>gi|26553709|ref|NP_757643.1| hypothetical protein MYPE2560 [Mycoplasma penetrans HF-2] >gi|26453716|dbj|BAC44047.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1124 aa)
Score = 5014, Expect = 0.0e+00, Identities = 1124/1124 (100%), Positives = 1124/1124 (100%)
  Q:     1 MVFIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           MVFIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI
  S:     1 MVFIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
>gi|26553719|ref|NP_757653.1| hypothetical protein MYPE2660 [Mycoplasma penetrans HF-2] >gi|26453726|dbj|BAC44057.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1150 aa)
Score = 3546, Expect = 0.0e+00, Identities = 796/1124 (70%), Positives = 932/1124 (82%)
  Q:     1 MVFIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQG-VNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSA-YANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTI--NNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSG-ITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTP-KTYSAEKEYTVFKSSDPSSFKFMGQTG-TEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           MV IM KLSKKISL ITSSILSIA GISIALPIS  A+ NSSI++I S NQAT TS VIPSEVNDQNANISTKNGPVTF+GN ITALDWFGN+LW  DF+  VP   G ++G +Y+G+W RAW+NWDY+RN DTIWVLGFWS S K QPLF+IKA+DGS T  H ++Y  I+GL SV +++AYRFVSAL SGK+MIYGGAGS+YN K ILYDP +K +SL+ GNSS+  ILP+G++S+GS+YKWYFFNLIP+A+NRNIVEVV F  +     +G+A +ANY+VYFLLVDD LNMV++SSSSS  QWAKPV+VA G+ GYRNSKITPQRDYYSLLDG+VVTVVYNTAIIIDGKS + ++G +P + SKWIKSWAFDSNQNLYFKFK+E +IYKVSGS+W T+  N  N  +SP  YLDL G+   + YA DLIIYNVYGYTGQLMMINS+YN  V+T NS  IT ++ND NYGLA  VTQN   Q++GDY G LNGP++  +ASDFELS+SAK+SKIPSEITK+DI  SNGF++ SSDF I  M+D+TG+I IEC+LYQIPWFT  LPD ISPK ++KTY TDKKI DKTSWKTL+ STDYDFLNMKPSTIKKED++NLDPFQVSFQSQ I D++G+QL+PKK Y      D+ G + V++ Y+YIPM  TYT + +  K+Y+    Y VF SS  ++F F+GQ   ++ T+DI++VSELKNLLSANTLPSSF+SLN+STD TNS FLQF+NTNTSKGYPISKM FTVTA+D  G+L I   MP+  SP  + +TF + YTNLNK ++Y F FK+VT IGTQNIN+ILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDE GTLTVA+NLDK YAQAIG G  GF+NYSAT+TFSGFMTKDQYNQRF+V FVSDSD  LLQLKQMQV++IY++F  +  + LTV  Q YTNLKDLIEKLLI++KGTSIP  WA+N  ITA+MHYDNAQGTISFYVKIDK LVDGSNSD+NLVVNYTGFVKGNVDST DNLSFVADNMLESYL+SNGDTT D+FKNF P +FA+WL+  DN+ ALKLISYKSGEYVT L    KY LSVI NETQRTVSI+I F  +TN KSL EYSVTYTI
  S:    24 MVLIMKKLSKKISLAITSSILSIAAGISIALPISQDAIRNSSISSISSSNQATTTSKVIPSEVNDQNANISTKNGPVTFMGNTITALDWFGNELWSIDFAKYVPDKNGTIDGVTYDGSWGRAWYNWDYDRNNDTIWVLGFWSSSNKKQPLFQIKASDGSFTK-HEIDYSKITGLGSVAVNTAYRFVSALGSGKIMIYGGAGSTYNAKGILYDPTSKISSLIEGNSSNNTILPLGNSSYGSSYKWYFFNLIPIASNRNIVEVVNFTTQAGITGDGAANHANYNVYFLLVDDNLNMVYDSSSSS--QWAKPVEVAQGMSGYRNSKITPQRDYYSLLDGKVVTVVYNTAIIIDGKSSDTKIGTFPMTDSKWIKSWAFDSNQNLYFKFKDEKIIYKVSGSAWDTLGSNLKNEAISPNRYLDLAGVGEVNKYADDLIIYNVYGYTGQLMMINSIYNANVNTSNSTTITPDSNDSNYGLAFGVTQNKTNQNEGDYVGILNGPSSILKASDFELSDSAKSSKIPSEITKEDIVESNGFMKTSSDFKITSMNDTTGDITIECQLYQIPWFTTTLPDDISPKTVTKTYKTDKKIADKTSWKTLSVSTDYDFLNMKPSTIKKEDIDNLDPFQVSFQSQIITDRNGQQLYPKKTYGFSDAKDSDGTIKVTVKYEYIPMGITYTGNASEVKSYTTNTTYKVFDSSMTAAFNFLGQNNNSQTTVDIRQVSELKNLLSANTLPSSFSSLNTSTDSTNSGFLQFVNTNTSKGYPISKMNFTVTADDNAGTLKISGTMPAQNSPNSRQETFTVTYTNLNKSSNYNFSFKNVTQIGTQNINSILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDENGTLTVAINLDKNYAQAIGNGTVGFSNYSATRTFSGFMTKDQYNQRFDVQFVSDSDTKLLQLKQMQVTEIYQTFNSNPSSSLTVGSQTYTNLKDLIEKLLIQSKGTSIPSDWATNDKITATMHYDNAQGTISFYVKIDKSLVDGSNSDINLVVNYTGFVKGNVDSTSDNLSFVADNMLESYLISNGDTTEDDFKNFNPTTFAEWLKAKDNEMALKLISYKSGEYVTYLS-SNKYKLSVIANETQRTVSIFINFDKLTNDKSLTEYSVTYTI 1150
>gi|26553708|ref|NP_757642.1| hypothetical protein MYPE2550 [Mycoplasma penetrans HF-2] >gi|26453715|dbj|BAC44046.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1124 aa)
Score = 3535, Expect = 0.0e+00, Identities = 805/1124 (71%), Positives = 938/1124 (83%)
  Q:     1 MVFIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVN-GQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNI-SGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGK-SDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNG-FLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           MVF MNK SKKI L  TSS+LSIAT +SIALPI+N A+ N SITN+ S NQ T  S +IPSEVNDQNANIST NGPVTFLGNKITALDWFGN+LW  DFS  VP   G   G +Y+GAW RAWFNWDYNR+TDTIWVLG WS     QPLFEIKAADG+IT TH +NY    S L   N S+ YRFVSALSSGKVM+YGGAG++YNGKAILYDPKT   ++LNGNSS  +ILP+ + S+GS+YKWYFFNLIPVA NRNIVEVVTFANKETS D G+  ANY+VYFLLVDD+LNMV+N ++++   W+K V VA+G+ GYRNSK+TPQRDYYSLLDGRVVTVVYNTAIIID K S++++ G YP S+SKWIKSWAFDSNQNLYFKFK+E  IYKVSGS WQTINN  T++  YVYLDLKGI + SAYA DLI+YNVYGYTGQLMMINS YN  V+T NS ITT+NN +NYGLALAVTQN  LQDKGDYKG LNGP+TFQ+ASDFELS+SA +SKIPSEITKDDIE SNG F+++S+DFTIK MDD TG+I+IECKLYQIPWFT  LP+GI+PK+I+K YTT KKI DKTSWKTLTTSTDYDFLNMKPS I +EDV NLDPFQVSFQSQTIVD  GK L+PKK Y V + +D+ G+V V I Y+YIPM  TY++ T   TY A   YTVF SS   +FKFMGQ G+ ++IDI KVSELKNLLSA+TLPSSF SLNSS+DKTNSAFLQFINTN SKGYPISKMKFTVTAND  GSL+IKA+MP++YSP    ++F++ YT LN+ ++Y F FKDVT IGTQNIN ILPSAVTDGDIINNF+ Y GF+SNDFSI KTV+DE G LTVA+NLDK YA AIG   +GF NY+ATK F+GFMTKD+YN+RF+V F+SD+DN L+QLKQMQ +KIYESF G+ PT L V  Q Y++LKDLI+KLL+++ GTSIP  W S+SSITA M+ DNAQGTISFYVKI +  + GSNSD+NLVVNYTGFVKGN+D+T DNLSF+ADNML+SYL+SNGDTT ++F  FTPD+FAKWL++++ QKALKLISYKSG+Y  LL + +KY +SVI NETQRTVS++I F DVT+PKSLKEYSVTYTI
