLIFVHELGHFVVAKALGVKVVRFSIGFGPRLFGFRRGETEYRISLLPLGGYVKM 71
>gi|167630333|ref|YP_001680832.1| peptidase m50 [Heliobacterium modesticaldum Ice1] >gi|167593073|gb|ABZ84821.1| peptidase m50 [Heliobacterium modesticaldum Ice1] (351 aa)
Score = 122, Expect = 4.7e-05, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     6 LVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++ F+    + GL I  HE GHF  AK   V V EF+IG+GP+++  +     +++ LLP+  FVR+
  S:     1 MITFLASVFVFGLMIFFHEFGHFAVAKAVGVRVLEFSIGMGPRLFGLRRGPTLYALRLLPVGGFVRM 67
>gi|195953375|ref|YP_002121665.1| membrane-associated zinc metalloprotease [Hydrogenobaculum sp. Y04AAS1] >gi|195932987|gb|ACG57687.1| membrane-associated zinc metalloprotease [Hydrogenobaculum sp. Y04AAS1] (438 aa)
Score = 122, Expect = 5.2e-05, Identities = 23/66 (34%), Positives = 41/66 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +L   IL++I++    HE GHF+ AKLF V V+ F++G G  I+ K+    ++ I  +P+  +V++
  S:     5 VLAFLILISILI--VFHEFGHFILAKLFGVKVEVFSVGFGSPIFKKKIGETEYQIAYIPMGGYVKL 68
>gi|160934101|ref|ZP_02081488.1| hypothetical protein CLOLEP_02964 [Clostridium leptum DSM 753] >gi|156866774|gb|EDO60146.1| hypothetical protein CLOLEP_02964 [Clostridium leptum DSM 753] (374 aa)
Score = 122, Expect = 5.2e-05, Identities = 25/69 (36%), Positives = 40/69 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           LL+IF +L     +  HE GHF+ AKL  + V EFA+G+GPK+   +    ++S+   PI  F  ++ +
  S:    12 LLIIFAVLLFEFIILSHEFGHFITAKLSGIRVNEFALGMGPKLIHFKRGETEYSLRAFPIGGFCAMEGE 80
>gi|15902286|ref|NP_357836.1| determinant for enhanced expression of pheromone [Streptococcus pneumoniae R6] >gi|116515700|ref|YP_815763.1| zinc metalloprotease Eep [Streptococcus pneumoniae D39] >gi|148983668|ref|ZP_01816987.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP3-BS71] >gi|148994605|ref|ZP_01823747.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP9-BS68] >gi|148996687|ref|ZP_01824405.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP11-BS70] >gi|149001622|ref|ZP_01826595.1| zinc metalloprotease Eep [Streptococcus pneumoniae SP14-BS69] >gi|149006017|ref|ZP_01829746.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP18-BS74] >gi|149017956|ref|ZP_01834415.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP23-BS72] >gi|168484645|ref|ZP_02709597.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC1873-00] >gi|168489738|ref|ZP_02713937.1| RIP metalloprotease RseP [Streptococcus pneumoniae SP195] >gi|168492218|ref|ZP_02716361.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC0288-04] >gi|168493959|ref|ZP_02718102.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC3059-06] >gi|168576310|ref|ZP_02722193.1| RIP metalloprotease RseP [Streptococcus pneumoniae MLV-016] >gi|169832703|ref|YP_001693791.1| RIP metalloprotease RseP [Streptococcus pneumoniae Hungary19A-6] >gi|182683243|ref|YP_001834990.1| eep protein [Streptococcus pneumoniae CGSP14] >gi|194398446|ref|YP_002036963.1| peptidase, M50 family [Streptococcus pneumoniae G54] >gi|73921088|sp|Q8DRB1|Y242_STRR6 Putative zinc metalloprotease spr0242 >gi|15457790|gb|AAK99046.1| Determinant for enhanced expression of pheromone [Streptococcus pneumoniae R6] >gi|116076276|gb|ABJ53996.1| zinc metalloprotease Eep [Streptococcus pneumoniae D39] >gi|147757262|gb|EDK64301.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP11-BS70] >gi|147760080|gb|EDK67069.1| zinc metalloprotease Eep [Streptococcus pneumoniae SP14-BS69] >gi|147762373|gb|EDK69334.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP18-BS74] >gi|147923815|gb|EDK74927.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP3-BS71] >gi|147927135|gb|EDK78173.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP9-BS68] >gi|147931520|gb|EDK82498.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP23-BS72] >gi|168995205|gb|ACA35817.1| RIP metalloprotease RseP [Streptococcus pneumoniae Hungary19A-6] >gi|172042159|gb|EDT50205.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC1873-00] >gi|182628577|gb|ACB89525.1| eep protein [Streptococcus pneumoniae CGSP14] >gi|183571810|gb|EDT92338.1| RIP metalloprotease RseP [Streptococcus pneumoniae SP195] >gi|183573581|gb|EDT94109.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC0288-04] >gi|183576068|gb|EDT96596.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC3059-06] >gi|183577831|gb|EDT98359.1| RIP metalloprotease RseP [Streptococcus pneumoniae MLV-016] >gi|194358113|gb|ACF56561.1| peptidase, M50 family [Streptococcus pneumoniae G54] (419 aa)
Score = 122, Expect = 5.4e-05, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L +L   ++  I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     2 LGILTFILVFGIIV--VVHEFGHFYFAKKSGILVREFAIGMGPKIFAHIGKDGTAYTIRILPLGGYVRM 68
>gi|160893348|ref|ZP_02074135.1| hypothetical protein CLOL250_00897 [Clostridium sp. L2-50] >gi|156865040|gb|EDO58471.1| hypothetical protein CLOL250_00897 [Clostridium sp. L2-50] (365 aa)
Score = 122, Expect = 5.6e-05, Identities = 21/61 (34%), Positives = 39/61 (63%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAF 67
           +I I+L   V +  HE+GHF+ AK+  + VKEF++G GPK++       ++++ L+P+  +
  S:     3 IILIILVFGVIIFFHELGHFIVAKINHITVKEFSMGFGPKLFQFHKKETQYTLRLIPLGGY 63
>gi|149011133|ref|ZP_01832438.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP19-BS75] >gi|147764769|gb|EDK71699.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP19-BS75] (419 aa)
Score = 122, Expect = 5.6e-05, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L +L   ++  I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     2 LGILTFILVFGIIV--VVHEFGHFYFAKKSGILVREFAIGMGPKIFAHIGKDGTAYTIRILPLGGYVRM 68
>gi|15900197|ref|NP_344801.1| eep protein [Streptococcus pneumoniae TIGR4] >gi|111658323|ref|ZP_01409012.1| hypothetical protein SpneT_02000513 [Streptococcus pneumoniae TIGR4] >gi|20978830|sp|Q97SR2|Y263_STRPN Putative zinc metalloprotease SP_0263 >gi|14971733|gb|AAK74441.1| eep protein [Streptococcus pneumoniae TIGR4] (419 aa)
Score = 122, Expect = 5.6e-05, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L +L   ++  I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     2 LGILTFILVFGIIV--VVHEFGHFYFAKKSGILVREFAIGMGPKIFAHIGKDGTAYTIRILPLGGYVRM 68
>gi|148988003|ref|ZP_01819466.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP6-BS73] >gi|147926467|gb|EDK77540.1| Holliday junction DNA helicase B [Streptococcus pneumoniae SP6-BS73] (419 aa)
Score = 121, Expect = 5.7e-05, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L +L   ++  I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     2 LGILTFILVFGIIV--VVHEFGHFYFAKKSGILVREFAIGMGPKIFAHIGKDGTAYTIRILPLGGYVRM 68
>gi|168485971|ref|ZP_02710479.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC1087-00] >gi|183570898|gb|EDT91426.1| RIP metalloprotease RseP [Streptococcus pneumoniae CDC1087-00] (419 aa)
Score = 121, Expect = 5.9e-05, Identities = 27/68 (39%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L +L   ++  I+V   +HE GHF FAK   + V+EFAIG+GPKI++    +   ++I +LP+  +VR+
  S:     2 LGILTFILVFGIIV--VVHEFGHFYFAKKSGILVREFAIGMGPKIFAHIGKDGTAYTIRILPLGGYVRM 68
>gi|167730440|emb|CAO81352.1| putative zinc metallopeptidase [Candidatus Cloacamonas acidaminovorans] (432 aa)
Score = 121, Expect = 6.0e-05, Identities = 23/71 (32%), Positives = 44/71 (61%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           L LLV  I   +M+   +HE+GHF+ A+ FKV ++ F+IG G  I++ +   I++ +  +P+  +V++  +
  S:     2 LTLLVTIIAFGLMI--FVHELGHFLVARSFKVGIESFSIGFGKAIWTTEKNGIQYRVGWIPLGGYVKMQGE 70
>gi|95928701|ref|ZP_01311447.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Desulfuromonas acetoxidans DSM 684] >gi|95135046|gb|EAT16699.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Desulfuromonas acetoxidans DSM 684] (440 aa)
Score = 121, Expect = 6.3e-05, Identities = 23/66 (34%), Positives = 44/66 (66%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + V+  +L + V + IHE+GHF  AKL  V V +F++G GP++ S+ +   ++ I+L+P+  +V++
  S:     2 ITVVAGILMLGVLVFIHELGHFCVAKLAGVKVLKFSLGFGPRLVSRTWGETEYLISLIPLGGYVQM 67
>gi|51892638|ref|YP_075329.1| putative membrane-associated Zn-dependent protease [Symbiobacterium thermophilum IAM 14863] >gi|51856327|dbj|BAD40485.1| putative membrane-associated Zn-dependent protease [Symbiobacterium thermophilum IAM 14863] (344 aa)
Score = 121, Expect = 6.4e-05, Identities = 24/68 (35%), Positives = 38/68 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L+ + +F L+  M     HE+GHF  AK F + V EFA+G GP +        ++S+  +P+  FVR+
  S:     7 LWAIPVFGLMIFM-----HELGHFAVAKFFDIRVHEFALGFGPALVGFNRGETRYSLRAIPLGGFVRM 69
>gi|190343268|gb|ACE75656.1| peptidase M50 [Candidatus Nitrospira defluvii] (463 aa)
Score = 121, Expect = 7.0e-05, Identities = 27/84 (32%), Positives = 51/84 (60%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQ 87
           FL+V+ +L+A       HE+GHF+ A+   V V +F++G GPKI+ +Q    ++ ++++P+  +V++        FGE  DE++
  S:    22 FLVVLGVLVAF------HEMGHFLAARWVGVKVLKFSLGFGPKIFGRQIGETEYLLSIVPLGGYVKL--------FGE--DEHE 89
>gi|62424986|ref|ZP_00380125.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Brevibacterium linens BL2] (488 aa)
Score = 121, Expect = 7.1e-05, Identities = 20/62 (32%), Positives = 36/62 (58%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           ++  L+ I + + +HE+GH V AK F V V  + +G GP ++S +    ++ I  LP+  F+
  S:    10 IVLFLIGISISIGLHELGHLVPAKKFGVKVTHYMVGFGPTVFSFRRGETEYGIKALPLGGFI 71
>gi|57242164|ref|ZP_00370104.1| membrane-associated zinc metalloprotease, putative [Campylobacter upsaliensis RM3195] >gi|57017356|gb|EAL54137.1| membrane-associated zinc metalloprotease, putative [Campylobacter upsaliensis RM3195] (368 aa)
Score = 121, Expect = 7.1e-05, Identities = 25/73 (34%), Positives = 44/73 (60%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSL 76
           FL  IF++  ++     HE+GHF+ AK   V V+ F+IG G  ++ K+F N K+ ++ LP+  +V++  +  L
  S:    22 FLATIFVISFLIF---FHELGHFLAAKSLGVRVEIFSIGFGKALFEKEFKNTKYRLSALPLGGYVKLKGQDDL 91
>gi|29829104|ref|NP_823738.1| metalloprotease [Streptomyces avermitilis MA-4680] >gi|29606210|dbj|BAC70273.1| putative metalloprotease [Streptomyces avermitilis MA-4680] (434 aa)
Score = 120, Expect = 8.0e-05, Identities = 18/68 (26%), Positives = 43/68 (63%)
  Q:     3 LFLLVIFIL-LAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +F+L I +  + +++ +  HE+GH   AKLF + V ++ +G GP ++S++    ++ +  +P+  ++R+
  S:     5 MFILGIVVFAIGLLISIAWHELGHLSTAKLFGIRVPQYMVGFGPTVWSRKKGETEYGVKAVPLGGYIRM 73
>gi|78042913|ref|YP_360597.1| putative membrane-associated zinc metalloprotease [Carboxydothermus hydrogenoformans Z-2901] >gi|77995028|gb|ABB13927.1| putative membrane-associated zinc metalloprotease [Carboxydothermus hydrogenoformans Z-2901] (343 aa)
Score = 120, Expect = 8.2e-05, Identities = 26/65 (40%), Positives = 41/65 (63%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +VIF LL     + IHE+GHF+ AK   + VKEF+IG GP +   +    ++S+ L+P+  FV++
  S:     8 IVIFFLL-----IWIHELGHFLAAKKVGIVVKEFSIGFGPLLAKTRKKETQYSLRLIPLGGFVKM 67
>gi|196036921|ref|ZP_03104305.1| putative membrane-associated zinc metalloprotease [Bacillus cereus W] >gi|196042169|ref|ZP_03109452.1| putative membrane-associated zinc metalloprotease [Bacillus cereus NVH0597-99] >gi|195990476|gb|EDX54460.1| putative membrane-associated zinc metalloprotease [Bacillus cereus W] >gi|196027021|gb|EDX65645.1| putative membrane-associated zinc metalloprotease [Bacillus cereus NVH0597-99] (418 aa)
Score = 120, Expect = 8.2e-05, Identities = 23/50 (46%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+
  S:    18 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRM 67
>gi|49478393|ref|YP_037881.1| membrane-associated zinc metalloprotease [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141668|ref|YP_085161.1| membrane-associated zinc metalloprotease [Bacillus cereus E33L] >gi|118479042|ref|YP_896193.1| peptidase RseP [Bacillus thuringiensis str. Al Hakam] >gi|166994474|ref|ZP_02260934.1| membrane-associated zinc metalloprotease [Bacillus cereus AH820] >gi|49329949|gb|AAT60595.1| membrane-associated zinc metalloprotease [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51975137|gb|AAU16687.1| membrane-associated zinc metalloprotease [Bacillus cereus E33L] >gi|118418267|gb|ABK86686.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Bacillus thuringiensis str. Al Hakam] (420 aa)
Score = 120, Expect = 8.2e-05, Identities = 23/50 (46%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+
  S:    20 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRM 69
>gi|196044632|ref|ZP_03111867.1| putative membrane-associated zinc metalloprotease [Bacillus cereus 03BB108] >gi|196024667|gb|EDX63339.1| putative membrane-associated zinc metalloprotease [Bacillus cereus 03BB108] (418 aa)
Score = 120, Expect = 8.7e-05, Identities = 23/50 (46%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+
  S:    18 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRM 67
>gi|163753615|ref|ZP_02160738.1| membrane-associated zinc metalloprotease [Kordia algicida OT-1] >gi|161325829|gb|EDP97155.1| membrane-associated zinc metalloprotease [Kordia algicida OT-1] (444 aa)
Score = 120, Expect = 8.7e-05, Identities = 47/199 (23%), Positives = 74/199 (37%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGP--KIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPFIQIGDSF 199
           +GLF+ +   +L I + + +HE+GHF+ AKLFK  V++F +   P   I  K+  +  + I  LP+  +V+I         G + +   KE  E                        +    W  R+K                           P WQ+LII  GG+  N +L  + Y+           P  QI D  
  S:     1 MGLFIQITTFVLIISILVILHELGHFIPAKLFKTKVEKFYLFFDPWFSIVKKKIGDTVYGIGWLPLGGYVKIA--------GMIDESMDKEQME------------------------KPPQPWEFRSK---------------------------PAWQRLIIMLGGVIVNFLLAWVIYISMFMYYGETYIPVDQIKDGL 142
>gi|89209767|ref|ZP_01188162.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Halothermothrix orenii H 168] >gi|89160836|gb|EAR80489.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Halothermothrix orenii H 168] (357 aa)
Score = 120, Expect = 8.9e-05, Identities = 25/66 (37%), Positives = 42/66 (63%)
  Q:     5 LLVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +L   I   I++G+ I  HE GH++ AK   + V+EFA+G GP+++S+Q     +SI  LP+  F ++
  S:     1 MLTTIISFIIVLGILIFIHEFGHYITAKKAGIRVEEFALGYGPRLFSRQKGETVYSIRALPLGGFCKM 68
>gi|30263824|ref|NP_846201.1| membrane-associated zinc metalloprotease, putative [Bacillus anthracis str. Ames] >gi|47529248|ref|YP_020597.1| membrane-associated zinc metalloprotease, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186670|ref|YP_029922.1| membrane-associated zinc metalloprotease, putative [Bacillus anthracis str. Sterne] >gi|65321147|ref|ZP_00394106.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Bacillus anthracis str. A2012] >gi|30258468|gb|AAP27687.1| membrane-associated zinc metalloprotease, putative [Bacillus anthracis str. Ames] >gi|47504396|gb|AAT33072.1| membrane-associated zinc metalloprotease, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180597|gb|AAT55973.1| membrane-associated zinc metalloprotease, putative [Bacillus anthracis str. Sterne] (420 aa)
Score = 120, Expect = 8.9e-05, Identities = 23/50 (46%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+
  S:    20 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRM 69
>gi|124523263|ref|ZP_01697458.1| putative membrane-associated zinc metalloprotease [Bacillus coagulans 36D1] >gi|124495624|gb|EAY43298.1| putative membrane-associated zinc metalloprotease [Bacillus coagulans 36D1] (419 aa)
Score = 120, Expect = 9.0e-05, Identities = 38/101 (37%), Positives = 55/101 (54%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK-------KSLQVFGELRDEYQKEADEYYLQHKEILDGCEKY 107
           VI  +L     +  HE GHF  AK   +  +EFAIG GPKI S +    ++++ LLPI  +VR+  +       K  Q  G L DE   EA E     K +++G ++Y
  S:     4 VIAFILIFGSLVIFHEAGHFFVAKKAGILCREFAIGFGPKILSFKKNETQYTVRLLPIGGYVRMAGEDPDMPELKPGQRVGLLFDE--NEAVE-----KIVVNGKDRY 104
>gi|116333949|ref|YP_795476.1| membrane-associated Zn-dependent protease 1 [Lactobacillus brevis ATCC 367] >gi|116099296|gb|ABJ64445.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Lactobacillus brevis ATCC 367] (425 aa)
Score = 120, Expect = 9.1e-05, Identities = 22/53 (41%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPK-IYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EF+IG+GPK +Y +      +++ LLP+  +VR+
  S:    16 VIVHEFGHFYFAKRGGILVREFSIGMGPKLVYHRGKDGTTYTLRLLPVGGYVRV 69
>gi|165872600|ref|ZP_02217231.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0488] >gi|167635827|ref|ZP_02394136.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0442] >gi|167639836|ref|ZP_02398105.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0193] >gi|170687892|ref|ZP_02879106.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0465] >gi|170706845|ref|ZP_02897303.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0389] >gi|177652099|ref|ZP_02934645.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0174] >gi|190568390|ref|ZP_03021297.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis Tsiankovskii-I] >gi|164711632|gb|EDR17178.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0488] >gi|167512237|gb|EDR87614.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0193] >gi|167528784|gb|EDR91542.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0442] >gi|170128263|gb|EDS97132.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0389] >gi|170668208|gb|EDT18957.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0465] >gi|172082468|gb|EDT67533.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis str. A0174] >gi|190560394|gb|EDV14372.1| putative membrane-associated zinc metalloprotease [Bacillus anthracis Tsiankovskii-I] (418 aa)
Score = 120, Expect = 9.2e-05, Identities = 23/50 (46%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH  FAK   +  +EFAIG GPKI+S +     ++I LLP+  +VR+
  S:    18 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTIRLLPLGGYVRM 67
>gi|91202698|emb|CAJ72337.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis] (603 aa)
Score = 120, Expect = 9.2e-05, Identities = 30/94 (31%), Positives = 48/94 (51%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEI 100
           VI ++  I + + IHE+GHF+ AK     V  F++G GP I  KQ+   ++ ++L P+  +V++         GE  DE +K    Y    K I
  S:    10 VILVIAGIGLLIFIHELGHFLMAKKIGARVLAFSLGFGPAILKKQWGETEYRLSLFPLGGYVKLA--------GENPDE-EKTGASYEFSSKSI 94
>gi|152965396|ref|YP_001361180.1| peptidase M50 [Kineococcus radiotolerans SRS30216] >gi|151359913|gb|ABS02916.1| peptidase M50 [Kineococcus radiotolerans SRS30216] (439 aa)
Score = 120, Expect = 9.3e-05, Identities = 38/164 (23%), Positives = 75/164 (45%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQST--WHV---RAKYNSYLK--KIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFN 170
           ++   + + V + +HE+GH + AK F V V ++ +G GP ++S++    ++ +  +P+  +VR+     + +F    D                             G+LR  ST  W +    A+  S+++    +++  F R          +P WQ+++I FGG F N
  S:    11 ILVAAVGVAVSIALHEVGHLLPAKRFGVKVVQYMVGFGPTLFSRRRGETEYGVKAIPLGGYVRM-----IGMFPPGPD-----------------------------GRLRASSTGRWALMAEEARRASFVEVGPGEEHRTFYR----------LPVWQRIVIMFGGPFVN 137
>gi|194332967|ref|YP_002014827.1| membrane-associated zinc metalloprotease [Prosthecochloris aestuarii DSM 271] >gi|194310785|gb|ACF45180.1| membrane-associated zinc metalloprotease [Prosthecochloris aestuarii DSM 271] (453 aa)
Score = 120, Expect = 9.4e-05, Identities = 46/201 (22%), Positives = 83/201 (41%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGI---GPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNS----NPF------------IQIGDSFLTILKNMVFY 209
           + ++AI + +T+HE+GHF+ AKLF + V +F IG      + + KQ    ++ I + P+  +V+I           + DE                       +++ + Q +    W  RAK                           P WQ+LI+  GG+  N++L    ++   +    +     NP             +Q GD F+++    V Y
  S:     9 YFIIAIFILVTVHELGHFLTAKLFGMRVDKFYIGFDFYNLRFWKKQIGETEYGIGVFPLGGYVKI---------AGMVDE-----------------------SLDTDFQEKDPEPWEFRAK---------------------------PVWQRLIVLAGGVVMNMVLAAAIFIGMASVFGESRTSTLNPAYVAKGSVYEAMGMQTGDRFVSVNGKQVSY 169
>gi|23013457|ref|ZP_00053350.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Magnetospirillum magnetotacticum MS-1] (385 aa)
Score = 120, Expect = 9.7e-05, Identities = 25/67 (37%), Positives = 45/67 (67%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           + LVIF+++  +V + +HE GHF+ A+   V V+ F+IG GP+++ +   N  ++ I LLP+  FV++
  S:    16 YYLVIFLVILTVV-VFVHEFGHFLVARWNGVKVEVFSIGFGPEVWGRVAANGTRWRIGLLPLGGFVKM 82
>gi|146297350|ref|YP_001181121.1| putative membrane-associated zinc metalloprotease [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410926|gb|ABP67930.1| putative membrane-associated zinc metalloprotease [Caldicellulosiruptor saccharolyticus DSM 8903] (350 aa)
Score = 119, Expect = 9.8e-05, Identities = 27/65 (41%), Positives = 41/65 (63%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR 69
           LL+  I+L I++   IHE GHF+  KL  V V+EFA+G GPKI+S +    ++S+    I  +V+
