>gi|26553478|ref|NP_757412.1| 50S ribosomal protein L1 [Mycoplasma penetrans HF-2] >gi|33301447|sp|Q8EX24|RL1_MYCPE 50S ribosomal protein L1 >gi|26453484|dbj|BAC43816.1| ribosomal protein L1 [Mycoplasma penetrans HF-2] (336 aa)
Score = 1275, Expect = 1.9e-138, Identities = 336/336 (100%), Positives = 336/336 (100%)
  Q:     1 MANQKKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAKGKVIADDSAKGENKKPAYLIQRVKYAQKKKPSKHPENPPVITEAKKKKVKKILKKAKPAKKAAVAKKPVVVNKKTATKKSPAKKGDVKKAKTSKK 336
           MANQKKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAKGKVIADDSAKGENKKPAYLIQRVKYAQKKKPSKHPENPPVITEAKKKKVKKILKKAKPAKKAAVAKKPVVVNKKTATKKSPAKKGDVKKAKTSKK
  S:     1 MANQKKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAKGKVIADDSAKGENKKPAYLIQRVKYAQKKKPSKHPENPPVITEAKKKKVKKILKKAKPAKKAAVAKKPVVVNKKTATKKSPAKKGDVKKAKTSKK 336
>gi|31544869|ref|NP_853447.1| 50S ribosomal protein L1 [Mycoplasma gallisepticum R] >gi|61215776|sp|Q8RLD8|RL1_MYCGA 50S ribosomal protein L1 >gi|19699029|gb|AAL91133.1| 50S ribosomal protein L1 [Mycoplasma gallisepticum] >gi|31541715|gb|AAP57015.1| RplA [Mycoplasma gallisepticum R] (226 aa)
Score = 538, Expect = 5.1e-53, Identities = 115/214 (53%), Positives = 157/214 (73%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +FD  + Y +++A+ +AK+T+  KF SSIDIAIKLNLDT+K+DQQLRG +SLP+   K  RIL +     Q +AK  G +  G+ + I EI  GW+DFD+IIT PK M EL KLGKILG +GLMPNPK G VT D+   I E++KG  +YRTD++GNIHM VGK + DT KIVEN N L+  I ++R ++VKG++I+ +++SSTMGPG++V +N
  S:    15 SFDPKQIYDLDKAIEIAKKTATTKFESSIDIAIKLNLDTTKADQQLRGAISLPHNVSKPIRILAITD--QQAEAKQAGADFVGEIDKINEIKAGWMDFDVIITNPKFMIELGKLGKILGPKGLMPNPKTGTVTQDIATAITEYRKGKKEYRTDTFGNIHMTVGKQSTDTNKIVENANALIDLIKSRRPSAVKGVYIQNISVSSTMGPGVKVKIN 226
>gi|167940697|ref|ZP_02527772.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 8] >gi|167958990|ref|ZP_02546062.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973286|ref|ZP_02555563.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974055|ref|ZP_02556332.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975547|ref|ZP_02557824.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988241|ref|ZP_02569912.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337960|ref|ZP_02694575.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 10] >gi|168362627|ref|ZP_02695806.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808171|ref|ZP_02829230.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 2] >gi|195867929|ref|ZP_03079927.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903406|gb|EDT49695.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208986|gb|EDU06029.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019078|gb|EDU57118.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998020|gb|EDU67117.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659746|gb|EDX53126.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660406|gb|EDX53665.1| ribosomal protein L1 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (229 aa)
Score = 500, Expect = 1.3e-48, Identities = 110/212 (51%), Positives = 154/212 (72%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D+ K Y + +A+ LA++ S  KF  SI+IA+KLNLDT+K +QQLRG++SLP   GK  R+LVL + +T++ A ++G ++ G ++ I  I K     D+IIT  KMMP L+KLGK+LG RGLMPNPK G VT D+ K + EFKKG  +YRTD+YGNIHM +G+ + +TAKI EN N LLS I +K+  +VKG +I+ + +S TMGPGI+V++N
  S:    16 DKQKAYPLFDAIKLAQEKSITKFDGSINIAVKLNLDTTKVEQQLRGSISLPNGNGKNVRVLVLSEDITKEQAAAVGADYFGGADYIQNIEKMLNQIDVIITNQKMMPLLAKLGKVLGPRGLMPNPKIGTVTNDVLKAVEEFKKGRIEYRTDTYGNIHMSIGRVSFETAKIEENANALLSLIRSKKPATVKGQYIQNIAISPTMGPGIKVIIN 227
>gi|13358104|ref|NP_078378.1| 50S ribosomal protein L1 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971325|ref|ZP_02553602.1| ribosomal protein L1 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168281853|ref|ZP_02689520.1| ribosomal protein L1 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308001|ref|ZP_02690676.1| ribosomal protein L1 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762329|ref|YP_001752625.1| ribosomal protein L1 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189041845|sp|B1AJI1|RL1_UREP2 50S ribosomal protein L1 >gi|33301591|sp|Q9PPV0|RL1_UREPA 50S ribosomal protein L1 >gi|11276663|pir||G82876 ribosomal protein L1 UU540 [imported] - Ureaplasma urealyticum >gi|6899545|gb|AAF30953.1|AE002153_1 ribosomal protein L1 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827906|gb|ACA33168.1| ribosomal protein L1 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902548|gb|EDT48837.1| ribosomal protein L1 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676047|gb|EDT87952.1| ribosomal protein L1 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700906|gb|EDU19188.1| ribosomal protein L1 [Ureaplasma parvum serovar 6 str. ATCC 27818] (229 aa)
Score = 497, Expect = 2.9e-48, Identities = 109/212 (51%), Positives = 154/212 (72%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D+ K Y + +A+ LA++ S  KF  SI+IAIKLNLDT+K +QQLRG++SLP   GK  R+LVL + +T+++A S+G ++ G ++ I  I K     D+IIT  KMMP L+KLGK+LG RGLMPNPK G VT D+ K + EFK+G  +YRTD+YGNIHM +G+ + +T KI EN N LL+ I +K+  +VKG +I+ + +S TMGPGI+V++N
  S:    16 DKQKAYPLFDAIKLAQEKSITKFDGSINIAIKLNLDTTKVEQQLRGSISLPNGNGKNVRVLVLSEDITKEEAASVGADYFGGADYIQNIEKMLNQIDVIITNQKMMPLLAKLGKVLGPRGLMPNPKIGTVTNDVLKAVEEFKRGRIEYRTDTYGNIHMSIGRVSFETTKIEENANALLNLIKSKKPATVKGQYIQNIAVSPTMGPGIKVVIN 227
>gi|72163056|ref|YP_290713.1| 50S ribosomal protein L1P [Thermobifida fusca YX] >gi|91207383|sp|Q47LI2|RL1_THEFY 50S ribosomal protein L1 >gi|71916788|gb|AAZ56690.1| LSU ribosomal protein L1P [Thermobifida fusca YX] (235 aa)
Score = 482, Expect = 1.5e-46, Identities = 97/232 (41%), Positives = 155/232 (66%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           +K+ +K +   DRT+ YT  EAV LAK+TS  KF +++++A++L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A++ G ++ GD +L+  I +G+LDFD ++ TP MM ++ +LG+ILG RGLMPNPK G VT D+ K +++ K G  ++R D +GN+H+++GK + D  K++EN    +  +   + ++ KG +I+K+ L++TMGPGI V  N T    K A
  S:     4 SKSYRKAAEQIDRTRLYTPAEAVRLAKETSTVKFDATVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFAAGERAEQARAAGADYVGDDDLVERIQQGFLDFDAVVATPDMMGKIGRLGRILGPRGLMPNPKTGTVTMDVAKAVSDIKGGKIEFRVDRHGNLHLIIGKVSFDEQKLLENYLAAVDEVLRLKPSAAKGRYIKKITLTTTMGPGIPVDPNATREAAKAA 235
>gi|187605173|ref|ZP_02991374.1| ribosomal protein L1 [Exiguobacterium sp. AT1b] >gi|187482742|gb|EDU20745.1| ribosomal protein L1 [Exiguobacterium sp. AT1b] (228 aa)
Score = 478, Expect = 4.4e-46, Identities = 100/209 (47%), Positives = 147/209 (70%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y + EAV L ++T+ AKF  +I++A++L +D  K+DQQ+RG V LP+  GK +++LV  KG   K+A++ G ++ GD+E I +I +GW DFD+I+ TP MM E+ KLG++LG +GLMPNPK G VT D+ K IA+ K G  +YR D  GNIH+ VGK + + +K+ ENI  +L  +   +  + KG +++ ++LSSTMGPGIRV
  S:    13 DRTKSYDLAEAVELVQKTATAKFDETIEVAVRLGVDPKKADQQIRGAVVLPHGTGKTQKVLVFAKGEKVKEAEAAGADYVGDAEYINKIQQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVEKAIADIKAGKVEYRVDKAGNIHVPVGKKSFEASKLSENIETILETLMKVKPATAKGTYLKNISLSSTMGPGIRV 221
>gi|160914583|ref|ZP_02076798.1| hypothetical protein EUBDOL_00591 [Eubacterium dolichum DSM 3991] >gi|158433741|gb|EDP12030.1| hypothetical protein EUBDOL_00591 [Eubacterium dolichum DSM 3991] (228 aa)
Score = 477, Expect = 5.7e-46, Identities = 98/213 (46%), Positives = 148/213 (69%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           DR+K Y ++EAV LAK+T+ AKF +S++++ KLN+D   +DQQ+RG + LP   GK +++ V+ +G  +++AK  G +  G  EL+ +I+KGW DFD+I+ TP MM EL KLG++LG +GLMPNPK G VT D+ K + + KKG  +YR D  GNI++++GK + +  K+ EN   + + IA  R  +VKG +I+ + +S+TMGPGI V V K
  S:    16 DRSKLYPVDEAVKLAKETNTAKFDASVEVSFKLNVDPRHADQQIRGAIVLPNGTGKTQKVCVIAQGPKEQEAKDAGADFVGGKELLDQIAKGWFDFDVIVATPNMMGELGKLGRVLGPKGLMPNPKTGTVTMDVAKAVEDIKKGKVEYRVDKEGNINVMIGKVSFEEEKLAENFRTIYNAIAKARPAAVKGTYIKNLVISTTMGPGIHVAVEK 228
>gi|15673982|ref|NP_268157.1| 50S ribosomal protein L1 [Lactococcus lactis subsp. lactis Il1403] >gi|33301467|sp|Q9CE47|RL1_LACLA 50S ribosomal protein L1 >gi|12725046|gb|AAK06098.1|AE006430_3 50S ribosomal protein L1 [Lactococcus lactis subsp. lactis Il1403] (229 aa)