  S:     1 MVFNMNKKSKKIILSTTSSVLSIATALSIALPITNNAIKNYSITNVSSTNQVTTESKIIPSEVNDQNANISTNNGPVTFLGNKITALDWFGNELWSIDFSQKVPDKDGATPGNNYDGAWKRAWFNWDYNRSTDTIWVLGSWSVKNNKQPLFEIKAADGTITKTHEINYAEFTSSLGQANNSNVYRFVSALSSGKVMVYGGAGTTYNGKAILYDPKTLKGTVLNGNSSDDKILPLKNTSYGSDYKWYFFNLIPVATNRNIVEVVTFANKETSGDAGNGLANYNVYFLLVDDELNMVYNQNTNN--PWSKHVLVANGISGYRNSKVTPQRDYYSLLDGRVVTVVYNTAIIIDAKNSNDIKYGTYPVSESKWIKSWAFDSNQNLYFKFKDESNIYKVSGSVWQTINNNTTSIPLYVYLDLKGIGSTSAYANDLIMYNVYGYTGQLMMINSKYNSLVNTSNSNITTDNNPQNYGLALAVTQNANLQDKGDYKGILNGPDTFQKASDFELSSSALSSKIPSEITKDDIETSNGGFMKDSTDFTIKSMDDKTGSIQIECKLYQIPWFTTSLPEGITPKIITKQYTTTKKIADKTSWKTLTTSTDYDFLNMKPSKITEEDVTNLDPFQVSFQSQTIVDSTGKILYPKKTYSVGTKNDSNGQVEVKIKYEYIPMGITYSNDTKATTYDASHTYTVFNSSTTPAFKFMGQNGSSSSIDISKVSELKNLLSADTLPSSFLSLNSSSDKTNSAFLQFINTNESKGYPISKMKFTVTANDNSGSLTIKADMPASYSPENTAKSFSVTYTGLNRASNYSFSFKDVTKIGTQNINAILPSAVTDGDIINNFLQYNGFNSNDFSIVKTVNDETGELTVAINLDKTYATAIGNSGHGFNNYTATKVFTGFMTKDEYNKRFDVQFLSDTDNKLIQLKQMQAAKIYESFKGTSPTSLQVGNQTYSDLKDLIKKLLVQSSGTSIPADW-SDSSITADMYIDNAQGTISFYVKIPQDKITGSNSDINLVVNYTGFVKGNIDNTSDNLSFIADNMLKSYLISNGDTTEEDFNKFTPDTFAKWLEDSNYQKALKLISYKSGQYEDLL-NTSKYKISVIANETQRTVSVFILFSDVTDPKSLKEYSVTYTI 1124
>gi|26553720|ref|NP_757654.1| hypothetical protein MYPE2670 [Mycoplasma penetrans HF-2] >gi|26453727|dbj|BAC44058.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1122 aa)
Score = 3495, Expect = 0.0e+00, Identities = 785/1120 (70%), Positives = 927/1120 (82%)
  Q:     5 MNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQG-VNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNIS-GLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSND-EGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDN-VQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNT--NTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNS-GITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTG-TEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           MNKLSKK+SL+ITSSILSIA GIS+ALPIS   + +SSITNI S +QAT  S VIPSEVNDQNANISTKNGPVTF+GN ITALDW+GNK+W+ DFS  VP   G V+G SY+GAWPRAW+NWDYNR+ DTIWVLGFWS + K QPLFEIKA+DG+ T  H V+Y   S  L + N++SAYRF+SALSSGKVMIYGGAGS+Y+ K ILYDPKTKTA L+ GNS+   ILP+GD S G NY+WYFFNLIP+A N+N+VEV  F++K T++D E +  A+Y +YFLLVDD LNM + + +     W+  +KVAD +QGYRN++ TPQRDYYSLLDGRVVTVVYNTAIIID K+ N ++ GV+P S++KWIKSWAFDSNQNLYFKFKNE  IYKVSG++W+T++N   N ++SP +YLDL G+S  + +A +LIIYNVYGYTGQLMM+NS++N+ V+TKNS  IT E+N + YGLA  VTQN   Q++GD  G LNGPN+  +ASDFELS+SA+TSKIPSEITKDDIE SNGFL+NS+DF I +MDD  G I+IEC+LYQIPWFT  LP+ ISPK ++K+YTT  KI DKTSWK LT STDYDFLNMKPS I  ED+ NLDPFQVSFQSQ +V+  G+QL+PKK Y V S DD  GKV V I Y+YIPM  TY S+T+PK Y     Y VFK+SD +SFKFMGQT  +  +I+I +VSELKNLLSANTLPSSF SLN+S DKTNS FLQFINTNTSKGYPISKMKFTVTANDT G+L+IKA+MP+ YSP+ + ++F   YTNLNK T+YKF FK+++ IG+QNIN+ILPSAVTDGDIINNFI YTGFSSNDFSITKTVDDE GTLTVA+NLDK YA+AIG GN GF+NYSAT+TFSGFMTKDQYNQRF+V FVSDSDN L+QLKQMQVSKI E+F  +  T LTVDG  Y+NLKDLIEKLLI++KGTSIP +WA+N+ ITA+MH DNAQGTISFYVKIDK +V GSNSD+NLVVNYTGFVKGNV  T DNLSFVADNML+SYL+SN D T + F  F P +FA WLQE DN++ALKLISYKSGEY  LL DKTKY L+VI NETQRTVSI+I F  V+N +SLKEYSVTYTI
  S:     1 MNKLSKKLSLIITSSILSIAAGISVALPISQNLVKDSSITNINSISQATTESKVIPSEVNDQNANISTKNGPVTFMGNTITALDWYGNKMWDIDFSKQVPDKNGTVSGNSYDGAWPRAWYNWDYNRSDDTIWVLGFWSSNNKKQPLFEIKASDGTFTK-HEVDYNKFSTDLPNPNVTSAYRFISALSSGKVMIYGGAGSTYDAKGILYDPKTKTAELIKGNSAEKSILPIGDNSFGENYRWYFFNLIPIANNKNLVEVFPFSSKATTDDTEAAKNASYDIYFLLVDDNLNMAYTTGT-----WSSKIKVADAMQGYRNTQATPQRDYYSLLDGRVVTVVYNTAIIIDAKNTNDIKYGVFPMSETKWIKSWAFDSNQNLYFKFKNESKIYKVSGTAWETLDNNLKNESISPQIYLDLSGVSDITKHANNLIIYNVYGYTGQLMMVNSIHNDYVNTKNSESITVESNPEEYGLAFGVTQNKTNQNEGDNVGILNGPNSILKASDFELSSSARTSKIPSEITKDDIETSNGFLKNSTDFKITKMDDEKGEIEIECQLYQIPWFTTTLPNDISPKTVTKSYTTSNKIADKTSWKNLTASTDYDFLNMKPSKITSEDLTNLDPFQVSFQSQVVVNAQGQQLYPKKTYTVSSQDDKTGKVGVKIKYEYIPMGITYISTTSPKIYETTHTYDVFKNSDSASFKFMGQTSNSNNSINITQVSELKNLLSANTLPSSFLSLNNSGDKTNSGFLQFINTNTSKGYPISKMKFTVTANDTAGTLTIKADMPTAYSPLNKDESFTATYTNLNKSTNYKFNFKNISQIGSQNINSILPSAVTDGDIINNFIEYTGFSSNDFSITKTVDDENGTLTVAINLDKNYAEAIGKGNVGFSNYSATRTFSGFMTKDQYNQRFDVQFVSDSDNKLIQLKQMQVSKIVETFNNTTSTSLTVDGTTYSNLKDLIEKLLIQSKGTSIPSNWANNNLITATMHADNAQGTISFYVKIDKSIVTGSNSDINLVVNYTGFVKGNVVDTGDNLSFVADNMLKSYLLSNKDVTEEEFNKFNPTTFANWLQEKDNERALKLISYKSGEYEQLLADKTKYKLAVIANETQRTVSIFINFNSVSNSQSLKEYSVTYTI 1122