  S:     4 LLIALIVLTIVI--LIHEFGHFIVCKLSGVLVEEFALGFGPKIFSIKGKETEYSVRAFLIGGYVK 66
>gi|134299816|ref|YP_001113312.1| putative membrane-associated zinc metalloprotease [Desulfotomaculum reducens MI-1] >gi|134052516|gb|ABO50487.1| putative membrane-associated zinc metalloprotease [Desulfotomaculum reducens MI-1] (347 aa)
Score = 119, Expect = 1.0e-04, Identities = 25/62 (40%), Positives = 39/62 (62%)
  Q:     9 FILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           FI    + GL I  HE+GHF+ AK   + V EF++G GPK++       ++++ LLP+  FVR+
  S:     4 FIASVAVFGLLIFFHELGHFLVAKKVGIMVHEFSLGFGPKVFGFNRGETRYNLRLLPLGGFVRM 67
>gi|56964000|ref|YP_175731.1| Zn-dependent protease [Bacillus clausii KSM-K16] >gi|81678862|sp|Q5WFT5|RASP_BACSK Zinc metalloprotease rasP (Regulating anti-sigma-W factor activity protease) (Regulating alternative sigma factor protease) >gi|56910243|dbj|BAD64770.1| Zn-dependent protease [Bacillus clausii KSM-K16] (418 aa)
Score = 119, Expect = 1.0e-04, Identities = 26/73 (35%), Positives = 44/73 (60%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           LL    + +++V   +HE GH  FAK   +   EFAIG+GPK+++ +  +  ++I LLPI  +VR+  ++  Q
  S:     4 LLAFIAIFSVLV--FVHEWGHLYFAKKAGILCYEFAIGMGPKLFAFERNDTIYTIRLLPIGGYVRMAGEEPEQ 74
>gi|157737117|ref|YP_001489800.1| membrane-associated zinc metalloprotease, putative [Arcobacter butzleri RM4018] >gi|157698971|gb|ABV67131.1| membrane-associated zinc metalloprotease, putative [Arcobacter butzleri RM4018] (352 aa)
Score = 119, Expect = 1.1e-04, Identities = 30/74 (40%), Positives = 44/74 (59%)
  Q:     8 IFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI----DSKKSLQVFGE 81
           I  LL +   +  HE+GHF+ AK F V V  F+IG G +IYSK +    + I L+P+  +V++    DS  +L   GE
  S:     4 ITFLLVLSFLVFFHELGHFLAAKFFGVKVHTFSIGFGKQIYSKYWKGTTWQIALIPLGGYVKMKGQDDSNPALIEDGE 81
>gi|167040290|ref|YP_001663275.1| putative membrane-associated zinc metalloprotease [Thermoanaerobacter sp. X514] >gi|166854530|gb|ABY92939.1| putative membrane-associated zinc metalloprotease [Thermoanaerobacter sp. X514] (332 aa)
Score = 119, Expect = 1.1e-04, Identities = 23/69 (33%), Positives = 42/69 (60%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           +L+  I+L+++V    HE GHF+ AKL    V EF+IG GP+++ K++   ++S   L    +V ++ +
  S:     3 ILISIIVLSVLV--MFHEFGHFIVAKLSGARVNEFSIGFGPRLFKKKYGETEYSFRALLFGGYVALEGE 69
>gi|167037629|ref|YP_001665207.1| putative membrane-associated zinc metalloprotease [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856463|gb|ABY94871.1| putative membrane-associated zinc metalloprotease [Thermoanaerobacter pseudethanolicus ATCC 33223] (332 aa)
Score = 119, Expect = 1.1e-04, Identities = 23/69 (33%), Positives = 42/69 (60%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           +L+  I+L+++V    HE GHF+ AKL    V EF+IG GP+++ K++   ++S   L    +V ++ +
  S:     3 ILISIIVLSVLV--MFHEFGHFIVAKLSGARVNEFSIGFGPRLFKKKYGETEYSFRALLFGGYVALEGE 69
>gi|32267180|ref|NP_861212.1| hypothetical protein HH1681 [Helicobacter hepaticus ATCC 51449] >gi|32263233|gb|AAP78278.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] (351 aa)
Score = 119, Expect = 1.1e-04, Identities = 26/68 (38%), Positives = 43/68 (63%)
  Q:     6 LVIFILLAIMVGLTI-HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           + IFI L I+  L   HE+GHF  A+L  V V+ F+IG G KI S Q    +++++L+P+  +V++  +
  S:     1 MSIFIALIILSFLVFFHELGHFFVARLCGVRVEVFSIGFGKKIASVQIGQTQYALSLIPLGGYVKLKGQ 69
>gi|152976186|ref|YP_001375703.1| putative membrane-associated zinc metalloprotease [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024938|gb|ABS22708.1| putative membrane-associated zinc metalloprotease [Bacillus cereus subsp. cytotoxis NVH 391-98] (418 aa)
Score = 119, Expect = 1.3e-04, Identities = 22/50 (44%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH  FAK   +  +EFAIG GPKI+S +     +++ LLP+  +VR+
  S:    18 HELGHLYFAKRAGILCREFAIGFGPKIFSFEKNETVYTVRLLPLGGYVRM 67
>gi|21224044|ref|NP_629823.1| metalloprotease [Streptomyces coelicolor A3(2)] >gi|20978852|sp|Q9KYS0|Y5695_STRCO Putative zinc metalloprotease SCO5695 >gi|7801267|emb|CAB91131.1| putative metalloprotease [Streptomyces coelicolor A3(2)] (430 aa)
Score = 118, Expect = 1.3e-04, Identities = 17/68 (25%), Positives = 42/68 (61%)
  Q:     3 LFLL-VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +F+L ++   + ++  +  HE+GH   AK+F + V ++ +G GP ++SK+  + ++ +  +P   ++R+
  S:     1 MFILGIVLFAVGLLFSIAWHELGHLSTAKMFGIRVPQYMVGFGPTLFSKKKGDTEYGVKAIPFGGYIRM 69
>gi|177670880|ref|ZP_02943970.1| peptidase M50 [Micrococcus luteus NCTC 2665] >gi|172072308|gb|EDT58345.1| peptidase M50 [Micrococcus luteus NCTC 2665] (455 aa)
Score = 118, Expect = 1.3e-04, Identities = 28/86 (32%), Positives = 48/86 (55%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV---------------RIDSKKSLQVFGELRDEYQKEADE 92
           V+ + L + V + +HE+GH V AKLF V V ++ IG GP + S +    ++    +P+  +V               R  S   +Q  G + D+ + +A E
  S:    13 VLAVALGLAVSIALHEVGHLVPAKLFGVRVTQYMIGFGPALVSWRRGETEYGFKAVPLGGYVAMIGMLPPPRPGQTPRTASTGFVQQLGRMADDARAQAAE 113
>gi|115374981|ref|ZP_01462252.1| membrane-associated zinc metalloprotease, putative [Stigmatella aurantiaca DW4/3-1] >gi|115368008|gb|EAU66972.1| membrane-associated zinc metalloprotease, putative [Stigmatella aurantiaca DW4/3-1] (537 aa)
Score = 118, Expect = 1.3e-04, Identities = 25/70 (35%), Positives = 42/70 (60%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +GLF L++ +L+      T+HE+GHF+ AK   V V +F+ G GPK+        ++ I LLP+  +V++
  S:     5 IGLFALLLGVLV------TVHELGHFLVAKACGVKVLKFSFGFGPKLLGFVKGETEYQIALLPLGGYVKM 68
>gi|110800806|ref|YP_696997.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens ATCC 13124] >gi|110675453|gb|ABG84440.1| putative membrane-associated zinc metalloprotease [Clostridium perfringens ATCC 13124] (262 aa)
Score = 118, Expect = 1.3e-04, Identities = 24/65 (36%), Positives = 41/65 (63%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           +I   +A+ + + IHE+GH++  K FK+ VK F+IG GPK++  +  N  F+  L+P+  +V  D
  S:     3 IINFTIAMYLSIFIHELGHYLSCKAFKIPVKTFSIGFGPKLFRFKKFNTDFTFKLIPMGGYVYND 67
>gi|194014586|ref|ZP_03053203.1| RIP metalloprotease RseP [Bacillus pumilus ATCC 7061] >gi|194013612|gb|EDW23177.1| RIP metalloprotease RseP [Bacillus pumilus ATCC 7061] (419 aa)
Score = 118, Expect = 1.5e-04, Identities = 31/79 (39%), Positives = 46/79 (58%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK-------KSLQVFGELRDEYQKEADEYYLQHKE 99
           HE+GH + A+   +  +EFAIG GPKI+S +     ++I LLPI  FV++  +       K     G L +E Q E ++  L  KE
  S:    18 HELGHLIMAQRAGILCREFAIGFGPKIFSFKRKETVYTIRLLPIGGFVKMAGEDPEVIEIKPGHTVGLLFNE-QNEVEKIILNDKE 102
>gi|157692335|ref|YP_001486797.1| M50 family peptidase [Bacillus pumilus SAFR-032] >gi|157681093|gb|ABV62237.1| M50 family peptidase [Bacillus pumilus SAFR-032] (421 aa)
Score = 118, Expect = 1.5e-04, Identities = 31/79 (39%), Positives = 46/79 (58%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK-------KSLQVFGELRDEYQKEADEYYLQHKE 99
           HE+GH + A+   +  +EFAIG GPKI+S +     ++I LLPI  FV++  +       K     G L +E Q E ++  L  KE
  S:    20 HELGHLIMAQRAGILCREFAIGFGPKIFSFKRKETVYTIRLLPIGGFVKMAGEDPEVIEIKPGHTVGLLFNE-QNEVEKIILNDKE 104
>gi|50954882|ref|YP_062170.1| zinc metalloprotease [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951364|gb|AAT89065.1| zinc metalloprotease [Leifsonia xyli subsp. xyli str. CTCB07] (443 aa)
Score = 118, Expect = 1.6e-04, Identities = 38/179 (21%), Positives = 84/179 (46%)
  Q:     1 VGLFLL-VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRD-EYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNL----ILFGLFYL 179
           V LF+L V+ +L+ +   + +HE+GH V AKLF V V ++ +G G  ++S +    ++ +  +P+  ++ +     + +F   ++    + A   ++Q            T+ ++ ++    T  V  +  ++ +                    +P W++++I F G F NL    +LFG+  +
  S:     4 VLLFILGVVVVLIGLAASIALHEVGHLVPAKLFGVKVTQYMVGFGKTLFSVRRGETEYGLKAIPLGGYISM-----IGMFPPGKEGGAGRNATTGFMQ------------TMVQDARVASAETVKVGEEERTFYR--------------------LPVWKRIVIMFSGPFMNLLIAVVLFGVLLM 151
>gi|121533723|ref|ZP_01665550.1| putative membrane-associated zinc metalloprotease [Thermosinus carboxydivorans Nor1] >gi|121307714|gb|EAX48629.1| putative membrane-associated zinc metalloprotease [Thermosinus carboxydivorans Nor1] (343 aa)
Score = 118, Expect = 1.6e-04, Identities = 25/61 (40%), Positives = 39/61 (63%)
  Q:    10 ILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           I    + GL I  HE+GHF+ AK+  + V EFAIG GPK++S +     +S+ ++P+  F +I
  S:     6 IATVFVFGLLIFFHELGHFITAKMVGMRVHEFAIGFGPKLWSCKKGETVYSLRVIPLGGFNKI 68
>gi|20807848|ref|NP_623019.1| membrane-associated Zn-dependent protease 1 [Thermoanaerobacter tengcongensis MB4] >gi|20516411|gb|AAM24623.1| predicted membrane-associated Zn-dependent protease 1 [Thermoanaerobacter tengcongensis MB4] (332 aa)
Score = 118, Expect = 1.6e-04, Identities = 21/69 (30%), Positives = 40/69 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           + +I  ++ + V +  HE GHF+ AKL    V EF+IG GP+++ K++   ++S   L    +V ++ +
  S:     1 MTIILSIIVLSVLVMFHEFGHFIVAKLSGARVNEFSIGFGPRLFKKKYGETEYSFRALLFGGYVALEGE 69
>gi|22538052|ref|NP_688903.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae 2603V/R] >gi|25011940|ref|NP_736335.1| hypothetical protein gbs1901 [Streptococcus agalactiae NEM316] >gi|76798735|ref|ZP_00780954.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae 18RS21] >gi|77414700|ref|ZP_00790832.1| putative membrane-associated zinc metalloprotease [Streptococcus agalactiae 515] >gi|22534956|gb|AAN00776.1|AE014278_3 membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae 2603V/R] >gi|24413482|emb|CAD47560.1| Unknown [Streptococcus agalactiae NEM316] >gi|76585914|gb|EAO62453.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae 18RS21] >gi|77159244|gb|EAO70423.1| putative membrane-associated zinc metalloprotease [Streptococcus agalactiae 515] (419 aa)
Score = 118, Expect = 1.6e-04, Identities = 26/50 (52%), Positives = 37/50 (74%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYS---KQFTNIKFSINLLPIMAFVRI 70
           HE GHF FAK   + V+EFAIG+GPKI+S   K+ T   ++I +LP+  +VR+
  S:    18 HEFGHFYFAKKSGILVREFAIGMGPKIFSHIDKEGTT--YTIRILPLGGYVRM 68
>gi|149198076|ref|ZP_01875123.1| hypothetical zinc metalloprotease [Lentisphaera araneosa HTCC2155] >gi|149138678|gb|EDM27084.1| hypothetical zinc metalloprotease [Lentisphaera araneosa HTCC2155] (533 aa)
Score = 117, Expect = 1.7e-04, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L ++F+       + IHE+GH + A   K++V +F+IG G +I SK++ NI F I  LP+  +V +
  S:     9 LSIVFVAFFFGFSIFIHELGHMLAALWRKMHVDKFSIGFGHRILSKRWKNIDFVIGWLPLGGYVAL 74
>gi|77412301|ref|ZP_00788616.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae CJB111] >gi|77161648|gb|EAO72644.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae CJB111] (419 aa)
Score = 117, Expect = 1.8e-04, Identities = 26/50 (52%), Positives = 37/50 (74%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYS---KQFTNIKFSINLLPIMAFVRI 70
           HE GHF FAK   + V+EFAIG+GPKI+S   K+ T   ++I +LP+  +VR+
  S:    18 HEFGHFYFAKKSGILVREFAIGMGPKIFSHIDKEGTT--YTIRILPLGGYVRM 68
>gi|157150783|ref|YP_001451118.1| membrane-associated zinc metalloprotease, putative [Streptococcus gordonii str. Challis substr. CH1] >gi|157075577|gb|ABV10260.1| membrane-associated zinc metalloprotease, putative [Streptococcus gordonii str. Challis substr. CH1] (417 aa)
Score = 117, Expect = 1.8e-04, Identities = 24/50 (48%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           HE GHF FAK   + V+EFAIG+GPKI+S    +   ++I +LP+  +VR+
  S:    17 HEYGHFYFAKKSGILVREFAIGMGPKIFSHIGKDGTAYTIRILPLGGYVRM 67
>gi|94985147|ref|YP_604511.1| peptidase M50 [Deinococcus geothermalis DSM 11300] >gi|94555428|gb|ABF45342.1| peptidase M50 and PDZ domain [Deinococcus geothermalis DSM 11300] (372 aa)
Score = 117, Expect = 1.8e-04, Identities = 22/65 (33%), Positives = 40/65 (61%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           +++ L+ I V   +HE+ HF  A+   V VK F++G+GP +  + +   ++ ++LLPI  +V ID
  S:    16 LLWTLVIIGVATFLHELAHFALARWQGVAVKTFSVGMGPVLLRRVWRGTEWRLSLLPIGGYVEID 80
>gi|91775876|ref|YP_545632.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Methylobacillus flagellatus KT] >gi|91709863|gb|ABE49791.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Methylobacillus flagellatus KT] (455 aa)
Score = 117, Expect = 1.8e-04, Identities = 26/82 (31%), Positives = 47/82 (57%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF--TNIKFSINLLPIMAFVRIDSKKSLQVFGELRD 84
           L L+   + L I++   +HE GHF  A+   V V  F++G G  I+S++F   N +F I+ LP+  +V++  ++ L   G + +
  S:     2 LTLIAFLVTLGILIA--VHEYGHFQVARWCNVKVLRFSLGFGKPIFSRRFGADNTEFVISALPLGGYVKMLDERELPTPGAVSE 83
>gi|16078719|ref|NP_389538.1| hypothetical protein BSU16560 [Bacillus subtilis subsp. subtilis str. 168] >gi|20978800|sp|O31754|RASP_BACSU Zinc metalloprotease rasP (Regulating anti-sigma-W factor activity protease) (Regulating alternative sigma factor protease) >gi|2634028|emb|CAB13529.1| yluC [Bacillus subtilis subsp. subtilis str. 168] (422 aa)
Score = 117, Expect = 1.8e-04, Identities = 22/50 (44%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH + A+   +  +EFAIG GPKI+S +     ++I LLP+  FVR+
  S:    20 HELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETVYTIRLLPVGGFVRM 69
>gi|76788389|ref|YP_330467.1| M50A family peptidase [Streptococcus agalactiae A909] >gi|77405663|ref|ZP_00782751.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae H36B] >gi|77409696|ref|ZP_00786361.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae COH1] >gi|76563446|gb|ABA46030.1| peptidase, M50A (S2P peptidase) subfamily [Streptococcus agalactiae A909] >gi|77171694|gb|EAO74898.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae COH1] >gi|77175736|gb|EAO78517.1| membrane-associated zinc metalloprotease, putative [Streptococcus agalactiae H36B] (419 aa)
Score = 117, Expect = 1.8e-04, Identities = 26/50 (52%), Positives = 37/50 (74%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYS---KQFTNIKFSINLLPIMAFVRI 70
           HE GHF FAK   + V+EFAIG+GPKI+S   K+ T   ++I +LP+  +VR+
  S:    18 HEFGHFYFAKKSGILVREFAIGMGPKIFSHIDKEGTT--YTIRILPLGGYVRM 68
>gi|154686073|ref|YP_001421234.1| YluC [Bacillus amyloliquefaciens FZB42] >gi|154351924|gb|ABS74003.1| YluC [Bacillus amyloliquefaciens FZB42] (420 aa)
Score = 117, Expect = 1.9e-04, Identities = 22/50 (44%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GH + A+   +  +EFAIG GPKI+S +     ++I LLP+  FVR+
  S:    18 HELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETVYTIRLLPVGGFVRM 67
>gi|125718858|ref|YP_001035991.1| Zinc metalloprotease, putative [Streptococcus sanguinis SK36] >gi|125498775|gb|ABN45441.1| Zinc metalloprotease, putative [Streptococcus sanguinis SK36] (418 aa)
Score = 117, Expect = 1.9e-04, Identities = 24/50 (48%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           HE GHF FAK   + V+EFAIG+GPKI+S    +   ++I +LP+  +VR+
  S:    17 HEFGHFYFAKKSGILVREFAIGMGPKIFSHIGKDGTAYTIRILPLGGYVRM 67
>gi|94991251|ref|YP_599351.1| M50 family membrane endopeptidase [Streptococcus pyogenes MGAS10270] >gi|94544759|gb|ABF34807.1| Membrane endopeptidase, M50 family [Streptococcus pyogenes MGAS10270] (419 aa)
Score = 117, Expect = 2.0e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|15675761|ref|NP_269935.1| may be involved in production of a peptide sex pheromone [Streptococcus pyogenes M1 GAS] >gi|20978835|sp|Q99XY3|Y1963_STRP1 Putative zinc metalloprotease SPy_1963/M5005_Spy1674 >gi|13622983|gb|AAK34656.1| may be involved in production of a peptide sex pheromone [Streptococcus pyogenes M1 GAS] (419 aa)
Score = 117, Expect = 2.0e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|71911487|ref|YP_283037.1| pheromone-processing membrane metalloprotease [Streptococcus pyogenes MGAS5005] >gi|71854269|gb|AAZ52292.1| pheromone-processing membrane metalloprotease [Streptococcus pyogenes MGAS5005] (419 aa)
Score = 117, Expect = 2.0e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|19746873|ref|NP_608009.1| hypothetical protein spyM18_2031 [Streptococcus pyogenes MGAS8232] >gi|139474449|ref|YP_001129165.1| putative pheromone-processing membrane metalloprotease [Streptococcus pyogenes str. Manfredo] >gi|73921074|sp|Q8NZB3|Y2031_STRP8 Putative zinc metalloprotease spyM18_2031 >gi|19749115|gb|AAL98508.1| hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|134272696|emb|CAM30967.1| putative pheromone-processing membrane metalloprotease [Streptococcus pyogenes str. Manfredo] (419 aa)
Score = 117, Expect = 2.0e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|168043020|ref|XP_001773984.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162674669|gb|EDQ61174.1| predicted protein [Physcomitrella patens subsp. patens] (387 aa)
Score = 117, Expect = 2.1e-04, Identities = 20/51 (39%), Positives = 35/51 (68%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +T+HE GHF+ A+L  ++V +FAIG GP I   +  N+++S+  +P+  +V
  S:    40 VTVHEAGHFLAARLQGIHVTQFAIGFGPPIAKFKSKNVEYSLRAVPLGGYV 90
>gi|71904324|ref|YP_281127.1| pheromone-processing membrane metalloprotease [Streptococcus pyogenes MGAS6180] >gi|71803419|gb|AAX72772.1| pheromone-processing membrane metalloprotease [Streptococcus pyogenes MGAS6180] (419 aa)
Score = 117, Expect = 2.1e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|196187153|gb|EDX82129.1| RIP metalloprotease RseP [Brevundimonas sp. BAL3] (405 aa)
Score = 117, Expect = 2.1e-04, Identities = 23/67 (34%), Positives = 42/67 (62%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVR 69
           + + ++  LL +   +TIHE+GHF+ A+ F V V  FAIG G  I+S+   + I++ +  +P+  +V+
  S:     8 ILIYIVPFLLVLTFIVTIHELGHFLVARAFGVKVDRFAIGFGKAIFSRTDRHGIEWRLGWMPLGGYVK 75
>gi|193214755|ref|YP_001995954.1| membrane-associated zinc metalloprotease [Chloroherpeton thalassium ATCC 35110] >gi|193088232|gb|ACF13507.1| membrane-associated zinc metalloprotease [Chloroherpeton thalassium ATCC 35110] (453 aa)
Score = 117, Expect = 2.2e-04, Identities = 39/177 (22%), Positives = 70/177 (39%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGI---GPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYL 179
           LF  + + ++AI + +T+HE GHF  AKLF + V++F IG      K++S      ++ I  +P+  +V+I           + DE                       + + + Q R    W  R+K                           P WQ+LI+   G+  N++L  + ++
  S:     3 LFSTIFYFIVAIFILVTVHEFGHFAAAKLFGMRVEKFYIGFDFWNLKLWSTHRGETEYGIGAIPLGGYVKISG---------IIDE-----------------------SFDTDFQSRAPEPWEFRSK---------------------------PVWQRLIVLAAGVIMNMVLAAVIFI 123
>gi|94995164|ref|YP_603262.1| Membrane endopeptidase, M50 family [Streptococcus pyogenes MGAS10750] >gi|94548672|gb|ABF38718.1| Membrane endopeptidase, M50 family [Streptococcus pyogenes MGAS10750] (419 aa)
Score = 116, Expect = 2.2e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|94989305|ref|YP_597406.1| M50 family membrane endopeptidase [Streptococcus pyogenes MGAS9429] >gi|94993194|ref|YP_601293.1| M50 family membrane endopeptidase [Streptococcus pyogenes MGAS2096] >gi|94542813|gb|ABF32862.1| membrane endopeptidase, M50 family [Streptococcus pyogenes MGAS9429] >gi|94546702|gb|ABF36749.1| Membrane endopeptidase, M50 family [Streptococcus pyogenes MGAS2096] (419 aa)
Score = 116, Expect = 2.2e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|50915028|ref|YP_061000.1| pheromone-processing membrane metalloprotease [Streptococcus pyogenes MGAS10394] >gi|73921047|sp|Q5X9U6|Y1682_STRP6 Putative zinc metalloprotease M6_Spy1682 >gi|50904102|gb|AAT87817.1| Pheromone-processing membrane metalloprotease [Streptococcus pyogenes MGAS10394] (419 aa)
Score = 116, Expect = 2.2e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|25028460|ref|NP_738514.1| putative membrane-associated zinc metalloprotease [Corynebacterium efficiens YS-314] >gi|23493745|dbj|BAC18714.1| putative membrane-associated zinc metalloprotease [Corynebacterium efficiens YS-314] (404 aa)
Score = 116, Expect = 2.2e-04, Identities = 42/178 (23%), Positives = 70/178 (39%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL-FGLFYLIQVTA 184
           V+   L I V + +HE GH++ A+ F + V+ F IG GP ++S +     + +  +P+  F  I    +       +DE   E DE   QH+ +                              YLK                     P WQ++I+  GG+  N+I+ F + Y + VT+
  S:     8 VVLFFLGIAVTIALHEWGHYITARAFGMKVRRFFIGFGPSVFSVRRGETVYGLKAVPVGGFCDIAGMTA-------QDEL--EPDE---QHRAM------------------------------YLK---------------------PWWQRIIVLSGGVAMNIIVGFVVLYGVAVTS 123
>gi|83311590|ref|YP_421854.1| membrane-associated Zn-dependent protease 1 [Magnetospirillum magneticum AMB-1] >gi|82946431|dbj|BAE51295.1| Predicted membrane-associated Zn-dependent protease 1 [Magnetospirillum magneticum AMB-1] (385 aa)
Score = 116, Expect = 2.2e-04, Identities = 22/69 (31%), Positives = 45/69 (65%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           G++  V+  L+ + V + +HE+GHF+ A+   V V+ F+IG GP+++ +   +  ++ I LLP+  +V++
  S:    13 GVWYYVVIFLVILTVVVFVHELGHFLIARWNGVKVEVFSIGFGPEVWGRVAADGTRWRIGLLPLGGYVKM 82