Score = 473, Expect = 1.5e-45, Identities = 101/209 (48%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+TS AKF +++++A  LN+D  KSDQQ+RG + LP   GK  R+LV  KG   ++A + G +  G  EL+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+H+ +GK + DT K+VEN   L S IAA +  + KG +I  +++++TMGPG++V
  S:    16 DATKLYSVEEAVALAKETSFAKFDATVEVAYNLNIDVKKSDQQIRGAMVLPNGTGKTARVLVFAKGAKAEEATAAGADFVGSDELVAKINGGWLDFDVVIATPDMMAVVGRLGRVLGPRNLMPNPKTGTVTMDVTKAVEESKAGKVNYRADKAGNVHVPIGKVSFDTEKLVENFKALNSVIAAAKPAASKGAYITNLSVTTTMGPGVKV 224
>gi|172056128|ref|YP_001812588.1| ribosomal protein L1 [Exiguobacterium sibiricum 255-15] >gi|171988649|gb|ACB59571.1| ribosomal protein L1 [Exiguobacterium sibiricum 255-15] (228 aa)
Score = 473, Expect = 1.6e-45, Identities = 101/219 (46%), Positives = 152/219 (69%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+ +   DRT  Y + EAV+L K+++ AKF  +I++A++L +D  K+DQQ+RG V LP+  GK +++LV  KG   K+A++ G + AGDSE I +I +GW DFD+I+ TP MM E+ KLG++LG +GLMPNPK G VT D+ K I + K G  +YR D  GNIH+ VGK + D AK+VENIN ++  +   +  + KG++++ + ++STMGPG++V
  S:     3 KKYKEAAKLIDRTVSYELAEAVDLTKKSATAKFDETIELAVRLGVDPKKADQQIRGAVVLPHGTGKTQKVLVFAKGEKLKEAEAAGADFAGDSEYITKIQQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAINDIKAGKVEYRVDKSGNIHVPVGKKSFDDAKLVENINTVIETLVKVKPATAKGVYLKNIAIASTMGPGVKV 221
>gi|13507959|ref|NP_109908.1| 50S ribosomal protein L1 [Mycoplasma pneumoniae M129] >gi|2500219|sp|P78035|RL1_MYCPN 50S ribosomal protein L1 >gi|1674313|gb|AAB96259.1| ribosomal protein L1 [Mycoplasma pneumoniae M129] (226 aa)
Score = 473, Expect = 1.7e-45, Identities = 102/209 (48%), Positives = 145/209 (69%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+TK Y ++EAV+L K+TS  KF  S+DIA+ LNLDT+K++QQLRG ++ P+  GK  RIL +     +K A   G +  G  + I +I  GWLDFDLIIT+PK M  L KLGK+LGT+GLMPNPK   VT D+P  +  +KKG  +YR DS+GNIHM +G+ ++ +  +VEN   LL  I +++  +VKGI+I+ + L++TMGP ++V
  S:    16 DKTKLYPLQEAVDLVKKTSITKFNGSVDIAVSLNLDTTKAEQQLRGAIAFPHSVGKPIRILAITD--DEKAALEAGADFVGGIDKINDIKNGWLDFDLIITSPKFMAALGKLGKLLGTKGLMPNPKTETVTDDVPAAVRAYKKGKKEYRADSFGNIHMSLGRVDSASNHLVENALALLDLIKSRKPATVKGIYIKNIALTTTMGPSLKV 222
>gi|116512945|ref|YP_811852.1| 50S ribosomal protein L1 [Lactococcus lactis subsp. cremoris SK11] >gi|125625041|ref|YP_001033524.1| 50S ribosomal protein L1 [Lactococcus lactis subsp. cremoris MG1363] >gi|123025149|sp|Q02WD3|RL1_LACLS 50S ribosomal protein L1 >gi|160166190|sp|A2RNF3|RL1_LACLM 50S ribosomal protein L1 >gi|116108599|gb|ABJ73739.1| LSU ribosomal protein L1P [Lactococcus lactis subsp. cremoris SK11] >gi|124493849|emb|CAL98842.1| 50S ribosomal protein L1 [Lactococcus lactis subsp. cremoris MG1363] (229 aa)
Score = 469, Expect = 5.3e-45, Identities = 100/209 (47%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+TS AKF +++++A  LN+D  KSDQQ+RG + LP   GK  R+LV  KG   ++A + G +  G  EL+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+H+ +GK + DT K+VEN   L + IAA +  + KG +I  +++++TMGPG++V
  S:    16 DATKAYSVEEAVALAKETSFAKFDATVEVAYNLNIDVKKSDQQIRGAMVLPNGTGKTARVLVFAKGAKAEEATAAGADFVGSDELVAKINGGWLDFDVVIATPDMMAVVGRLGRVLGPRNLMPNPKTGTVTMDVTKAVGESKAGKVNYRADKAGNVHVPIGKVSFDTEKLVENFKALNTVIAAAKPAASKGAYITNLSVTTTMGPGVKV 224
>gi|169839872|ref|ZP_02873060.1| 50S ribosomal protein L1 [candidate division TM7 single-cell isolate TM7a] (237 aa)
Score = 466, Expect = 1.2e-44, Identities = 101/213 (47%), Positives = 141/213 (66%)
  Q:    16 SVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           S   D+ K YT EEA++L  +T +AKF+ ++++AI+L +D   +DQQ+RGTVSLP   GK  RIL +  G     A + G + AGD E I +I  GWLDFDL+I TP MMP+L +LG+ILGT+GLMPNPK+G VTT++ +T+ EFKKG   ++ D  G+IH+ +GK +     IVEN    L  I   +  + KG ++  V +S TMGPGI+V
  S:    12 SQKVDKMKVYTPEEALDLVFETKSAKFVETVELAIRLGVDPRHADQQVRGTVSLPNGTGKTVRILAITSGENIDKALAAGADFAGDDEYINKIQGGWLDFDLVIATPDMMPKLGRLGRILGTKGLMPNPKSGTVTTNIEQTVQEFKKGKVAFKVDKLGSIHLPIGKVDFTKEAIVENFKVALDQIIKLKPATSKGQYLRTVAISLTMGPGIKV 224
>gi|12044934|ref|NP_072744.1| 50S ribosomal protein L1 [Mycoplasma genitalium G37] >gi|1350682|sp|P47328|RL1_MYCGE 50S ribosomal protein L1 >gi|3844669|gb|AAC71300.1| ribosomal protein L1 [Mycoplasma genitalium G37] >gi|166079064|gb|ABY79682.1| ribosomal protein L1 [synthetic Mycoplasma genitalium JCVI-1.0] (226 aa)
Score = 462, Expect = 3.6e-44, Identities = 103/209 (49%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ K Y I+EA  L K+T+  KF+SS+DIA+ LNLDT+K++QQLRG ++ P+  GK  RIL +     +K A   G +  G  + I  I  GWLDFDLIIT+PK M  L KLGK+LGTRGLMPNPK   VT D+   I  +KKG  +YRTDS+GNIH+ +GK +  T  +V N   L+  I +KR ++VKG +I+ + L++TMGP ++V
  S:    16 DKNKLYPIQEAFELIKKTAITKFVSSVDIAVSLNLDTTKAEQQLRGAIAFPFSIGKSIRILAITD--DEKKASEAGADFVGGLDKIEAIKNGWLDFDLIITSPKFMGALGKLGKLLGTRGLMPNPKTETVTDDVVSAIKAYKKGKKEYRTDSFGNIHLSLGKTDTKTEHLVANAMALIDLIKSKRPSTVKGTYIKNIALTTTMGPSLKV 222
>gi|27467219|ref|NP_763856.1| 50S ribosomal protein L1 [Staphylococcus epidermidis ATCC 12228] >gi|57866130|ref|YP_187775.1| 50S ribosomal protein L1 [Staphylococcus epidermidis RP62A] >gi|33301560|sp|Q8CTT4|RL1_STAES 50S ribosomal protein L1 >gi|81675388|sp|Q5HRL4|RL1_STAEQ 50S ribosomal protein L1 >gi|27314761|gb|AAO03898.1|AE016744_301 50S ribosomal protein L1 [Staphylococcus epidermidis ATCC 12228] >gi|57636788|gb|AAW53576.1| ribosomal protein L1 [Staphylococcus epidermidis RP62A] (231 aa)
Score = 461, Expect = 4.4e-44, Identities = 92/219 (42%), Positives = 147/219 (67%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++ +   DRT++Y++EEA+ LAK+TS A F +S+++A +L +DT K+DQQ+RG V LP+  GK +R+LV  KG    +A+  G ++ G+++ + +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR +  G +H  +GK + D  K+V+N   L   +A  +  S KG + + V +++TMGPG++V
  S:     6 KKYQEAASKVDRTQYYSVEEAIKLAKETSVANFDASVEVAFRLGIDTRKNDQQIRGAVVLPHGTGKSQRVLVFAKGDKITEAEEAGADYVGEADYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFDEEKLVDNFRTLQDVLAKAKPASAKGTYFKSVAVTTTMGPGVKV 224
>gi|162139696|ref|YP_456660.2| 50S ribosomal protein L1 [Aster yellows witches'-broom phytoplasma AYWB] >gi|160166867|sp|Q2NJ12|RL1_AYWBP 50S ribosomal protein L1 (230 aa)
Score = 457, Expect = 1.2e-43, Identities = 98/210 (46%), Positives = 143/210 (68%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FD  K Y ++EA++LAKQT  AKF ++++ A  LNLD  K DQ LRG + LP+  GK  ++ VL KG   K A+    ++ GD +LI +I+K W DFD+++ TP+MMP+LSKLG++LG +GLMPNPK G VT D+ + + E K G  +YR D  GNIH ++GK + D AK++EN+  L   + A +  +VKG +I+ V +S+TM PGI++
  S:    14 FDVKKTYPLQEAISLAKQTQVAKFDATVECAFHLNLDLKKVDQNLRGALVLPHGTGKVLKVAVLAKGEQAKQAQEAQADYVGDQDLIDKIAKNWFDFDVLVATPEMMPQLSKLGRLLGPKGLMPNPKTGTVTNDVLQAVKEIKNGKIEYRLDKSGNIHTILGKVSFDEAKLLENLKTLYLQLMAVKPRTVKGTYIKSVTISTTMAPGIKI 223
>gi|148322486|gb|EDK87736.1| ribosomal protein L1 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (235 aa)
Score = 456, Expect = 1.5e-43, Identities = 93/206 (45%), Positives = 137/206 (66%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y I EA+ L ++T  AKF+ ++++A++L +D   +DQQ+RGTV LP+  GK  +IL +  G   + A + G ++AG  E I +I +GWLDFDL+I TP MMP++ +LGKILGT+GLMPNPK+G VT D+   ++EFKKG   +R D  G+IH  +GK + D  KIVEN    +  I   +  S KG ++  + +S TMGPG+++
  S:    20 KLYDIREALELVQKTKTAKFVETVEVALRLGVDPRHADQQIRGTVVLPHGTGKTVKILAITSGENIEKALAAGADYAGAEEYINQIQQGWLDFDLVIATPDMMPKIGRLGKILGTKGLMPNPKSGTVTPDIAAAVSEFKKGKLAFRVDKLGSIHAPIGKVDFDLDKIVENFKAFMDQIIRLKPASSKGQYLRTIAVSLTMGPGVKM 225
>gi|84789849|gb|ABC65581.1| LSU ribosomal protein L1P [Aster yellows witches'-broom phytoplasma AYWB] (236 aa)
Score = 456, Expect = 1.6e-43, Identities = 98/210 (46%), Positives = 143/210 (68%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FD  K Y ++EA++LAKQT  AKF ++++ A  LNLD  K DQ LRG + LP+  GK  ++ VL KG   K A+    ++ GD +LI +I+K W DFD+++ TP+MMP+LSKLG++LG +GLMPNPK G VT D+ + + E K G  +YR D  GNIH ++GK + D AK++EN+  L   + A +  +VKG +I+ V +S+TM PGI++
  S:    20 FDVKKTYPLQEAISLAKQTQVAKFDATVECAFHLNLDLKKVDQNLRGALVLPHGTGKVLKVAVLAKGEQAKQAQEAQADYVGDQDLIDKIAKNWFDFDVLVATPEMMPQLSKLGRLLGPKGLMPNPKTGTVTNDVLQAVKEIKNGKIEYRLDKSGNIHTILGKVSFDEAKLLENLKTLYLQLMAVKPRTVKGTYIKSVTISTTMAPGIKI 229
>gi|39721852|dbj|BAD04342.1| ribosomal protein L1 [Onion yellows phytoplasma OY-M] (241 aa)
Score = 455, Expect = 2.2e-43, Identities = 97/210 (46%), Positives = 142/210 (67%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FD  K Y ++EA++LAKQT  AKF ++++ A  LNLD  K DQ LRG + LP+  GK  ++ VL KG   K A+    ++ GD +LI +I+K W DFD+++ TP+MMP+LSKLG++LG +GLMPNPK G VT D+ + + E K G  +YR D  GNIH ++GK + D  K++EN+  L   + A +  +VKG +I+ V +S+TM PGI++