>gi|26553711|ref|NP_757645.1| hypothetical protein MYPE2580 [Mycoplasma penetrans HF-2] >gi|26453718|dbj|BAC44049.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1130 aa)
Score = 3477, Expect = 0.0e+00, Identities = 776/1120 (69%), Positives = 925/1120 (82%)
  Q:     5 MNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVNGQ-------SYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINN--TNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGD-TTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           M KLSKKISL+ITSSILSIATGISIALPISN AL NSSITNI SKNQAT++SPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLW+ DF+TL+P   G   +       +Y+G W RAWFNWDYNRNTD IW+LG+WS++ KTQPL  I+A++G + +T+ ++Y  +  L +V   +AYRFVSALSSGKVM+YGGAGS Y+ K ILYDP + + S+++G+S+  EILP  D ++G  Y+WYFFNLIP+  N+N+VEV+ F+  E+ +D G   ANY+VYFLLVDD+LNM+    +     W+K VKVADG+Q YRN+KITPQRDYY++LDG+VVTVVYNTAI+IDGK+DN+Q GVYP S+ KWIKSWAFDSNQNLYFKFK+E  +YKVSGS WQT+NN  TN+NV   +YLDL GI    +YA DLI+YNVYGYTGQLMMINS YN +VDT NS IT + ND+ YGLA+AV QN   Q KGDYKG LNG N+FQ+ S+FELS SAK+SKIPSEITK+DI ASNGFL+N SDFTIKEMDD TG IKIECKLYQ+PWFTDKLPD ISPK+I   Y TDK I DKTSWK LTTSTDYDFLNMKP+TI+K DVENLDPFQVSFQSQTIVDK+G  L+PKK YDVK  DD +G V V++ Y+YIPM  TY  ST+ ++Y AE  Y VFKSS   +FKFMGQT +E +I+IQ VSELKNLLSANTLPSSF SLNSS+DKTNS FLQF+NTNTSKGYPISKM FTVTA+D +GSLSIK  MP+TYSP G  +TF+I YTNLNK ++YKF FK V++IG Q+I +ILPSA+TDGDIINNFISYTGF+SNDFSITKTV+DE G LTVA+NLDKKYA  IG G+YGF NYSATKTF+GFMTKD+YN+RF+V FV D D+ L+QLKQMQVSKIY+SF G+  T LTV  + Y  LKDLI++LL+++ GT+IP SW ++++ITA MH DN+QGTISFYVKI K  + G+NSD+NLV NYTGFVKGN   T DNLSFVADNML+SYL+SNGD ++ + F  FTPD+FAKWL +N+N+KALKLISYKSG+Y  LL+D TKY+L+V+ N TQR V I++ F  VTN +SL EYSVTYTI
  S:     9 MKKLSKKISLVITSSILSIATGISIALPISNSALLNSSITNITSKNQATESSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWDIDFTTLIPDQNGNKNEGQQSQSLTYSGPWSRAWFNWDYNRNTDLIWILGYWSNNKKTQPLLGIQASNGQVKHTYNLSYDGV--LNNVGTGTAYRFVSALSSGKVMVYGGAGSPYDAKGILYDPDSNSTSVISGDSAKNEILPTNDETYGKKYRWYFFNLIPIGNNKNLVEVLPFSRDESVDDGGFPNANYNVYFLLVDDKLNMIHKEGT-----WSKLVKVADGMQNYRNTKITPQRDYYTMLDGKVVTVVYNTAIVIDGKNDNIQFGVYPMSEKKWIKSWAFDSNQNLYFKFKDESKVYKVSGSVWQTLNNSTTNSNVPLDLYLDLAGIQDIKSYANDLIMYNVYGYTGQLMMINSKYNAKVDTTNSTITVDTNDQKYGLAIAVNQNSSNQTKGDYKGMLNGDNSFQKTSNFELSASAKSSKIPSEITKEDIVASNGFLKNPSDFTIKEMDDKTGTIKIECKLYQVPWFTDKLPDDISPKIIEHEYKTDKTISDKTSWKNLTTSTDYDFLNMKPTTIQKGDVENLDPFQVSFQSQTIVDKNGNTLYPKKTYDVKDKDDAKGTVKVTVKYEYIPMGITYKDSTSVRSYDAETTYNVFKSSTTPAFKFMGQTNSEPSINIQNVSELKNLLSANTLPSSFLSLNSSSDKTNSGFLQFVNTNTSKGYPISKMNFTVTADDRQGSLSIKGVMPNTYSPTGNQETFSITYTNLNKASNYKFDFKTVSSIGNQSIKSILPSAITDGDIINNFISYTGFNSNDFSITKTVNDETGELTVAINLDKKYASEIGDGSYGFKNYSATKTFTGFMTKDEYNKRFDVQFVKDDDSKLIQLKQMQVSKIYDSFSGTNTTPLTVGNKTYNTLKDLIKELLVESIGTAIPTSW-NDATITAEMHADNSQGTISFYVKIPKEKITGANSDINLVANYTGFVKGNAVQTGDNLSFVADNMLKSYLLSNGDISSEEEFNKFTPDTFAKWLTDNNNEKALKLISYKSGQYEDLLKDSTKYSLTVLSNPTQRKVDIFVRFNGVTNNQSLTEYSVTYTI 1130
>gi|26553714|ref|NP_757648.1| hypothetical protein MYPE2610 [Mycoplasma penetrans HF-2] >gi|26453721|dbj|BAC44052.1| hypothetical protein [Mycoplasma penetrans HF-2] (1128 aa)
Score = 3338, Expect = 0.0e+00, Identities = 754/1120 (67%), Positives = 917/1120 (81%)
  Q:     5 MNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVNG---QSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNI-SGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKET-SNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTI--NNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYT--SSTTPKTYSAEKEYTVFKSSDPS-SFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIP--DSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           MN  SKKISL ITSSILS+ATG+SIA+PI+     ++SI N+ S NQAT++SP+I SEVNDQNAN+ST NGP+TFLG+KITALDWFGNKLWE DFS LV GS G  G    ++ GAW R W+NWDYNR TDTIWV+G+WS++TK QPLFEIKA++G I N H ++Y    S   + NI + YRF+++LSSGKVMIYGGAG+SY+ K +LYDPK KTA+L+ G+S+STEILPM + S+G+ YKWYFFNLIP+A NRNIVEVV F ++ + + D G+  ANY++YFLLVDD LNM+    SSS   WAK V+VA G+QG+RNSKITPQRDYYSLLDG+VVTVVYNTAIIIDGKS++ ++G +P + SKWIKSWAFDSNQNLYFKFK E ++YKVSGS+W  +  N  N  +SP  YLDL G++A   YA ++ IYNVYG+TGQLMMINS YNE VDT NS ++ E N  NYGLA+AV QN   Q+ GDYKG LNGP++ Q+ASDF LS+SA+TSKIPSEITKDDI  +NGFL+NS+DF I  MDD+ G+I+IE  LYQIPWF  +LPD ISPK + KTYTTD KI +KTSWKTL+ +TDYDF+NMKP+TI++EDVENLDPFQVSFQSQ I + +G QL+PKK Y V   +D+ G V V++ Y+YIPM  TYT  +S+  K+Y     Y VF S+  + +F F GQ  +EA++DI++VSELKNLLSANTLPSSF++LN+STDKTNS FLQFINTNTSKGYPISKM F VTAND+ G+L I+A MPS+ SP G  Q+FN+ YTNLNK T+YKFGFK V TIG QNI +ILPSAVTDGDIINNFI YTGFSSNDFSI KT+DDEKGTLTVA+NLDK YAQAIG G+ GF NYSAT+ FSGFMT+D+YNQRF+V FV DS + LLQLKQ+QVS+I+ S  G+ P  LTV+   Y NL DLI+KLLI+++G+SIP  +SW++N+ I++SM+YDNAQGTISFY+KIDK LVDGSNSDLNLVVNYTGFVKGNVD+T+DNLSFVADNMLESYL+S+ DTT + FK F P +FA+WL+ NDN+KALKLISYKSGEY+T L  K KY LSVI NETQRTV I+I F ++ + KSL+EYSVTYTI