>gi|21911225|ref|NP_665493.1| putative determinant for enhanced expression of pheromone [Streptococcus pyogenes MGAS315] >gi|28896603|ref|NP_802953.1| hypothetical protein SPs1691 [Streptococcus pyogenes SSI-1] >gi|73921048|sp|Q8K5S6|Y1689_STRP3 Putative zinc metalloprotease SpyM3_1689/SPs1691 >gi|21905438|gb|AAM80296.1| putative determinant for enhanced expression of pheromone [Streptococcus pyogenes MGAS315] >gi|28811857|dbj|BAC64786.1| hypothetical protein [Streptococcus pyogenes SSI-1] (419 aa)
Score = 116, Expect = 2.3e-04, Identities = 23/53 (43%), Positives = 36/53 (67%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EFAIG+GPKI+S        +++ +LP+  +VR+
  S:    15 VIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRMLPLGGYVRM 68
>gi|158520498|ref|YP_001528368.1| putative membrane-associated zinc metalloprotease [Desulfococcus oleovorans Hxd3] >gi|158509324|gb|ABW66291.1| putative membrane-associated zinc metalloprotease [Desulfococcus oleovorans Hxd3] (355 aa)
Score = 116, Expect = 2.5e-04, Identities = 19/66 (28%), Positives = 43/66 (65%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L  + I+L +++    HE+GHF+ A+LF V V++F++G GP+++  +     + ++ +P+  +V++
  S:     4 LFALIIVLGVLI--FFHELGHFLVARLFGVGVEKFSLGFGPRLFGFKSGITDYQVSAIPLGGYVKM 67
>gi|34558497|ref|NP_908312.1| putative integral membrane protein [Wolinella succinogenes DSM 1740] >gi|34481791|emb|CAE11212.1| PUTATIVE INTEGRAL MEMBRANE PROTEIN [Wolinella succinogenes] (354 aa)
Score = 116, Expect = 2.6e-04, Identities = 19/53 (35%), Positives = 37/53 (69%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           HE+GHF+ A+ F V V+ F+IG G KIY K + + +++++ +P+  +V++  +
  S:    17 HELGHFLAARWFGVKVEVFSIGFGHKIYKKVYGDTEYALSAIPLGGYVKMKGQ 69
>gi|189499091|ref|YP_001958561.1| membrane-associated zinc metalloprotease [Chlorobium phaeobacteroides BS1] >gi|189494532|gb|ACE03080.1| membrane-associated zinc metalloprotease [Chlorobium phaeobacteroides BS1] (453 aa)
Score = 116, Expect = 2.7e-04, Identities = 42/171 (24%), Positives = 66/171 (38%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGI---GPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYL 179
           + +LAI V +T HE+GHF+ AKLF + V +F IG      + + K+    ++ I + P+  +V+I       V   L  ++QK   E                             W  RAK                           P WQ+LI+  GG+  N+IL    ++
  S:     9 YFILAIFVLVTAHELGHFLTAKLFGMRVDKFYIGFDFYNLRFWKKKIGETEYGIGVFPLGGYVKIAG----MVDESLDTDFQKSEPE----------------------------PWEFRAK---------------------------PVWQRLIVLAGGVTMNMILAAAIFI 123
>gi|81428869|ref|YP_395869.1| putative membrane-associated zinc metalloendopeptidase [Lactobacillus sakei subsp. sakei 23K] >gi|78610511|emb|CAI55562.1| Putative membrane-associated zinc metalloendopeptidase [Lactobacillus sakei subsp. sakei 23K] (425 aa)
Score = 115, Expect = 3.0e-04, Identities = 19/53 (35%), Positives = 35/53 (66%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GHF  AK   + V+EF++G+GPK+++ +     ++I  LP+  +VR+
  S:    15 VVVHEFGHFYMAKRSGILVREFSVGMGPKLFATRKNGTTYTIRWLPLGGYVRM 67
>gi|57167949|ref|ZP_00367088.1| membrane-associated zinc metalloprotease, putative [Campylobacter coli RM2228] >gi|57020323|gb|EAL56992.1| membrane-associated zinc metalloprotease, putative [Campylobacter coli RM2228] (367 aa)
Score = 115, Expect = 3.1e-04, Identities = 23/75 (30%), Positives = 44/75 (58%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           +L I   +  HE+GHF+ AK   V V+ F+IG G  ++ ++F   K+ ++ LP+  +V++  +  +Q   E +D+
  S:    26 ILVISFLIFFHELGHFLAAKSLGVKVEIFSIGFGQSLFEREFKGTKYRLSALPLGGYVKLKGQDDMQPGLENQDQ 100
>gi|189345640|ref|YP_001942169.1| membrane-associated zinc metalloprotease [Chlorobium limicola DSM 245] >gi|189339787|gb|ACD89190.1| membrane-associated zinc metalloprotease [Chlorobium limicola DSM 245] (453 aa)
Score = 115, Expect = 3.1e-04, Identities = 22/62 (35%), Positives = 41/62 (66%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIG---IGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F ++AI + +T+HE+GHF+ AKLF + V +F IG      +++ K+    ++ I + P+  +V+I
  S:     9 FFIVAIFILVTVHELGHFLTAKLFGMRVDKFYIGFDFFNLRLWKKKIGETEYGIGVFPLGGYVKI 73
>gi|124026369|ref|YP_001015485.1| membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. NATL1A] >gi|123961437|gb|ABM76220.1| Predicted membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. NATL1A] (361 aa)
Score = 115, Expect = 3.3e-04, Identities = 28/66 (42%), Positives = 41/66 (62%)
  Q:    10 ILLAIMV-GLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKS 75
           +LL+I V GL I  HE GHF+ A L K+ V  F+IG GP +  K+   I +S+  LP+  FV    +++
  S:     3 VLLSIAVLGLLIFFHESGHFLAAVLQKIKVSGFSIGFGPALLKKEINGITYSLRSLPLGGFVSFPDEET 71
>gi|72382647|ref|YP_292002.1| hypothetical protein PMN2A_0808 [Prochlorococcus marinus str. NATL2A] >gi|72002497|gb|AAZ58299.1| YUP8H12.25 {{Arabidopsis thaliana}}-type protein. Metallo peptidase. MEROPS family M50B [Prochlorococcus marinus str. NATL2A] (361 aa)
Score = 115, Expect = 3.3e-04, Identities = 28/66 (42%), Positives = 41/66 (62%)
  Q:    10 ILLAIMV-GLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKS 75
           +LL+I V GL I  HE GHF+ A L K+ V  F+IG GP +  K+   I +S+  LP+  FV    +++
  S:     3 VLLSIAVLGLLIFFHESGHFLAAVLQKIKVSGFSIGFGPALLKKEINGITYSLRSLPLGGFVSFPDEET 71
>gi|182435615|ref|YP_001823334.1| putative metalloprotease [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464131|dbj|BAG18651.1| putative metalloprotease [Streptomyces griseus subsp. griseus NBRC 13350] (436 aa)
Score = 115, Expect = 3.5e-04, Identities = 21/66 (31%), Positives = 40/66 (60%)
  Q:     5 LLVIFILLAIMVGLTI----HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           LL +  +   +VGL      HE+GH   AK+F + V ++ +G GP I+S++  + ++ I  +P   ++R+
  S:     7 LLTVLGIAVFVVGLLFSIAWHELGHLSTAKMFGIRVPQYMVGFGPTIWSRKKGDTEYGIKAIPAGGYIRM 76
>gi|110639369|ref|YP_679578.1| peptidase RseP [Cytophaga hutchinsonii ATCC 33406] >gi|110282050|gb|ABG60236.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Cytophaga hutchinsonii ATCC 33406] (430 aa)
Score = 115, Expect = 3.5e-04, Identities = 40/186 (21%), Positives = 76/186 (40%)
  Q:    12 LAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPFIQIGD 197
           L+I+VG  +HE+GH + AK F + V++F+IG  PK++  +  + ++S+  +P+  FV+I           + DE                       +++      +   W  R+K                           P WQ+LI+  GG+  N++   + +LI ++    N   +I  G+
  S:     9 LSILVG--VHELGHMLTAKYFGMRVEKFSIGFPPKLFGFKKGDTEYSVGAIPLGGFVKISG---------MVDE-----------------------SMDTEALKEEPKAWEFRSK---------------------------PAWQRLIVMLGGVIVNVL---VAFLINISLTWINGEEYISAGE 130
>gi|37521213|ref|NP_924590.1| hypothetical protein gll1644 [Gloeobacter violaceus PCC 7421] >gi|35212209|dbj|BAC89585.1| gll1644 [Gloeobacter violaceus PCC 7421] (360 aa)
Score = 115, Expect = 3.6e-04, Identities = 20/66 (30%), Positives = 41/66 (62%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +F+L   ++L +++   +HE+GHF+ A+L  ++V  F+IG GP +   Q    ++++  LP+  +V
  S:     1 MFVLAAILVLGVLI--VVHELGHFLAARLQGIHVNRFSIGFGPVLLRYQGPQTEYALRALPLGGYV 64
>gi|158337186|ref|YP_001518361.1| membrane-associated zinc metalloprotease, putative [Acaryochloris marina MBIC11017] >gi|158307427|gb|ABW29044.1| membrane-associated zinc metalloprotease, putative [Acaryochloris marina MBIC11017] (362 aa)
Score = 115, Expect = 3.6e-04, Identities = 20/61 (32%), Positives = 41/61 (67%)
  Q:     8 IFILLAIM-VGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           IFI++ I+ + + +HE+GHF+ A+L  ++V  F+IG GP ++  Q    ++++  +P+  +V
  S:     7 IFIMIGILGLLIAVHELGHFLAARLQGIHVNRFSIGFGPVLWKYQGEQTEYALRSIPLGGYV 68
>gi|57241093|ref|ZP_00369040.1| membrane-associated zinc metalloprotease, putative [Campylobacter lari RM2100] >gi|57018014|gb|EAL54789.1| membrane-associated zinc metalloprotease, putative [Campylobacter lari RM2100] (368 aa)
Score = 114, Expect = 4.0e-04, Identities = 22/73 (30%), Positives = 45/73 (61%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSL 76
           FL+ +F++  ++     HE+GHF+ AK  +V+V+ F+IG G  ++ K + N ++ ++ LP   +V++  +  L
  S:    22 FLITLFVISFLIF---FHELGHFLAAKHMRVDVEIFSIGFGKAVFKKTYKNTEYRLSALPFGGYVKLKGQDDL 91
>gi|171778814|ref|ZP_02919876.1| hypothetical protein STRINF_00735 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282460|gb|EDT47884.1| hypothetical protein STRINF_00735 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (420 aa)
Score = 114, Expect = 4.2e-04, Identities = 29/68 (42%), Positives = 43/68 (63%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS---KQFTNIKFSINLLPIMAFVRI 70
           L ++   I+  I+V   +HE GH  FAK   + V+EF+IG+GPKI+S   K+ T   F I  LP+  +VR+
  S:     2 LGIITFIIVFGILV--IVHEFGHLYFAKKSGILVREFSIGMGPKIFSHFDKEGTAYTFRI--LPLGGYVRM 68
>gi|116492649|ref|YP_804384.1| peptidase RseP [Pediococcus pentosaceus ATCC 25745] >gi|116102799|gb|ABJ67942.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Pediococcus pentosaceus ATCC 25745] (420 aa)
Score = 114, Expect = 4.2e-04, Identities = 22/50 (44%), Positives = 33/50 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE GHFV AK   + V+EF+IG+GPKI   +     +++ +LPI  +VR+
  S:    19 HEYGHFVAAKKSGILVREFSIGMGPKIVDLKRNGTTYTLRILPIGGYVRM 68
>gi|159036942|ref|YP_001536195.1| peptidase M50 [Salinispora arenicola CNS-205] >gi|157915777|gb|ABV97204.1| peptidase M50 [Salinispora arenicola CNS-205] (416 aa)
Score = 114, Expect = 4.3e-04, Identities = 21/67 (31%), Positives = 38/67 (56%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            L V    LAI++ +++HE GH + AK F + V  + +G GP ++S +    ++ I  +P+  F +I
  S:     4 LLGVTLFALAILISVSLHEAGHLLTAKAFGMKVTRYFVGFGPTLWSFRRGETEYGIKGIPLGGFCKI 70
>gi|15639588|ref|NP_219038.1| zinc protease, putative [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025826|ref|YP_001933598.1| possible zinc protease [Treponema pallidum subsp. pallidum SS14] >gi|20978804|sp|O83609|Y600_TREPA Putative zinc metalloprotease TP_0600 >gi|3322894|gb|AAC65573.1| zinc protease, putative [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018401|gb|ACD71019.1| possible zinc protease [Treponema pallidum subsp. pallidum SS14] (450 aa)
Score = 114, Expect = 4.3e-04, Identities = 18/57 (31%), Positives = 37/57 (64%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           HE+GHFV A   +V V  F++G+GP ++ K+F   ++ +++LP+  +  +  +++ Q
  S:    18 HELGHFVAALWCRVEVLSFSVGMGPVLFRKKFGKTEYRLSMLPLGGYCGMKGEQAFQ 74
>gi|28378680|ref|NP_785572.1| zinc-dependent protease, membrane associated (putative) [Lactobacillus plantarum WCFS1] >gi|28271516|emb|CAD64421.1| zinc-dependent protease, membrane associated (putative) [Lactobacillus plantarum WCFS1] (425 aa)
Score = 114, Expect = 4.3e-04, Identities = 20/53 (37%), Positives = 34/53 (64%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GHF FAK   + V+EF++G+GPK  + +     +++  LPI  +VR+
  S:    16 VIVHEFGHFYFAKKAGILVREFSVGMGPKAVAFRRNATTYTLRFLPIGGYVRM 68
>gi|118602560|ref|YP_903775.1| putative membrane-associated zinc metalloprotease [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567499|gb|ABL02304.1| putative membrane-associated zinc metalloprotease [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (445 aa)
Score = 114, Expect = 4.4e-04, Identities = 22/62 (35%), Positives = 40/62 (64%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F L+ I + +T+HE+GHF+ AK   V V  F+IG G  + S ++   ++++ +LP+  FV++
  S:     9 FFLITIGILVTVHELGHFLVAKKLNVKVLRFSIGFGKILKSFKYGETQYTLCVLPLGGFVKM 70
>gi|194340993|gb|EDX21959.1| metalloprotease [Streptomyces sp. Mg1] (430 aa)
Score = 114, Expect = 4.6e-04, Identities = 17/64 (26%), Positives = 39/64 (60%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           V+  +  +++ +  HE+GH   AKLF + V ++ +G G  I+S++  + ++ I  +P+  ++R+
  S:     7 VLVFVAGLLISIAWHELGHLSTAKLFGIRVPQYMVGFGKTIWSRKKGDTEYGIKAIPMGGYIRM 70
>gi|15806519|ref|NP_295230.1| hypothetical protein DR_1507 [Deinococcus radiodurans R1] >gi|20978858|sp|Q9RU85|Y1507_DEIRA Putative zinc metalloprotease DR_1507 >gi|6459268|gb|AAF11073.1|AE001994_9 conserved hypothetical protein [Deinococcus radiodurans R1] (377 aa)
Score = 113, Expect = 5.0e-04, Identities = 21/59 (35%), Positives = 39/59 (66%)
  Q:    13 AIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           AI+ G+++  HE+ H+  A+   V V  F++G+GP ++ K +   ++ ++LLPI  +V ID
  S:    20 AIIFGVSVFLHELAHYGLARAQGVRVNSFSVGMGPVLFKKLWRGTEWRVSLLPIGGYVEID 80
>gi|194476551|ref|YP_002048730.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Paulinella chromatophora] >gi|171191558|gb|ACB42520.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Paulinella chromatophora] (359 aa)
Score = 113, Expect = 5.3e-04, Identities = 21/48 (43%), Positives = 30/48 (62%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE GHF+ A L K+ V  F++G GP I  KQ   + F++ L+P+  FV
  S:    17 HEAGHFLVAILQKIRVYGFSVGFGPAILKKQHNGVTFALRLIPLGGFV 64
>gi|119358445|ref|YP_913089.1| peptidase RseP [Chlorobium phaeobacteroides DSM 266] >gi|119355794|gb|ABL66665.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Chlorobium phaeobacteroides DSM 266] (446 aa)
Score = 113, Expect = 5.7e-04, Identities = 47/194 (24%), Positives = 79/194 (40%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIG---IGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNN----SNP-FIQIGDSFLTI 202
           F ++AI V +T HE+GHF+ AKLF + V +F IG      +I+ K+    ++ I + P+  +V+I           + DE                       +++ +      S W  RAK                           P WQ+LI+  GG+  N++L    ++     L  +     NP FI+ G  F ++
  S:     9 FFIVAIFVLVTAHELGHFLTAKLFGMRVDKFYIGFDFFDLRIWKKKIGETEYGIGVFPLGGYVKI---------AGMVDE-----------------------SMDTSYSASAPSPWEFRAK---------------------------PVWQRLIVLAGGVIMNMVLATAIFIGVTFTLGESRTTVENPAFIEQGSVFSSM 151
>gi|51245013|ref|YP_064897.1| hypothetical protein DP1161 [Desulfotalea psychrophila LSv54] >gi|50876050|emb|CAG35890.1| hypothetical membrane protein [Desulfotalea psychrophila LSv54] (357 aa)
Score = 113, Expect = 5.8e-04, Identities = 21/66 (31%), Positives = 40/66 (60%)
  Q:     5 LLVIFILLAIMVGLT-IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +  IF  + ++  L  +HE+GHF+ AK F V V +F++G GP++  K     ++ ++  P+  FV++
  S:     1 MTTIFSFILVLGALIFVHELGHFLLAKFFGVRVLKFSLGFGPRLCGKTIGETEYVLSAFPLGGFVKM 67
>gi|71892060|ref|YP_277790.1| hypothetical protein BPEN_286 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71796166|gb|AAZ40917.1| putative membrane protein [Candidatus Blochmannia pennsylvanicus str. BPEN] (457 aa)
Score = 113, Expect = 5.8e-04, Identities = 27/83 (32%), Positives = 53/83 (63%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI-DSKKSLQVFGELRDE 85
            F  +I  +LA+ + +T+HE GHFV A+  KV V+ F+IG GP ++S + +N  ++ I+ +    +V++ +++K +    E R++
  S:     5 FFWNLIAFILALSILITVHEYGHFVAARFLKVKVERFSIGFGPVLWSWRDSNDTEYVISAVLFGGYVKLFNTRKKIASCDEERNQ 89
>gi|167746787|ref|ZP_02418914.1| hypothetical protein ANACAC_01499 [Anaerostipes caccae DSM 14662] >gi|167653747|gb|EDR97876.1| hypothetical protein ANACAC_01499 [Anaerostipes caccae DSM 14662] (343 aa)
Score = 112, Expect = 6.7e-04, Identities = 20/44 (45%), Positives = 28/44 (63%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLP 63
           +HE+GHF  AK   + V EF IG+GP ++ KQ     +S+ LLP
  S:    16 VHELGHFSVAKKNGIRVDEFCIGLGPTLFGKQVGETYYSVKLLP 59
>gi|46198811|ref|YP_004478.1| membrane metalloprotease [Thermus thermophilus HB27] >gi|46196434|gb|AAS80851.1| membrane metalloprotease [Thermus thermophilus HB27] (355 aa)
Score = 112, Expect = 6.9e-04, Identities = 23/71 (32%), Positives = 44/71 (61%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           VG+ L   + L+ I V + +HE+GH++ A+L  V VK F+IG GP ++ K+    ++ ++ +P+  +  I+
  S:    18 VGMSLF--WFLVIIGVSVFVHELGHYLAARLQGVRVKAFSIGFGPVLWRKEAWGTEWRLSAIPLGGYADIE 86
>gi|169830800|ref|YP_001716782.1| putative membrane-associated zinc metalloprotease [Candidatus Desulforudis audaxviator MP104C] >gi|169637644|gb|ACA59150.1| putative membrane-associated zinc metalloprotease [Candidatus Desulforudis audaxviator MP104C] (339 aa)
Score = 112, Expect = 7.1e-04, Identities = 21/65 (32%), Positives = 40/65 (61%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR 69
           L V+ +++   + + IHE+GHF+ AK   + V EFA+G GP++   +    ++++  +P+  FVR
  S:     2 LTVVAVIVVFGLLIFIHELGHFLVAKRAGILVHEFALGFGPRLAGIRRGETEYTLRAVPLGGFVR 66
>gi|157164061|ref|YP_001466917.1| RIP metalloprotease RseP [Campylobacter concisus 13826] >gi|112800271|gb|EAT97615.1| RIP metalloprotease RseP [Campylobacter concisus 13826] (369 aa)
Score = 112, Expect = 7.5e-04, Identities = 24/73 (32%), Positives = 43/73 (58%)
  Q:     1 VGLFLLVIFIL---LAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           +GL+    + L   LAI   +  HE+GHF+ A++  V V  F+IG G KIY+K      + ++ +P+  +V++  +
  S:    13 LGLYAYSFYFLVTVLAISFLIFFHELGHFLAARMLGVKVNTFSIGFGEKIYTKNVGGTDYCLSAIPLGGYVQLKGQ 88
>gi|154174843|ref|YP_001408199.1| RIP metalloprotease RseP [Campylobacter curvus 525.92] >gi|112802473|gb|EAT99817.1| RIP metalloprotease RseP [Campylobacter curvus 525.92] (370 aa)
Score = 112, Expect = 7.5e-04, Identities = 24/70 (34%), Positives = 43/70 (61%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           FL+ +F   AI   +  HE+GHF+ A+   V V  F+IG G KIY+K+    +++I+ +P+  +V++  +
  S:    22 FLITVF---AISFLVFFHELGHFLAARSLGVAVNTFSIGFGDKIYTKKVGATEYAISAIPLGGYVQLKGQ 88
>gi|157413738|ref|YP_001484604.1| membrane-associated Zn-dependent protease 1 [Prochlorococcus marinus str. MIT 9215] >gi|157388313|gb|ABV51018.1| Predicted membrane-associated Zn-dependent protease 1 [Prochlorococcus marinus str. MIT 9215] (359 aa)
Score = 112, Expect = 7.5e-04, Identities = 22/48 (45%), Positives = 30/48 (62%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE+GHF+ A L  + V  F+IG GP I  K+F NI +S  + P+  FV
  S:    17 HEMGHFLAAILQGIYVDGFSIGFGPSIIQKKFKNITYSFRVFPLGGFV 64
>gi|116626175|ref|YP_828331.1| putative membrane-associated zinc metalloprotease [Solibacter usitatus Ellin6076] >gi|116229337|gb|ABJ88046.1| putative membrane-associated zinc metalloprotease [Solibacter usitatus Ellin6076] (442 aa)
Score = 112, Expect = 7.7e-04, Identities = 20/68 (29%), Positives = 43/68 (63%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKK 74
           V+++L+ I V + IHE+GHF  A+ F V V+ F+ G GP+++  +  +  +  +L+ +  +V++  ++
  S:     8 VLWLLVLIGVMIMIHELGHFWAARFFDVRVEAFSFGFGPRLFGFRRGDTDYRFSLILLGGYVKMAGEQ 75
>gi|42571017|ref|NP_973582.1| membrane-associated zinc metalloprotease, putative [Arabidopsis thaliana] (410 aa)
Score = 112, Expect = 8.0e-04, Identities = 22/68 (32%), Positives = 39/68 (57%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +G F  V+  +  +   + +HE GHF+ A L  ++V +FAIG GP +    + N+++S+   P+  FV
  S:    82 LGSFESVLEAIAVLTTIIVVHESGHFLAASLQGIHVSKFAIGFGPILAKFDYNNVEYSLRAFPLGGFV 149
>gi|38234078|ref|NP_939845.1| hypothetical protein DIP1499 [Corynebacterium diphtheriae NCTC 13129] >gi|38200340|emb|CAE50026.1| Putative membrane protein [Corynebacterium diphtheriae] (404 aa)
Score = 112, Expect = 8.0e-04, Identities = 26/95 (27%), Positives = 43/95 (45%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHK 98
            L V+     I + + +HE GHF+ A+ F + V+ F IG GP I S +  N ++     P+  F  I    +       +D+   E   + + HK
  S:     5 LLGVVLFATGIAITIALHEWGHFMAARAFGMRVRRFFIGFGPTITSYRRGNTEYGFKAFPLGGFCDIAGMTN-------QDQVTPEEAPHAMMHK 92
>gi|152981722|ref|YP_001353741.1| membrane-associated Zn-dependent protease [Janthinobacterium sp. Marseille] >gi|151281799|gb|ABR90209.1| membrane-associated Zn-dependent protease [Janthinobacterium sp. Marseille] (455 aa)
Score = 111, Expect = 8.5e-04, Identities = 21/68 (30%), Positives = 47/68 (69%)
  Q:     3 LFLLVIFILLAIMVGL--TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF--TNIKFSINLLPIMAFVRI 70
           + LL   +  A+++G+   +HE+GH++ A+   V V  F++G+G  IYS++F     ++++++LP+  +V++
  S:     1 MMLLQTILAFAVVLGVLVIVHELGHYLVARWCGVKVLRFSVGMGKVIYSRRFGADQTEWAVSVLPLGGYVKM 72
>gi|168049061|ref|XP_001776983.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162671684|gb|EDQ58232.1| predicted protein [Physcomitrella patens subsp. patens] (509 aa)
Score = 111, Expect = 8.6e-04, Identities = 19/51 (37%), Positives = 33/51 (64%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +T+HE GHF+ A+L  + V +FAIG GP +   Q   +++S+  +P+  +V
  S:   160 ITVHEAGHFLAARLQGIRVTKFAIGFGPTLAKWQGKEVEYSLRAIPLGGYV 210
>gi|88807544|ref|ZP_01123056.1| hypothetical protein WH7805_13373 [Synechococcus sp. WH 7805] >gi|88788758|gb|EAR19913.1| hypothetical protein WH7805_13373 [Synechococcus sp. WH 7805] (361 aa)
Score = 111, Expect = 8.7e-04, Identities = 19/51 (37%), Positives = 31/51 (60%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           + IHE GHF+ A+L  + V  F++G GP +   +   I +++ LLP+  FV
  S:    14 IVIHEAGHFLAARLQGIRVNGFSVGFGPAVLKTERNGITYALRLLPLGGFV 64
>gi|87303147|ref|ZP_01085945.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. WH 5701] >gi|87282314|gb|EAQ74274.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. WH 5701] (362 aa)
Score = 111, Expect = 8.7e-04, Identities = 21/61 (34%), Positives = 36/61 (59%)