  S:    25 FDVKKTYPLQEAISLAKQTQVAKFDAAVECAFHLNLDPKKVDQNLRGALVLPHGTGKVLKVAVLAKGEQAKQAQEAQADYVGDQDLIDKIAKNWFDFDVLVATPEMMPQLSKLGRLLGPKGLMPNPKTGTVTNDVLQAVKEIKNGKIEYRLDKSGNIHAILGKVSFDETKLLENLKTLYLQLMAVKPRTVKGTYIKSVTISTTMAPGIKI 234
>gi|70727470|ref|YP_254386.1| 50S ribosomal protein L1 [Staphylococcus haemolyticus JCSC1435] >gi|82581576|sp|Q4L3J7|RL1_STAHJ 50S ribosomal protein L1 >gi|68448196|dbj|BAE05780.1| 50S ribosomal protein L1 [Staphylococcus haemolyticus JCSC1435] (231 aa)
Score = 454, Expect = 2.9e-43, Identities = 93/209 (44%), Positives = 142/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y++EEA++LAK+TS A F +S+++A +L +DT K+DQQ+RG V LP   GK +R+LV  KG    +A+  G ++ G+SE + +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR +  G +H  +GK +    K+VEN   L   +A  + +S KG + + V +++TMGPG+++
  S:    16 DRTKHYSVEEAISLAKETSIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQRVLVFAKGDKITEAEEAGADYVGESEYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFSDEKLVENFKTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKI 224
>gi|34762880|ref|ZP_00143863.1| LSU ribosomal protein L1P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887444|gb|EAA24531.1| LSU ribosomal protein L1P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (235 aa)
Score = 453, Expect = 3.6e-43, Identities = 93/206 (45%), Positives = 136/206 (66%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y I EA+ L ++T  AKF+ ++++A++L +D   +DQQ+RGTV LP+  GK  +IL +  G   + A + G ++AG  E I +I +GWLDFDL+I TP MMP++ +LGKILGT+GLMPNPK+G VT D+   ++EFKKG   +R D  G+IH  +GK + D  KI EN    +  I   +  S KG ++  V +S TMGPG+++
  S:    20 KLYDIREALELVQKTKTAKFVETVEVALRLGVDPRHADQQIRGTVVLPHGTGKSVKILAITSGENIEKALAAGADYAGAEEYINQIQQGWLDFDLVIATPDMMPKIGRLGKILGTKGLMPNPKSGTVTPDIAAAVSEFKKGKLAFRVDKLGSIHAPIGKVDFDLDKIEENFKAFMDQIIRLKPASSKGQYLRTVAVSLTMGPGVKM 225
>gi|161611248|ref|NP_950509.2| 50S ribosomal protein L1 [Onion yellows phytoplasma OY-M] >gi|61215599|sp|Q6YQW6|RL1_ONYPE 50S ribosomal protein L1 (230 aa)
Score = 452, Expect = 4.2e-43, Identities = 97/210 (46%), Positives = 142/210 (67%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FD  K Y ++EA++LAKQT  AKF ++++ A  LNLD  K DQ LRG + LP+  GK  ++ VL KG   K A+    ++ GD +LI +I+K W DFD+++ TP+MMP+LSKLG++LG +GLMPNPK G VT D+ + + E K G  +YR D  GNIH ++GK + D  K++EN+  L   + A +  +VKG +I+ V +S+TM PGI++
  S:    14 FDVKKTYPLQEAISLAKQTQVAKFDAAVECAFHLNLDPKKVDQNLRGALVLPHGTGKVLKVAVLAKGEQAKQAQEAQADYVGDQDLIDKIAKNWFDFDVLVATPEMMPQLSKLGRLLGPKGLMPNPKTGTVTNDVLQAVKEIKNGKIEYRLDKSGNIHAILGKVSFDETKLLENLKTLYLQLMAVKPRTVKGTYIKSVTISTTMAPGIKI 223
>gi|19705330|ref|NP_602825.1| 50S ribosomal protein L1 [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|33301454|sp|Q8RHI3|RL1_FUSNN 50S ribosomal protein L1 >gi|19713307|gb|AAL94124.1| LSU ribosomal protein L1P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (235 aa)
Score = 452, Expect = 5.2e-43, Identities = 93/206 (45%), Positives = 135/206 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y I EA+ L ++T  AKF  ++++A++L +D   +DQQ+RGTV LP+  GK  +IL +  G   + A + G ++AG  E I +I +GWLDFDL+I TP MMP++ +LGKILGT+GLMPNPK+G VT D+   ++EFKKG   +R D  G+IH  +GK + D  KI EN    +  I   +  S KG ++  V +S TMGPG+++
  S:    20 KLYDIREALELVQKTKTAKFTETVEVALRLGVDPRHADQQIRGTVVLPHGTGKTVKILAITSGENIEKALAAGADYAGAEEYINQIQQGWLDFDLVIATPDMMPKIGRLGKILGTKGLMPNPKSGTVTPDIAAAVSEFKKGKLAFRVDKLGSIHAPIGKVDFDLDKIEENFKAFMDQIIRLKPASSKGQYLRTVAVSLTMGPGVKM 225
>gi|169830050|ref|YP_001700208.1| 50S ribosomal protein L1 [Lysinibacillus sphaericus C3-41] >gi|168994538|gb|ACA42078.1| 50S ribosomal protein L1 [Lysinibacillus sphaericus C3-41] (232 aa)
Score = 450, Expect = 7.2e-43, Identities = 91/209 (43%), Positives = 139/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   Y+ +EA+ LA++TS   F +++++A +L +DT K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GD+E I +I +GW DFD+I+ TP MM E+ KLG++LG +GLMPNPK G VT D+ K I E K G  +YR D  G IH  +GK +   AK+VEN   +   +   +  + KG +++ VN+++TMGP +++
  S:    16 DRNSLYSAQEAIELAQKTSTVNFDATVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKLKEAEAAGADYVGDAEYIQKIQQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAIEEIKAGKVEYRADKAGIIHAPIGKVSFSAAKLVENFLAVFDVVQKAKPAAAKGTYMKSVNITTTMGPAVKI 224
>gi|49482768|ref|YP_039992.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus MRSA252] >gi|61215548|sp|Q6GJD0|RL1_STAAR 50S ribosomal protein L1 >gi|49240897|emb|CAG39564.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus MRSA252] (229 aa)
Score = 450, Expect = 8.5e-43, Identities = 90/219 (41%), Positives = 146/219 (66%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++ +   DRT+ Y++EEA+ LAK+TS A F +S+++A +L +DT K+DQQ+RG V LP   GK + +LV  KG    +A++ G ++ G++E + +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR +  G +H  +GK +    +++EN N L   +A  + +S KG + + V +++TMGPG+++
  S:     6 KKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKI 224
>gi|15923528|ref|NP_371062.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus Mu50] >gi|21282222|ref|NP_645310.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus MW2] >gi|49485403|ref|YP_042624.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651414|ref|YP_185470.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus COL] >gi|82750246|ref|YP_415987.1| 50S ribosomal protein L1 [Staphylococcus aureus RF122] >gi|87162295|ref|YP_493226.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus USA300] >gi|88194300|ref|YP_499092.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148266998|ref|YP_001245941.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus JH9] >gi|150393045|ref|YP_001315720.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus JH1] >gi|151220712|ref|YP_001331534.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978867|ref|YP_001441126.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus Mu3] >gi|161508778|ref|YP_001574437.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728921|ref|ZP_02761198.1| ribosomal protein L1 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122540134|sp|Q2G0P0|RL1_STAA8 50S ribosomal protein L1 >gi|123487077|sp|Q2FJA2|RL1_STAA3 50S ribosomal protein L1 >gi|166219591|sp|A7WYW1|RL1_STAA1 50S ribosomal protein L1 >gi|172048775|sp|A6QEJ0|RL1_STAAE 50S ribosomal protein L1 >gi|189041841|sp|A6TZ15|RL1_STAA2 50S ribosomal protein L1 >gi|189041842|sp|A5IQ92|RL1_STAA9 50S ribosomal protein L1 >gi|189041843|sp|A8YZN6|RL1_STAAT 50S ribosomal protein L1 >gi|54039108|sp|P66092|RL1_STAAW 50S ribosomal protein L1 >gi|54041602|sp|P66091|RL1_STAAM 50S ribosomal protein L1 >gi|61215544|sp|Q6GBU9|RL1_STAAS 50S ribosomal protein L1 >gi|81695155|sp|Q5HID7|RL1_STAAC 50S ribosomal protein L1 >gi|91207380|sp|Q2YSC3|RL1_STAAB 50S ribosomal protein L1 >gi|14246306|dbj|BAB56700.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus Mu50] >gi|21203658|dbj|BAB94358.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus MW2] >gi|49243846|emb|CAG42271.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285600|gb|AAW37694.1| ribosomal protein L1 [Staphylococcus aureus subsp. aureus COL] >gi|82655777|emb|CAI80177.1| 50S ribosomal protein L1 [Staphylococcus aureus RF122] >gi|87128269|gb|ABD22783.1| ribosomal protein L1 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201858|gb|ABD29668.1| ribosomal protein L1 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740067|gb|ABQ48365.1| LSU ribosomal protein L1P [Staphylococcus aureus subsp. aureus JH9] >gi|149945497|gb|ABR51433.1| ribosomal protein L1 [Staphylococcus aureus subsp. aureus JH1] >gi|150373512|dbj|BAF66772.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721002|dbj|BAF77419.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus Mu3] >gi|160367587|gb|ABX28558.1| ribosomal protein L1 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (230 aa)
Score = 448, Expect = 1.2e-42, Identities = 90/219 (41%), Positives = 146/219 (66%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++ +   DRT+ Y++EEA+ LAK+TS A F +S+++A +L +DT K+DQQ+RG V LP   GK + +LV  KG    +A++ G ++ G++E + +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR +  G +H  +GK +    +++EN N L   +A  + +S KG + + V +++TMGPG+++