  S:     1 MNNTSKKISLAITSSILSVATGLSIAIPIAGNTAKDTSIANVSSVNQATESSPIIASEVNDQNANLSTSNGPITFLGDKITALDWFGNKLWEIDFSKLVEGSNGQIGGGSSNFTGAWKRTWWNWDYNRATDTIWVIGYWSNTTKKQPLFEIKASNGEILNKHEIDYSKFGSDFPNPNIGTVYRFITSLSSGKVMIYGGAGNSYDAKGVLYDPKNKTATLIKGDSASTEILPMNNTSYGTKYKWYFFNLIPIATNRNIVEVVNFVDEGSITGDNGAGKANYNIYFLLVDDNLNMIHKKDSSS--PWAKHVQVASGMQGFRNSKITPQRDYYSLLDGKVVTVVYNTAIIIDGKSNDTKIGTFPMTDSKWIKSWAFDSNQNLYFKFKGEKIVYKVSGSAWDNLGSNLGNKTISPDRYLDLGGVTAIKDYADNMTIYNVYGFTGQLMMINSKYNENVDTNNSSLS-ETNTGNYGLAIAVNQNSTNQNVGDYKGILNGPDSIQKASDFNLSDSARTSKIPSEITKDDIVTTNGFLKNSTDFKIVSMDDTKGSIEIETNLYQIPWFATRLPDNISPKTVRKTYTTDNKIQNKTSWKTLSNTTDYDFVNMKPTTIQREDVENLDPFQVSFQSQIITNANGAQLYPKKTYSVSEQNDSAGTVKVTVKYEYIPMGITYTGNNSSQIKSYETNTTYNVFNSTTTTPAFHFAGQRTSEASVDIRQVSELKNLLSANTLPSSFSNLNTSTDKTNSGFLQFINTNTSKGYPISKMTFKVTANDSAGTLKIEATMPSSNSPTGNQQSFNVTYTNLNKSTNYKFGFKTVNTIGGQNIKSILPSAVTDGDIINNFIEYTGFSSNDFSIAKTIDDEKGTLTVAINLDKDYAQAIGNGSLGFKNYSATRVFSGFMTRDEYNQRFDVQFVKDSSSQLLQLKQLQVSEIFSSLTGTSPKGLTVENTNYKNLNDLIDKLLIESRGSSIPTANSWSNNTKISSSMNYDNAQGTISFYIKIDKSLVDGSNSDLNLVVNYTGFVKGNVDTTNDNLSFVADNMLESYLISSKDTTEEQFKTFNPTTFAEWLKANDNEKALKLISYKSGEYITHLTSK-KYKLSVIANETQRTVDIFINFDELKDNKSLREYSVTYTI 1128
>gi|26553721|ref|NP_757655.1| hypothetical protein MYPE2680 [Mycoplasma penetrans HF-2] >gi|26453728|dbj|BAC44059.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1131 aa)
Score = 3090, Expect = 0.0e+00, Identities = 691/1122 (61%), Positives = 880/1122 (78%)
  Q:     3 FIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVN-GQSYN-GAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLE-SVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNT--NVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEA-SNGFLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTG--TEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFK-DVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           FIM+KLSKK++L I SS+LSIATG+SIALPIS     +S ITNI S NQ+TQ   ++P+EVNDQNAN+ST NGP+TF+GNKITALDW+GN LWEKD +  +P   G   G+ Y  GAWPRAWFNWDYNR+++ +WVLGFWS +T+ QPL  I A+ G+I  T+ ++Y + S    +V  S+ YRF+SALSSGKVM+YGGAGSSYN K ILYDP T +ASL++G+SS++ ILP+G+A++GS YKWYFFNLIP+A NRN+VEV+ +++   S D GS  ANY+VYFLLVDDQLNMV   SS+   +W+K V+VA G+ GYRN++ITPQRDYYSLLDGRVVTVVYNTA+IID  + +V+ G YP S++KWIKSWAFDSNQNLYFKFK+E  IYKVSG+ W T+NN+++   VSPY YL+L GI+    YA +LI+YNV+ YTGQLM+INS YN+RV+T NS IT++NN+ NYGLA+ +TQN   Q++GD+KG LNG ++ Q+ASDF+LS+SA  SKIPSEIT++DIE  +N FLRNSSDF+I  ++D TG I IECKLYQIPWF  +LP  I+P+V+S  YTT+ KI +K SWKTL+TSTDYDF+NM P+ I+ EDVENLDPFQ SFQSQTI +  G+QL+PKK Y V + +D  G + V++ Y Y+PM  TY +S   KTY+A   Y VFKS+D + FKFMGQTG  T ++I++  V+ELKNLL+ANTLPSSF SLN+STD TNSAFLQF+NT  SKGYPISKM+FTV A+D  G+LSI A MPS YSP   +QTF + YTNLN+  +Y F FK + +++G+Q+ + +LPS++TDGDIINN I Y GF+SNDF+ITKT +D  GTL V ++L+  YA A+G GN GFTNYSA+ TF+GFMT+DQYN+RFNV+F  D+D  LL LKQMQ S+IY+S   +   +LTV   KYT+LK+LIE LL+  KG+ +P  W  NSSITA M+YDN+QGT SFYV I K L+ GSNSDLNLVVNYTGFVKGNV +T DNLSFVADNML++YL+S G  T   +  FTP SFA+WL+   N  AL LI+YK+G+Y  LL + + Y  +++ N TQ+TVS+YI+F +VT+  SL EYSVTYTI
  S:     7 FIMSKLSKKLTLSILSSVLSIATGLSIALPISQHLENSSLITNISSINQSTQAGEIVPTEVNDQNANLSTNNGPITFIGNKITALDWYGNVLWEKDMADEIPDKTGAKPGKDYTEGAWPRAWFNWDYNRSSNLLWVLGFWSSTTRKQPLLGIDASTGNIKYTYDIDYSSYSSSIGNVTASTTYRFISALSSGKVMVYGGAGSSYNAKGILYDPTTSSASLISGDSSNSNILPLGNATYGSKYKWYFFNLIPIANNRNLVEVLPYSSDYASGDAGSNNANYNVYFLLVDDQLNMVTKDSSN---RWSKLVQVASGMAGYRNTQITPQRDYYSLLDGRVVTVVYNTAVIIDASASDVRFGSYPMSEAKWIKSWAFDSNQNLYFKFKDETTIYKVSGTYWGTLNNSSSSSTVSPYTYLNLSGITQTKDYASNLIMYNVHEYTGQLMLINSKYNDRVNTDNSSITSQNNNDNYGLAIGITQNANDQNQGDFKGILNGADSIQKASDFQLSDSAIASKIPSEITRNDIETLNNSFLRNSSDFSITSINDETGEITIECKLYQIPWFASELPSNITPRVVSHQYTTNNKITNKVSWKTLSTSTDYDFMNMTPTKIRAEDVENLDPFQASFQSQTITNASGEQLYPKKTYTVSNANDTNGTINVTVKYDYVPMGLTYNTSNV-KTYTATHSYQVFKSTDTAEFKFMGQTGSSTTSSINVTNVAELKNLLNANTLPSSFLSLNNSTDSTNSAFLQFVNTANSKGYPISKMRFTVAADDNAGTLSITANMPSDYSPTNTSQTFTVTYTNLNRAANYSFRFKTNYSSVGSQSFSALLPSSITDGDIINNLIEYQGFNSNDFTITKTANDANGTLLVQISLNSNYASAVGNGNAGFTNYSASHTFTGFMTEDQYNERFNVEFTDDTDTKLLDLKQMQPSQIYDSLVTATTKELTVGNTKYTDLKELIENLLVSEKGSLVPSGWKDNSSITAGMYYDNSQGTASFYVNIPKSLMAGSNSDLNLVVNYTGFVKGNVVATQDNLSFVADNMLKNYLISKGFVTQTEYDAFTPTSFAEWLRSGTN--ALNLITYKTGQYEQLLNNPSGYTFNIVANTTQKTVSVYIHFNNVTDSNSLSEYSVTYTI 1131
>gi|26553768|ref|NP_757702.1| hypothetical protein MYPE3140 [Mycoplasma penetrans HF-2] >gi|26453775|dbj|BAC44106.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1182 aa)
Score = 3028, Expect = 0.0e+00, Identities = 682/1122 (60%), Positives = 877/1122 (78%)