  Q:     8 IFILLAIMVGL-TIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +   LAI+ GL  +HE GHF+ A    + V  F+IG GP +  +Q   ++F++  +P+  +V
  S:     3 VLTALAILAGLIVVHEAGHFLAATWQGIRVSGFSIGFGPALLQRQRRGVQFALRAIPLGGYV 64
>gi|145593899|ref|YP_001158196.1| peptidase M50 [Salinispora tropica CNB-440] >gi|145303236|gb|ABP53818.1| peptidase M50 [Salinispora tropica CNB-440] (416 aa)
Score = 111, Expect = 9.0e-04, Identities = 20/67 (29%), Positives = 38/67 (56%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
            L V    LAI++ +++HE GH + AK F + V  + +G GP ++S +    ++ +  +P+  F +I
  S:     4 LLGVTLFALAILISVSLHEAGHLLTAKAFGMKVTRYFVGFGPTLWSFRRGETEYGLKGIPLGGFCKI 70
>gi|42527842|ref|NP_972940.1| membrane-associated zinc metalloprotease, putative [Treponema denticola ATCC 35405] >gi|41818670|gb|AAS12859.1| membrane-associated zinc metalloprotease, putative [Treponema denticola ATCC 35405] (450 aa)
Score = 111, Expect = 9.3e-04, Identities = 21/58 (36%), Positives = 38/58 (65%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           IHE+GHF+ AKL  V V+ F+IG GP ++ K+  + ++ I+ +P+  +  +  +K+ Q
  S:    17 IHELGHFIAAKLCGVVVESFSIGWGPVLFKKKKGDTEYRISAIPMGGYCGMKGEKAFQ 74
>gi|18402981|ref|NP_565745.1| membrane-associated zinc metalloprotease, putative [Arabidopsis thaliana] >gi|14423492|gb|AAK62428.1|AF386983_1 Unknown protein [Arabidopsis thaliana] >gi|3298536|gb|AAC25930.1| expressed protein [Arabidopsis thaliana] >gi|21553979|gb|AAM63060.1| unknown [Arabidopsis thaliana] >gi|30387545|gb|AAP31938.1| At2g32480 [Arabidopsis thaliana] (447 aa)
Score = 111, Expect = 9.6e-04, Identities = 22/68 (32%), Positives = 39/68 (57%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +G F  V+  +  +   + +HE GHF+ A L  ++V +FAIG GP +    + N+++S+   P+  FV
  S:    82 LGSFESVLEAIAVLTTIIVVHESGHFLAASLQGIHVSKFAIGFGPILAKFDYNNVEYSLRAFPLGGFV 149
>gi|159903817|ref|YP_001551161.1| membrane-associated Zn-dependent protease 1 [Prochlorococcus marinus str. MIT 9211] >gi|159888993|gb|ABX09207.1| Predicted membrane-associated Zn-dependent protease 1 [Prochlorococcus marinus str. MIT 9211] (365 aa)
Score = 111, Expect = 1.0e-03, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           F  VI  +  + + +  HE GHF+ A L  + V  F+IG GP +  K+F  + +SI   P+  FV
  S:     3 FFNVIASIAVLALLIFFHEAGHFLAATLQGIRVSGFSIGFGPALLEKEFKGVTYSIRAFPLGGFV 67
>gi|15611312|ref|NP_222963.1| hypothetical protein jhp0242 [Helicobacter pylori J99] >gi|4154773|gb|AAD05832.1| putative [Helicobacter pylori J99] (351 aa)
Score = 111, Expect = 1.0e-03, Identities = 21/64 (32%), Positives = 44/64 (68%)
  Q:     7 VIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++FI+  +M+   I  HE+GHF+ A++  V V+ F+IG G K++  +    +F+++L+P+  +V++
  S:     1 MMFIVAVLMLAFLIFVHELGHFIIARICGVKVEVFSIGFGKKLWFFKLFGTQFALSLIPLGGYVKL 66
>gi|15010610|gb|AAK73964.1| At1g05140/YUP8H12_25 [Arabidopsis thaliana] (299 aa)
Score = 111, Expect = 1.0e-03, Identities = 23/59 (38%), Positives = 35/59 (59%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L AI+V   +HE GHF+ A L  + V +FAIG GP +      N+++S+   P+  FV
  S:    88 VLTAIIV---VHETGHFLAASLQGIRVSKFAIGFGPILAKFNSNNVEYSLRAFPLGGFV 143
>gi|148244655|ref|YP_001219349.1| membrane-associated Zn-dependent protease [Candidatus Vesicomyosocius okutanii HA] >gi|146326482|dbj|BAF61625.1| membrane-associated Zn-dependent protease [Candidatus Vesicomyosocius okutanii HA] (445 aa)
Score = 111, Expect = 1.0e-03, Identities = 21/62 (33%), Positives = 38/62 (61%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F L+   +  T+HE+GHF+ AK F V V  F+IG G  + S ++   ++++  LP+  F+++
  S:     9 FFLITTSILTTVHELGHFLVAKKFNVKVLRFSIGFGKILTSFKYGETQYTLCALPLGGFIKM 70
>gi|167766539|ref|ZP_02438592.1| hypothetical protein CLOSS21_01045 [Clostridium sp. SS2/1] >gi|167711662|gb|EDS22241.1| hypothetical protein CLOSS21_01045 [Clostridium sp. SS2/1] (343 aa)
Score = 111, Expect = 1.1e-03, Identities = 21/44 (47%), Positives = 28/44 (63%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLP 63
           +HE+GHF+ AK   + V EF IG+GP I  KQ     +S+ LLP
  S:    16 VHELGHFLIAKKNGIQVDEFCIGLGPTIIGKQVGETFYSVKLLP 59
>gi|78185966|ref|YP_374009.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Pelodictyon luteolum DSM 273] >gi|78165868|gb|ABB22966.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Pelodictyon luteolum DSM 273] (454 aa)
Score = 111, Expect = 1.1e-03, Identities = 20/62 (32%), Positives = 40/62 (64%)
  Q:     9 FILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIG---IGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F ++AI + +T+HE GHF+ A++F + V +F IG      +++ K+    ++ I + P+  +V+I
  S:     9 FFIVAIFILVTVHEFGHFITARIFGMRVDKFYIGFDFFDMRLWKKKIGETEYGIGVFPLGGYVKI 73
>gi|78212122|ref|YP_380901.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. CC9605] >gi|78196581|gb|ABB34346.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. CC9605] (360 aa)
Score = 110, Expect = 1.2e-03, Identities = 20/48 (41%), Positives = 30/48 (62%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE GHF+ A L  ++V  F+IG GP +  KQ   + +++ LLP+  FV
  S:    17 HEAGHFLAATLQGIHVSGFSIGFGPALIKKQRRGVTYALRLLPLGGFV 64
>gi|152992350|ref|YP_001358071.1| membrane-associated zinc metalloprotease [Sulfurovum sp. NBC37-1] >gi|151424211|dbj|BAF71714.1| membrane-associated zinc metalloprotease [Sulfurovum sp. NBC37-1] (350 aa)
Score = 110, Expect = 1.2e-03, Identities = 18/53 (33%), Positives = 35/53 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           HE+GHF  A+ F V +  F+IG G ++++K+    ++SI+ +P+  +VR+  +
  S:    17 HELGHFTAARFFGVQIDVFSIGFGKRLWTKKIGKTEWSISAIPLGGYVRMKGQ 69
>gi|12230846|sp|Q9ZMH8|Y242_HELPJ Putative zinc metalloprotease jhp_0242 (350 aa)
Score = 110, Expect = 1.2e-03, Identities = 21/63 (33%), Positives = 43/63 (68%)
  Q:     8 IFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +FI+  +M+   I  HE+GHF+ A++  V V+ F+IG G K++  +    +F+++L+P+  +V++
  S:     1 MFIVAVLMLAFLIFVHELGHFIIARICGVKVEVFSIGFGKKLWFFKLFGTQFALSLIPLGGYVKL 65
>gi|149194614|ref|ZP_01871710.1| putative integral membrane protein [Caminibacter mediatlanticus TB-2] >gi|149135358|gb|EDM23838.1| putative integral membrane protein [Caminibacter mediatlanticus TB-2] (348 aa)
Score = 110, Expect = 1.3e-03, Identities = 22/81 (27%), Positives = 47/81 (58%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           +L   ++L+ ++    HE+GHF+ A+L  V V+ F+IG G K++ K+  +  + I+ +P+  +V++  +     F +  D+
  S:     1 MLTAILILSFLI--FFHELGHFLMARLVGVKVEVFSIGFGKKLFCKKIGDTNWCISAIPLGGYVQMKGQDDSNPFAKSDDK 79
>gi|113476792|ref|YP_722853.1| hypothetical protein Tery_3268 [Trichodesmium erythraeum IMS101] >gi|110167840|gb|ABG52380.1| YUP8H12.25 {{Arabidopsis thaliana}}-type protein. Metallo peptidase. MEROPS family M50B [Trichodesmium erythraeum IMS101] (364 aa)
Score = 110, Expect = 1.3e-03, Identities = 23/59 (38%), Positives = 38/59 (64%)
  Q:    10 ILLAIMVG---LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +LLAI V    + +HE+GHF+ A+L  ++V  F+IG GP I+  Q    ++++   P+  FV
  S:     3 VLLAIAVLGILIVVHELGHFMAARLQNIHVNRFSIGFGPVIWKYQGPQTEYALRGFPLGGFV 64
>gi|109947859|ref|YP_665087.1| zinc metalloprotease [Helicobacter acinonychis str. Sheeba] >gi|109715080|emb|CAK00088.1| zinc metalloprotease [Helicobacter acinonychis str. Sheeba] (347 aa)
Score = 110, Expect = 1.3e-03, Identities = 20/65 (30%), Positives = 43/65 (66%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +V+  +L +   + +HE+GHF  A+L  V V+ F+IG G K++  +  + +F+++L+P+  +V++
  S:     1 MVVAAILMLAFLIFVHELGHFTIARLCGVKVEVFSIGFGKKLWFFRLFDTQFALSLIPLGGYVKL 65
>gi|68171449|ref|ZP_00544837.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Ehrlichia chaffeensis str. Sapulpa] >gi|67999130|gb|EAM85792.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Ehrlichia chaffeensis str. Sapulpa] (387 aa)
Score = 110, Expect = 1.3e-03, Identities = 27/68 (39%), Positives = 45/68 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY---SKQFTNIKFSINLLPIMAFVRI 70
            +LL   I+++I+V   +HE GH++ AKL  V V+ F+IG GP+++    K  T  KFS+  +PI  +V++
  S:    24 FYLLSFLIIMSIIV--FVHEYGHYIVAKLCNVKVEVFSIGFGPELFGINDKSGTRWKFSV--IPIGGYVKM 90
>gi|88658328|ref|YP_507855.1| putative membrane-associated zinc metalloprotease [Ehrlichia chaffeensis str. Arkansas] >gi|88599785|gb|ABD45254.1| putative membrane-associated zinc metalloprotease [Ehrlichia chaffeensis str. Arkansas] (380 aa)
Score = 110, Expect = 1.3e-03, Identities = 27/68 (39%), Positives = 45/68 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY---SKQFTNIKFSINLLPIMAFVRI 70
            +LL   I+++I+V   +HE GH++ AKL  V V+ F+IG GP+++    K  T  KFS+  +PI  +V++
  S:    17 FYLLSFLIIMSIIV--FVHEYGHYIVAKLCNVKVEVFSIGFGPELFGINDKSGTRWKFSV--IPIGGYVKM 83
>gi|88606695|ref|YP_505742.1| putative membrane-associated zinc metalloprotease [Anaplasma phagocytophilum HZ] >gi|88597758|gb|ABD43228.1| putative membrane-associated zinc metalloprotease [Anaplasma phagocytophilum HZ] (362 aa)
Score = 109, Expect = 1.4e-03, Identities = 28/91 (30%), Positives = 50/91 (54%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           G F +  F LL + V + IHE GH+  AKL KV V+ F++G GP+++     +  ++  +L+P+  +V++        FG+  D    E ++
  S:    14 GSFYVASF-LLVLSVVVFIHEYGHYCVAKLCKVKVETFSLGFGPELFGITDGSGTRWKFSLVPVGGYVKM--------FGDALDREMSEEEK 96
>gi|134094567|ref|YP_001099642.1| membrane-associated metalloprotease involved in RseA cleavage [Herminiimonas arsenicoxydans] >gi|133738470|emb|CAL61515.1| putative Peptidase M50 [Herminiimonas arsenicoxydans] (455 aa)
Score = 109, Expect = 1.4e-03, Identities = 20/66 (30%), Positives = 45/66 (68%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF--TNIKFSINLLPIMAFVRI 70
           LL   ++L +++   +HE+GH++ A+   V V  F++G+G  IYS++F     ++++++LP+  +V++
  S:     7 LLAFAVVLGVLI--IVHELGHYLVARWCGVKVLRFSVGMGKVIYSRRFGKDQTEWAVSVLPLGGYVKM 72
>gi|196189129|gb|EDX84093.1| RIP metalloprotease RseP [Synechococcus sp. PCC 7335] (367 aa)
Score = 109, Expect = 1.5e-03, Identities = 20/64 (31%), Positives = 41/64 (64%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L +  +LA+++   +HE+GHF+ A+L  ++V  F+IG GP ++  Q    ++++  +P+  FV
  S:     3 VLAVIGVLALLI--FVHELGHFMAARLQGIHVNRFSIGFGPILWKYQGPQTEYALRAIPLGGFV 64
>gi|33240754|ref|NP_875696.1| membrane-associated Zn-dependent protease [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33238282|gb|AAQ00349.1| Predicted membrane-associated Zn-dependent protease [Prochlorococcus marinus subsp. marinus str. CCMP1375] (360 aa)
Score = 109, Expect = 1.5e-03, Identities = 24/64 (37%), Positives = 37/64 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           L+    +LA+++    HE GHF+ A L  + V  F+IG GP +  K+F  + +SI  LP+  FV
  S:     3 LIASISVLALLI--FFHESGHFLAATLQGIRVSGFSIGFGPALIKKEFQGVTYSIRALPLGGFV 64
>gi|167646760|ref|YP_001684423.1| membrane-associated zinc metalloprotease [Caulobacter sp. K31] >gi|167349190|gb|ABZ71925.1| membrane-associated zinc metalloprotease [Caulobacter sp. K31] (494 aa)
Score = 109, Expect = 1.5e-03, Identities = 30/102 (29%), Positives = 54/102 (52%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKY 107
           L+ F L+ ++V +TIHE+GHF  AK   V +  FAIG G  I   +  + +++ +  LP+  +VR    +++     + D+   EA    ++ +E  D   +Y
  S:    12 LIAFPLVILLV-VTIHELGHFWAAKACGVAIDRFAIGFGKPIAKWRDRSGVQWQLGWLPLGGYVRFSGDENV---ASVPDQDDLEAMRAEIERREGRDAVARY 110
>gi|104774218|ref|YP_619198.1| putative metalloprotease [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423299|emb|CAI98140.1| Putative metalloprotease [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (415 aa)
Score = 109, Expect = 1.5e-03, Identities = 23/66 (34%), Positives = 39/66 (59%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +L   I+  ++V   +HE GHF  AK   + V+EF+IG+GPK+   +     ++I  LP+  +VR+
  S:     4 ILAFIIVFGLVV--FVHEFGHFFVAKKAGILVREFSIGMGPKLIQWRPGQTTYTIRWLPLGGYVRL 67
>gi|116514306|ref|YP_813212.1| membrane-associated Zn-dependent protease 1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093621|gb|ABJ58774.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (415 aa)
Score = 109, Expect = 1.6e-03, Identities = 23/66 (34%), Positives = 39/66 (59%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +L   I+  ++V   +HE GHF  AK   + V+EF+IG+GPK+   +     ++I  LP+  +VR+
  S:     4 ILAFIIVFGLVV--FVHEFGHFFVAKKAGILVREFSIGMGPKLIQWRPGQTTYTIRWLPLGGYVRL 67
>gi|86138419|ref|ZP_01056993.1| membrane-associated zinc metalloprotease, putative [Roseobacter sp. MED193] >gi|85824944|gb|EAQ45145.1| membrane-associated zinc metalloprotease, putative [Roseobacter sp. MED193] (449 aa)
Score = 109, Expect = 1.6e-03, Identities = 21/68 (30%), Positives = 41/68 (60%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFT-NIKFSINLLPIMAFVR 69
           GLF  V+  ++A+ V + +HE GH++  +   ++ + F++G GP ++S+Q     K+ I  LP   +V+
  S:    12 GLFYTVVSFVVALSVIVAVHEYGHYIVGRWSGIHAEVFSLGFGPVLWSRQDKRGTKWQIAALPFGGYVK 80
>gi|16330353|ref|NP_441081.1| hypothetical protein slr1821 [Synechocystis sp. PCC 6803] >gi|2496803|sp|P73714|Y1821_SYNY3 Putative zinc metalloprotease slr1821 >gi|1652842|dbj|BAA17761.1| slr1821 [Synechocystis sp. PCC 6803] (366 aa)
Score = 109, Expect = 1.8e-03, Identities = 20/58 (34%), Positives = 36/58 (62%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +LA+++   +HE+GHF  A+L  ++V  FA+G GP +   Q    ++SI  +P+  +V
  S:    12 VLAVLIA--VHELGHFAAARLQGIHVTRFALGFGPPLLKYQGAETEYSIRAIPLGGYV 67
>gi|23006908|ref|ZP_00049010.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Magnetospirillum magnetotacticum MS-1] (167 aa)
Score = 109, Expect = 1.8e-03, Identities = 17/51 (33%), Positives = 32/51 (62%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +HE+GH V AK F V V ++ +G GP ++S+     ++ +  +P+  +VR+
  S:    20 LHEVGHMVPAKKFGVRVSQYMVGFGPTLWSRTKGETEYGLKAIPLGGYVRL 70
>gi|148240242|ref|YP_001225629.1| membrane-associated Zn-dependent protease [Synechococcus sp. WH 7803] >gi|147848781|emb|CAK24332.1| Predicted membrane-associated Zn-dependent protease [Synechococcus sp. WH 7803] (362 aa)
Score = 109, Expect = 1.8e-03, Identities = 18/51 (35%), Positives = 31/51 (60%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           + IHE GHF+ A+L  + V  F++G GP +   +   + +++ LLP+  FV
  S:    14 IVIHEAGHFLAARLQGIRVNGFSVGFGPALLKTERNGVTYALRLLPLGGFV 64
>gi|149915219|ref|ZP_01903747.1| Protease ecfE, putative [Roseobacter sp. AzwK-3b] >gi|149810940|gb|EDM70779.1| Protease ecfE, putative [Roseobacter sp. AzwK-3b] (447 aa)
Score = 108, Expect = 1.9e-03, Identities = 20/68 (29%), Positives = 40/68 (58%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVR 69
           GLF+ ++  ++A+   + +HE GH++  +   +    F+IG GP I+S+   +  ++ + LLP   FV+
  S:    12 GLFMTILAFVVALSAIVAVHEYGHYIVGRWSGIKADVFSIGFGPVIWSRMDKHGTRWQVALLPFGGFVK 80
>gi|42525113|ref|NP_970493.1| zinc metalloprotease [Bdellovibrio bacteriovorus HD100] >gi|39577324|emb|CAE81147.1| hypothetical zinc metalloprotease [Bdellovibrio bacteriovorus HD100] (557 aa)
Score = 108, Expect = 1.9e-03, Identities = 29/91 (31%), Positives = 53/91 (58%)
  Q:     2 GLFLLVIF-ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           GL  +V F ILL I++   +HE+GHF+ A+   V V+ F++G G K+ + +  +  ++++L+P+  +V++        FGE   E   E D+
  S:    10 GLSAIVPFVILLGILI--FVHELGHFLVARWCGVRVEVFSLGFGKKLLTYKKGDTTYALSLIPLGGYVKM--------FGEQNGEGISEEDK 91
>gi|152995308|ref|YP_001340143.1| putative membrane-associated zinc metalloprotease [Marinomonas sp. MWYL1] >gi|150836232|gb|ABR70208.1| putative membrane-associated zinc metalloprotease [Marinomonas sp. MWYL1] (448 aa)
Score = 108, Expect = 1.9e-03, Identities = 25/83 (30%), Positives = 48/83 (57%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           + L ++ I++A+ + +T HE GHF  A+   V V  F++G G  IY     T  ++++ L+P+  +VR+  ++   V  EL+ +
  S:     1 MMLNILSIVVALGLLITFHEFGHFFVARRCGVKVLRFSVGFGKPIYRYVGKTGTEYTLALIPLGGYVRMLDEREGNVPAELKKQ 84
>gi|58617592|ref|YP_196791.1| putative metalloprotease [Ehrlichia ruminantium str. Gardel] >gi|58417204|emb|CAI28317.1| Hypothetical zinc metalloprotease [Ehrlichia ruminantium str. Gardel] (379 aa)
Score = 108, Expect = 2.0e-03, Identities = 26/68 (38%), Positives = 45/68 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY---SKQFTNIKFSINLLPIMAFVRI 70
            +LL   I+++I+V   +HE GH++ AKL  V ++ F+IG GP+++    K  T  KFS  L+P+  +V++
  S:    17 FYLLSFLIIMSIIV--FVHEYGHYIIAKLCNVKIEVFSIGFGPELFGINDKSGTRWKFS--LIPLGGYVKM 83
>gi|22655054|gb|AAM98118.1| unknown protein [Arabidopsis thaliana] (441 aa)
Score = 108, Expect = 2.0e-03, Identities = 23/59 (38%), Positives = 35/59 (59%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L AI+V   +HE GHF+ A L  + V +FAIG GP +      N+++S+   P+  FV
  S:    88 VLTAIIV---VHETGHFLAASLQGIRVSKFAIGFGPILAKFNSNNVEYSLRAFPLGGFV 143
>gi|196234967|ref|ZP_03133771.1| peptidase M50 [Thermus aquaticus Y51MC23] >gi|196220923|gb|EDY15538.1| peptidase M50 [Thermus aquaticus Y51MC23] (336 aa)
Score = 108, Expect = 2.0e-03, Identities = 18/65 (27%), Positives = 42/65 (64%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           + + L+ I V + +HE+GH++ A++  V VK F++G GP ++ K+  + ++ ++ +P+  +  I+
  S:     3 LFWFLIIIGVSVFVHELGHYLAARVQGVRVKAFSVGFGPVLWRKRAWDTEWRLSAIPLGGYADIE 67
>gi|108562685|ref|YP_627001.1| hypothetical protein HPAG1_0260 [Helicobacter pylori HPAG1] >gi|107836458|gb|ABF84327.1| conserved hypothetical integral membrane protein [Helicobacter pylori HPAG1] (351 aa)
Score = 108, Expect = 2.0e-03, Identities = 21/64 (32%), Positives = 43/64 (67%)
  Q:     7 VIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++FI+  +M+   I  HE+GHF  A++  V V+ F+IG G K++  +    +F+++L+P+  +V++
  S:     1 MMFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLWFFKLFGTQFALSLIPLGGYVKL 66
>gi|57239552|ref|YP_180688.1| putative metalloprotease [Ehrlichia ruminantium str. Welgevonden] >gi|58579538|ref|YP_197750.1| putative metalloprotease [Ehrlichia ruminantium str. Welgevonden] >gi|57161631|emb|CAH58560.1| putative membrane-associated zinc metalloprotease [Ehrlichia ruminantium str. Welgevonden] >gi|58418164|emb|CAI27368.1| Hypothetical zinc metalloprotease [Ehrlichia ruminantium str. Welgevonden] (379 aa)
Score = 108, Expect = 2.1e-03, Identities = 26/68 (38%), Positives = 45/68 (66%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY---SKQFTNIKFSINLLPIMAFVRI 70
            +LL   I+++I+V   +HE GH++ AKL  V ++ F+IG GP+++    K  T  KFS  L+P+  +V++
  S:    17 FYLLSFLIIMSIIV--FVHEYGHYIIAKLCNVKIEVFSIGFGPELFGINDKSGTRWKFS--LIPLGGYVKM 83
>gi|94968448|ref|YP_590496.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Acidobacteria bacterium Ellin345] >gi|94550498|gb|ABF40422.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Acidobacteria bacterium Ellin345] (446 aa)
Score = 108, Expect = 2.1e-03, Identities = 23/75 (30%), Positives = 42/75 (56%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSL 76
           G  + ++ I+  + V + +HE GHF  AKLF V V+ F+IG G ++   +     + I+ LP+  +V++  +  L
  S:     3 GFLIAIVSIVFVLGVLVLVHEFGHFAAAKLFGVRVETFSIGFGKRLVGFRRGETDYRISALPLGGYVKMTGETPL 77
>gi|18390484|ref|NP_563729.1| membrane-associated zinc metalloprotease, putative [Arabidopsis thaliana] >gi|2388583|gb|AAB71464.1| Similar to Synechocystis hypothetical protein (gb|D90908). [Arabidopsis thaliana] >gi|17065222|gb|AAL32765.1| Unknown protein [Arabidopsis thaliana] (441 aa)
Score = 108, Expect = 2.1e-03, Identities = 23/59 (38%), Positives = 35/59 (59%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L AI+V   +HE GHF+ A L  + V +FAIG GP +      N+++S+   P+  FV
  S:    88 VLTAIIV---VHETGHFLAASLQGIRVSKFAIGFGPILAKFNSNNVEYSLRAFPLGGFV 143
>gi|83589890|ref|YP_429899.1| peptidase RseP [Moorella thermoacetica ATCC 39073] >gi|83572804|gb|ABC19356.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Moorella thermoacetica ATCC 39073] (336 aa)
Score = 108, Expect = 2.2e-03, Identities = 24/68 (35%), Positives = 39/68 (57%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +  LVIF +L I     +HE GH++ AK   + V+EFAIG+GP ++  +     +S+   P+  F R+
  S:     4 ILALVIFSILVI-----VHEGGHYLAAKRAGIKVEEFAIGMGPALWQVKKGETIYSLRAFPLGGFNRM 66
>gi|182416437|ref|YP_001821503.1| membrane-associated zinc metalloprotease [Opitutus terrae PB90-1] >gi|177843651|gb|ACB77903.1| membrane-associated zinc metalloprotease [Opitutus terrae PB90-1] (488 aa)
Score = 108, Expect = 2.2e-03, Identities = 23/66 (34%), Positives = 43/66 (65%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFV 68
           +FL+++F   +I V    HE+GHF+ A+   V+V+ F+IG GP I+S +    +++ I+ +P+  +V
  S:    16 IFLVIVFFGGSIFV----HELGHFLAARRRGVHVERFSIGFGPAIFSWRGRDGVEYRISWIPLGGYV 78
>gi|152990445|ref|YP_001356167.1| membrane-associated zinc metalloprotease [Nitratiruptor sp. SB155-2] >gi|151422306|dbj|BAF69810.1| membrane-associated zinc metalloprotease [Nitratiruptor sp. SB155-2] (354 aa)
Score = 108, Expect = 2.2e-03, Identities = 18/53 (33%), Positives = 35/53 (66%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSK 73
           HE+GHF+ A+ F V V+ F+IG GP +  K+    +++I+ +P+  +V++  +
  S:    17 HELGHFLAARFFGVTVERFSIGFGPILTKKRCCGTEWAISAIPLGGYVKMKGQ 69
>gi|37694419|gb|AAQ99140.1| membrane-associated zinc metalloprotease [Flavobacterium columnare] (449 aa)