  S:     6 KKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKI 224
>gi|15926216|ref|NP_373749.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus N315] >gi|33301584|sp|Q99W68|RL1_STAAN 50S ribosomal protein L1 >gi|13700429|dbj|BAB41727.1| 50S ribosomal protein L1 [Staphylococcus aureus subsp. aureus N315] (230 aa)
Score = 448, Expect = 1.4e-42, Identities = 90/219 (41%), Positives = 146/219 (66%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++ +   DRT+ Y++EEA+ LAK+TS A F +S+++A +L +DT K+DQQ+RG V LP   GK + +LV  KG    +A++ G ++ G++E + +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR +  G +H  +GK +    +++EN N L   +A  + +S KG + + V +++TMGPG+++
  S:     6 KKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGTDYVGEAEYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKI 224
>gi|150020538|ref|YP_001305892.1| 50S ribosomal protein L1 [Thermosipho melanesiensis BI429] >gi|166219592|sp|A6LKQ6|RL1_THEM4 50S ribosomal protein L1 >gi|149793059|gb|ABR30507.1| ribosomal protein L1 [Thermosipho melanesiensis BI429] (232 aa)
Score = 446, Expect = 2.0e-42, Identities = 106/209 (50%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y + EAV+LAK+ + AKF  ++++ IK N+D  KSDQQ+R T+SLP+  GKE R+LV  KG   ++AK  G ++ G  +L  +I K G+LDFD+ I TP MM  + +LGKILG RGLMPNPK G VT D+   + +FKKG  + RTD  GN+H+ VGKA+ +  K+ ENI      +   + T VKG FI+KV LS+TMGPGI+V
  S:    16 DRTKEYDLNEAVDLAKKVATAKFDETVELHIKTNIDYRKSDQQIRSTISLPHGTGKEVRVLVFAKGEKAEEAKKAGADYVGAEDLAEKIQKEGFLDFDVAIATPDMMKIIGRLGKILGPRGLMPNPKAGTVTNDVAAAVKDFKKGRMEIRTDKTGNLHIPVGKASFEKEKLTENIKSAYEQVLNLKPTGVKGTFIKKVVLSTTMGPGIKV 225
>gi|28377496|ref|NP_784388.1| 50S ribosomal protein L1 [Lactobacillus plantarum WCFS1] >gi|33301440|sp|Q88YW9|RL1_LACPL 50S ribosomal protein L1 >gi|28270328|emb|CAD63229.1| ribosomal protein L1 [Lactobacillus plantarum WCFS1] (229 aa)
Score = 444, Expect = 4.0e-42, Identities = 94/209 (44%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y + EAV+L K+   AKF +++++A KLN+DT ++DQQLRG V LP   GK++ ++V  KG   K+A+  G +  G+++L+ +I  GWLDFD+ I TP MM ++ +LG++LG +GLMPNPK G VT D+ K + + K G   YRTD  GN+H+ VGK + DT K+V N   +   I   R  SV+G FI+ + ++ST  P +RV
  S:    16 DRDKAYDVTEAVDLVKKMDFAKFDATVEVAFKLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFAKGDKAKEAEEAGADFVGETDLVQKIQDGWLDFDVAIATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTMDVAKAVNDSKAGKVTYRTDRDGNVHVPVGKVSFDTDKLVGNFKTIEDTIVKARPASVRGTFIQNLVVTSTFTPAVRV 224
>gi|145596447|ref|YP_001160744.1| ribosomal protein L1 [Salinispora tropica CNB-440] >gi|189041835|sp|A4XBQ9|RL1_SALTO 50S ribosomal protein L1 >gi|145305784|gb|ABP56366.1| LSU ribosomal protein L1P [Salinispora tropica CNB-440] (238 aa)
Score = 443, Expect = 4.7e-42, Identities = 89/220 (40%), Positives = 145/220 (65%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  +K +   DR+K YT  EAV LAK+T++ KF +++++A++L +D  K+DQ +RGTV+LP+  GK  R++V   G   ++A + G +  G  EL+A I  GWLDFD  I TP  M ++ ++ +ILG RGLMPNPK G VT ++ K +A+ K G   +R D + N+H+++GKA+   +++V+N   +L  I   + ++ KG ++ KV L++TMGPG+ +
  S:     4 SKNYRKAAAAIDRSKLYTPAEAVKLAKETTSVKFDATVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAAGAKAEEAVAAGADEVGTDELVARIQGGWLDFDAAIATPDQMAKIGRIARILGPRGLMPNPKTGTVTMNVTKAVADIKGGKIAFRVDKHSNLHLIIGKASFSESQLVDNYAAVLDEILRAKPSAAKGKYLRKVTLTTTMGPGVPI 223
>gi|148269605|ref|YP_001244065.1| 50S ribosomal protein L1 [Thermotoga petrophila RKU-1] >gi|166219593|sp|A5IJW6|RL1_THEP1 50S ribosomal protein L1 >gi|147735149|gb|ABQ46489.1| LSU ribosomal protein L1P [Thermotoga petrophila RKU-1] (233 aa)
Score = 442, Expect = 6.3e-42, Identities = 101/209 (48%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK+Y ++EA+ L K+T+ AKF  +I++ I+  +D  K +Q +RGTV LP+  GKE R+LV  KG   K+A   G ++ G  +L+ +I K G+LDFD+ I TP MM  + +LGKILG RGLMP+PK+G VT ++ + + EFKKG  + RTD  GNIH+ VGK + D  K+ ENI   +  I   +   VKG FI+K  LSSTMGPGI++
  S:    16 DRTKYYDLDEAIELVKKTATAKFDETIELHIQTGIDYRKPEQHIRGTVVLPHGTGKEVRVLVFAKGEAAKEALEAGADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRVIGRLGKILGPRGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIISAVRQIMQMKPAGVKGQFIKKAVLSSTMGPGIKL 225
>gi|24380006|ref|NP_721961.1| 50S ribosomal protein L1 [Streptococcus mutans UA159] >gi|33301565|sp|Q8DSY0|RL1_STRMU 50S ribosomal protein L1 >gi|24377994|gb|AAN59267.1|AE014993_11 50S ribosomal protein L1 [Streptococcus mutans UA159] (229 aa)
Score = 442, Expect = 6.7e-42, Identities = 94/212 (44%), Positives = 138/212 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D TK Y++EEAV LAK+T+ AKF +++++A  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK  G +  G+ +L+ +I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D  K+VEN       IA  +  + KG +I  + L++T GPGI+V  N
  S:    16 DSTKAYSVEEAVALAKETNFAKFDATVEVAYNLNIDVKKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKEAGADFVGEDDLVQKINGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQTIIGKVSFDADKLVENFKAFNDVIAKAKPATAKGTYITNLVLTTTQGPGIKVDAN 227
>gi|50843341|ref|YP_056568.1| 50S ribosomal protein L1 [Propionibacterium acnes KPA171202] >gi|61215505|sp|Q6A6K3|RL1_PROAC 50S ribosomal protein L1 >gi|50840943|gb|AAT83610.1| 50S ribosomal protein L1 [Propionibacterium acnes KPA171202] (232 aa)
Score = 442, Expect = 7.6e-42, Identities = 89/212 (41%), Positives = 139/212 (65%)
  Q:    17 VNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           VN D  + Y+ EEA+ L    ++AKF  ++D+AI+L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A+  G +  GD +LIA++  G+LDFD ++ TP MM ++ +LG++LG RGLMPNPK G VT D+ K +++ K G  ++RTD Y N+H ++GK +  + K+ EN    L  I   +  + KG ++ K+ +SSTMGPG+++
  S:    14 VNLD--QLYSPEEALALVASGASAKFDETVDVAIRLGVDPKKADQMVRGTVNLPHGTGKTTRVLVFATGEKAEAAREAGADEVGDDDLIAKVQGGYLDFDSVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTMDVAKAVSDIKGGKIEFRTDRYANLHFLIGKVSFGSEKLAENYFAALDEILRLKPNAAKGRYLRKITVSSTMGPGVQI 223
>gi|159039847|ref|YP_001539100.1| ribosomal protein L1 [Salinispora arenicola CNS-205] >gi|189041832|sp|A8M542|RL1_SALAI 50S ribosomal protein L1 >gi|157918682|gb|ABW00110.1| ribosomal protein L1 [Salinispora arenicola CNS-205] (238 aa)
Score = 441, Expect = 8.1e-42, Identities = 93/234 (39%), Positives = 153/234 (65%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAKG 242
           +K+ +K +   DR+K YT  EAV LAK+T++ KF +++++A++L +D  K+DQ +RGTV+LP+  GK  R++V   G   ++A + G +  G  EL+A I  GWL+FD  I TP  M ++ ++ +ILG RGLMPNPK G VT ++ K +++ K G   +R D + N+H+++GKA+   A++V+N   +L  +   + ++ KG +++KV L++TMGPG+ V  N   VVK   +G
  S:     4 SKSYRKAAAAIDRSKLYTPAEAVKLAKETTSVKFDATVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAAGAKAEEAVAAGADEVGTDELVARIQGGWLEFDAAIATPDQMAKIGRIARILGPRGLMPNPKTGTVTMNVAKAVSDIKGGKIAFRVDKHSNLHLIIGKASFSEAQLVDNYAAVLDEVLRAKPSAAKGKYLKKVTLTTTMGPGVPVDPN---VVKNLQEG 234
>gi|33301555|sp|Q84IF4|RL1_SELRU 50S ribosomal protein L1 >gi|28394173|dbj|BAC57016.1| 50S ribosomal protein L1 [Selenomonas ruminantium] (226 aa)
Score = 441, Expect = 9.1e-42, Identities = 91/206 (44%), Positives = 134/206 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           KFYT  EA+ L K+T+  KF  +I++ ++L +D   +DQQ+RG + LP+  GK KR+LV  KG   K+A++ G +  G  E++ +I  GWLDFD+ + TP MM  + +LGK+LG RGLMPNPK G VT DL K ++E K G  +YRTD  GN+H  +GKA+ D  K+ +N   L+  +   +  + KG ++  + +S+TMGPGI V
  S:    19 KFYTAAEAMELVKKTATKKFDETIELHVRLGVDPKYADQQVRGAMVLPHGTGKSKRVLVFAKGEKVKEAEAAGADFVGSDEIVQKIQGGWLDFDVAVATPDMMGTVGRLGKVLGPRGLMPNPKLGTVTMDLTKAVSEIKAGKVEYRTDKAGNVHCPIGKASFDAEKLQQNFQALIDTLNRVKPAAAKGQYMRSITVSATMGPGIPV 224
>gi|56418629|ref|YP_145947.1| 50S ribosomal protein L1 [Geobacillus kaustophilus HTA426] >gi|61214574|sp|Q5L420|RL1_GEOKA 50S ribosomal protein L1 >gi|56378471|dbj|BAD74379.1| 50S ribosomal protein L1 [Geobacillus kaustophilus HTA426] (233 aa)
Score = 441, Expect = 9.9e-42, Identities = 98/218 (44%), Positives = 145/218 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           DR+K Y I EA+ L K+T+ AKF +++++A +L +D  K+DQQ+RG V LP+  GK  R+LV  KG   K+A++ G ++ GD+E I +I +GW DFD+++ TP MM E+ KLG+ILG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + D  K+ EN   +   I   +  + KG +++ V ++STMGPGI+V  +  AV +