  Q:     3 FIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVN-GQSY-NGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAY-ANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTI---NNTNTNVSPYVYLDLKGISA--ASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEA-SNGFLRN--SSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTP-KTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           FIM KLSKKI+L I  S+L +ATG+S+ALP+S  AL+NSSIT++   N A+ TS ++ SE NDQNANIST NGP+TF GNKITALDWFGNK WE DF+T VP       G  Y + AW R+WFNWDYNR+ D +WVLG++S +TK QPLF+I  + G+I  T  + Y N+S     ++++AYRFVSALSSGKVM+YGGAGS+Y+ KA+LYDP T T + ++GNS++T ILP+GD+++G  Y+WYFFNLIP+A N+N+VEV  F+   TS+D  +A  A+Y +YFLLVDD LNM+      +  +WA  VK A+ + GYRN+++TPQRDYY++LDG+VVTVVYNTAIIID   ++V  G +P + +KWIKSWAFDSNQNLYFKFK++  IYKVSG  W+T+   NN   +VSP +YLDL GIS    + YA + +IYNVYGYTGQLM+INS YN+ +    S      +D NYGLA+AVTQN+  Q++GD+KG LNGP++FQ+ASDF + NS   SKIPSEITK+DI   +N F+++  SS F I ++DDS G  K+   LYQIPWFT++LP   SP+ +S  +TT  KI +KTSWKTL+TSTDYDFLNM PS ++  DV +L+PFQ SFQSQTI + +G+QL+PK  Y ++S DD +G++TV  +YQY+PMS   ++  +  K+YS+   Y +F +S  ++FKF GQT  E +ID+ +V +LKNLLSANTLPSSF SLN+S+D TNS FLQF+NTNTSKGYPISKMKFTV ANDT G+L I A MPS YSP  Q ++F++ YTNLNK+TSYKF F +V +IG  N N ILPSA+TDGDIIN+FISYTGFSSNDF+ITKT +DE G+LTVA++L+  YA  IG GN GFTNY+AT+TF+GFMT D+YNQRFNV+F  DSDN LL LKQ+QVS+IY++F+G+    LT+   KY +LK LI+ LL+K++G+ IP SW +++ ITA M+YDN+QGTISFYVKI K L+ G+NSDLNLV NYTGFVKGNVDST DNLSFVA+NML+SYLV+N   T + F  FTPD+FAKWLQ+N+NQ+ALKLISYKSGEYV+LL D +K+ ++VI N  QRTVS+Y+YF++VT+PKSLKEYSVTY I
  S:    63 FIMRKLSKKITLSILGSVLGVATGLSVALPMSESALSNSSITSLSQNNHAS-TSDLVISENNDQNANISTNNGPITFHGNKITALDWFGNKKWEIDFATHVPDKTSTKPGVDYTDSAWQRSWFNWDYNRSKDKLWVLGYYSTNTKKQPLFQINGSTGAIEKTFDLTYTNLS-----SVNNAYRFVSALSSGKVMVYGGAGSTYDAKALLYDPDTDTLTQISGNSNNTTILPIGDSTYGQKYRWYFFNLIPIANNKNLVEVFPFSTDPTSDDTTAARNASYDIYFLLVDDNLNMI-----ETTGEWATKVKAANAMVGYRNTQVTPQRDYYTMLDGKVVTVVYNTAIIIDATGNSVNYGTFPMTDNKWIKSWAFDSNQNLYFKFKDDTKIYKVSGDFWKTLTSSNNHTASVSPTIYLDLSGISKDNVNTYASNFVIYNVYGYTGQLMIINSYYNKFIRLSESEKIP--SDANYGLAIAVTQNENQQNQGDFKGTLNGPDSFQKASDFTIENSILQSKIPSEITKNDITTLNNSFIKDGDSSGFVISDIDDSKGTFKVTVNLYQIPWFTNELPSDSSPRTVSYDFTTTNKIGNKTSWKTLSTSTDYDFLNMLPSKVQVSDVSSLNPFQASFQSQTITNANGEQLYPKTTYSIQSRDDTKGEITVKADYQYVPMSANLSNYVSNVKSYSSTNTYKIFSNSSAANFKFAGQTNNETSIDVSQVPQLKNLLSANTLPSSFTSLNNSSDSTNSGFLQFVNTNTSKGYPISKMKFTVAANDTAGTLKIDAVMPSNYSPKNQQESFSVTYTNLNKVTSYKFSFNNVNSIGGTNKNLILPSAITDGDIINSFISYTGFSSNDFTITKTANDETGSLTVAISLNSNYASEIGNGNVGFTNYNATQTFTGFMTTDEYNQRFNVEFEDDSDNKLLALKQVQVSEIYDAFYGTNKNGLTIGSTKYDDLKSLIKGLLVKSQGSLIPTSW-TDTRITADMYYDNSQGTISFYVKIPKELISGANSDLNLVANYTGFVKGNVDSTSDNLSFVANNMLKSYLVNNSGITEEQFDQFTPDTFAKWLQDNNNQEALKLISYKSGEYVSLLADSSKHKITVISNPVQRTVSVYVYFENVTDPKSLKEYSVTYNI 1182
>gi|26553724|ref|NP_757658.1| MYPE 2560 paralog, 57% [Mycoplasma penetrans HF-2] >gi|26453731|dbj|BAC44062.1| MYPE 2560 paralog, 57% [Mycoplasma penetrans HF-2] (1123 aa)
Score = 2984, Expect = 0.0e+00, Identities = 670/1120 (59%), Positives = 853/1120 (76%)
  Q:     5 MNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVP------GSQGVNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKN-ISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINN-TNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNG-FLRNSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQT--GTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFK-DVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           M+KLSKKI+L   +S+LSIATG+SI LPISN +L NSSITNI S NQ+T  S + PSE NDQNAN+ST NGP+TFLGNKITALDW+GNKLWEKD STL+P       + G      NG W RAWFNWDYNRNTD +W++G+WS  TK QPL  IKA+ G I + + ++Y++  S L +    +AYRFVSAL+SGKVMIYGGA ++YNGK +L++P   T +LLNGNS++  I P  D+ +G+ Y+WYFFNLIP+  N+N VEV+ F+   T+ D G   ANY+VYFLLVDD LN++  + +     W+K VKVADG+Q YRN+KITPQRDYY++LDG+VVTVVYNTAI+I+   +++  G YP S++KWIKSWAFDSNQNLYFKFK+E  IYKVSGS+W ++NN T++ ++P  YLDL GI     YA +LIIYNVYGYTGQLMM+NS YNE VDT NSGIT + N    GLALAVTQN   Q++GDYKG LNG ++ Q+ASDFELS SA  SKIPSEIT+ DI   N  FL+N+SDFTI ++DD+ G I+I+C LYQIPWF  +LP  I+P+V++  YTT  KI +K SWKTL+ +TDYDFLNMKPS I  +DV NLDPFQVSFQSQ I    G+QL+PKK Y V   +D  G + VS+ Y+Y+PM  +Y+++   K+Y     YTVFKS+D  +F+F GQT  G+ A+ID+  V+ELKNLL+A+TLPSSFN LNSSTD TNSAFLQFINT  SKGYPISKMKFTVTA+D  G+L I A MP++YSP    +TF + YTNLNK  +YKF FK   ++IG+QN +T+LPS++TDGDIINN I Y GF+SNDF+ITKT +D+ GTL V ++L+  YA AIG GN GF NYSAT TF+GFM +DQYN+RFNV+FV DS   L+ LKQMQ S++Y++   +K T LTV    Y NLK+L+EKLLI   G+ +P  W  N+SI   M+YDN+QGT SFYV I K L+ G+NSDLNLV NYTGF+KGN   T+DNLSFV+DNML++YL+S G  T + ++ FT  SFA+WL+E++N  A+KLI+YK+G+Y  LL D TKY+++++ N TQ+TVS+YI+F  +T+  SL EYSV Y I