Score = 108, Expect = 2.2e-03, Identities = 45/202 (22%), Positives = 80/202 (39%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGP--KIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNN---SNPFIQIGDSFLTILKNMVFYNA 211
           IL  + V + +HE GH++ AKLFK+ V++F + + P   +  K+  + ++ I  LPI  +V++           + DE                       +++K    +    W  R+K                           P WQ+LI+  GG+  N++L    Y++  T        +N   Q G +F  + K + F N 
  S:    10 ILFILSVLVILHEFGHYLPAKLFKIRVEKFYLFMDPWFSLLKKKIGDTEWGIGWLPIGGYVKL---------AGMMDE-----------------------SMDKEQMAQPAQPWEFRSK---------------------------PAWQRLIVMLGGVTVNVVLAWFIYIMLFTNYGQKYIATNKIQQSGLAFSEVGKQIGFKNG 157
>gi|153004028|ref|YP_001378353.1| putative membrane-associated zinc metalloprotease [Anaeromyxobacter sp. Fw109-5] >gi|152027601|gb|ABS25369.1| putative membrane-associated zinc metalloprotease [Anaeromyxobacter sp. Fw109-5] (347 aa)
Score = 108, Expect = 2.2e-03, Identities = 17/53 (32%), Positives = 35/53 (66%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GH++ A+ F + V+ F++G GP + + +    +F+++ LP+  +VRI
  S:    18 IVLHEAGHYLAARAFGMRVERFSVGFGPVVAAFRRGETEFAVSALPLGGYVRI 70
>gi|148653594|ref|YP_001280687.1| putative membrane-associated zinc metalloprotease [Psychrobacter sp. PRwf-1] >gi|148572678|gb|ABQ94737.1| putative membrane-associated zinc metalloprotease [Psychrobacter sp. PRwf-1] (479 aa)
Score = 108, Expect = 2.3e-03, Identities = 23/68 (33%), Positives = 42/68 (61%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKI--YSKQFTNIKFSINLLPIMAFVRI 70
           LF L    +L  +V L  HE GH++ A++  V V  ++IG GPK+  ++ + T I + ++ LP+  +V++
  S:     9 LFFLAFVAILGPLVAL--HEWGHYIVARMCGVKVLTYSIGFGPKLASWTSKKTGINYRLSALPLGGYVKM 76
>gi|91223480|ref|ZP_01258745.1| putative membrane-associated Zn-dependent protease [Vibrio alginolyticus 12G01] >gi|91191566|gb|EAS77830.1| putative membrane-associated Zn-dependent protease [Vibrio alginolyticus 12G01] (452 aa)
Score = 108, Expect = 2.4e-03, Identities = 24/72 (33%), Positives = 48/72 (66%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVR-IDSK 73
           G+   +I  ++A+ + + +HE GHF  A+   V V++F+IG G  I+SK   +  ++SI+++P+  +V+ +DS+
  S:     3 GILWNLISFIVALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWSKVGKDGTEYSISMIPLGGYVKMVDSR 76
>gi|82524088|emb|CAJ19127.1| putative Zn metalloprotease [unidentified microorganism] (459 aa)
Score = 107, Expect = 2.6e-03, Identities = 23/64 (35%), Positives = 36/64 (56%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           L+ I  LL +   +TIHE+GHF+ AK   V V  F+IG G K+   +    ++ I+ +P   +V
  S:     9 LMFILGLLGLSFLVTIHELGHFLVAKWNNVKVNTFSIGFGKKLLRYRHGETEYCISAIPFGGYV 72
>gi|55980824|ref|YP_144121.1| membrane-associated Zn-dependent protease [Thermus thermophilus HB8] >gi|55772237|dbj|BAD70678.1| membrane-associated Zn-dependent protease [Thermus thermophilus HB8] (336 aa)
Score = 107, Expect = 2.6e-03, Identities = 18/65 (27%), Positives = 41/65 (63%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           + + L+ I V + +HE+GH++ A+L  V VK F++G GP ++ ++    ++ ++ +P+  +  I+
  S:     3 LFWFLVIIGVSVFVHELGHYLAARLQGVRVKAFSVGFGPVLWRREAWGTEWRLSAIPLGGYADIE 67
>gi|124005423|ref|ZP_01690264.1| membrane-associated zinc metalloprotease, putative [Microscilla marina ATCC 23134] >gi|123989245|gb|EAY28823.1| membrane-associated zinc metalloprotease, putative [Microscilla marina ATCC 23134] (436 aa)
Score = 107, Expect = 2.7e-03, Identities = 19/67 (28%), Positives = 43/67 (64%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F+++  +L+ + + + +HE+GH + AK+F + V++F+IG GP+I    +   ++ I  + +  +V+I
  S:     4 FIMIAQLLVGLSILVGLHEMGHLLAAKMFGIRVEKFSIGFGPRIVGFTYKGTEYIIAPIFLGGYVKI 70
>gi|116072763|ref|ZP_01470029.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. BL107] >gi|116064650|gb|EAU70410.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. BL107] (360 aa)
Score = 107, Expect = 2.8e-03, Identities = 19/48 (39%), Positives = 29/48 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE GHF+ A L  + V  F+IG GP +  +Q   + +++ LLP+  FV
  S:    17 HEAGHFLAATLQGIRVSGFSIGFGPALIKRQRKGVTYALRLLPLGGFV 64
>gi|78185358|ref|YP_377793.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Synechococcus sp. CC9902] >gi|78169652|gb|ABB26749.1| YUP8H12.25 {{Arabidopsis thaliana}}-type protein. Metallo peptidase. MEROPS family M50B [Synechococcus sp. CC9902] (360 aa)
Score = 107, Expect = 2.8e-03, Identities = 19/48 (39%), Positives = 29/48 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE GHF+ A L  + V  F+IG GP +  +Q   + +++ LLP+  FV
  S:    17 HEAGHFLAATLQGIRVSGFSIGFGPALIKRQRKGVTYALRLLPLGGFV 64
>gi|167999229|ref|XP_001752320.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162696715|gb|EDQ83053.1| predicted protein [Physcomitrella patens subsp. patens] (377 aa)
Score = 107, Expect = 3.0e-03, Identities = 20/62 (32%), Positives = 38/62 (61%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           V+  L+ +   + +HE GHF+ A++  ++V +FAIG GP I      N+++S+  +P+  +V
  S:    23 VVEALVVLGTIVIVHETGHFLAARVQGIHVTQFAIGFGPVILRFSGQNVEYSLRAIPLGGYV 84
>gi|148656722|ref|YP_001276927.1| peptidase M50 [Roseiflexus sp. RS-1] >gi|148568832|gb|ABQ90977.1| peptidase M50 [Roseiflexus sp. RS-1] (392 aa)
Score = 106, Expect = 3.2e-03, Identities = 23/60 (38%), Positives = 38/60 (63%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPK-IYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFG 80
           HE+GHF+ A  F + V+EF +G  P+ +   +   +K+++N LPI  FVR  S +  Q++G
  S:    47 HELGHFLTAVWFGIKVEEFGLGYPPRAMVLFERNGVKYTLNWLPIGGFVRF-SGEGDQIYG 106
>gi|159475066|ref|XP_001695644.1| intramembrane metalloprotease [Chlamydomonas reinhardtii] >gi|158275655|gb|EDP01431.1| intramembrane metalloprotease [Chlamydomonas reinhardtii] (504 aa)
Score = 106, Expect = 3.3e-03, Identities = 20/59 (33%), Positives = 35/59 (59%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L AI   + +HE GHF  A+L  + V  FA+G GP I+  +   +++ +N +P+  +V
  S:   137 VLAAI---VAVHEAGHFAAARLQGIRVARFAVGFGPAIWKYKGPEVEYCLNAVPLGGYV 192
>gi|153891897|ref|ZP_02012867.1| putative membrane-associated zinc metalloprotease [Opitutaceae bacterium TAV2] >gi|151582026|gb|EDN45609.1| putative membrane-associated zinc metalloprotease [Opitutaceae bacterium TAV2] (495 aa)
Score = 106, Expect = 3.3e-03, Identities = 23/68 (33%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVG--LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L LL   +L+A+  G  + +HE+GHF+ A+   V V  F+IG GPKI++    + +++ ++ +P+  +V +
  S:     7 LSLLWALVLMALFFGGSIFVHELGHFLAARRRGVKVDRFSIGFGPKIFAWTGKDGVEYRLSWIPLGGYVAL 77
>gi|150024194|ref|YP_001295020.1| M50 family membrane-associated zinc metalloprotease precursor [Flavobacterium psychrophilum JIP02/86] >gi|149770735|emb|CAL42199.1| Probable M50 family membrane-associated zinc metalloprotease precursor [Flavobacterium psychrophilum JIP02/86] (444 aa)
Score = 106, Expect = 3.3e-03, Identities = 41/174 (23%), Positives = 71/174 (40%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFA--IGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLI 180
           +IFIL  +++   +HE GH++ A++FKV V++F   I +G  ++ K+  + ++ I  LP+  +V++           + DE                       +++     +    W  R+K                           P WQ+LII  GGI  N+IL  L Y I
  S:    10 IIFILSVLVI---LHEFGHYITARMFKVKVEKFYLFIDLGFSLFKKKINDTEWGIGWLPMGGYVKLSG---------MIDE-----------------------SMDTEQMAQPAQPWEFRSK---------------------------PAWQRLIIMLGGIAVNIILAILIYTI 123
>gi|50119978|ref|YP_049145.1| zinc metallopeptidase [Pectobacterium atrosepticum SCRI1043] >gi|49610504|emb|CAG73949.1| protease [Erwinia carotovora subsp. atroseptica SCRI1043] (451 aa)
Score = 106, Expect = 3.6e-03, Identities = 27/83 (32%), Positives = 49/83 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQ-FTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F++G G  ++ ++  T  +F I L+P+  +V++  ++   V  E R +
  S:     5 LWNLAAFII-ALGVLVTVHEFGHFWVARRCGVKVERFSVGFGRALWRRRDRTGTEFVIALIPLGGYVKMLDERVDTVAPEFRHQ 87
>gi|157826706|ref|YP_001495770.1| putative membrane-associated zinc metalloprotease [Rickettsia bellii OSU 85-389] >gi|157802010|gb|ABV78733.1| Putative membrane-associated zinc metalloprotease [Rickettsia bellii OSU 85-389] (352 aa)
Score = 106, Expect = 3.6e-03, Identities = 21/66 (31%), Positives = 41/66 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           L ++  ++ I + + IHE+GH+  A+ F V ++EF+IG G ++        +++ I LLP+  +V+I
  S:     2 LSIVGFIITISILVFIHELGHYAVARFFNVKIEEFSIGFGKELIGITDSKGVRWKICLLPLGGYVKI 68
>gi|91205933|ref|YP_538288.1| putative membrane-associated zinc metalloprotease [Rickettsia bellii RML369-C] >gi|91069477|gb|ABE05199.1| Putative membrane-associated zinc metalloprotease [Rickettsia bellii RML369-C] (352 aa)
Score = 106, Expect = 3.7e-03, Identities = 21/66 (31%), Positives = 41/66 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           L ++  ++ I + + IHE+GH+  A+ F V ++EF+IG G ++        +++ I LLP+  +V+I
  S:     2 LSIVGFIITISILVFIHELGHYAVARFFNVKIEEFSIGFGKELIGITDSKGVRWKICLLPLGGYVKI 68
>gi|156975499|ref|YP_001446406.1| protease [Vibrio harveyi ATCC BAA-1116] >gi|156527093|gb|ABU72179.1| hypothetical protein VIBHAR_03230 [Vibrio harveyi ATCC BAA-1116] (452 aa)
Score = 106, Expect = 3.9e-03, Identities = 27/76 (35%), Positives = 49/76 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRIDSKKSLQV 78
           L+ LV FI+ A+ + + +HE GHF  A+   V V++F+IG G  I+SK   +  ++SI+++P+  +V++   +  QV
  S:     5 LWNLVSFIV-ALGILVAVHEYGHFWVARRCGVKVEKFSIGFGKSIWSKVGKDGTEYSISMIPLGGYVKMVDSRVDQV 80
>gi|71066085|ref|YP_264812.1| peptidase RseP [Psychrobacter arcticus 273-4] >gi|71039070|gb|AAZ19378.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Psychrobacter arcticus 273-4] (457 aa)
Score = 106, Expect = 4.0e-03, Identities = 27/87 (31%), Positives = 50/87 (57%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY--SKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEA 90
            L  IF+L  +   + +HE GH++ A+L  V V  ++IG GPK++  + + + I + I+ LP+  +V++  ++     GE+  E Q  A
  S:     7 LLAAIFVLGPL---IALHEWGHYIVARLCGVKVLTYSIGFGPKLFGWTSKKSGIDYRISALPLGGYVKMLDERE----GEVAKEEQHLA 88
>gi|154147904|ref|YP_001406194.1| RIP metalloprotease RseP [Campylobacter hominis ATCC BAA-381] >gi|153803913|gb|ABS50920.1| RIP metalloprotease RseP [Campylobacter hominis ATCC BAA-381] (370 aa)
Score = 105, Expect = 4.3e-03, Identities = 20/67 (29%), Positives = 40/67 (59%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           +L+I   +  HE GHF+ A+   V V  F++G G KI++K +   ++ I+ +P+  +V +  ++ L+
  S:    26 VLSISFLIFFHEFGHFIVARRLGVKVNVFSVGFGEKIWAKSWRGTEYRISAIPLGGYVSLKGQEDLK 92
>gi|145347490|ref|XP_001418197.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578426|gb|ABO96490.1| predicted protein [Ostreococcus lucimarinus CCE9901] (370 aa)
Score = 105, Expect = 4.3e-03, Identities = 19/62 (30%), Positives = 37/62 (59%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           VI  +  + V +T HE GHF  A+   ++V  FA+G GP +++ +   +++S+  +P+  +V
  S:    11 VITAIGVLAVIITAHECGHFFAARARGIHVNAFAVGFGPNLFTYRGPEVEYSLKAIPLGGYV 72
>gi|183597590|ref|ZP_02959083.1| hypothetical protein PROSTU_00872 [Providencia stuartii ATCC 25827] >gi|188023086|gb|EDU61126.1| hypothetical protein PROSTU_00872 [Providencia stuartii ATCC 25827] (450 aa)
Score = 105, Expect = 4.3e-03, Identities = 27/83 (32%), Positives = 46/83 (55%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           +G F  +   ++AI V +T+HE GHF  A+   V V+ F+IG G  ++ K      +F I L+P+  +V++  ++   V  E R
  S:     1 MGFFWSLAAFIIAIGVLITVHEFGHFWVARRCGVYVERFSIGFGKTLWRKVDRQGTEFVIALIPLGGYVKMLDERVGDVSPERR 84
>gi|153835390|ref|ZP_01988057.1| RIP metalloprotease RseP [Vibrio harveyi HY01] >gi|148868076|gb|EDL67248.1| RIP metalloprotease RseP [Vibrio harveyi HY01] (452 aa)
Score = 105, Expect = 4.4e-03, Identities = 27/71 (38%), Positives = 49/71 (69%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVR-IDSK 73
           L+ LV FI+ A+ + + +HE GHF  A+   V V++F+IG G  I+SK   +  ++SI+++P+  +V+ +DS+
  S:     5 LWNLVSFIV-ALGILVAVHEYGHFWVARRCGVKVEKFSIGFGKSIWSKVGKDGTEYSISMIPLGGYVKMVDSR 76
>gi|161870880|ref|YP_001600054.1| integral membrane protein [Neisseria meningitidis 053442] >gi|161596433|gb|ABX74093.1| integral membrane protein [Neisseria meningitidis 053442] (474 aa)
Score = 105, Expect = 4.5e-03, Identities = 20/72 (27%), Positives = 47/72 (65%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKK 74
           L  L+ FI  AI++ +++HE GH++ A+L  V V  F++G G   ++++  + ++ +  +P+  +V+ +D+++
  S:    29 LHTLLAFIF-AILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIPLGGYVKMVDTRE 100
>gi|126696728|ref|YP_001091614.1| membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. MIT 9301] >gi|126543771|gb|ABO18013.1| Predicted membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. MIT 9301] (359 aa)
Score = 105, Expect = 4.6e-03, Identities = 21/48 (43%), Positives = 29/48 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE+GHF+ A L  + V  F+IG GP I  K+F +I +S    P+  FV
  S:    17 HEMGHFLAAILQGIYVDGFSIGFGPSIIQKKFRDITYSFRAFPLGGFV 64
>gi|99036032|ref|ZP_01315070.1| hypothetical protein Wendoof_01000087 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (372 aa)
Score = 105, Expect = 4.6e-03, Identities = 23/69 (33%), Positives = 45/69 (65%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           G++  + F L+ I V + +HE GH+V AK  KV V+ F+IG GP+I+     +  ++ ++++P+  +V++
  S:    14 GIYYFLSFSLI-ISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSVVPLGGYVKM 82
>gi|42520892|ref|NP_966807.1| membrane-associated zinc metalloprotease, putative [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410632|gb|AAS14741.1| membrane-associated zinc metalloprotease, putative [Wolbachia endosymbiont of Drosophila melanogaster] (372 aa)
Score = 105, Expect = 4.7e-03, Identities = 23/69 (33%), Positives = 45/69 (65%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           G++  + F L+ I V + +HE GH+V AK  KV V+ F+IG GP+I+     +  ++ ++++P+  +V++
  S:    14 GIYYFLSFSLI-ISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSVVPLGGYVKM 82
>gi|123968915|ref|YP_001009773.1| membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. AS9601] >gi|123199025|gb|ABM70666.1| Predicted membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. AS9601] (359 aa)
Score = 105, Expect = 4.7e-03, Identities = 21/48 (43%), Positives = 29/48 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE+GHF+ A L  + V  F+IG GP I  K+F +I +S    P+  FV
  S:    17 HEMGHFLAAILQGIYVDGFSIGFGPSIIQKKFRDITYSFRAFPLGGFV 64
>gi|120555452|ref|YP_959803.1| putative membrane-associated zinc metalloprotease [Marinobacter aquaeolei VT8] >gi|120325301|gb|ABM19616.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Marinobacter aquaeolei VT8] (449 aa)
Score = 105, Expect = 4.7e-03, Identities = 25/81 (30%), Positives = 47/81 (58%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           +L + + L I+V  T+HE GHF  A+ F V V  F++G G  ++S       ++++  +P+  +V++  ++   V  ELRD+
  S:     7 VLALALTLGILV--TLHEYGHFWVARRFGVKVLRFSVGFGKPLFSWYDRHGTEYAVAAIPLGGYVKMLDEREGPVPEELRDQ 86
>gi|167455364|ref|ZP_02321586.1| membrane-associated zinc metalloprotease [Anaeromyxobacter dehalogenans 2CP-1] >gi|167418049|gb|EDR84748.1| membrane-associated zinc metalloprotease [Anaeromyxobacter dehalogenans 2CP-1] (351 aa)
Score = 105, Expect = 4.9e-03, Identities = 19/53 (35%), Positives = 34/53 (64%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GH++ A+   + V+ F+IG GP + S +    +F+I+ LP+  +VRI
  S:    18 IVLHEAGHYLAARRSGMRVERFSIGFGPVVLSFRRGETEFAISALPLGGYVRI 70
>gi|145218954|ref|YP_001129663.1| putative membrane-associated zinc metalloprotease [Prosthecochloris vibrioformis DSM 265] >gi|145205118|gb|ABP36161.1| putative membrane-associated zinc metalloprotease [Prosthecochloris vibrioformis DSM 265] (437 aa)
Score = 105, Expect = 5.1e-03, Identities = 39/182 (21%), Positives = 74/182 (40%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGI---GPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLIL-----FGLFYLIQVTALNNNSNPFIQIGDSF 199
           +T+HE+GHF+ AKLF + V +F IG      +++ K+  + ++ + + P+  +V+I           + DE                       +++ + +      W  RAK                           P WQ+LI+  GG+  NL+L      G+ Y +  +  +  +  F++ G  F
  S:    18 VTVHELGHFLTAKLFGMRVDKFYIGFDFYNMRLWKKKIGDTEYGLGVFPLGGYVKI---------AGMVDE-----------------------SLDTDFEASAPQPWEFRAK---------------------------PVWQRLIVLAGGVTMNLLLAAAIFIGVTYTLGESRTSTATPAFVETGSIF 148
>gi|125625171|ref|YP_001033654.1| putative zinc metalloprotease [Lactococcus lactis subsp. cremoris MG1363] >gi|124493979|emb|CAL98977.1| putative zinc metalloprotease [Lactococcus lactis subsp. cremoris MG1363] (428 aa)
Score = 105, Expect = 5.2e-03, Identities = 20/50 (40%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           HE GH  +AK   + V+E+A+G+GPKI++ Q  +   ++I +LP+  +VR+
  S:    19 HEYGHLWWAKRSGILVREYAVGMGPKIFAHQAKDGTLYTIRILPLGGYVRL 69
>gi|86140994|ref|ZP_01059553.1| membrane-associated zinc metalloprotease [Flavobacterium sp. MED217] >gi|85832936|gb|EAQ51385.1| membrane-associated zinc metalloprotease [Leeuwenhoekiella blandensis MED217] (438 aa)
Score = 104, Expect = 5.3e-03, Identities = 40/179 (22%), Positives = 71/179 (39%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPK--IYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNN 188
           + L++ + + +HE GHF+ A+LFK+ V++F +    K  ++ K+     + I  LP+  +V+I           + DE                       +++K    ++   W  R+K                           P WQ+LI+  GG+  N+IL G F  I + A   N
  S:    11 LFLSLSLLIVLHEFGHFIPARLFKIRVEKFFLFFDVKFSLFKKKIGETVYGIGWLPLGGYVKI---------AGMIDE-----------------------SMDKEAMAQEPKEWEFRSK---------------------------PAWQRLIVMIGGVTVNIIL-GFFIYIMIIAYYGN 131
>gi|167554436|ref|ZP_02348175.1| zinc metallopeptidase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (249 aa)
Score = 104, Expect = 5.4e-03, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELR 85
>gi|124022315|ref|YP_001016622.1| membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. MIT 9303] >gi|123962601|gb|ABM77357.1| Predicted membrane-associated Zn-dependent proteases 1 [Prochlorococcus marinus str. MIT 9303] (360 aa)
Score = 104, Expect = 5.4e-03, Identities = 21/61 (34%), Positives = 35/61 (57%)
  Q:     8 IFILLAIMVGLTI-HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +F  L ++  L I HE GHF+ A    + V  F+IG GP +  +Q   + +++ +LP+  FV
  S:     3 VFAALTVLALLIIIHEAGHFLAATAQGIRVNGFSIGFGPALIKRQRRGVTYALRVLPLGGFV 64
>gi|33863642|ref|NP_895202.1| hypothetical protein PMT1375 [Prochlorococcus marinus str. MIT 9313] >gi|33635225|emb|CAE21550.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT 9313] (360 aa)
Score = 104, Expect = 5.4e-03, Identities = 21/61 (34%), Positives = 35/61 (57%)
  Q:     8 IFILLAIMVGLTI-HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +F  L ++  L I HE GHF+ A    + V  F+IG GP +  +Q   + +++ +LP+  FV
  S:     3 VFAALTVLALLIIIHEAGHFLAATAQGIRVNGFSIGFGPALIKRQRRGVTYALRVLPLGGFV 64
>gi|116513082|ref|YP_811989.1| membrane-associated Zn-dependent protease 1 [Lactococcus lactis subsp. cremoris SK11] >gi|116108736|gb|ABJ73876.1| Predicted membrane-associated Zn-dependent protease 1 [Lactococcus lactis subsp. cremoris SK11] (428 aa)
Score = 104, Expect = 5.4e-03, Identities = 20/50 (40%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           HE GH  +AK   + V+E+A+G+GPKI++ Q  +   ++I +LP+  +VR+
  S:    19 HEYGHLWWAKRSGILVREYAVGMGPKIFAHQAKDGTLYTIRILPLGGYVRL 69
>gi|163766347|ref|ZP_02173373.1| membrane-associated zinc metalloprotease [Anaeromyxobacter sp. K] >gi|196171441|gb|ACG72414.1| membrane-associated zinc metalloprotease [Anaeromyxobacter sp. K] (351 aa)
Score = 104, Expect = 5.6e-03, Identities = 18/53 (33%), Positives = 34/53 (64%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GH++ A+   + V+ F++G GP + S +    +F+I+ LP+  +VRI
  S:    18 IVVHEAGHYLAARRSGMRVERFSVGFGPVVLSFRRGETEFAISALPLGGYVRI 70
>gi|86157548|ref|YP_464333.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85774059|gb|ABC80896.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Anaeromyxobacter dehalogenans 2CP-C] (351 aa)
Score = 104, Expect = 5.6e-03, Identities = 18/53 (33%), Positives = 34/53 (64%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           + +HE GH++ A+   + V+ F++G GP + S +    +F+I+ LP+  +VRI
  S:    18 IVVHEAGHYLAARRSGMRVERFSVGFGPVVLSFRRGETEFAISALPLGGYVRI 70
>gi|163723891|ref|ZP_02131424.1| putative membrane-associated zinc metalloprotease [Desulfatibacillum alkenivorans AK-01] >gi|161402923|gb|EDQ27158.1| putative membrane-associated zinc metalloprotease [Desulfatibacillum alkenivorans AK-01] (359 aa)
Score = 104, Expect = 5.8e-03, Identities = 16/50 (32%), Positives = 34/50 (68%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           HE+GHF+ A+L  V V+ F++G GP+++ K+     + ++ +P+  +V++
  S:    18 HELGHFLAARLLGVGVETFSLGFGPRLFGKKSGMTDYRVSAVPLGGYVKM 67