  S:    16 DRSKAYPIAEAIELVKKTNIAKFDATVEVAFRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDAEYINKIQQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEYRVDKAGNIHVPIGKVSFDNEKLAENFAAVYEAILKAKPAAAKGTYVKNVTITSTMGPGIKVDPSTVAVAQ 233
>gi|121534748|ref|ZP_01666569.1| ribosomal protein L1 [Thermosinus carboxydivorans Nor1] >gi|121306768|gb|EAX47689.1| ribosomal protein L1 [Thermosinus carboxydivorans Nor1] (234 aa)
Score = 440, Expect = 1.1e-41, Identities = 93/209 (44%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +R K Y  EEAV L K+T++AKF  ++++A+KL +D   +DQQ+RG V LPY  GK KR+LV  KG   K+A+  G +  G  +++A+I +GW DFD+ + TP MM  + +LGKILG +GLMPNPK G VT D+ + + E K G  +YRTD  GNIH  +GK + D  K+++N   L+  +   +  + KG ++  + LS+TMGPG++V
  S:    16 ERGKLYDPEEAVELVKKTASAKFDETVEVAVKLGVDPKHADQQVRGAVVLPYGTGKTKRVLVFAKGEKAKEAEEAGADFVGAEDMVAKIQEGWTDFDVAVATPDMMGMVGRLGKILGPKGLMPNPKVGTVTMDVARAVKEIKAGKIEYRTDKAGNIHAPIGKVSFDNEKLLKNFYTLIDTLIRVKPAAAKGQYLRSITLSTTMGPGVKV 224
>gi|148543546|ref|YP_001270916.1| 50S ribosomal protein L1P [Lactobacillus reuteri F275] >gi|148530580|gb|ABQ82579.1| LSU ribosomal protein L1P [Lactobacillus reuteri F275] (253 aa)
Score = 439, Expect = 1.4e-41, Identities = 92/207 (44%), Positives = 134/207 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           D  K Y +++AV L K  + A F S+I++A  LN+DT ++DQQLRG V LP   GK++ ++V   G   K A+  G +  GD +L+ +I  GWLDFD+ I TP MMP++ +LG++LG +GLMPNPK G VT D+ K +++ K G   YRTD  GN+ +  GK + DT K+VEN+  L   +A  R  SV+G +I+  ++SST GP +
  S:    40 DSKKEYAVKDAVQLVKDIAYANFDSTIEVAFNLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFANGENAKAAQEAGADFVGDDDLVEKIQDGWLDFDVAIATPDMMPKVGRLGRVLGPKGLMPNPKTGTVTMDVAKAVSDAKAGQVTYRTDRDGNVAVPFGKVSFDTDKLVENLATLEDIVAKARPASVRGTYIKHASISSTFGPSV 246
>gi|81429283|ref|YP_396284.1| 50S ribosomal protein L1 [Lactobacillus sakei subsp. sakei 23K] >gi|91207355|sp|Q38V06|RL1_LACSS 50S ribosomal protein L1 >gi|78610926|emb|CAI55978.1| 50S ribosomal protein L1 [Lactobacillus sakei subsp. sakei 23K] (229 aa)
Score = 439, Expect = 1.4e-41, Identities = 92/211 (43%), Positives = 137/211 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           D TK YT+EEA++L K+   AKF +S+++A +LN+D  ++DQQ+RG V LP   GK +R++V  +G   K A++ G +  G  +L+ +I  GWLDFD+ + TP MM ++ +LG++LG +GLMPNPK G VT D+ K + + K G   YR D  G +H  +GK + D AK+VEN   +   I   R  S KG +I  +++SST GPG++V V
  S:    16 DATKAYTVEEAIDLVKKVDFAKFDASLEVAYRLNVDPKQADQQIRGAVVLPNGTGKTQRVIVFAQGEQAKQAEAAGADVVGAEDLVEKIQGGWLDFDVAVATPPMMAQVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNDIKAGQVAYRVDKAGIVHAPIGKVSFDAAKLVENFKAMQDVIIKARPASAKGQYITSLSVSSTFGPGVKVDV 226
>gi|184152953|ref|YP_001841294.1| 50S ribosomal protein L1 [Lactobacillus reuteri F275] >gi|194468091|ref|ZP_03074077.1| ribosomal protein L1 [Lactobacillus reuteri 100-23] >gi|183224297|dbj|BAG24814.1| 50S ribosomal protein L1 [Lactobacillus reuteri F275] >gi|194452944|gb|EDX41842.1| ribosomal protein L1 [Lactobacillus reuteri 100-23] (230 aa)
Score = 438, Expect = 2.2e-41, Identities = 92/207 (44%), Positives = 134/207 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           D  K Y +++AV L K  + A F S+I++A  LN+DT ++DQQLRG V LP   GK++ ++V   G   K A+  G +  GD +L+ +I  GWLDFD+ I TP MMP++ +LG++LG +GLMPNPK G VT D+ K +++ K G   YRTD  GN+ +  GK + DT K+VEN+  L   +A  R  SV+G +I+  ++SST GP +
  S:    17 DSKKEYAVKDAVQLVKDIAYANFDSTIEVAFNLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFANGENAKAAQEAGADFVGDDDLVEKIQDGWLDFDVAIATPDMMPKVGRLGRVLGPKGLMPNPKTGTVTMDVAKAVSDAKAGQVTYRTDRDGNVAVPFGKVSFDTDKLVENLATLEDIVAKARPASVRGTYIKHASISSTFGPSV 223
>gi|138893773|ref|YP_001124226.1| 50S ribosomal protein L1 [Geobacillus thermodenitrificans NG80-2] >gi|160165979|sp|A4IJH7|RL1_GEOTN 50S ribosomal protein L1 >gi|134265286|gb|ABO65481.1| LSU ribosomal protein L1P [Geobacillus thermodenitrificans NG80-2] (233 aa)
Score = 437, Expect = 2.7e-41, Identities = 97/218 (44%), Positives = 143/218 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           DR K Y + EA+ L K+T+ AKF +++++A +L +D  K+DQQ+RG V LP+  GK  R+LV  KG   K+A++ G ++ GD+E I +I +GW DFD+++ TP MM E+ KLG+ILG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + D  K+ EN   +   I   +  + KG +++ V ++STMGPGI+V     AV +
  S:    16 DRFKAYPVAEAIELVKKTNVAKFDATVEVAFRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDTEYINKIQQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVTKAVQEIKAGKVEYRVDKAGNIHVPIGKVSFDNEKLAENFATIYEAILKAKPAAAKGTYVKNVTITSTMGPGIKVDPTTVAVAQ 233
>gi|56961920|ref|YP_173642.1| 50S ribosomal protein L1 [Bacillus clausii KSM-K16] >gi|61214583|sp|Q5WLS4|RL1_BACSK 50S ribosomal protein L1 >gi|56908154|dbj|BAD62681.1| 50S ribosomal protein L1 [Bacillus clausii KSM-K16] (231 aa)
Score = 437, Expect = 2.8e-41, Identities = 93/209 (44%), Positives = 144/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   Y  EEA+ L K+TS AKF  ++++A++L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G ++ G+ +LI +I++GW DFD+I+ TP MM ++ +LG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + DT K++EN   ++  +   +  + KG +++ + ++STMGPGIRV
  S:    16 DRDTAYQAEEALELVKKTSVAKFDETVEVAVRLGVDPKKADQQIRGAVVLPHGTGKTQRVLVFAKGEKAKEAEAAGADYVGEDDLINKINQGWFDFDVIVATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTFDVTKAVEEIKAGKVEYRVDKSGNIHVPIGKVSFDTPKLLENFQTIVETLHKVKPAAAKGTYVKNIAVASTMGPGIRV 224
>gi|167757652|ref|ZP_02429779.1| hypothetical protein CLORAM_03202 [Clostridium ramosum DSM 1402] >gi|167702649|gb|EDS17228.1| hypothetical protein CLORAM_03202 [Clostridium ramosum DSM 1402] (228 aa)
Score = 436, Expect = 3.0e-41, Identities = 94/213 (44%), Positives = 142/213 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           ++ K Y+IEEAV L K+TS  KF +++D+A +L +D  ++DQQLRG + LP   GK K++LV+ +G   ++AK  G +  G  E++ +I KGWLDF+++I TP MM EL KLG+ILG +GLMPNPK G VT D+ K + E K G   YRTD  GN+ M +G+ + D  K+VEN   +   +   + ++ KG++++ + +SSTMGP I++   K
  S:    16 EKGKAYSIEEAVALVKETSKVKFDAAVDVAFRLGVDPRQADQQLRGALVLPNGTGKSKKVLVVTEGPKAQEAKDAGADVVGGKEILEDIKKGWLDFEVMIATPDMMAELGKLGRILGPKGLMPNPKTGTVTMDVAKAVKETKAGKVTYRTDKEGNVQMTIGRVSFDNDKLVENFTAIYDLLVKIKPSTSKGVYMKNIVVSSTMGPSIKIAAAK 228
>gi|169351740|ref|ZP_02868678.1| hypothetical protein CLOSPI_02521 [Clostridium spiroforme DSM 1552] >gi|169291962|gb|EDS74095.1| hypothetical protein CLOSPI_02521 [Clostridium spiroforme DSM 1552] (228 aa)
Score = 436, Expect = 3.0e-41, Identities = 94/213 (44%), Positives = 142/213 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           ++ K Y+IEEAV L K+TS  KF +++D+A +L +D  ++DQQLRG + LP   GK K++LV+ +G   ++AK  G +  G  E++ +I KGWLDF+++I TP MM EL KLG+ILG +GLMPNPK G VT D+ K + E K G   YRTD  GN+ + +G+ + +  K+VEN N +   +   + ++ KG+++  + +SSTMGP I+V   K
  S:    16 EKGKAYSIEEAVALVKETSKVKFDAAVDVAFRLGVDPRQADQQLRGALVLPNGTGKTKKVLVVTEGPKAQEAKDAGADVVGGKEILEDIKKGWLDFEVMIATPDMMAELGKLGRILGPKGLMPNPKTGTVTMDVAKAVKETKAGKVTYRTDKEGNVQLTIGRVSFENDKLVENFNAIYDLLVKIKPSTSKGVYMRNIAISSTMGPSIKVSAAK 228
>gi|148263131|ref|YP_001229837.1| 50S ribosomal protein L1 [Geobacter uraniireducens Rf4] >gi|189041818|sp|A5GAX8|RL1_GEOUR 50S ribosomal protein L1 >gi|146396631|gb|ABQ25264.1| LSU ribosomal protein L1P [Geobacter uraniireducens Rf4] (233 aa)
Score = 436, Expect = 3.4e-41, Identities = 94/227 (41%), Positives = 145/227 (63%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           T+K  K+     DR+K YT+++ + L K T+ AKF  ++D+A++L +D   +DQ +RG V LP   GK+ R+LV  KG  +K+A+  G +  G  +L+A+I +GW DFD  I TP MM  + K+GK+LG RGLMPNPK G VT D+ + + E K G  ++R +  G IH  VGK + D  K+ ENI  L+  +   + ++ KG +I+K+++SSTMGPG+ + V+  +
  S:     3 TSKKLKEALAKVDRSKSYTLKDGIELVKNTAFAKFTETVDVAVRLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEKEKEARDAGADFVGADDLVAKIQEGWFDFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDVGRAVNESKSGKVEFRVEKAGIIHAPVGKVSFDADKLKENILALVDALVKSKPSAAKGTYIKKISVSSTMGPGVNLDVSDVS 229
>gi|184154745|ref|YP_001843085.1| 50S ribosomal protein L1 [Lactobacillus fermentum IFO 3956] >gi|183226089|dbj|BAG26605.1| 50S ribosomal protein L1 [Lactobacillus fermentum IFO 3956] (230 aa)
Score = 436, Expect = 3.7e-41, Identities = 87/207 (42%), Positives = 136/207 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           D  K Y +++AV+L K+   A F +++++A  LN+DT ++DQQLRG + LP   GK++ ++V  KG   K A+  G +  GD +L+ +I  GWLDFD+ I TP MMP++ +LG++LG +GLMPNPK G VT D+ K +++ K G   YRTD  GN+ +  GK + DTAK+VEN+  +   +   R  +V+G +I+  +++ST GP +