  S:     1 MSKLSKKITLSAITSVLSIATGLSIGLPISNNSLKNSSITNISSSNQSTTASKLAPSEANDQNANLSTSNGPITFLGNKITALDWYGNKLWEKDLSTLIPDYNGKVSTDGSATNYDNGPWKRAWFNWDYNRNTDLLWIIGYWSPVTKKQPLLGIKASSGDIQHNYDIDYQSYTSSLGATTTGTAYRFVSALASGKVMIYGGAATAYNGKGLLFNPSDSTLTLLNGNSATESIFPPNDSEYGTKYRWYFFNLIPIGNNKNFVEVLPFSRDATTGDAGYPNANYNVYFLLVDDNLNLIETTGT-----WSKLVKVADGMQNYRNTKITPQRDYYTMLDGKVVTVVYNTAIVINATGNSINYGTYPMSEAKWIKSWAFDSNQNLYFKFKDESTIYKVSGSAWSSLNNNTSSAIAPNTYLDLAGIPQTKDYANNLIIYNVYGYTGQLMMVNSKYNENVDTSNSGITEDANPDKLGLALAVTQNANSQNQGDYKGILNGDDSIQKASDFELSQSAIDSKIPSEITRSDINTLNSSFLKNASDFTITKIDDANGTIEIQCNLYQIPWFASELPSNITPRVVTHQYTTTNKINNKISWKTLSETTDYDFLNMKPSKIAVDDVTNLDPFQVSFQSQIITTAQGQQLYPKKTYSVSDPNDTAGTIKVSVKYEYVPMGLSYSTNNV-KSYETNFTYTVFKSTDTPAFRFTGQTTSGSSASIDVSNVAELKNLLNASTLPSSFNYLNSSTDSTNSAFLQFINTANSKGYPISKMKFTVTADDVAGTLKITATMPASYSPKNSEETFTVTYTNLNKAANYKFNFKTSSSSIGSQNFSTLLPSSITDGDIINNLIEYQGFNSNDFTITKTANDQNGTLLVQISLNSSYASAIGNGNAGFKNYSATHTFTGFMNEDQYNERFNVEFVDDSSEVLIDLKQMQSSQVYDTLV-TKNTSLTVGNTTYNNLKELVEKLLITKLGSLVPTGWKDNASIDVGMYYDNSQGTASFYVNIPKSLMAGANSDLNLVANYTGFLKGNAVQTNDNLSFVSDNMLKNYLISKGFVTKEQYEAFTAASFAEWLKEDNN--AIKLITYKTGQYEQLLNDPTKYSINIVANTTQKTVSVYIHFNGITDSNSLSEYSVVYAI 1123
>gi|26554186|ref|NP_758120.1| hypothetical protein MYPE7300 [Mycoplasma penetrans HF-2] >gi|26454195|dbj|BAC44524.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1126 aa)
Score = 2980, Expect = 0.0e+00, Identities = 689/1120 (61%), Positives = 865/1120 (77%)
  Q:     5 MNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPG-------SQGVNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNTN--VSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSG-ITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEA-SNGFLR--NSSDFTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTS-STTPKTYSAEKEYTVF-KSSDPSSFKFMGQTGTEATIDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           M K +KK+ L  TS+I +IA  + I LP SN  L NS IT+I S NQAT +S VIPSEVNDQNAN+STKNGPVTF+GN ITALDW+GN LW  DF+  VP               SY+GAWPRAW+NWDYNRNT+ IWVLGFWS +T+ QPL  I A+ G+I   H ++Y  +  + SVN+ SAYRFVSALSSGKVM+YGGAGS+Y+ K ILYDP T T +LL GNS++T ILP+G++  G+ Y+WYF+NLIP+  NRN+V V+ ++ +  SND G   ANY +YFLLVDDQLNMV     +S   WA  VKVA G+ GYRN++ITPQRDYY++LDG+VVTVVYNTA+IIDG   NV +  YP SQSKWIKSWAFDSNQNLYFKFK+E +IYKVSG+SW + ++  +N  +SP  YLDL GI+ A  YA +L IYNVYGYTGQLM+INS+YN RV+T NS  IT ENN  +YGLA+AVTQN   QD+GD+ GFLNG N+FQ+ASDF + NS  +SKIPSEITK+DI   +N FL+  +S+ F +  +DD  G+I + C LYQIPWF+  LP  +SP+VI+KT+ T  KI +K SWKTL+TSTDYDFLNM PS ++  D+  LDPFQ SFQSQT+ +  G QL+PK  Y + S +DN G++T+   Y+YIPMS + ++ S + KTY A   YT+F KS+   SF FMG     +T+DI+ V++LKNLLSANTLPSSF SLN+S+  TNS FLQF++TN+SKGYPISKM+FTVTANDT+G+L I A MPS YSP   +++F++ YTNLNK+TSY FGF + TT+G  N+N ILPSA+TDGDIIN+FISYTGFSSNDF+ITKT +DE G+LTVA++L+  YA  IG GN GFTNY AT+TF+GFM+ D+YNQRFNV+FV DS  +L++ KQMQVS+I+ S  GS P+ LTV    YTNLKDLIE LL+ + G +IP  W  NS+I ASM+YD++QGTISFYVKID+ +VDGSN+DLNLVVNYTGFVKGNVDST+DNLSFV+DNML+SY  S G  + ++F NFTP SFA WLQ N+ Q A +LI+YKSG+Y T+L     Y  ++IPNE QRTVS+YI+F+ +TN +SL EYSV Y+I
  S:     1 MKKRNKKLILSFTSAISAIAASLGIVLPASNTDL-NSKITSISSTNQATSSSDVIPSEVNDQNANLSTKNGPVTFIGNTITALDWYGNSLWSIDFTKHVPDVNGNKNNGSNSASLSYDGAWPRAWYNWDYNRNTNLIWVLGFWSGNTRKQPLIGINASTGAIVYQHDLDYTGL--INSVNVGSAYRFVSALSSGKVMVYGGAGSAYDAKGILYDPTTNTRTLLTGNSANTSILPVGNSEFGNQYRWYFYNLIPIGNNRNLVSVLPYSTQVASNDAGYPNANYDIYFLLVDDQLNMV-----ASSGIWASKVKVASGMVGYRNTQITPQRDYYTMLDGKVVTVVYNTAVIIDGTGSNVTLNSYPMSQSKWIKSWAFDSNQNLYFKFKDEAIIYKVSGTSWNSQSSNGSNSAISPTTYLDLAGINDAKQYANNLTIYNVYGYTGQLMLINSIYNNRVNTTNSSTITVENNPNSYGLAIAVTQNSTQQDQGDFIGFLNGTNSFQKASDFTIDNSVLSSKIPSEITKNDITTLNNSFLKENDSNGFKVTTIDDVNGSITVTCDLYQIPWFSSTLPSDVSPRVITKTFNTTNKINNKVSWKTLSTSTDYDFLNMVPSKVQVADINALDPFQASFQSQTVTNSSGTQLYPKTTYSITSTNDNNGQITIKAVYEYIPMSASLSNLSQSVKTYEATTTYTIFNKSNTTPSFNFMGANSNNSTVDIRNVAQLKNLLSANTLPSSFTSLNTSSSSTNSEFLQFVDTNSSKGYPISKMRFTVTANDTQGTLKIDATMPSEYSPNNTSESFSVTYTNLNKVTSYSFGFNNPTTVGGTNMNLILPSAITDGDIINSFISYTGFSSNDFTITKTANDETGSLTVAISLNSNYASEIGNGNVGFTNYVATRTFTGFMSTDEYNQRFNVEFVDDSSEALIEFKQMQVSQIFNSLNGSSPS-LTVGSTTYTNLKDLIENLLVTSMGNAIPKGWKDNSNIDASMYYDDSQGTISFYVKIDQSVVDGSNTDLNLVVNYTGFVKGNVDSTNDNLSFVSDNMLKSYSTSKGFVSEEDFNNFTPTSFANWLQNNNYQYAKELITYKSGQYQTILNSNNNYTFTIIPNEAQRTVSVYIHFEGITNQQSLSEYSVQYSI 1126
>gi|26554188|ref|NP_758122.1| hypothetical protein MYPE7320 [Mycoplasma penetrans HF-2] >gi|26454197|dbj|BAC44526.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1106 aa)
Score = 2828, Expect = 0.0e+00, Identities = 647/1077 (60%), Positives = 827/1077 (76%)
  Q:    48 SKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVN-GQSYN-GAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKE-TSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGKSDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINN-TNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVD-TKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGPNTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRNSSD------FTIKEMDDSTGNIKIECKLYQIPWFTDKLPDGISPKVISKTYTTDKKIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEAT--IDIQKVSELKNLLSANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNIKYTNLNKITSYKFGFKDVT-TIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGNYGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIPDSWASNSSITASMHYDNAQGTISFYVKIDKLLVDGSNSDLNLVVNYTGFVKGNVDSTDDNLSFVADNMLESYLVSNGDTTADNFKNFTPDSFAKWLQENDNQKALKLISYKSGEYVTLLQDKTKYNLSVIPNETQRTVSIYIYFKDVTNPKSLKEYSVTYTI 1124