>gi|15674110|ref|NP_268285.1| hypothetical protein L181494 [Lactococcus lactis subsp. lactis Il1403] >gi|20978839|sp|Q9CDT3|Y2128_LACLA Putative zinc metalloprotease LL2128 >gi|12725185|gb|AAK06226.1|AE006441_4 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (428 aa)
Score = 104, Expect = 6.0e-03, Identities = 20/50 (40%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           HE GH  +AK   + V+E+A+G+GPKI++ Q  +   ++I +LP+  +VR+
  S:    19 HEYGHLWWAKRSGILVREYAVGMGPKIFAHQAKDGTLYTIRILPLGGYVRL 69
>gi|188527065|ref|YP_001909752.1| hypothetical protein HPSH_01340 [Helicobacter pylori Shi470] >gi|188143305|gb|ACD47722.1| hypothetical protein HPSH_01340 [Helicobacter pylori Shi470] (351 aa)
Score = 104, Expect = 6.1e-03, Identities = 21/64 (32%), Positives = 42/64 (65%)
  Q:     7 VIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++FI+  +M+   I  HE+GHF  A++  V V+ F+IG G K+   +    +F+++L+P+  +V++
  S:     1 MMFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLCFFKLFGTQFALSLIPLGGYVKL 66
>gi|2367602|gb|AAB69699.1| unknown [Helicobacter pylori] (351 aa)
Score = 104, Expect = 6.1e-03, Identities = 21/64 (32%), Positives = 42/64 (65%)
  Q:     7 VIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++FI+  +M+   I  HE+GHF  A++  V V+ F+IG G K+   +    +F+++L+P+  +V++
  S:     1 MMFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLCFFKLFGTQFALSLIPLGGYVKL 66
>gi|15644886|ref|NP_207056.1| hypothetical protein HP0258 [Helicobacter pylori 26695] >gi|2495696|sp|P56136|Y258_HELPY Putative zinc metalloprotease HP_0258 >gi|2313352|gb|AAD07326.1| conserved hypothetical integral membrane protein [Helicobacter pylori 26695] (348 aa)
Score = 104, Expect = 6.2e-03, Identities = 21/63 (33%), Positives = 41/63 (65%)
  Q:     8 IFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +FI+  +M+   I  HE+GHF  A++  V V+ F+IG G K+   +    +F+++L+P+  +V++
  S:     1 MFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLCFFKLFGTQFALSLIPLGGYVKL 65
>gi|168701658|ref|ZP_02733935.1| probable metalloproteinase [Gemmata obscuriglobus UQM 2246] (772 aa)
Score = 104, Expect = 6.2e-03, Identities = 30/84 (35%), Positives = 46/84 (54%)
  Q:     9 FILLAIMVGLT----IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFT--NIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           F  L +++GL     IHE+GHF+ AK   V+V  F+IG GP +   Q+      + I ++P+  FV        Q+ GE      +EAD+
  S:    65 FDTLKVVLGLGFIIFIHELGHFLAAKWCDVHVNMFSIGFGPAVPFCQYKWGETTYKIGIIPLGGFV--------QMVGEGDGADSEEADD 146
>gi|157372018|ref|YP_001480007.1| zinc metallopeptidase [Serratia proteamaculans 568] >gi|157323782|gb|ABV42879.1| putative membrane-associated zinc metalloprotease [Serratia proteamaculans 568] (451 aa)
Score = 104, Expect = 6.3e-03, Identities = 28/83 (33%), Positives = 49/83 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           L+ LV F L+A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  ++   V  ELR +
  S:     5 LWNLVAF-LVALGVLITVHEFGHFWVARRCGVRVERFSIGFGRALWRRTDRQGTEYVIALIPLGGYVKMLDERVDSVAPELRHQ 87
>gi|77957696|ref|ZP_00821745.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Yersinia bercovieri ATCC 43970] (464 aa)
Score = 104, Expect = 6.3e-03, Identities = 30/99 (30%), Positives = 55/99 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           L+ L  FI+ A+ + +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  ++   V  ELR  +Q   ++  LQ   I+
  S:     5 LWSLAAFII-ALGILITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVAAVAPELR--HQSFNNKTVLQRAAIV 101
>gi|120603160|ref|YP_967560.1| putative membrane-associated zinc metalloprotease [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120563389|gb|ABM29133.1| putative membrane-associated zinc metalloprotease [Desulfovibrio vulgaris subsp. vulgaris DP4] (354 aa)
Score = 104, Expect = 6.4e-03, Identities = 18/62 (29%), Positives = 39/62 (62%)
  Q:     9 FILLAIMVGLTI-HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F +L ++ GL   HE+GH++ A++  + V  F++G GP+I+  +     + ++L+P+  +V +
  S:     5 FSVLLVLGGLIFFHELGHYLAARVLGIGVHTFSLGFGPRIFGWRSGQTDYRLSLIPLGGYVSL 67
>gi|46579278|ref|YP_010086.1| membrane-associated zinc metalloprotease, putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46448692|gb|AAS95345.1| membrane-associated zinc metalloprotease, putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (354 aa)
Score = 104, Expect = 6.4e-03, Identities = 18/62 (29%), Positives = 39/62 (62%)
  Q:     9 FILLAIMVGLTI-HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           F +L ++ GL   HE+GH++ A++  + V  F++G GP+I+  +     + ++L+P+  +V +
  S:     5 FSVLLVLGGLIFFHELGHYLAARVLGIGVHTFSLGFGPRIFGWRSGQTDYRLSLIPLGGYVSL 67
>gi|196232815|ref|ZP_03131665.1| peptidase M50 [Chthoniobacter flavus Ellin428] >gi|196223014|gb|EDY17534.1| peptidase M50 [Chthoniobacter flavus Ellin428] (569 aa)
Score = 104, Expect = 6.6e-03, Identities = 21/75 (28%), Positives = 43/75 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVF 79
           +LVIF L+ I     +HE+GHF+ A+   + +++F +  G  ++ K+   +++S+  +P   FV +    S++ F
  S:    16 VLVIFNLMII-----VHELGHFLTARWRGLKIEKFGVWFGKPLWKKKVNGVEYSLGSIPFGGFVALPQLASMEGF 85
>gi|93006533|ref|YP_580970.1| peptidase M50, putative membrane-associated zinc metallopeptidase [Psychrobacter cryohalolentis K5] >gi|92394211|gb|ABE75486.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Psychrobacter cryohalolentis K5] (457 aa)
Score = 104, Expect = 6.6e-03, Identities = 23/75 (30%), Positives = 46/75 (61%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY--SKQFTNIKFSINLLPIMAFVRIDSKKSLQV 78
            L  IF+L  +   + +HE GH++ A+L  V V  ++IG GPK++  + + + I + I+ LP+  +V++  ++  +V
  S:     7 LLAAIFVLGPL---IALHEWGHYIVARLCGVRVLTYSIGFGPKLFGWTSKKSGIDYRISALPLGGYVKMLDEREGEV 80
>gi|73667475|ref|YP_303491.1| peptidase RseP [Ehrlichia canis str. Jake] >gi|72394616|gb|AAZ68893.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Ehrlichia canis str. Jake] (380 aa)
Score = 104, Expect = 6.7e-03, Identities = 25/68 (36%), Positives = 44/68 (64%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY---SKQFTNIKFSINLLPIMAFVRI 70
            +LL    +++++V   +HE GH++ AKL  V ++ F+IG GP+++    K  T  KFSI  +PI  +V++
  S:    17 FYLLSFLTIMSVIV--FVHEYGHYIVAKLCNVKIEVFSIGFGPELFGINDKSGTRWKFSI--IPIGGYVKM 83
>gi|121634058|ref|YP_974303.1| putative inner membrane protease [Neisseria meningitidis FAM18] >gi|120865764|emb|CAM09493.1| putative inner membrane protease [Neisseria meningitidis FAM18] (446 aa)
Score = 104, Expect = 6.8e-03, Identities = 19/69 (27%), Positives = 46/69 (66%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKK 74
           L+ FI  AI++ +++HE GH++ A+L  V V  F++G G   ++++  + ++ +  +P+  +V+ +D+++
  S:     4 LLAFIF-AILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIPLGGYVKMVDTRE 72
>gi|15676110|ref|NP_273241.1| hypothetical protein NMB0183 [Neisseria meningitidis MC58] >gi|20978847|sp|Q9K1G9|Y183_NEIMB Putative zinc metalloprotease NMB0183 >gi|7225402|gb|AAF40640.1| conserved hypothetical protein [Neisseria meningitidis MC58] (446 aa)
Score = 104, Expect = 6.8e-03, Identities = 19/69 (27%), Positives = 46/69 (66%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKK 74
           L+ FI  AI++ +++HE GH++ A+L  V V  F++G G   ++++  + ++ +  +P+  +V+ +D+++
  S:     4 LLAFIF-AILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIPLGGYVKMVDTRE 72
>gi|15793113|ref|NP_282935.1| integral membrane protein [Neisseria meningitidis Z2491] >gi|20978787|sp|Q9JX32|Y084_NEIMA Putative zinc metalloprotease NMA0084 >gi|121051132|emb|CAM07403.1| putative integral membrane protein [Neisseria meningitidis Z2491] (446 aa)
Score = 104, Expect = 6.8e-03, Identities = 19/69 (27%), Positives = 46/69 (66%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKK 74
           L+ FI  AI++ +++HE GH++ A+L  V V  F++G G   ++++  + ++ +  +P+  +V+ +D+++
  S:     4 LLAFIF-AILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIPLGGYVKMVDTRE 72
>gi|91069867|gb|ABE10798.1| conserved hypothetical protein [uncultured Prochlorococcus marinus clone ASNC1363] (359 aa)
Score = 104, Expect = 6.9e-03, Identities = 20/48 (41%), Positives = 30/48 (62%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE+GHF+ A L  + V  F+IG GP I  K++ +I +S+   P+  FV
  S:    17 HEMGHFLAAILQGIYVDGFSIGFGPSIIQKRYKDITYSLRAFPLGGFV 64
>gi|27365214|ref|NP_760742.1| membrane-associated Zn-dependent protease 1 [Vibrio vulnificus CMCP6] >gi|27361361|gb|AAO10269.1|AE016803_56 Predicted membrane-associated Zn-dependent proteases 1 [Vibrio vulnificus CMCP6] (452 aa)
Score = 104, Expect = 6.9e-03, Identities = 25/68 (36%), Positives = 46/68 (67%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L+ LV FI+ A+ + + +HE GHF  A+   V V++F+IG G  I+SK   +  ++SI+++P+  +V++
  S:     5 LWNLVSFIV-ALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWSKVGQDGTEYSISVIPLGGYVKM 72
>gi|148284253|ref|YP_001248343.1| putative membrane-associated zinc-dependent metalloprotease [Orientia tsutsugamushi str. Boryong] >gi|146739692|emb|CAM79502.1| putative membrane-associated zinc-dependent metalloprotease [Orientia tsutsugamushi Boryong] (353 aa)
Score = 104, Expect = 6.9e-03, Identities = 25/68 (36%), Positives = 43/68 (63%)
  Q:     3 LFLLVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNI-KFSINLLPIMAFVRI 70
           +FL+   +   I  GL I  HE+GH+  A+L  V V+EF+IG G ++++    N+ ++ I + P+  FVR+
  S:     1 MFLVTTILSFVITTGLLIFVHELGHYFCARLCGVYVQEFSIGFGKELFAFIDKNLTRWKICIFPLGGFVRM 71
>gi|37680734|ref|NP_935343.1| membrane-associated Zn-dependent protease 1 [Vibrio vulnificus YJ016] >gi|37199483|dbj|BAC95314.1| predicted membrane-associated Zn-dependent protease 1 [Vibrio vulnificus YJ016] (452 aa)
Score = 103, Expect = 7.0e-03, Identities = 25/68 (36%), Positives = 46/68 (67%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L+ LV FI+ A+ + + +HE GHF  A+   V V++F+IG G  I+SK   +  ++SI+++P+  +V++
  S:     5 LWNLVSFIV-ALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWSKVGQDGTEYSISVIPLGGYVKM 72
>gi|86608469|ref|YP_477231.1| membrane-associated zinc metalloprotease, putative [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86557011|gb|ABD01968.1| membrane-associated zinc metalloprotease, putative [Synechococcus sp. JA-2-3B'a(2-13)] (365 aa)
Score = 103, Expect = 7.1e-03, Identities = 18/49 (36%), Positives = 30/49 (61%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +HE GHF  AKL  ++V  F++G GP ++  Q    +++I  LP+  +V
  S:    16 VHEAGHFAAAKLQGIHVNRFSLGFGPVLWRYQGKETEYAIRALPLGGYV 64
>gi|86605615|ref|YP_474378.1| putative membrane-associated zinc metalloprotease [Synechococcus sp. JA-3-3Ab] >gi|86554157|gb|ABC99115.1| putative membrane-associated zinc metalloprotease [Synechococcus sp. JA-3-3Ab] (366 aa)
Score = 103, Expect = 7.1e-03, Identities = 18/49 (36%), Positives = 30/49 (61%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +HE GHF  AKL  ++V  F++G GP ++  Q    +++I  LP+  +V
  S:    16 VHEAGHFAAAKLQGIHVNRFSLGFGPVLWRYQGKETEYAIRALPLGGYV 64
>gi|196180138|gb|EDX75130.1| RIP metalloprotease RseP [Microcoleus chthonoplastes PCC 7420] (366 aa)
Score = 103, Expect = 7.2e-03, Identities = 19/64 (29%), Positives = 38/64 (59%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L    +LA+++   +HE+GHF+ A+L  +    F++G GP ++  Q  + +++I   P+  FV
  S:     3 ILAAIAVLAVLI--VVHELGHFMAARLQGIYANRFSLGFGPVLWKYQGPDTEYAIRAFPLGGFV 64
>gi|33866427|ref|NP_897986.1| hypothetical protein SYNW1895 [Synechococcus sp. WH 8102] >gi|33633205|emb|CAE08410.1| conserved hypothetical protein [Synechococcus sp. WH 8102] (361 aa)
Score = 103, Expect = 7.2e-03, Identities = 19/48 (39%), Positives = 28/48 (58%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE GHF+ A L  + V  F+IG GP +  +Q   + ++I  LP+  FV
  S:    17 HEAGHFLAATLQGIRVSGFSIGFGPALIKRQRRGVTYAIRALPLGGFV 64
>gi|90415800|ref|ZP_01223733.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [marine gamma proteobacterium HTCC2207] >gi|90332174|gb|EAS47371.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [marine gamma proteobacterium HTCC2207] (452 aa)
Score = 103, Expect = 7.5e-03, Identities = 26/79 (32%), Positives = 42/79 (53%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIG-PKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           L   + F L+A+ V ++ HE GHF  A+   V V+ F+IG G P +      N +F I  LP+  +V++  ++   V  E
  S:     3 LLQTIFFTLIALGVLVSFHEFGHFWVARRCGVKVQRFSIGFGTPLLRWHDSHNTEFVIAALPLGGYVKMLDEREGDVSAE 82
>gi|116749220|ref|YP_845907.1| putative membrane-associated zinc metalloprotease [Syntrophobacter fumaroxidans MPOB] >gi|116698284|gb|ABK17472.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Syntrophobacter fumaroxidans MPOB] (367 aa)
Score = 103, Expect = 7.6e-03, Identities = 19/65 (29%), Positives = 40/65 (61%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKS 75
           ++ + V + +HE+GHF+ AK   V V  F++G GPK++     + ++ I+ +P+  +V++  + S
  S:    14 IVVLGVLIFVHELGHFLVAKWMHVTVLRFSLGFGPKLWGFTRGDTEYRISWIPLGGYVKMLGEDS 78
>gi|168477516|ref|ZP_02706539.1| hypothetical protein Salmoentericaenterica_22925 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (426 aa)
Score = 103, Expect = 7.6e-03, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELR 85
>gi|59802118|ref|YP_208830.1| hypothetical protein NGO1800 [Neisseria gonorrhoeae FA 1090] >gi|194099960|ref|YP_002003099.1| Putative zinc metalloprotease NMA0084 [Neisseria gonorrhoeae NCCP11945] >gi|59719013|gb|AAW90418.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] >gi|193935250|gb|ACF31074.1| Putative zinc metalloprotease NMA0084 [Neisseria gonorrhoeae NCCP11945] (446 aa)
Score = 103, Expect = 8.0e-03, Identities = 19/69 (27%), Positives = 46/69 (66%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKK 74
           L+ FI  AI++ +++HE GH++ A+L  V V  F++G G   ++++  + ++ +  +P+  +V+ +D+++
  S:     4 LLAFIF-AILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIPLGGYVKMVDTRE 72
>gi|17231463|ref|NP_488011.1| hypothetical protein all3971 [Nostoc sp. PCC 7120] >gi|20978816|sp|Q8YQ64|Y3971_ANASP Putative zinc metalloprotease all3971 >gi|17133105|dbj|BAB75670.1| all3971 [Nostoc sp. PCC 7120] (364 aa)
Score = 103, Expect = 8.0e-03, Identities = 20/64 (31%), Positives = 38/64 (59%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L    +LA+++   +HE+GHFV A+   ++V  F++G GP ++  Q    +++I   P+  FV
  S:     3 VLAAIAVLAVLI--LVHELGHFVAARSQGIHVNRFSLGFGPVLWKYQGAETEYAIRAFPLGGFV 64
>gi|90022235|ref|YP_528062.1| peptidase RseP [Saccharophagus degradans 2-40] >gi|89951835|gb|ABD81850.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Saccharophagus degradans 2-40] (466 aa)
Score = 103, Expect = 8.2e-03, Identities = 25/86 (29%), Positives = 46/86 (53%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADE 92
           +++ L+AI + + IHE GHF  A+   V V  F+IG GP++ +       +F+++ +P+  +V+            + DE + E DE
  S:    25 LLWFLIAISILVAIHEYGHFYVARRCGVKVLRFSIGFGPRLLTWTDKKGTEFALSAIPLGGYVK------------MLDEREGEVDE 99
>gi|170021471|ref|YP_001726425.1| membrane-associated zinc metalloprotease [Escherichia coli ATCC 8739] >gi|169756399|gb|ACA79098.1| membrane-associated zinc metalloprotease [Escherichia coli ATCC 8739] (450 aa)
Score = 103, Expect = 8.3e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|75907951|ref|YP_322247.1| hypothetical protein Ava_1730 [Anabaena variabilis ATCC 29413] >gi|75701676|gb|ABA21352.1| YUP8H12.25 {{Arabidopsis thaliana}}-type protein. Metallo peptidase. MEROPS family M50B [Anabaena variabilis ATCC 29413] (364 aa)
Score = 103, Expect = 8.3e-03, Identities = 20/64 (31%), Positives = 38/64 (59%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L    +LA+++   +HE+GHFV A+   ++V  F++G GP ++  Q    +++I   P+  FV
  S:     3 VLAAIAVLAVLI--LVHELGHFVAARSQGIHVNRFSLGFGPVLWKYQGAETEYAIRAFPLGGFV 64
>gi|30061733|ref|NP_835904.1| zinc metallopeptidase [Shigella flexneri 2a str. 2457T] >gi|56479619|ref|NP_706121.2| zinc metallopeptidase [Shigella flexneri 2a str. 301] >gi|30039975|gb|AAP15709.1| hypothetical protein S0169 [Shigella flexneri 2a str. 2457T] >gi|56383170|gb|AAN41828.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] (450 aa)
Score = 103, Expect = 8.3e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|26246122|ref|NP_752161.1| zinc metallopeptidase [Escherichia coli CFT073] >gi|91209246|ref|YP_539232.1| zinc metallopeptidase [Escherichia coli UTI89] >gi|26106519|gb|AAN78705.1|AE016755_205 Protease ecfE [Escherichia coli CFT073] >gi|91070820|gb|ABE05701.1| inner membrane zinc metalloprotease required for the extracytoplasmic stress response mediated by sigma(E) [Escherichia coli UTI89] (465 aa)
Score = 103, Expect = 8.3e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    27 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 100
>gi|157159641|ref|YP_001456959.1| zinc metallopeptidase [Escherichia coli HS] >gi|157065321|gb|ABV04576.1| RIP metalloprotease RseP [Escherichia coli HS] (450 aa)
Score = 103, Expect = 8.3e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|157156244|ref|YP_001461345.1| zinc metallopeptidase [Escherichia coli E24377A] >gi|157078274|gb|ABV17982.1| RIP metalloprotease RseP [Escherichia coli E24377A] (450 aa)
Score = 103, Expect = 8.3e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|171059524|ref|YP_001791873.1| membrane-associated zinc metalloprotease [Leptothrix cholodnii SP-6] >gi|170776969|gb|ACB35108.1| membrane-associated zinc metalloprotease [Leptothrix cholodnii SP-6] (491 aa)
Score = 103, Expect = 8.4e-03, Identities = 22/84 (26%), Positives = 48/84 (57%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVR-IDSKKSLQVFGELRDEYQKEA 90
           ++F L+ + V +  HE GH+  A+   V V  F+IG G  ++ +Q  + ++ I +LP+  +V+ +D +++     +L   + ++A
  S:     4 LLFFLITLAVLIVAHEWGHYRVARACGVKVLRFSIGFGRPLWRRQSGDTEWVIGMLPLGGYVKMLDEREAPVPPDQLDQSFNRKA 88
>gi|58697127|ref|ZP_00372562.1| Zinc metalloprotease [Wolbachia endosymbiont of Drosophila simulans] >gi|58536576|gb|EAL59919.1| Zinc metalloprotease [Wolbachia endosymbiont of Drosophila simulans] (215 aa)
Score = 103, Expect = 8.4e-03, Identities = 23/69 (33%), Positives = 44/69 (63%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           G++  + F L+ I V + +HE GH+V AK  KV V+ F+IG GP+I+     +  ++ ++ +P+  +V++
  S:    14 GIYYFLSFSLI-ISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAVPLGGYVKM 82
>gi|188496437|ref|ZP_03003707.1| peptidase EcfE [Escherichia coli 53638] >gi|188491636|gb|EDU66739.1| peptidase EcfE [Escherichia coli 53638] (451 aa)
Score = 103, Expect = 8.5e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|187732347|ref|YP_001878978.1| RIP metalloprotease RseP [Shigella boydii CDC 3083-94] >gi|187429339|gb|ACD08613.1| RIP metalloprotease RseP [Shigella boydii CDC 3083-94] (450 aa)
Score = 103, Expect = 8.5e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|15799858|ref|NP_285870.1| zinc metallopeptidase [Escherichia coli O157:H7 EDL933] >gi|15829432|ref|NP_308205.1| zinc metallopeptidase [Escherichia coli O157:H7 str. Sakai] >gi|16128169|ref|NP_414718.1| zinc metallopeptidase [Escherichia coli str. K-12 substr. MG1655] >gi|89107056|ref|AP_000836.1| zinc metallopeptidase [Escherichia coli W3110] >gi|110804228|ref|YP_687748.1| zinc metallopeptidase [Shigella flexneri 5 str. 8401] >gi|168707908|ref|ZP_02740185.1| zinc metallopeptidase [Escherichia coli O157:H7 str. EC4045] >gi|168737982|ref|ZP_02770259.1| zinc metallopeptidase [Escherichia coli O157:H7 str. EC4115] >gi|168751395|ref|ZP_02776417.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4113] >gi|168755789|ref|ZP_02780796.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4401] >gi|168765295|ref|ZP_02790302.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4501] >gi|168770350|ref|ZP_02795357.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4486] >gi|168777013|ref|ZP_02802020.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4196] >gi|168782068|ref|ZP_02807075.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4076] >gi|168789285|ref|ZP_02814292.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC869] >gi|168792556|ref|ZP_02817563.1| zinc metallopeptidase [Escherichia coli O157:H7 str. EC4042] >gi|170079812|ref|YP_001729132.1| inner membrane zinc RIP metalloprotease [Escherichia coli str. K12 substr. DH10B] >gi|193063248|ref|ZP_03044339.1| RIP metalloprotease RseP [Escherichia coli E22] >gi|194428260|ref|ZP_03060802.1| RIP metalloprotease RseP [Escherichia coli B171] >gi|194439126|ref|ZP_03071208.1| RIP metalloprotease RseP [Escherichia coli 101-1] >gi|195938142|ref|ZP_03083524.1| zinc metallopeptidase [Escherichia coli O157:H7 str. EC4024] >gi|83308955|sp|P0AEH2|RSEP_ECO57 Regulator of sigma E protease >gi|83308956|sp|P0AEH1|RSEP_ECOLI Regulator of sigma E protease >gi|12512901|gb|AAG54478.1|AE005193_8 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|15529630|gb|AAL01378.1|AF407012_1 inner membrane protein [Escherichia coli] >gi|1552753|gb|AAB08605.1| hypothetical [Escherichia coli] >gi|1786373|gb|AAC73287.1| zinc metallopeptidase [Escherichia coli str. K-12 substr. MG1655] >gi|4902917|dbj|BAA77851.1| zinc metallopeptidase [Escherichia coli W3110] >gi|13359634|dbj|BAB33601.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|110613776|gb|ABF02443.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] >gi|169887647|gb|ACB01354.1| inner membrane zinc RIP metalloprotease [Escherichia coli str. K12 substr. DH10B] >gi|187767687|gb|EDU31531.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4196] >gi|188014570|gb|EDU52692.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4113] >gi|189000422|gb|EDU69408.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4076] >gi|189357018|gb|EDU75437.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4401] >gi|189360726|gb|EDU79145.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4486] >gi|189364911|gb|EDU83327.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC4501] >gi|189371079|gb|EDU89495.1| RIP metalloprotease RseP [Escherichia coli O157:H7 str. EC869] >gi|192931156|gb|EDV83759.1| RIP metalloprotease RseP [Escherichia coli E22] >gi|194413635|gb|EDX29915.1| RIP metalloprotease RseP [Escherichia coli B171] >gi|194421945|gb|EDX37950.1| RIP metalloprotease RseP [Escherichia coli 101-1] (450 aa)