  S:    17 DSKKEYAVDDAVDLVKEIDFANFDATVEVAFNLNVDTKQADQQLRGAIVLPNGTGKDQTVIVFAKGENAKAAQEAGADFVGDQDLVEKIQDGWLDFDVAIATPDMMPQVGRLGRVLGPKGLMPNPKTGTVTMDVAKAVSDAKAGQVTYRTDRDGNVAVPFGKVSFDTAKLVENLKTIEDVVVKARPAAVRGTYIKHASIASTFGPSV 223
>gi|73663526|ref|YP_302307.1| 50S ribosomal protein L1 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581577|sp|Q49V48|RL1_STAS1 50S ribosomal protein L1 >gi|72496041|dbj|BAE19362.1| 50S ribosomal protein L1 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (231 aa)
Score = 436, Expect = 3.7e-41, Identities = 94/220 (42%), Positives = 143/220 (65%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   DR K Y +EEAV LAK+T+ A F +S+++A +L +DT K+DQQ+RG V LP   GK +R+LV  KG    +A++ G +  G+ E + +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR +  G +H  +GK + DT K+VEN   L   +   +  S KG + + V +++TMGPG++V
  S:     5 SKRYQEAASKIDRLKHYNVEEAVELAKETNIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQRVLVFAKGDKAAEAEAAGADFVGEGEYVEKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKSGIVHASIGKTSFDTDKLVENFKTLQDVLTKAKPASAKGTYFKSVAVTTTMGPGVKV 224
>gi|21223031|ref|NP_628810.1| 50S ribosomal protein L1 [Streptomyces coelicolor A3(2)] >gi|19860152|sp|P48950|RL1_STRCO 50S ribosomal protein L1 >gi|7248343|emb|CAB77423.1| 50S ribosomal protein L1 [Streptomyces coelicolor A3(2)] (241 aa)
Score = 435, Expect = 4.1e-41, Identities = 96/225 (42%), Positives = 143/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +K+ +      DR K Y   EAV LAK+TS +KF  ++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A + G +  G  ELI E+SKG LDFD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + + K G  ++R D + N+H ++GK + D  K+VEN    L  I   + ++ KG +I+K  LS+TMGPGI +  N+T
  S:     5 SKSLRAADAKIDRDKLYAPLEAVRLAKETSTSKFDGTVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAEAATAAGADIVGSDELIDEVSKGRLDFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTPDVAKAVNDIKGGKIEFRVDKHSNLHFIIGKTSFDDTKLVENYGAALEEILRLKPSAAKGRYIKKAALSTTMGPGIPLDSNRT 229
>gi|119714944|ref|YP_921909.1| 50S ribosomal protein L1P [Nocardioides sp. JS614] >gi|119535605|gb|ABL80222.1| LSU ribosomal protein L1P [Nocardioides sp. JS614] (259 aa)
Score = 435, Expect = 4.1e-41, Identities = 88/225 (39%), Positives = 143/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +KT +  + +FD+ + Y    A+ +AK +S  KF  ++D+ ++L +D  K+DQ +RGTV+LP+  GK  R+LV       + A+  G +  G  ELI +++ GWLDFD ++ TP MM ++ +LG++LG RGLMPNPK G VT D+ K +++ K G  ++R D + N+H ++GKA+    ++ EN    L  +   +  S KG +I+K+ +S+TMGPGI+V  N+T
  S:    23 SKTYRAAAESFDKDELYAPLAAIKIAKTSSKKKFDETVDVVMRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFANADKAEAAREAGADVVGGDELIDKVAGGWLDFDAVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTPDVAKAVSDIKGGKIEFRVDRHANLHFIIGKASFGEVQLAENYAAALEEVLRLKPASSKGRYIKKITVSTTMGPGIQVDPNRT 247
>gi|1172983|sp|P04447|RL1_BACST 50S ribosomal protein L1 (233 aa)
Score = 434, Expect = 5.1e-41, Identities = 96/218 (44%), Positives = 144/218 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           DR+K Y I EA+ L K+T+ AKF +++++A +L +D  K+DQQ+RG V LP+  GK  R+LV  KG   K+A++ G ++ GD+E I +I +GW DFD+++ TP MM E+ KLG+ILG +GLMP+PK G VT D+ K + E K G  +YR D  GNIH+ +GK + D  K+ EN   +   +   +  + KG +++ V ++STMGPGI+V     AV +
  S:    16 DRSKAYPIAEAIELVKKTNVAKFDATVEVAFRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDTEYINKIQQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPDPKTGTVTFDVAKAVQEIKAGKVEYRVDKAGNIHVPIGKVSFDNEKLAENFAAVYEALIKAKPAAAKGTYVKNVTITSTMGPGIKVDPTTVAVAQ 233
>gi|15612683|ref|NP_240986.1| 50S ribosomal protein L1 [Bacillus halodurans C-125] >gi|33301471|sp|Q9KGE5|RL1_BACHD 50S ribosomal protein L1 >gi|10172732|dbj|BAB03839.1| 50S ribosomal protein L1 [Bacillus halodurans C-125] (231 aa)
Score = 434, Expect = 6.1e-41, Identities = 92/209 (44%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR + Y +EEA+ L K+ S AKF  ++++A++L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GD + I +IS+GW DFD+I+ TP MM ++ KLG++LG +GLMPNPK G VT ++ K + + K G  +YR D  GNIH+ +GK + DTAK+ EN   ++  +   +  + KG +++ + +SSTMGPG++V
  S:    16 DRDQAYQVEEALELVKKASVAKFDETVEVAVRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDEDCINKISQGWFDFDVIVATPDMMAQVGKLGRVLGPKGLMPNPKTGTVTFEVEKAVNDIKAGKVEYRVDKAGNIHVPIGKVSFDTAKLAENFETIIDTLVKAKPAAAKGTYLKNIAVSSTMGPGVKV 224
>gi|42518506|ref|NP_964436.1| 50S ribosomal protein L1 [Lactobacillus johnsonii NCC 533] >gi|61214648|sp|Q74L13|RL1_LACJO 50S ribosomal protein L1 >gi|41582791|gb|AAS08402.1| 50S ribosomal protein L1 [Lactobacillus johnsonii NCC 533] (230 aa)
Score = 434, Expect = 6.3e-41, Identities = 90/209 (43%), Positives = 135/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TKFY+++EA+ LAK+TS A F ++I++A  LN+D  ++DQQ+RG + LP   GK K+++V  +G     AK  G +  G  +L+ ++  G+LDFD++I TP MM ++ +LG+ILG +GLMPNPK G VT D+ K +   K G  +YR D  G IH  +GKA+ D  K+ +N + L   I   R  S KG +++ V +S+T GPGI +
  S:    16 DSTKFYSVDEAMKLAKETSYANFDATIEVAYNLNVDPKQADQQIRGALVLPNGTGKSKKVVVFAEGPQADQAKEAGADEVGSDDLVEKVQNGYLDFDVVIATPMMMAKVGRLGRILGPKGLMPNPKTGTVTMDVAKAVENQKAGQVEYRVDKQGLIHAPIGKASFDAEKLAQNFDALRDVILRARPASTKGQYVKSVAVSATFGPGIHL 224
>gi|15643221|ref|NP_228265.1| 50S ribosomal protein L1 [Thermotoga maritima MSB8] >gi|132757|sp|P29393|RL1_THEMA 50S ribosomal protein L1 >gi|4980961|gb|AAD35538.1|AE001723_8 ribosomal protein L1 [Thermotoga maritima MSB8] >gi|48185|emb|CAA77860.1| ribosomal protein L1 [Thermotoga maritima] (233 aa)
Score = 433, Expect = 7.1e-41, Identities = 99/209 (47%), Positives = 142/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK+Y ++EA+ L K+T+ AKF  +I++ I+  +D  K +Q +RGT+ LP+  GKE ++LV  KG   K+A   G ++ G  +L+ +I K G+LDFD+ I TP MM  + +LGKILG RGLMP+PK+G VT ++ + + EFKKG  + RTD  GNIH+ VGK + D  K+ ENI   +  I   +   VKG FI+KV L+STMGPGI++
  S:    16 DRTKYYDLDEAIELVKKTATAKFDETIELHIQTGIDYRKPEQHIRGTIVLPHGTGKEVKVLVFAKGEKAKEALEAGADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRIIGRLGKILGPRGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMKPAGVKGQFIKKVVLASTMGPGIKL 225
>gi|118475867|ref|YP_893018.1| 50S ribosomal protein L1 [Bacillus thuringiensis str. Al Hakam] >gi|118415092|gb|ABK83511.1| LSU ribosomal protein L1P [Bacillus thuringiensis str. Al Hakam] (259 aa)
Score = 433, Expect = 7.9e-41, Identities = 95/215 (44%), Positives = 143/215 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DR   Y+  EAV L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G +  GD++ I +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + + AK+VEN   +   +   +  + KG +++ V ++STMGPG+RV V+  A
  S:    45 DRAAAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGVRVDVSTLA 259
>gi|162447037|ref|YP_001620169.1| large subunit ribosomal protein L1 [Acholeplasma laidlawii PG-8A] >gi|189041801|sp|A9NEL3|RL1_ACHLI 50S ribosomal protein L1 >gi|161985144|gb|ABX80793.1| large subunit ribosomal protein L1 [Acholeplasma laidlawii PG-8A] (230 aa)
Score = 432, Expect = 8.6e-41, Identities = 102/213 (47%), Positives = 146/213 (68%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +D++  YT  EAV LAK+TS AKF +++++A +LN+D  K+DQ LRG +SLP+  GK  R++V+ K    K+A + G   AGD ELI +I KGW DFD+++ TP MM +L KLG++LG +GLMPNPK G VT D+ K + E K G  +YRTD  GNIH  +GK + D+ K+ EN+  + + +   +  +VKG +I+K+ LS+TMGPGI V  N
  S:    14 YDKSVAYTGLEAVELAKKTSVAKFDATVEVAFRLNVDPRKADQNLRGAISLPHGTGKTVRVVVIAKPEKAKEALAAGALEAGDVELIDKIGKGWFDFDVMVATPDMMAQLGKLGRVLGPKGLMPNPKTGTVTLDVAKAVEEIKAGKIEYRTDKVGNIHAPIGKVSFDSNKLHENMLAIYNQLVRIKPATVKGTYIKKIALSTTMGPGIMVEEN 226
>gi|160166848|sp|A1SEI7|RL1_NOCSJ 50S ribosomal protein L1 (240 aa)
Score = 432, Expect = 8.6e-41, Identities = 88/225 (39%), Positives = 143/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +KT +  + +FD+ + Y    A+ +AK +S  KF  ++D+ ++L +D  K+DQ +RGTV+LP+  GK  R+LV       + A+  G +  G  ELI +++ GWLDFD ++ TP MM ++ +LG++LG RGLMPNPK G VT D+ K +++ K G  ++R D + N+H ++GKA+    ++ EN    L  +   +  S KG +I+K+ +S+TMGPGI+V  N+T
  S:     4 SKTYRAAAESFDKDELYAPLAAIKIAKTSSKKKFDETVDVVMRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFANADKAEAAREAGADVVGGDELIDKVAGGWLDFDAVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTPDVAKAVSDIKGGKIEFRVDRHANLHFIIGKASFGEVQLAENYAAALEEVLRLKPASSKGRYIKKITVSTTMGPGIQVDPNRT 228