           S NQAT +S +IPSE NDQNAN+ST +GPVTF GNKI+ALDW+GN+LW  D +  +  + G   G SYN G+W RAWFNWDYNR T+ IWVLGFWS +TKTQP+  I A+ G I ++H ++Y + +GL    ++S+YRF++ALSSGKVM+YGGA   Y  K +LYDP + + SL++G+S+   ILP GD S+GSNY+WYFFNL+P+A N+NIVEVV +AN    + D+G+  ANY+ YFLLVDD LNM+    S + S W+KPVKVADG+Q YRN+ ITPQRDYY +LDG+VVTVVYNTAI+ID    +VQVG YP S+SKWIKSWAFDSNQNLYFKFK+E  IYKVSG+ W ++N  T T V+P  YLDL G +     A +L+IYNVYGYTGQL++INS Y+  ++ T N  IT++NN  NYGLA A+TQN   QDKGDYKG LNGPN+FQ+A+DF+++ S   SK+PSEIT+ D+E  NG +   +D      FTI E++D TG  K+   LYQIPWF D LP   +PK I+K++T  +KI  K SWKTL+ ++DYDFLNMKPSTI  +DV NLDPFQVSFQSQTI +  G QL+PKK Y V + +D  G+V V I+Y+Y+PM  TYT+S++ KTY++  +YTVFK++D ++FKF+GQT + ++  ID+    +LKNLLSANTLPSSF+SLNSS + TNS+FLQF+NT+ SKGYPISKM F V++NDT G L+I A MPS YSP G  QTF++ YTNLNK ++Y F FK  T TI     +T+LPS VT+G+IINN I YTGF+SNDF+ITKT +D +GTL V++ L++ YA  +G GN GFTNY+A+ TF+GFM  DQ+NQRFNV FVSD+   LL LKQMQVS+IY     +  T    DG  Y ++K+L+EKLL+++ GTSIP +W+S SSI+A+M+ DN+QGT SFY+ I K L+DGS +DLNLVVNYTGFVKGNVDSTDDNLSFVA+NML+S+LVSNG  TA+ F N TP  F+ WL+EN+N+ ALKLISYKSG+Y T+L   T Y +SVI NETQRTVSIYI F  +TN +SL EYS+ Y+I
  S:    22 SINQATSSSDLIPSESNDQNANLSTTSGPVTFTGNKISALDWYGNQLWTLDLAQNIADASGAKPGTSYNDGSWQRAWFNWDYNRATNLIWVLGFWSKTTKTQPILGIDASTGEIKHSHDISYSS-AGLNITAVNSSYRFITALSSGKVMVYGGAAFHYEAKGLLYDPTSNSVSLVSGDSADQSILPKGDTSYGSNYRWYFFNLMPIADNKNIVEVVNYANSSGLTGDQGNGLANYNTYFLLVDDSLNMI----SKTDSTWSKPVKVADGMQNYRNTAITPQRDYYMMLDGKVVTVVYNTAIVIDASGSSVQVGTYPMSESKWIKSWAFDSNQNLYFKFKDEKKIYKVSGNVWNSLNGGTATTVTPTTYLDLDGFADTKPCADNLMIYNVYGYTGQLLLINSHYSPYINLTTNPEITSDNNSSNYGLAFAITQNSNQQDKGDYKGTLNGPNSFQKAADFDINASVLNSKLPSEITRSDLELQNGGILKEADVAKWPPFTISEINDETGTFKVTVNLYQIPWFVDTLPSDATPKTITKSFTA-QKISTKVSWKTLSETSDYDFLNMKPSTITAQDVTNLDPFQVSFQSQTITNSQGVQLYPKKTYSVGTTNDATGEVEVKISYEYVPMGVTYTNSSSVKTYTSSTKYTVFKTTDTATFKFVGQTASSSSTRIDVTTTPQLKNLLSANTLPSSFDSLNSSNNSTNSSFLQFVNTSDSKGYPISKMNFRVSSNDTNGELTITATMPSQYSPNGSAQTFSVTYTNLNKSSNYGFNFKTTTNTIDGNAFSTMLPSVVTEGNIINNLIEYTGFNSNDFTITKTANDAEGTLVVSIELNRNYASQVGNGNSGFTNYTASYTFTGFMNSDQFNQRFNVSFVSDTSEKLLALKQMQVSQIYSDLTDANKTLTLSDGSTYKDVKELMEKLLVESLGTSIPQNWSSQSSISATMYVDNSQGTASFYLNIPKDLIDGSETDLNLVVNYTGFVKGNVDSTDDNLSFVANNMLKSFLVSNGSFTAEQFDNLTPLEFSNWLKENNNENALKLISYKSGQYQTILNGTTGYTVSVITNETQRTVSIYINFDGITNSQSLSEYSIQYSI 1106
>gi|26554219|ref|NP_758153.1| hypothetical protein MYPE7630 [Mycoplasma penetrans HF-2] >gi|26454228|dbj|BAC44557.1| hypothetical protein [Mycoplasma penetrans HF-2] (194 aa)
Score = 205, Expect = 8.7e-14, Identities = 58/167 (34%), Positives = 85/167 (50%)
  Q:     1 MVFIMNKLSKKISLMITSSILSIATGISIALPISNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNANISTKNGPVTFLGNKITALDWFGNKLWEKDFSTLVPGSQGVNGQSYNGAWPRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNY 167
           M FIMNK+SK+ISL+I +S+LSI  G+ + L  SN+ + NSSI NI S N+    S +I  E  + N N+     P+ FLGNKIT  DW   K W+K  S ++        ++            DY +    I +LGF     K + L ++    G I +   +N+
  S:     1 MRFIMNKISKRISLLIINSVLSIKAGM-VFLVFSNE-IKNSSIINIPSINRIKTPSEIISFEYCNHNTNLYMTTQPIIFLGNKITTFDWCAIKSWDKYLSDIICMEDKYTSETL-----------DYKKQIIIISILGFLIWKNKIKTLLDMCTLIGKIKDQININF 154
>gi|26554227|ref|NP_758161.1| hypothetical protein MYPE7710 [Mycoplasma penetrans HF-2] >gi|26454236|dbj|BAC44565.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1042 aa)
Score = 123, Expect = 3.4e-04, Identities = 171/773 (22%), Positives = 307/773 (39%)
  Q:    34 SNQALTNSSITNIYSKNQATQTSPVIPSEVNDQNA--NISTKNGPVTFLGNKIT--ALDWFGNKLWEKDFSTLVPGSQGVNGQSYNGAW--------------PRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVAD-GLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDGK------SDNVQVGVYPTSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSSWQTINNTNTNVSPYVYLDLKGISAASAYAQDLIIYNVYGYTGQLMMINSVYNERVDTKNSGITTENNDKNYGLALAVTQNDKLQDKGDYKGFLNGP------NTFQQASDFELSNSAKTSKIPSEITKDDIEASNGFLRN---SSDFTIKEMDDSTGNIKIECKLYQI-PWFTDKLPDGISPKVISKTYTTDK----KIIDKTSWKTLTTSTDYDFLNMKPSTIKKEDVENLDPFQVSFQSQTIVDKDGKQLFPKKIYDVKSHDDNQGKVTVSINYQYIPMSETYTSSTTPKTYSAEKEYTVFKSSDPSSFKFMGQTGTEATIDIQKVSELKNLLS---ANTLPSSFNSLNSSTDKTNSAFLQFINTNTSKGYPISKMKFTVTANDTEGSLSIKAEMPSTYSPIGQTQTFNI----KYTNLNKITSYKFGFK 806