Score = 103, Expect = 8.5e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|170683080|ref|YP_001742304.1| RIP metalloprotease RseP [Escherichia coli SMS-3-5] >gi|170520798|gb|ACB18976.1| RIP metalloprotease RseP [Escherichia coli SMS-3-5] (450 aa)
Score = 103, Expect = 8.6e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|118462609|ref|YP_882901.1| peptidase M50 [Mycobacterium avium 104] >gi|118163896|gb|ABK64793.1| peptidase M50 [Mycobacterium avium 104] (407 aa)
Score = 103, Expect = 8.6e-03, Identities = 17/71 (23%), Positives = 38/71 (53%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           ++   LAI++ + +HE GH   A+   + V+ + +G GP ++S +    ++ +  +P+  F  I    S++
  S:     7 IVLFALAILISVALHECGHMWVARATGMKVRRYFVGFGPTLWSTRRGETEYGLKAVPLGGFCDIAGMTSVE 77
>gi|111023548|ref|YP_706520.1| membrane-associated Zn-dependent protease [Rhodococcus sp. RHA1] >gi|110823078|gb|ABG98362.1| possible membrane-associated Zn-dependent protease [Rhodococcus sp. RHA1] (406 aa)
Score = 103, Expect = 8.6e-03, Identities = 20/70 (28%), Positives = 36/70 (51%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSL 76
           V+   L I + + +HE GH   A+   + V+ + IG GPK++S +    ++ +  LP+  F  I    +L
  S:     7 VVLFALGIALSIALHEAGHMWVAQATGMKVRRYFIGFGPKVFSFRRGETEYGLKALPLGGFCDIAGMTAL 76
>gi|41409037|ref|NP_961873.1| hypothetical protein MAP2939c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41397396|gb|AAS05256.1| hypothetical protein MAP_2939c [Mycobacterium avium subsp. paratuberculosis K-10] (407 aa)
Score = 103, Expect = 8.6e-03, Identities = 17/71 (23%), Positives = 38/71 (53%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQ 77
           ++   LAI++ + +HE GH   A+   + V+ + +G GP ++S +    ++ +  +P+  F  I    S++
  S:     7 IVLFALAILISVALHECGHMWVARATGMKVRRYFVGFGPTLWSTRRGETEYGLKAVPLGGFCDIAGMTSVE 77
>gi|110640395|ref|YP_668123.1| zinc metallopeptidase [Escherichia coli 536] >gi|117622461|ref|YP_851374.1| zinc metallopeptidase [Escherichia coli APEC O1] >gi|191172791|ref|ZP_03034328.1| RIP metalloprotease RseP [Escherichia coli F11] >gi|110341987|gb|ABG68224.1| protease EcfE [Escherichia coli 536] >gi|115511585|gb|ABI99659.1| zinc metallopeptidase [Escherichia coli APEC O1] >gi|190906941|gb|EDV66543.1| RIP metalloprotease RseP [Escherichia coli F11] (450 aa)
Score = 103, Expect = 8.6e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|68536243|ref|YP_250948.1| putative membrane-associated Zn-dependent metalloprotease [Corynebacterium jeikeium K411] >gi|68263842|emb|CAI37330.1| putative membrane-associated Zn-dependent metalloprotease [Corynebacterium jeikeium K411] (414 aa)
Score = 102, Expect = 9.1e-03, Identities = 25/97 (25%), Positives = 47/97 (48%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           L ++   L I + + +HE GH + A++  + V+ + IG GP I+S +  + ++ +  +P+  F  I     L    E+ DE +  A      H+ I 
  S:     5 LGILLFALGIALSIALHEAGHLIAARMSGMRVRRYFIGFGPTIFSFRKGHTEYGLKGVPLGGFCDIAGMTKLD---EMTDEERPYAMYDKPAHRRIF 98
>gi|156741798|ref|YP_001431927.1| peptidase M50 [Roseiflexus castenholzii DSM 13941] >gi|156233126|gb|ABU57909.1| peptidase M50 [Roseiflexus castenholzii DSM 13941] (371 aa)
Score = 102, Expect = 9.2e-03, Identities = 22/60 (36%), Positives = 37/60 (61%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPK-IYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFG 80
           HE+GHF+ A  F + V+EF +G  P+ +   +   +K+++N LPI  FVR   +   Q++G
  S:    26 HELGHFLTAVWFGIKVEEFGLGYPPRAMVLFERNGVKYTLNWLPIGGFVRFGGEGE-QIYG 85
>gi|82542775|ref|YP_406722.1| zinc metallopeptidase [Shigella boydii Sb227] >gi|81244186|gb|ABB64894.1| conserved hypothetical protein [Shigella boydii Sb227] (450 aa)
Score = 102, Expect = 9.3e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|88798264|ref|ZP_01113850.1| predicted membrane-associated Zn-dependent protease 1 [Reinekea sp. MED297] >gi|88779040|gb|EAR10229.1| predicted membrane-associated Zn-dependent protease 1 [Reinekea sp. MED297] (448 aa)
Score = 102, Expect = 9.3e-03, Identities = 25/81 (30%), Positives = 47/81 (58%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEA 90
           ++LA+ + +TIHE GHF  A+   V V  F++G G  I+S       +F++  +P+  +V++  ++     GE+ D+ + EA
  S:     8 LILALGILVTIHEYGHFWVARRCGVRVLRFSVGFGKPIWSWMDRHGTEFAVAWIPLGGYVKMLDERE----GEVPDDQRHEA 85
>gi|126736316|ref|ZP_01752058.1| Protease ecfE, putative [Roseobacter sp. CCS2] >gi|126714137|gb|EBA11006.1| Protease ecfE, putative [Roseobacter sp. CCS2] (441 aa)
Score = 102, Expect = 9.4e-03, Identities = 22/66 (33%), Positives = 40/66 (60%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVR 69
           F++V F++ A+ V + IHE GH++  +   ++   F++G GP IYS+      K+ I  LP+  +V+
  S:    12 FMIVAFVV-ALSVIVAIHEYGHYIVGRWCGIHADVFSLGFGPVIYSRMDKRGTKWQIAALPLGGYVK 77
>gi|82775566|ref|YP_401913.1| zinc metallopeptidase [Shigella dysenteriae Sd197] >gi|81239714|gb|ABB60424.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (450 aa)
Score = 102, Expect = 9.4e-03, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELR 85
>gi|121998241|ref|YP_001003028.1| putative membrane-associated zinc metalloprotease [Halorhodospira halophila SL1] >gi|121589646|gb|ABM62226.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Halorhodospira halophila SL1] (455 aa)
Score = 102, Expect = 9.6e-03, Identities = 22/72 (30%), Positives = 45/72 (62%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS---KQFTNIKFSINLLPIMAFVRIDSKKSLQV 78
           VI  L+AI + +T+HE GHF  A+   V V+ F++G G  + S   +   +I++ ++ +P+  +V++  ++  +V
  S:     7 VIAFLVAIAILVTVHEAGHFFVARWCNVRVRRFSVGFGRPLLSWRGRGPDHIEYCLSAIPLGGYVQMLDEREGEV 81
>gi|91788550|ref|YP_549502.1| peptidase RseP [Polaromonas sp. JS666] >gi|91697775|gb|ABE44604.1| RseP peptidase. Metallo peptidase. MEROPS family M50B [Polaromonas sp. JS666] (458 aa)
Score = 102, Expect = 9.6e-03, Identities = 23/68 (33%), Positives = 40/68 (58%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN--IKFSINLLPIMAFVRI 70
           L LL   + L I++   +HE GH+  A    + V +F+IG G  IY+ +  N   +F+I +LP+  +V++
  S:     2 LTLLAFVVALGILIA--VHEYGHYRVAVACGIKVLKFSIGFGKPIYTWRLKNKPTEFAIGMLPLGGYVKM 69
>gi|146310378|ref|YP_001175452.1| zinc metallopeptidase [Enterobacter sp. 638] >gi|145317254|gb|ABP59401.1| putative membrane-associated zinc metalloprotease [Enterobacter sp. 638] (450 aa)
Score = 102, Expect = 9.9e-03, Identities = 27/81 (33%), Positives = 47/81 (58%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      +F I L+P+  +V++  ++   V  E+R
  S:     5 LWNLAAFIV-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKSLWRRTDRYGTEFVIALIPLGGYVKMLDERVESVAPEMR 85
>gi|62178793|ref|YP_215210.1| zinc metallopeptidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62126426|gb|AAX64129.1| putative membrane-associated Zn-dependent protease [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (450 aa)
Score = 102, Expect = 9.9e-03, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELR 85
>gi|87118619|ref|ZP_01074518.1| membrane-associated zinc metalloprotease, putative [Marinomonas sp. MED121] >gi|86166253|gb|EAQ67519.1| membrane-associated zinc metalloprotease, putative [Marinomonas sp. MED121] (448 aa)
Score = 102, Expect = 1.0e-02, Identities = 25/79 (31%), Positives = 45/79 (56%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIG-PKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           V+ IL+A+ V +T HE GH++ A+   V V  F++G G P +        +F++ L+P+  +VR+  ++   V   L+ E
  S:     5 VLSILIALGVLITFHEFGHYIVARACGVKVLRFSVGFGKPLLKWVNKNGTEFTLALIPLGGYVRMLDEREGDVPEALKGE 84
>gi|167470424|ref|ZP_02335128.1| RIP metalloprotease RseP [Yersinia pestis FV-1] (222 aa)
Score = 102, Expect = 1.0e-02, Identities = 30/99 (30%), Positives = 55/99 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           L+ L  FI+ A+ + +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  ++   V  ELR  +Q   ++  LQ   I+
  S:     5 LWSLAAFIV-ALGILITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVEAVAPELR--HQSFNNKTVLQRAAIV 101
>gi|161504658|ref|YP_001571770.1| zinc metallopeptidase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866005|gb|ABX22628.1| hypothetical protein SARI_02779 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (450 aa)
Score = 102, Expect = 1.0e-02, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELR 85
>gi|16763613|ref|NP_459228.1| zinc metallopeptidase [Salmonella typhimurium LT2] >gi|56412496|ref|YP_149571.1| zinc metallopeptidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161612595|ref|YP_001586560.1| zinc metallopeptidase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167546840|ref|ZP_02342402.1| hypothetical protein Sentent_26339 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167553364|ref|ZP_02347113.1| hypothetical protein Sentente_22937 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167990109|ref|ZP_02571209.1| hypothetical protein Sententer_01000001_0100001610 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168221781|ref|ZP_02647013.1| hypothetical protein Senterenterica_15401 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168228349|ref|ZP_02653580.1| hypothetical protein Sententeric_21427 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168230531|ref|ZP_02655589.1| hypothetical protein Sententerica_06116 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168235002|ref|ZP_02660060.1| hypothetical protein Senteenterica_02360 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168244990|ref|ZP_02669922.1| hypothetical protein Senterienterica_25344 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263909|ref|ZP_02685882.1| hypothetical protein Salmentericaenterica_22748 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464213|ref|ZP_02698116.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168823252|ref|ZP_02835252.1| hypothetical protein Salentericaenterica_27967 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194444218|ref|YP_002039463.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449403|ref|YP_002044213.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469383|ref|ZP_03075367.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735257|ref|YP_002113246.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|20978466|sp|Q8ZRP1|RSEP_SALTY Regulator of sigma E protease >gi|16418728|gb|AAL19187.1| putative membrane-associated Zn-dependent protease [Salmonella typhimurium LT2] >gi|56126753|gb|AAV76259.1| putative membrane protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161361959|gb|ABX65727.1| hypothetical protein SPAB_00286 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194402881|gb|ACF63103.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407707|gb|ACF67926.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455747|gb|EDX44586.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710759|gb|ACF89980.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632931|gb|EDX51385.1| RIP metalloprotease RseP [Salmonella enterica subsp. enterica serovar Newport str. SL317] (450 aa)
Score = 102, Expect = 1.0e-02, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELR 85
>gi|16759213|ref|NP_454830.1| zinc metallopeptidase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29140763|ref|NP_804105.1| zinc metallopeptidase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|20978462|sp|Q8Z9A4|RSEP_SALTI Regulator of sigma E protease >gi|25331643|pir||AI0529 probable membrane protein yaeL [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501504|emb|CAD08681.1| putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136387|gb|AAO67954.1| putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (450 aa)
Score = 102, Expect = 1.0e-02, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELR 85
>gi|58698452|ref|ZP_00373361.1| membrane-associated zinc metalloprotease, putative [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535044|gb|EAL59134.1| membrane-associated zinc metalloprotease, putative [Wolbachia endosymbiont of Drosophila ananassae] (383 aa)
Score = 102, Expect = 1.0e-02, Identities = 23/69 (33%), Positives = 44/69 (63%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           G++  + F L+ I V + +HE GH+V AK  KV V+ F+IG GP+I+     +  ++ ++ +P+  +V++
  S:    14 GIYYFLSFSLI-ISVIVFVHEYGHYVVAKACKVKVESFSIGFGPEIFGFNDKSGTRWKLSAVPLGGYVKM 82
>gi|46445895|ref|YP_007260.1| hypothetical protein pc0261 [Candidatus Protochlamydia amoebophila UWE25] >gi|46399536|emb|CAF22985.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (653 aa)
Score = 102, Expect = 1.1e-02, Identities = 22/66 (33%), Positives = 37/66 (56%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           L VI  +L +   + IHE+GH+  A+   + V+ F+IG G  IYS +   +K+ +  L    +V+I
  S:     6 LYVILAILGLSFLIFIHELGHYYMARRLGMKVETFSIGFGRPIYSWERDGVKWQVGWLLFGGYVKI 71
>gi|163801786|ref|ZP_02195683.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio campbellii AND4] >gi|159174294|gb|EDP59098.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Vibrio campbellii AND4] (452 aa)
Score = 102, Expect = 1.1e-02, Identities = 26/71 (36%), Positives = 49/71 (69%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVR-IDSK 73
           L+ LV FI+ A+ + + +HE GHF  A+   V V++F+IG G  I+S+   +  ++SI+++P+  +V+ +DS+
  S:     5 LWNLVSFIV-ALGILVAVHEYGHFWVARRCGVKVEKFSIGFGKSIWSRVGKDGTEYSISMIPLGGYVKMVDSR 76
>gi|32491134|ref|NP_871388.1| hypothetical protein WGLp385 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166341|dbj|BAC24531.1| yaeL [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (446 aa)
Score = 102, Expect = 1.1e-02, Identities = 27/78 (34%), Positives = 50/78 (64%)
  Q:     4 FLLVIF-ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIY-SKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGE 81
           F+  IF  ++++ + +TIHE GHF  A+   V+V++F+IGIG  I+ +      ++ I+LLPI  ++++ + KS  +  E
  S:     4 FIWNIFSFIISVSILITIHEFGHFFIARKLGVHVEKFSIGIGKVIWKTVDKKGTEYVISLLPIGGYIKMLNYKSKNITKE 83
>gi|118047282|ref|ZP_01515921.1| peptidase M50 [Chloroflexus aggregans DSM 9485] >gi|117996206|gb|EAV10408.1| peptidase M50 [Chloroflexus aggregans DSM 9485] (388 aa)
Score = 102, Expect = 1.1e-02, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPK-IYSKQFTNIKFSINLLPIMAFVR 69
           +LV  I+L+++V   +HE+GH        + V+EF IG  P+ +   +   IK+++N LP+  FVR
  S:    24 ILVFLIMLSLLV--FVHELGHLWVGLRMGIKVEEFGIGFPPRALVLFERNGIKYTLNWLPLGGFVR 87
>gi|77977741|ref|ZP_00833182.1| COG0750: Predicted membrane-associated Zn-dependent proteases 1 [Yersinia intermedia ATCC 29909] (451 aa)
Score = 102, Expect = 1.2e-02, Identities = 30/99 (30%), Positives = 55/99 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           L+ L  FI+ A+ + +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  ++   V  ELR  +Q   ++  LQ   I+
  S:     5 LWSLAAFII-ALGILITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVEAVAPELR--HQSFNNKTVLQRAAIV 101
>gi|189182936|ref|YP_001936721.1| putative membrane-associated Zn-dependent protease 1 [Orientia tsutsugamushi str. Ikeda] >gi|189179707|dbj|BAG39487.1| putative membrane-associated Zn-dependent protease 1 [Orientia tsutsugamushi str. Ikeda] (353 aa)
Score = 102, Expect = 1.2e-02, Identities = 28/87 (32%), Positives = 47/87 (54%)
  Q:     3 LFLLVIFILLAIMVGLTI--HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNI-KFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKE 89
           +FL+   +   I  GL +  HE+GH+  A++  V V+EF+IG G +I++    N+ ++ I + P   FVR+      Q F   R  Y  +
  S:     1 MFLVTTILSFVITTGLLVFVHELGHYFCARVCGVYVQEFSIGFGKEIFAFVDKNLTRWKICIFPFGGFVRMQHHS--QDFASDRRSYNNQ 88
>gi|196240944|ref|ZP_03139710.1| membrane-associated zinc metalloprotease [Cyanothece sp. PCC 7425] >gi|196215023|gb|EDY09676.1| membrane-associated zinc metalloprotease [Cyanothece sp. PCC 7425] (369 aa)
Score = 101, Expect = 1.2e-02, Identities = 19/65 (29%), Positives = 37/65 (56%)
  Q:     4 FLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           FL V+  +  + V + +HE GHF+ A+   ++V  F+IG GP ++  Q    ++++   P+  +V
  S:     3 FLSVLAAIAVLAVLIVVHEAGHFLAARWQGIHVNRFSIGFGPVLWKYQGPETEYALRGFPLGGYV 67
>gi|193211745|ref|YP_001997698.1| membrane-associated zinc metalloprotease [Chlorobaculum parvum NCIB 8327] >gi|193085222|gb|ACF10498.1| membrane-associated zinc metalloprotease [Chlorobaculum parvum NCIB 8327] (453 aa)
Score = 101, Expect = 1.2e-02, Identities = 41/177 (23%), Positives = 67/177 (37%)
  Q:    18 LTIHEIGHFVFAKLFKVNVKEFAIG---IGPKIYSKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFYLIQVTALNNNSNPFIQ 194
           +T HE GHF+ A++F + V  F IG    G  ++ K+    ++ I   P+  +V+I           + DE     D  Y+Q                     +   W  RAK                           P WQ+LI+  GG+  N++L  + + I +TA+   S   I+
  S:    18 VTAHEFGHFITARIFGMRVDRFFIGFDFFGTTLWKKKIGETEYGIGAFPLGGYVKI---------AGMVDE---SMDTDYVQ--------------------SEAKPWEFRAK---------------------------PVWQRLIVLAGGVAMNMVLAAVIF-ISITAMFGESQTSIK 137
>gi|152968770|ref|YP_001333879.1| zinc metallopeptidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953619|gb|ABR75649.1| membrane-associated protease [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (455 aa)
Score = 101, Expect = 1.2e-02, Identities = 29/82 (35%), Positives = 49/82 (59%)
  Q:     2 GLFLLVIFILLAIMVGL----TIHEIGHFVFAKLFKVNVKEFAIGIGPKIY---SKQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           G  L V++ L A ++ L    T+HE GHF  A+   + V+ F+IG G  ++    KQ T  +F I L+P+  +V++  ++   V  E+R
  S:     4 GYMLSVLWNLAAFIIALGVLITVHEFGHFWVARRCGIRVERFSIGFGKALWRRMDKQGT--EFVIALIPLGGYVKMLDERVEAVAPEMR 90
>gi|149374430|ref|ZP_01892204.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Marinobacter algicola DG893] >gi|149361133|gb|EDM49583.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Marinobacter algicola DG893] (449 aa)
Score = 101, Expect = 1.2e-02, Identities = 24/79 (30%), Positives = 49/79 (62%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS---KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           V+ ++L + + +T+HE GHF  A+   V V  F++G G  ++S   +Q T  +F++  +P+  +V++  ++   V  EL+D+
  S:     7 VLALILTLGILVTLHEAGHFWVARRCGVKVLRFSVGFGKPLFSWYDRQGT--EFAVAAIPLGGYVKMLDEREGPVPEELKDQ 86
>gi|119483276|ref|ZP_01618690.1| hypothetical protein L8106_04466 [Lyngbya sp. PCC 8106] >gi|119458043|gb|EAW39165.1| hypothetical protein L8106_04466 [Lyngbya sp. PCC 8106] (364 aa)
Score = 101, Expect = 1.2e-02, Identities = 19/64 (29%), Positives = 40/64 (62%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L    +LA+++   +HE+GHF+ A++  ++V  F+IG GP +   Q +  ++++  +P+  FV
  S:     3 VLAPIAVLAVLI--FVHELGHFMAARVQNIHVNRFSIGFGPILMKYQGSETEYALRGIPLGGFV 64
>gi|167560158|ref|ZP_02353161.1| hypothetical protein Sententeri_25311 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (450 aa)
Score = 101, Expect = 1.2e-02, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  +++  V  ELR
  S:     5 LWNLAAFII-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIALIPLGGYVKMLDERAELVAPELR 85
>gi|167042079|gb|ABZ06814.1| putative peptidase family M50 [uncultured marine microorganism HF4000_141I21] (368 aa)
Score = 101, Expect = 1.3e-02, Identities = 28/87 (32%), Positives = 50/87 (57%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEY 93
           +I  L+ IM+ + IHE GH+ FAK + V + +F+IG G +I+     +  ++ I  +P+  +V+    ++  VF +   E QK  D+Y
  S:     4 LIPFLILIMIVVFIHEYGHYYFAKRYGVGITDFSIGFGSEIFGWHDKSGTRWKICWIPLGGYVKFFGDRN--VFSQA--EQQKVIDKY 87
>gi|126666173|ref|ZP_01737153.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Marinobacter sp. ELB17] >gi|126629495|gb|EBA00113.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Marinobacter sp. ELB17] (449 aa)
Score = 101, Expect = 1.3e-02, Identities = 26/81 (32%), Positives = 45/81 (55%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDE 85
           +L + + L I+V  TIHE GHF  A+ F V V  F++G G  ++S       +F++  +P+  +V++   +   V  EL D+
  S:     7 ILSLVLTLGILV--TIHEYGHFWVARRFGVKVLRFSVGFGKPLWSWYDRHGTEFAVAAIPLGGYVKMLDAREGPVSPELIDQ 86