>gi|157363338|ref|YP_001470105.1| 50S ribosomal protein L1 [Thermotoga lettingae TMO] >gi|166984587|sp|A8F4F7|RL1_THELT 50S ribosomal protein L1 >gi|157313942|gb|ABV33041.1| ribosomal protein L1 [Thermotoga lettingae TMO] (233 aa)
Score = 432, Expect = 1.0e-40, Identities = 95/209 (45%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRT+FY++++A+ L KQT+ AKF  ++++ +  N+DT + +QQ+R TV+LP+  GK  R+LV  KG   + AK+ G ++ G  EL+ +I+ + + DFD+ I TP MM  + KLGKILG RGLMP+PK+G VT D+   +  FK G  + R D  G IH+ VGK + D  K+ EN+      I A R   VKG FI++V LSSTMG GI++
  S:    16 DRTRFYSVDDAIELVKQTATAKFDETVELHLSTNIDTKRPEQQVRSTVTLPHGTGKRVRVLVFAKGDKAEAAKNAGADYVGGDELVEKITNENFTDFDVAIATPDMMRSIGKLGKILGPRGLMPSPKSGTVTEDVETAVKAFKMGRIEVRNDKTGCIHIPVGKCSFDGEKLRENLLSAYRQIIALRPAGVKGQFIKRVVLSSTMGVGIKI 225
>gi|170288281|ref|YP_001738519.1| ribosomal protein L1 [Thermotoga sp. RQ2] >gi|170175784|gb|ACB08836.1| ribosomal protein L1 [Thermotoga sp. RQ2] (233 aa)
Score = 432, Expect = 1.0e-40, Identities = 99/209 (47%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK+Y ++EA+ L K+T+ AKF  +I++ I+  +D  K +Q +RGT+ LP+  GKE ++LV  KG   K+A   G ++ G  +L+ +I K G+LDFD+ I TP MM  + +LGKILG RGLMP+PK+G VT ++ + + EFKKG  + RTD  GNIH+ VGK + D  K+ ENI   +  I   +   VKG FI+K  LSSTMGPGI++
  S:    16 DRTKYYDLDEAIELVKKTATAKFDETIELHIQTGIDYRKPEQHIRGTIVLPHGTGKEVKVLVFAKGEKAKEALEAGADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRIIGRLGKILGPRGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMKPAGVKGQFIKKAVLSSTMGPGIKL 225
>gi|167729450|emb|CAO80361.1| 50S ribosomal subunit protein L1 [Candidatus Cloacamonas acidaminovorans] (234 aa)
Score = 432, Expect = 1.1e-40, Identities = 87/212 (41%), Positives = 136/212 (64%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           FDR K + + EA+ L K    +KF  ++++   L +D  K+DQQ+R ++ LP+  GKE R+LV  +G   ++AK  G ++ G  +LI +IS GW DFD++I TP +M  + KLG++LG RGLMPNPK G VT D+ K + E K G   YR D + N+H+ VGK + +  K+ +NI  +L+ +   R  ++KG++I+ + L +TM PGI++ V
  S:    14 FDRQKRFDLNEAIKLLKSLPTSKFDETVELHFNLGVDPRKADQQIRNSLVLPHGTGKEMRVLVFAEGDKAEEAKKAGADYVGVDDLIEKISNGWFDFDVVIATPNLMGRIGKLGRVLGPRGLMPNPKVGTVTMDVGKAVQEAKSGKITYRVDKFANLHIPVGKLSFEEEKLKDNIKAVLAAVLRDRPPTLKGVYIKSITLCTTMSPGIKIQV 225
>gi|110602087|ref|ZP_01390233.1| ribosomal protein L1 [Geobacter sp. FRC-32] >gi|110547203|gb|EAT60483.1| ribosomal protein L1 [Geobacter sp. FRC-32] (233 aa)
Score = 431, Expect = 1.2e-40, Identities = 92/227 (40%), Positives = 144/227 (63%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           T+K  K      DR+K YT+ + + L + ++ AKF  ++D+A++L +D   +DQ +RG V LP   GKE R+LV  KG  +K+A+  G +  G  +L+A+I +GW +FD  I TP MM  + K+GK+LG RGLMPNPK G VT D+ + + E K G  ++R +  G IH  VGK + +T K+ ENI  L+  +   + ++ KG +I+K+++SSTMGPG+ + V+  +
  S:     3 TSKKLKDALAKVDRSKSYTLNDGLELVRSSAYAKFTETVDVAVRLGVDPRHADQMVRGAVVLPNGLGKEVRVLVFAKGEKEKEARDAGADFVGADDLVAKIQEGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDVGRAVNESKSGKVEFRVEKAGIIHAPVGKVSFETDKLKENILALIDALVKSKPSAAKGTYIKKISVSSTMGPGVNLDVSDVS 229
>gi|30260289|ref|NP_842666.1| 50S ribosomal protein L1 [Bacillus anthracis str. Ames] >gi|42779179|ref|NP_976426.1| 50S ribosomal protein L1 [Bacillus cereus ATCC 10987] >gi|47525352|ref|YP_016701.1| 50S ribosomal protein L1 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183132|ref|YP_026384.1| 50S ribosomal protein L1 [Bacillus anthracis str. Sterne] >gi|49479291|ref|YP_034450.1| 50S ribosomal protein L1 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145120|ref|YP_081709.1| 50S ribosomal protein L1 [Bacillus cereus E33L] >gi|166996976|ref|ZP_02263435.1| 50S ribosomal protein L1 [Bacillus cereus AH820] >gi|167636696|ref|ZP_02394983.1| ribosomal protein L1 [Bacillus anthracis str. A0442] >gi|160166820|sp|A0R8G8|RL1_BACAH 50S ribosomal protein L1 >gi|33301428|sp|Q81VU2|RL1_BACAN 50S ribosomal protein L1 >gi|61214596|sp|Q63HA2|RL1_BACCZ 50S ribosomal protein L1 >gi|61214624|sp|Q6HPS0|RL1_BACHK 50S ribosomal protein L1 >gi|61214642|sp|Q73FA8|RL1_BACC1 50S ribosomal protein L1 >gi|30253610|gb|AAP24152.1| ribosomal protein L1 [Bacillus anthracis str. Ames] >gi|42735094|gb|AAS39034.1| ribosomal protein L1 [Bacillus cereus ATCC 10987] >gi|47500500|gb|AAT29176.1| ribosomal protein L1 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177059|gb|AAT52435.1| ribosomal protein L1 [Bacillus anthracis str. Sterne] >gi|49330847|gb|AAT61493.1| ribosomal protein L1 (50S ribosomal protein L1) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978589|gb|AAU20139.1| ribosomal protein L1 (50S ribosomal protein L1) [Bacillus cereus E33L] >gi|167527870|gb|EDR90697.1| ribosomal protein L1 [Bacillus anthracis str. A0442] (230 aa)
Score = 431, Expect = 1.3e-40, Identities = 95/215 (44%), Positives = 143/215 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DR   Y+  EAV L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G +  GD++ I +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + + AK+VEN   +   +   +  + KG +++ V ++STMGPG+RV V+  A
  S:    16 DRAAAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGVRVDVSTLA 230
>gi|154684621|ref|YP_001419782.1| 50S ribosomal protein L1 [Bacillus amyloliquefaciens FZB42] >gi|166219566|sp|A7Z0M5|RL1_BACA2 50S ribosomal protein L1 >gi|154350472|gb|ABS72551.1| RplA [Bacillus amyloliquefaciens FZB42] (232 aa)
Score = 431, Expect = 1.3e-40, Identities = 94/209 (44%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y + EAV L K+T+ AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GDS+ IA+I +GW +FD+I+ TP MM E+ K+G++LG +GLMPNPK G VT ++ K I E K G  +YR D  GNIH+ +GK + +  K+VEN   +   I   +  + KG++++ V ++STMGPG++V
  S:    16 DRAKAYDVAEAVALTKKTNTAKFDATVEVAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDSDYIAKIQQGWFEFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEYRVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKV 224
>gi|171854029|emb|CAM12002.1| 50S ribosomal protein L1 [Candidatus Phytoplasma australiense] (229 aa)
Score = 430, Expect = 1.7e-40, Identities = 91/210 (43%), Positives = 140/210 (66%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FD  K Y ++EA+ L KQ+   KF ++++ A  LNLD  K+DQ LRG + LP+  GK  ++ V+ KG   K AK    ++ GD +LI +ISK W DFD++++TP+MMP+LSKLG++LG +GLMPNPK G VT ++ + ++E K G  +YR D  GNIH ++GK + +  K++EN+  L   +   +  + KG +I+ V +S+TM PGI++
  S:    14 FDIKKRYPLQEAIKLTKQSQITKFDATVECAFHLNLDPKKADQNLRGALVLPHGTGKTLKLAVIAKGEQAKIAKEAQADYVGDEDLIEKISKNWFDFDVLVSTPEMMPQLSKLGRLLGPKGLMPNPKTGTVTDNVGQAVSEIKNGKIEYRLDKNGNIHAIIGKTSFEEHKLLENLKTLYLQLMRIKPRTAKGNYIKNVTISTTMSPGIKI 223
>gi|116629028|ref|YP_814200.1| 50S ribosomal protein L1 [Lactobacillus gasseri ATCC 33323] >gi|122273974|sp|Q045W0|RL1_LACGA 50S ribosomal protein L1 >gi|116094610|gb|ABJ59762.1| LSU ribosomal protein L1P [Lactobacillus gasseri ATCC 33323] (230 aa)
Score = 430, Expect = 1.8e-40, Identities = 90/209 (43%), Positives = 135/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TKFY+++EA+ LAK+TS A F ++I++A  L++D  ++DQQ+RG + LP   GK K+++V  +G     AK  G +  G  +L+ ++  G+LDFD++I TP MM ++ +LG+ILG +GLMPNPK G VT D+ K +   K G  +YR D  G IH  +GKA+ D  K+ +N + L   I   R  S KG +I+ V +S+T GPGI +
  S:    16 DSTKFYSVDEAMKLAKETSYANFDATIEVAYNLSVDPKQADQQIRGALVLPNGTGKSKKVVVFAEGPQADQAKEAGADEVGSDDLVEKVQNGYLDFDVVIATPMMMAKVGRLGRILGPKGLMPNPKTGTVTMDVAKAVENQKAGQVEYRVDKQGLIHAPIGKASFDADKLAQNFDALRDVILRARPASAKGQYIKSVAVSATFGPGIHL 224
>gi|83591287|ref|YP_431296.1| 50S ribosomal protein L1 [Moorella thermoacetica ATCC 39073] >gi|123523759|sp|Q2RFN6|RL1_MOOTA 50S ribosomal protein L1 >gi|83574201|gb|ABC20753.1| LSU ribosomal protein L1P [Moorella thermoacetica ATCC 39073] (231 aa)
Score = 430, Expect = 1.8e-40, Identities = 90/208 (43%), Positives = 136/208 (65%)
  Q:    21 RTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           R + Y  +EA+ L K+T++AKF  ++++A+KL +D   +DQQ+RGTV LP   GK +R+LV  KG   K+A+  G +  G  +L+ +I  GWLDFD+ I TP MM  + +LG+ILG RGLMPNPK G VT D+ + + E K G  ++R D    IH  +GKA+ + +K+ EN   L+  +   +  + KG +++ V+L++TMGPGIRV
  S:    17 RQELYEPDEAIELLKKTASAKFDETVEVAVKLGVDPRHADQQVRGTVVLPNGTGKTRRVLVFAKGDKAKEAEEAGADFVGAEDLVEKIQGGWLDFDVAIATPDMMGLVGRLGRILGPRGLMPNPKAGTVTMDIARAVKEVKAGKIEFRVDKTAIIHAPIGKASFEASKLKENFQALMDALLRAKPATAKGQYLKSVSLATTMGPGIRV 224