           S++A +NS + N+ S +        IP+    QN+  N+S  NGP+    N  T  A DW+GN  W    ++    + G N   Y+ AW                   +W YN  TD ++VL      T    L  + +  G+I +T  +   ++  ++ V+ +S+                   +S N  +++Y  + +T  L     ++TE               Y + +IP+  N +I    T    +T+       +   +    VDD L  +  S + S +      K +D  + G++ +      DY   +  ++ +V  N +++   K      S N  +G +       I S   D+N  +YFK      +  +S      ++N+   +   + L+    +   A A++  ++ V   +    +++  +   + + +S I T                          GFLNG        T   +  F +SN A  S IPS +   +I  +N  L N    +   I   DD +G++ ++     +  W+ +      +  VIS+ Y   K    KI   T+W    T+   +   ++PS I  E ++      V+  S  +  ++         + + S +DN G++T+     Y    +    S      + +K Y V K++    F F GQT  +     +  S++  LL+   A     S N L            Q+ N   S   P S   + +T  D       K     T S     +T NI    +Y NL+K T  KF  +
  S:    47 SSRATSNSGLKNL-STDTTQNAQISIPTSYYQQNSFKNLSNDNGPILLFDNARTFGATDWYGNPSWYITLNS----ADGKNDGYYSAAWFSTSTSSAIDFSKAGTKVVDWAYNHKTDNLYVL------TDKSFLIIVSSKTGTIVSTSEIG-NSVDKIQIVDFNSSVYL---------------WNSKNTMSVIYTVEPQTGKLNTSQINTTEFSGK-----------YLYGIIPLDVNYSIAVTSTTKQADTN-------STVSITLDFVDDNLKKI--SGAVSETTTLNSTKASDIYINGFQRNS-----DYVIFVQNKIYSVSLNKSLMSSSKFTDLLGSSNTNLGGFTLPSGGIINSAFLDANNQIYFKTSESRDVNSLS------VSNSFNKMEIPITLNTT-FANKEANAKNTQVFPVLNSSSNNQVVSRGFTGYILSYDSFIGT--------------------------GFLNGSVINYQFTTQSNSPSFNVSN-AGISAIPSGVNSTNIAKNNNSLSNVTLETSNAILIADDISGSLYVKVPYTMVGAWYGNG-----NNSVISRGYLVGKFNFQKIETATTW---ATNLPANIARLEPSQINPELLKRNGTSIVTIPSSVLALQNSNLNIN---FVIVSKNDNNGEITLKATITY----KNAYGSIVSYAMATDKTYKVKKAAANYDFAFAGQTTADKPKVNKHNSDIGTLLTEAAAAVKDGSDNFLTVDVGTLEGTLAQYANVLPSLWNPNSVNDYFITTKD-------KYPNNPTVSLFPDDETGNIVIVVQYNNLSKDTPSKFAIR 757
>gi|26554229|ref|NP_758163.1| hypothetical protein MYPE7730 [Mycoplasma penetrans HF-2] >gi|26454238|dbj|BAC44567.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1003 aa)
Score = 101, Expect = 1.1e-01, Identities = 93/345 (26%), Positives = 153/345 (44%)
  Q:    51 QATQTSPV-IPSEVNDQNA--NISTKNGPVTFLGN--KITALDWFGNKLWEKDFSTLVPGSQGVNGQSYNGAW--------------PRAWFNWDYNRNTDTIWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNISGLESVNISSAYRFVSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGNSSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSAYANYHVYFLLVDDQLNMVFNSSSSSGSQWAKPVKVADGLQGYRNSKITPQRDYYSLLDGRVVTVVYNTAIIIDG-------KSDNVQVGVYP-TSQSKWIKSWAFDSNQNLYFKFKNEDVIYKVSGSS 395
           +A+Q S V IP     QN+  N+S  NGP+    +     A DW+GN  W   + TL   +   +G  Y+ AW                   +W YN  TD ++VL      T TQ L  + +  G++ +T+ VN      ++ ++ +S+             +Y        GK    +P+T   S  NGN+S+          H SN   + + LIP+  N  I   VT  ++ +  D     ++  +    VDD LN +  S + + S  +  +         RNS      DY   +  ++ +V  N +++ +         S N  +G +  TS S  I S   D+N  +YFK  N + I  +S S+
  S:    18 EASQNSQVSIPQSYYQQNSFKNLSNDNGPILLFDDARSFGATDWYGNPAW---YITLNSATSKTDGY-YSAAWFSTSTSSAIDFAQAGTKVVDWAYNHKTDNLYVL------TDTQYLIIVSSKTGTVVSTNKVNNNVNK-IQIIDFNSS-------------VYLWNSKDKTGKFYSVEPQTGKLSNTNGNTST----------HLSNK--HLYGLIPLDVNYTIA--VTSTSEPSDTD-----SSISLSLDFVDDNLNKITGSPTENISLSSTKLSSIYINGFKRNS------DYVIFIKNKIYSVSLNKSLMSNSSFTNLLDNSKNPALGNFSLTSGSDDINSAFLDANGQIYFKATNSENINTLSVSN 340
>gi|163841552|ref|YP_001625957.1| hypothetical protein RSal33209_2819 [Renibacterium salmoninarum ATCC 33209] >gi|162955028|gb|ABY24543.1| conserved hypothetical protein [Renibacterium salmoninarum ATCC 33209] (425 aa)
Score = 100, Expect = 1.5e-01, Identities = 48/161 (29%), Positives = 73/161 (45%)
  Q:   115 NGAWPRAWFNWDYNRNTDT---IWVLGFWSDSTKTQPLFEIKAADGSITNTHTVNYKNIS--GLESVNISSAYRF-----VSALSSGKVMIYGGAGSSYNGKAILYDPKTKTASLLNGN-SSSTEILPMGDASHGSNYKWYFFNLIPVAANRNIVEVVTFANKETSNDEGSA 275
           +GA  +AWF        D    IWV      +++T  L  ++  DG +    T   + +   G +  + S+A R      V+AL  G V I      +YNG    YDP +KT S L  + +  ++++  GD             LI V ANR+ +  V    +    DEGSA
  S:   239 DGAADQAWFAQSSGLAVDANGDIWVA-----ASETSALRVLRVTDGRVNRVETAVGEGLFDFGFQDGDASAA-RLQHPLGVAALPDGSVAI----ADTYNGAVRRYDPASKTVSTLARDLAEPSDVVLDGDL------------LIVVEANRHQLSRVALPKEALQVDEGSA 388
>gi|50550941|ref|XP_502944.1| hypothetical protein [Yarrowia lipolytica] >gi|49648812|emb|CAG81136.1| unnamed protein product [Yarrowia lipolytica CLIB122] (666 aa)
Score = 99, Expect = 1.7e-01, Identities = 41/160 (25%), Positives = 72/160 (45%)
  Q:   803 FGFKDVTTIGTQNINTILPSAVTDGDIINNFISYTGFSSNDFSITKTVDDEKGTLTVAVNLDKKYAQAIGTGN----YGFTNYSATKTFSGFMTKDQYNQRFNVDFVSDSDNSLLQLKQMQVSKIYESFFGSKPTDLTVDGQKYTNLKDLIEKLLIKNKGTSIP 962
           FG   + TI    +  +LP  VT         + TG   +D  + +T+D    TL    +L +KY + +   N    + F+N ++   F      +Q+   +NV F S +D  L      +V K+YE F  ++  DLT   ++  N  D +  ++  +  +S P
  S:   225 FGLTHLGTIKALTLQGLLPGIVTGFKEGAFIAALTGIYVSDLELLETIDSLPDTLN---DLYQKYKERLAEENKHKDHSFSNSNSDYDFDYAFDFEQFANTYNVTFSSVTDKVLRSEYPPEV-KMYEEFIENQLGDLTF--EEAFNKSDRVLNIVAHSHDSSFP 382