>gi|154509149|ref|ZP_02044791.1| hypothetical protein ACTODO_01670 [Actinomyces odontolyticus ATCC 17982] >gi|153798783|gb|EDN81203.1| hypothetical protein ACTODO_01670 [Actinomyces odontolyticus ATCC 17982] (415 aa)
Score = 101, Expect = 1.3e-02, Identities = 16/56 (28%), Positives = 35/56 (62%)
  Q:    15 MVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           +  + +HE+GH + AK F V V ++A+G GP ++ K+  +  +++  + +  +V+I
  S:    17 LASVALHEVGHMLPAKKFGVLVPDYAVGFGPALWKKKIGDTTYALRAILLGGYVKI 72
>gi|78779673|ref|YP_397785.1| hypothetical protein PMT9312_1290 [Prochlorococcus marinus str. MIT 9312] >gi|78713172|gb|ABB50349.1| YUP8H12.25 {{Arabidopsis thaliana}}-type protein. Metallo peptidase. MEROPS family M50B [Prochlorococcus marinus str. MIT 9312] (359 aa)
Score = 101, Expect = 1.3e-02, Identities = 20/48 (41%), Positives = 29/48 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           HE+GHF+ A L  + V  F+IG GP I  K++ +I +S    P+  FV
  S:    17 HEMGHFLAAILQGIYVDGFSIGFGPSIIQKKYKDITYSFRAFPLGGFV 64
>gi|94496935|ref|ZP_01303509.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Sphingomonas sp. SKA58] >gi|94423611|gb|EAT08638.1| Peptidase M50, putative membrane-associated zinc metallopeptidase [Sphingomonas sp. SKA58] (377 aa)
Score = 101, Expect = 1.3e-02, Identities = 20/66 (30%), Positives = 40/66 (60%)
  Q:     4 FLLVIFILLAIMVGLT-IHEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVR 69
           FLL +   +A++  L  +HE+GH++  + F V  + F+IG GP++++       ++ +  LP+  +VR
  S:     7 FLLTVLAFVAVIGPLVFVHELGHYLVGRWFGVKAEAFSIGFGPELFAWVDRRGTRWRVAALPLGGYVR 74
>gi|114764267|ref|ZP_01443495.1| membrane-associated zinc metalloprotease, putative [Roseovarius sp. HTCC2601] >gi|114543215|gb|EAU46232.1| membrane-associated zinc metalloprotease, putative [Roseovarius sp. HTCC2601] (447 aa)
Score = 101, Expect = 1.4e-02, Identities = 23/63 (36%), Positives = 38/63 (60%)
  Q:     7 VIFILLAIMVGLT----IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVR 69
           VI+ L+A +V L+    IHE GH++  +   ++   F++G GP IYS+      K+ I  LP   +V+
  S:    13 VIYTLVAFVVALSVIVAIHEYGHYIVGRWSGIDADVFSLGFGPVIYSRYDKRGTKWQIAALPFGGYVK 80
>gi|29347411|ref|NP_810914.1| membrane-associated zinc metalloprotease [Bacteroides thetaiotaomicron VPI-5482] >gi|29339311|gb|AAO77108.1| membrane-associated zinc metalloprotease [Bacteroides thetaiotaomicron VPI-5482] (451 aa)
Score = 101, Expect = 1.4e-02, Identities = 38/169 (22%), Positives = 67/169 (39%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF----TNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFY 178
           +++++ + + IHE GHF+FA+LFKV V++F +   P     +F    ++ ++++  LP+  +V+I       +  E  D  Q +  E                             W  R+K                           P WQ+L+I  GG+ FN +L    Y
  S:    11 LIMSLSLLVIIHEGGHFLFARLFKVRVEKFCLFFDPWFTLFKFKPKRSDTEYAVGWLPLGGYVKIAG-----MIDESMDTEQMKQPE---------------------------QPWEFRSK---------------------------PAWQRLLIMVGGVLFNFLLALFIY 124
>gi|162419009|ref|YP_001607765.1| zinc metallopeptidase [Yersinia pestis Angola] >gi|162351824|gb|ABX85772.1| RIP metalloprotease RseP [Yersinia pestis Angola] (451 aa)
Score = 101, Expect = 1.4e-02, Identities = 30/99 (30%), Positives = 55/99 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           L+ L  FI+ A+ + +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  ++   V  ELR  +Q   ++  LQ   I+
  S:     5 LWSLAAFIV-ALGILITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVEAVAPELR--HQSFNNKTVLQRAAIV 101
>gi|16121351|ref|NP_404664.1| zinc metallopeptidase [Yersinia pestis CO92] >gi|22127004|ref|NP_670427.1| zinc metallopeptidase [Yersinia pestis KIM] >gi|45442567|ref|NP_994106.1| zinc metallopeptidase [Yersinia pestis biovar Microtus str. 91001] >gi|51597311|ref|YP_071502.1| zinc metallopeptidase [Yersinia pseudotuberculosis IP 32953] >gi|108806524|ref|YP_650440.1| zinc metallopeptidase [Yersinia pestis Antiqua] >gi|108813109|ref|YP_648876.1| zinc metallopeptidase [Yersinia pestis Nepal516] >gi|145598943|ref|YP_001163019.1| zinc metallopeptidase [Yersinia pestis Pestoides F] >gi|149366948|ref|ZP_01888981.1| putative membrane protein [Yersinia pestis CA88-4125] >gi|153950643|ref|YP_001400004.1| zinc metallopeptidase [Yersinia pseudotuberculosis IP 31758] >gi|165927104|ref|ZP_02222936.1| RIP metalloprotease RseP [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939844|ref|ZP_02228384.1| RIP metalloprotease RseP [Yersinia pestis biovar Orientalis str. IP275] >gi|166011892|ref|ZP_02232790.1| RIP metalloprotease RseP [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211795|ref|ZP_02237830.1| RIP metalloprotease RseP [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399810|ref|ZP_02305328.1| RIP metalloprotease RseP [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419807|ref|ZP_02311560.1| RIP metalloprotease RseP [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425358|ref|ZP_02317111.1| RIP metalloprotease RseP [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170023322|ref|YP_001719827.1| membrane-associated zinc metalloprotease [Yersinia pseudotuberculosis YPIII] >gi|186896416|ref|YP_001873528.1| membrane-associated zinc metalloprotease [Yersinia pseudotuberculosis PB1/+] >gi|20978463|sp|Q8ZH59|RSEP_YERPE Protease rseP >gi|21960050|gb|AAM86678.1|AE013913_8 hypothetical protein y3128 [Yersinia pestis KIM] >gi|45437432|gb|AAS62983.1| putative membrane protein [Yersinia pestis biovar Microtus str. 91001] >gi|51590593|emb|CAH22234.1| putative membrane protein [Yersinia pseudotuberculosis IP 32953] >gi|108776757|gb|ABG19276.1| membrane protein [Yersinia pestis Nepal516] >gi|108778437|gb|ABG12495.1| putative membrane protein [Yersinia pestis Antiqua] >gi|115346830|emb|CAL19716.1| putative membrane protein [Yersinia pestis CO92] >gi|145210639|gb|ABP40046.1| membrane protein [Yersinia pestis Pestoides F] >gi|149290562|gb|EDM40638.1| putative membrane protein [Yersinia pestis CA88-4125] >gi|152962138|gb|ABS49599.1| RIP metalloprotease RseP [Yersinia pseudotuberculosis IP 31758] >gi|165912247|gb|EDR30884.1| RIP metalloprotease RseP [Yersinia pestis biovar Orientalis str. IP275] >gi|165921000|gb|EDR38224.1| RIP metalloprotease RseP [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989158|gb|EDR41459.1| RIP metalloprotease RseP [Yersinia pestis biovar Antiqua str. E1979001] >gi|166207566|gb|EDR52046.1| RIP metalloprotease RseP [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962548|gb|EDR58569.1| RIP metalloprotease RseP [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050518|gb|EDR61926.1| RIP metalloprotease RseP [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055758|gb|EDR65542.1| RIP metalloprotease RseP [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749856|gb|ACA67374.1| membrane-associated zinc metalloprotease [Yersinia pseudotuberculosis YPIII] >gi|186699442|gb|ACC90071.1| membrane-associated zinc metalloprotease [Yersinia pseudotuberculosis PB1/+] (451 aa)
Score = 101, Expect = 1.4e-02, Identities = 30/99 (30%), Positives = 55/99 (55%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEIL 101
           L+ L  FI+ A+ + +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I L+P+  +V++  ++   V  ELR  +Q   ++  LQ   I+
  S:     5 LWSLAAFIV-ALGILITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVEAVAPELR--HQSFNNKTVLQRAAIV 101
>gi|149192153|ref|ZP_01870374.1| hypothetical protein VSAK1_11745 [Vibrio shilonii AK1] >gi|148834023|gb|EDL51039.1| hypothetical protein VSAK1_11745 [Vibrio shilonii AK1] (447 aa)
Score = 101, Expect = 1.4e-02, Identities = 26/69 (37%), Positives = 45/69 (65%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVR-IDSK 73
           L V  + L I+V   +HE GHF  A+   V V++F+IG G  I+SK   +  ++SI+++P+  +V+ +DS+
  S:     3 LRVFIVALGILVA--VHEYGHFWVARKCGVYVEKFSIGFGKSIWSKVGKDGTEYSISVIPLGGYVKMLDSR 71
>gi|22299185|ref|NP_682432.1| hypothetical protein tll1642 [Thermosynechococcus elongatus BP-1] >gi|22295367|dbj|BAC09194.1| tll1642 [Thermosynechococcus elongatus BP-1] (368 aa)
Score = 101, Expect = 1.5e-02, Identities = 18/64 (28%), Positives = 41/64 (64%)
  Q:     5 LLVIFILLAIM-VGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           ++ + + +AI+ + + +HE GHF+ A+   ++V  F+IG GP ++  Q    ++++ L+P+  +V
  S:     3 MVAVVVAIAILGILIFVHEWGHFIAARSQGIHVNRFSIGFGPILWKFQGKETEYALRLIPLGGYV 67
>gi|157147392|ref|YP_001454711.1| zinc metallopeptidase [Citrobacter koseri ATCC BAA-895] >gi|157084597|gb|ABV14275.1| hypothetical protein CKO_03190 [Citrobacter koseri ATCC BAA-895] (450 aa)
Score = 101, Expect = 1.5e-02, Identities = 26/81 (32%), Positives = 48/81 (59%)
  Q:     3 LFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           L+ L  FI+ A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ I ++P+  +V++  +++  V  ELR
  S:     5 LWNLAAFIV-ALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYVIAMIPLGGYVKMLDERAEPVVPELR 85
>gi|58584316|ref|YP_197889.1| membrane-associated Zn-dependent protease [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418632|gb|AAW70647.1| Predicted membrane-associated Zn-dependent protease [Wolbachia endosymbiont strain TRS of Brugia malayi] (374 aa)
Score = 101, Expect = 1.5e-02, Identities = 27/69 (39%), Positives = 43/69 (62%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKI---YSKQFTNIKFSINLLPIMAFVRI 70
           G++  + F L+ I V + +HE GH++ AK +KV V+ F+IG GP I   Y K  T  K S   +P+  +V++
  S:    14 GIYNFLSFSLI-ISVIVFVHEYGHYIIAKAYKVKVESFSIGFGPGIFGFYDKSGTRWKLSA--IPLGGYVKM 82
>gi|88607986|ref|YP_506595.1| putative membrane-associated zinc metalloprotease [Neorickettsia sennetsu str. Miyayama] >gi|88600155|gb|ABD45623.1| putative membrane-associated zinc metalloprotease [Neorickettsia sennetsu str. Miyayama] (366 aa)
Score = 101, Expect = 1.5e-02, Identities = 17/50 (34%), Positives = 35/50 (70%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYS-KQFTNIKFSINLLPIMAFVRI 70
           HE GH++FAK+F V V+EF+IG G +++     +  ++ ++++P   +V++
  S:    22 HEFGHYIFAKMFGVKVEEFSIGFGKELFGFSDKSGTRWKLSMIPAGGYVKM 72
>gi|16126159|ref|NP_420723.1| membrane-associated zinc metalloprotease, putative [Caulobacter crescentus CB15] >gi|20978837|sp|Q9A710|MMPA_CAUCR Metalloprotease mmpA (Membrane metalloprotease A) >gi|13423369|gb|AAK23891.1| membrane-associated zinc metalloprotease, putative [Caulobacter crescentus CB15] (398 aa)
Score = 100, Expect = 1.6e-02, Identities = 19/69 (27%), Positives = 42/69 (60%)
  Q:     1 VGLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIG-PKIYSKQFTNIKFSINLLPIMAFVR 69
           +G  ++++ +L  + V +T+HE+GH+  A+   V ++ F+IG G P I  +    +++ +  +P+  +VR
  S:     2 IGFLIMLVSLLFVLSVVVTVHELGHYWAARACGVAIERFSIGFGAPLISWRDKRGVEWCVASIPLGGYVR 71
>gi|121638751|ref|YP_978975.1| putative transmembrane protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|121494399|emb|CAL72880.1| Probable conserved transmembrane protein [Mycobacterium bovis BCG str. Pasteur 1173P2] (404 aa)
Score = 100, Expect = 1.6e-02, Identities = 16/64 (25%), Positives = 35/64 (54%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++   LAI++ + +HE GH   A+   + V+ + +G GP ++S +    ++ +  +P+  F  I
  S:     7 IVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWSTRRGETEYGVKAVPLGGFCDI 70
>gi|31794046|ref|NP_856539.1| transmembrane protein [Mycobacterium bovis AF2122/97] >gi|31619641|emb|CAD96581.1| PROBABLE CONSERVED TRANSMEMBRANE PROTEIN [Mycobacterium bovis AF2122/97] (404 aa)
Score = 100, Expect = 1.6e-02, Identities = 16/64 (25%), Positives = 35/64 (54%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++   LAI++ + +HE GH   A+   + V+ + +G GP ++S +    ++ +  +P+  F  I
  S:     7 IVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWSTRRGETEYGVKAVPLGGFCDI 70
>gi|15610006|ref|NP_217385.1| transmembrane protein [Mycobacterium tuberculosis H37Rv] >gi|15842411|ref|NP_337448.1| PDZ domain-containing protein [Mycobacterium tuberculosis CDC1551] >gi|148662712|ref|YP_001284235.1| putative transmembrane protein [Mycobacterium tuberculosis H37Ra] >gi|148824060|ref|YP_001288814.1| transmembrane protein [Mycobacterium tuberculosis F11] >gi|167969498|ref|ZP_02551775.1| putative transmembrane protein [Mycobacterium tuberculosis H37Ra] >gi|194545016|ref|YP_002080045.1| hypothetical protein TBCG_02807 [Mycobacterium tuberculosis C] >gi|20978863|sp|O33351|Y2869_MYCTU Putative zinc metalloprotease Rv2869c/MT2937 >gi|2612814|emb|CAA15531.1| PROBABLE CONSERVED TRANSMEMBRANE PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|13882712|gb|AAK47262.1| PDZ domain family protein [Mycobacterium tuberculosis CDC1551] >gi|124602023|gb|EAY61033.1| hypothetical protein TBCG_02807 [Mycobacterium tuberculosis C] >gi|134151024|gb|EBA43069.1| conserved transmembrane protein [Mycobacterium tuberculosis str. Haarlem] >gi|148506864|gb|ABQ74673.1| putative conserved transmembrane protein [Mycobacterium tuberculosis H37Ra] >gi|148722587|gb|ABR07212.1| conserved transmembrane protein [Mycobacterium tuberculosis F11] (404 aa)
Score = 100, Expect = 1.6e-02, Identities = 16/64 (25%), Positives = 35/64 (54%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRI 70
           ++   LAI++ + +HE GH   A+   + V+ + +G GP ++S +    ++ +  +P+  F  I
  S:     7 IVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWSTRRGETEYGVKAVPLGGFCDI 70
>gi|118577234|ref|YP_899474.1| peptidase M50 [Pelobacter propionicus DSM 2379] >gi|118504739|gb|ABL01221.1| peptidase M50 [Pelobacter propionicus DSM 2379] (325 aa)
Score = 100, Expect = 1.7e-02, Identities = 15/51 (29%), Positives = 31/51 (60%)
  Q:    21 HEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFVRID 71
           HE GHF  A+ F ++V EF+IG G +++  +     +++  +P+  +++ D
  S:    15 HEAGHFFAARWFHISVPEFSIGFGARVFGWKRNGTTYNLRAIPLGGYIKTD 65
>gi|148261541|ref|YP_001235668.1| putative membrane-associated zinc metalloprotease [Acidiphilium cryptum JF-5] >gi|146403222|gb|ABQ31749.1| putative membrane-associated zinc metalloprotease [Acidiphilium cryptum JF-5] (353 aa)
Score = 100, Expect = 1.7e-02, Identities = 20/65 (30%), Positives = 42/65 (64%)
  Q:     6 LVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN-IKFSINLLPIMAFVRI 70
           L   ++L ++V  T+HE+GH++ A+   V V+ F++G GP ++S+   +   + I+ +P+  +VR+
  S:     9 LGFIVVLGVLV--TVHELGHYLVARWRGVTVEAFSLGFGPALFSRTDRHGTVWKISAIPLGGYVRM 72
>gi|153809485|ref|ZP_01962153.1| hypothetical protein BACCAC_03803 [Bacteroides caccae ATCC 43185] >gi|149127866|gb|EDM19089.1| hypothetical protein BACCAC_03803 [Bacteroides caccae ATCC 43185] (451 aa)
Score = 100, Expect = 1.8e-02, Identities = 38/169 (22%), Positives = 66/169 (39%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF----TNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFY 178
           +++++ + + IHE GHF+FA+LFKV V++F +   P     +F    +  ++++  LP+  +V+I       +  E  D  Q +  E                             W  R+K                           P WQ+L+I  GG+ FN +L    Y
  S:    11 LIMSLSLLVIIHEGGHFLFARLFKVRVEKFCLFFDPWFTLFKFKPKKSETEYAVGWLPLGGYVKIAG-----MIDESMDTEQMKQPE---------------------------QPWEFRSK---------------------------PAWQRLLIMVGGVLFNFLLALFIY 124
>gi|114777893|ref|ZP_01452807.1| putative metalloprotease [Mariprofundus ferrooxydans PV-1] >gi|114551680|gb|EAU54232.1| putative metalloprotease [Mariprofundus ferrooxydans PV-1] (452 aa)
Score = 100, Expect = 1.8e-02, Identities = 23/79 (29%), Positives = 45/79 (56%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN--IKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKE 89
           ++AI + + +HE GHF  A+   + V++F+IG GP ++S +  +  + + I  +P+  +V++         GE  DE  +E
  S:    12 VVAIALLIAVHEYGHFTVARRLGIRVEKFSIGFGPALFSWRSRDGEVLYVIAAIPLGGYVKM--------LGENPDEQAEE 84
>gi|167752009|ref|ZP_02424136.1| hypothetical protein ALIPUT_00251 [Alistipes putredinis DSM 17216] >gi|167660250|gb|EDS04380.1| hypothetical protein ALIPUT_00251 [Alistipes putredinis DSM 17216] (440 aa)
Score = 100, Expect = 1.9e-02, Identities = 21/63 (33%), Positives = 40/63 (63%)
  Q:     8 IFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGP--KIYSKQFTNIKFSINLLPIMAFVRI 70
           +F+   I+VG  IHE+GHF+ A+ FK+ V++F I   P   ++  +  + ++ +  LP+  +V+I
  S:    10 LFLCFTILVG--IHELGHFLMARAFKIRVEKFYIFFDPWFSLFKFKRGDTEYGLGWLPLGGYVKI 72
>gi|74310796|ref|YP_309215.1| zinc metallopeptidase [Shigella sonnei Ss046] >gi|73854273|gb|AAZ86980.1| conserved hypothetical protein [Shigella sonnei Ss046] (450 aa)
Score = 100, Expect = 1.9e-02, Identities = 22/73 (30%), Positives = 44/73 (60%)
  Q:    11 LLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVRIDSKKSLQVFGELR 83
           ++A+ V +T+HE GHF  A+   V V+ F+IG G  ++ +      ++ + L+P+  +V++  +++  V  ELR
  S:    12 IVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVMALIPLGGYVKMLDERAEPVVPELR 85
>gi|160883461|ref|ZP_02064464.1| hypothetical protein BACOVA_01430 [Bacteroides ovatus ATCC 8483] >gi|156111181|gb|EDO12926.1| hypothetical protein BACOVA_01430 [Bacteroides ovatus ATCC 8483] (451 aa)
Score = 99, Expect = 2.0e-02, Identities = 37/169 (21%), Positives = 67/169 (39%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF----TNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFY 178
           +++++ + + +HE GHF+FA+LFKV V++F +   P     +F    ++ ++++  LP+  +V+I       +  E  D  Q +  E                             W  R+K                           P WQ+L+I  GG+ FN +L    Y
  S:    11 LIMSLSLLVIVHEGGHFLFARLFKVRVEKFCLFFDPWFTLFKFKPKKSDTEYAVGWLPLGGYVKIAG-----MIDESMDTEQMKQPE---------------------------QPWEFRSK---------------------------PAWQRLLIMVGGVLFNFLLALFIY 124
>gi|37522587|ref|NP_925964.1| hypothetical protein gll3018 [Gloeobacter violaceus PCC 7421] >gi|35213588|dbj|BAC90959.1| gll3018 [Gloeobacter violaceus PCC 7421] (350 aa)
Score = 99, Expect = 2.0e-02, Identities = 17/49 (34%), Positives = 30/49 (61%)
  Q:    20 IHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +HE+GHF+ A+   + V  F+IG GP I   Q   +++++  LP+  +V
  S:    16 VHELGHFLAARWQGIRVSRFSIGFGPVIARYQGPEVEYALRALPLGGYV 64
>gi|118472533|ref|YP_886916.1| zinc metalloprotease [Mycobacterium smegmatis str. MC2 155] >gi|118173820|gb|ABK74716.1| zinc metalloprotease [Mycobacterium smegmatis str. MC2 155] (406 aa)
Score = 99, Expect = 2.1e-02, Identities = 24/94 (25%), Positives = 46/94 (48%)
  Q:     7 VIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTN----IKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEI 100
           ++   LAI+V + +HE GH   A+   + V+ + +G GP ++S +  N     ++ I  +P+  F  I    S+       DE   E   Y +  +++
  S:     7 IVLFALAILVSVALHECGHMWVARATGMKVRRYFVGFGPTLWSTRRANRLGSTEYGIKAIPLGGFCDIAGMTSV-------DEIAPEDRPYAMYKQKV 97
>gi|83942314|ref|ZP_00954775.1| membrane-associated zinc metalloprotease, putative [Sulfitobacter sp. EE-36] >gi|83846407|gb|EAP84283.1| membrane-associated zinc metalloprotease, putative [Sulfitobacter sp. EE-36] (447 aa)
Score = 99, Expect = 2.1e-02, Identities = 21/68 (30%), Positives = 38/68 (55%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVR 69
           GL   ++  ++A+ V + IHE GH++  +   ++   F++G GP IYS+      K+ I  LP   +V+
  S:     9 GLIWTLLAFVIALSVIVAIHEYGHYIVGRWSGIHADVFSLGFGPVIYSRYDKRGTKWQIAALPFGGYVK 77
>gi|83955550|ref|ZP_00964181.1| membrane-associated zinc metalloprotease, putative [Sulfitobacter sp. NAS-14.1] >gi|83840194|gb|EAP79369.1| membrane-associated zinc metalloprotease, putative [Sulfitobacter sp. NAS-14.1] (351 aa)
Score = 99, Expect = 2.1e-02, Identities = 21/68 (30%), Positives = 38/68 (55%)
  Q:     2 GLFLLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSK-QFTNIKFSINLLPIMAFVR 69
           GL   ++  ++A+ V + IHE GH++  +   ++   F++G GP IYS+      K+ I  LP   +V+
  S:     9 GLIWTLLAFVIALSVIVAIHEYGHYIVGRWSGIHADVFSLGFGPVIYSRFDKRGTKWQIAALPFGGYVK 77
>gi|119510132|ref|ZP_01629271.1| hypothetical protein N9414_00710 [Nodularia spumigena CCY9414] >gi|119465193|gb|EAW46091.1| hypothetical protein N9414_00710 [Nodularia spumigena CCY9414] (365 aa)
Score = 99, Expect = 2.1e-02, Identities = 20/64 (31%), Positives = 37/64 (57%)
  Q:     5 LLVIFILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQFTNIKFSINLLPIMAFV 68
           +L    +LA+++   +HE+GHF  A+   + V  F++G GP ++  Q    +++I L P+  FV
  S:     3 VLAAIAVLAVLI--LVHELGHFTAARSQGILVNRFSLGFGPVLWKYQGPQTEYAIRLFPLGGFV 64
>gi|60682950|ref|YP_213094.1| putative protease [Bacteroides fragilis NCTC 9343] >gi|60494384|emb|CAH09180.1| putative protease [Bacteroides fragilis NCTC 9343] (451 aa)
Score = 99, Expect = 2.1e-02, Identities = 38/169 (22%), Positives = 66/169 (39%)
  Q:    10 ILLAIMVGLTIHEIGHFVFAKLFKVNVKEFAIGIGPKIYSKQF----TNIKFSINLLPIMAFVRIDSKKSLQVFGELRDEYQKEADEYYLQHKEILDGCEKYITIEKNGQLRKQSTWHVRAKYNSYLKKIDKYANFSRKIDGTLIIDEVPKWQQLIIYFGGIFFNLILFGLFY 178
           +++++ + + IHE GHF+FA+LFKV V++F +   P     +F    +  ++++  LP+  +V+I       +  E  D  Q +  E                             W  R+K                           P WQ+L+I  GG+ FN +L    Y
  S:    11 LIMSLSLLVIIHEGGHFLFARLFKVRVEKFCLFFDPWFTLFKFKPKKSETEYAVGWLPLGGYVKIAG-----MIDESMDTEQMKQPE---------------------------QPWEFRSK---------------------------PAWQRLLIMVGGVLFNFLLALFIY 124