>gi|161511215|ref|NP_829999.2| 50S ribosomal protein L1 [Bacillus cereus ATCC 14579] (230 aa)
Score = 429, Expect = 2.3e-40, Identities = 95/215 (44%), Positives = 143/215 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DR   Y+  EAV L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G +  GD++ I +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + + AK+VEN   +   +   +  + KG +++ V ++STMGPG+RV V+  A
  S:    16 DRAAAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDTDYIGKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFKTIADTLQKVKPAAAKGTYMKNVTVASTMGPGVRVDVSTLA 230
>gi|166154528|ref|YP_001654646.1| 50S ribosomal protein L1 [Chlamydia trachomatis 434/Bu] >gi|165930516|emb|CAP04010.1| LSU ribosomal protein L1P [Chlamydia trachomatis 434/Bu] (232 aa)
Score = 428, Expect = 2.8e-40, Identities = 89/210 (42%), Positives = 134/210 (63%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D  K Y++ EA+++ KQ    +F  ++D+++KL +D  KSDQQ+RG+VSLP+  GK  RILV   G    +A   G +  G  +L+ +I  GW+DFD+ + TP MM E+ KLGK+LG R LMP PK G VTTD+ KTIAE +KG  +++ D  G  ++ V K + D+A+I EN+  L + +   +  + KG ++    +SSTMGPG+ V
  S:    15 YDLAKSYSLGEAIDILKQCPTVRFDQTVDVSVKLGIDPRKSDQQIRGSVSLPHGTGKVLRILVFAAGDKAAEAIEAGADFVGSDDLVEKIKGGWVDFDVAVATPDMMREVGKLGKVLGPRNLMPTPKAGTVTTDVVKTIAELRKGKIEFKADRAGVCNVGVAKLSFDSAQIKENVEALCAALVKAKPATAKGQYLVNFTISSTMGPGVTV 224
>gi|52078597|ref|YP_077388.1| 50S ribosomal protein L1 [Bacillus licheniformis ATCC 14580] >gi|52783959|ref|YP_089788.1| 50S ribosomal protein L1 [Bacillus licheniformis ATCC 14580] >gi|81667236|sp|Q65PB9|RL1_BACLD 50S ribosomal protein L1 >gi|52001808|gb|AAU21750.1| ribosomal protein L1 (BL1) [Bacillus licheniformis ATCC 14580] >gi|52346461|gb|AAU39095.1| RplA [Bacillus licheniformis DSM 13] (232 aa)
Score = 428, Expect = 3.0e-40, Identities = 93/209 (44%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y + EA+ L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GD++ I +I +GW DFD+I+ TP MM E+ K+G++LG +GLMPNPK G VT ++ K + E K G  +YR D  GNIH+ +GK + +  K+VEN   +   I   +  + KG++++ V+++STMGPGI+V
  S:    16 DRTKAYDVNEAIELVKKTNTAKFDATVEAAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDADYINKIQQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEEGKLVENFATMYDTILKAKPAAAKGVYVKNVSVTSTMGPGIKV 224
>gi|33301427|sp|Q81J52|RL1_BACCR 50S ribosomal protein L1 >gi|29893908|gb|AAP07200.1| LSU ribosomal protein L1P [Bacillus cereus ATCC 14579] (232 aa)
Score = 427, Expect = 3.8e-40, Identities = 95/215 (44%), Positives = 143/215 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DR   Y+  EAV L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G +  GD++ I +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + + AK+VEN   +   +   +  + KG +++ V ++STMGPG+RV V+  A
  S:    18 DRAAAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDTDYIGKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFKTIADTLQKVKPAAAKGTYMKNVTVASTMGPGVRVDVSTLA 232
>gi|16802295|ref|NP_463780.1| 50S ribosomal protein L1 [Listeria monocytogenes EGD-e] >gi|33301459|sp|Q8YAA4|RL1_LISMO 50S ribosomal protein L1 >gi|16409614|emb|CAD00776.1| ribosomal protein L1 [Listeria monocytogenes] (229 aa)
Score = 427, Expect = 3.9e-40, Identities = 93/209 (44%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YT EEAV LAK+   AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ G+SE + +I++GW DFD+I+ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GN+H  +GK + D AK+VEN   +   +   +  + KG +++ +++++T GPGI+V
  S:    16 DANKVYTAEEAVELAKKIDFAKFDATVEVAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKINQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEYRVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGIKV 224
>gi|166155403|ref|YP_001653658.1| 50S ribosomal protein L1 [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165931391|emb|CAP06964.1| LSU ribosomal protein L1P [Chlamydia trachomatis L2b/UCH-1/proctitis] (232 aa)
Score = 427, Expect = 4.0e-40, Identities = 89/210 (42%), Positives = 134/210 (63%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D  K Y++ EA+++ KQ    +F  ++D+++KL +D  KSDQQ+RG+VSLP+  GK  RILV   G    +A   G +  G  +L+ +I  GW+DFD+ + TP MM E+ KLGK+LG R LMP PK G VTTD+ KTIAE +KG  +++ D  G  ++ V K + D+A+I EN+  L + +   +  + KG ++    +SSTMGPG+ V
  S:    15 YDLAKSYSLGEAIDILKQCPTVRFDQTVDVSVKLGIDPRKSDQQVRGSVSLPHGTGKVLRILVFAAGDKAAEAIEAGADFVGSDDLVEKIKGGWVDFDVAVATPDMMREVGKLGKVLGPRNLMPTPKAGTVTTDVVKTIAELRKGKIEFKADRAGVCNVGVAKLSFDSAQIKENVEALCAALVKAKPATAKGQYLVNFTISSTMGPGVTV 224
>gi|15835209|ref|NP_296968.1| 50S ribosomal protein L1 [Chlamydia muridarum Nigg] >gi|13878714|sp|Q9PK77|RL1_CHLMU 50S ribosomal protein L1 >gi|7190630|gb|AAF39424.1| ribosomal protein L1 [Chlamydia muridarum Nigg] (232 aa)
Score = 427, Expect = 4.2e-40, Identities = 90/210 (42%), Positives = 135/210 (64%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D TK Y++ EA+++ KQ    +F  ++D+++KL +D  KSDQQ+RG+VSLP+  GK  RILV   G    +A   G +  G  +L+ +I  GW+DFD+ + TP MM E+ KLGK+LG R LMP PK+G VTTD+ K IAE +KG  +++ D  G  ++ V K + D+A+I ENI  L + +   +  + KG ++    +SSTMGPG+ V
  S:    15 YDFTKPYSLGEAIDILKQCPAVRFDQTVDVSVKLGIDPRKSDQQIRGSVSLPHGTGKVLRILVFAAGDKAAEAIEAGADFVGSDDLVEKIKGGWVDFDVAVATPDMMREVGKLGKVLGPRNLMPTPKSGTVTTDVVKAIAELRKGKIEFKADRAGVCNVGVAKLSFDSAQIKENIEALCAALVKAKPATAKGQYLVNFTISSTMGPGVTV 224
>gi|154249531|ref|YP_001410356.1| 50S ribosomal protein L1 [Fervidobacterium nodosum Rt17-B1] >gi|171769345|sp|A7HLB6|RL1_FERNB 50S ribosomal protein L1 >gi|154153467|gb|ABS60699.1| ribosomal protein L1 [Fervidobacterium nodosum Rt17-B1] (235 aa)
Score = 426, Expect = 4.6e-40, Identities = 102/219 (46%), Positives = 144/219 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           D  K YT++EAV L K+T+ AKF  +++  IK N+D  KS+Q +R T+SLP+  GK  R+LV  KG   ++AK  G ++ G  EL  +I+ +G++DFD+ I TP MM  + KLGK+LG RGLMPNPK G VT D+   ++EFKKG  + RTD  GN+H  VGKA+ +  K+ ENI      I + R   VKG FI+K  +++TMGPGI++ +N  A  K+
  S:    16 DSEKAYTLDEAVELLKKTATAKFDETVEFHIKTNIDYRKSEQNIRSTISLPHGTGKSVRVLVFAKGEKAEEAKQAGADYVGAEELADKIANEGFVDFDVAIATPDMMKVIGKLGKVLGPRGLMPNPKTGTVTEDIAAAVSEFKKGKVEVRTDKTGNLHFPVGKASFEPDKLKENIKSAYEQILSLRPAGVKGHFIKKAVVATTMGPGIKLDLNVLAEGKR 235
>gi|118411001|ref|YP_874396.1| 50S ribosomal protein L1 [Phaeodactylum tricornutum] >gi|125987546|sp|A0T0C1|RK1_PHATR Chloroplast 50S ribosomal protein L1 >gi|116739748|gb|ABK20619.1| 50S ribosomal protein L1 [Phaeodactylum tricornutum] (230 aa)
Score = 426, Expect = 4.8e-40, Identities = 94/219 (42%), Positives = 147/219 (67%)
  Q:    10 KTPKKPSVNFDRTK---FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++   NF+RTK   +  I+EA+ + K+T+  KF+ S+++   LN+D   +DQQLR TV+LP   GK+  I VL      ++AKS G +  G+ ELIA+I++G ++FDL+I TP MMP+L+KLG++LG +GLMP+PK+G VT+ L  T+ EFKKG  +Y+ D  G +H+  GK+N    ++VEN+  L   I   R + VKG + + V++ +TMGP +++
  S:     3 KVSRRHKENFERTKNIVYSNIDEAIAVLKETATTKFVESVELHANLNIDPKYADQQLRTTVTLPNGIGKQVVIAVLTNEENFEEAKSSGGDIVGNDELIAQITQGQINFDLLIATPNMMPKLAKLGRMLGPKGLMPSPKSGTVTSTLQSTLTEFKKGKFEYKADKTGIVHVNFGKSNFTNEQLVENLKALYQSIEQNRPSGVKGKYFKSVSICTTMGPSVKL 224
>gi|169830423|ref|YP_001716405.1| ribosomal protein L1 [Candidatus Desulforudis audaxviator MP104C] >gi|169637267|gb|ACA58773.1| ribosomal protein L1 [Candidatus Desulforudis audaxviator MP104C] (231 aa)
Score = 426, Expect = 5.1e-40, Identities = 88/213 (41%), Positives = 134/213 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           D  K Y + EA+ L ++ + AKF  +++ A+KL +D   +DQQ+RG V LP+  GK + +LV  KG    +A+  G ++ G  E++A+I  GW++FD+ I TP MM  + K+G+ILG RGLMPNPK G VT D+ + +AE K G  QYR D  GNIH  +GK + +  K+ EN+  L+  +   +  + KG ++  + ++STMGPG+RV   K
  S:    16 DSEKQYEVREALELVRKLAPAKFDETVEAAVKLGVDPRHADQQVRGAVVLPHGTGKTRTVLVFAKGEKVTEAEKAGADYVGGEEMVAKIQGGWMEFDVAIATPDMMSAVGKIGRILGPRGLMPNPKTGTVTFDIARAVAEVKAGKIQYRVDKAGNIHAPIGKVSFEVEKLEENLKTLIDALIRAKPAAAKGQYLRGIVVTSTMGPGVRVNTRK 228
>gi|19551720|ref|NP_599722.1| 50S ribosomal protein L1 [Corynebacterium glutamicum ATCC 13032] >gi|62389375|ref|YP_224777.1| 50S ribosomal protein L1 [Corynebacterium glutamicum ATCC 13032] >gi|145294629|ref|YP_001137450.1| 50S ribosomal protein L1 [Corynebacterium glutamicum R] >gi|160165853|sp|A4QBF1|RL1_CORGB 50S ribosomal protein L1 >gi|33301472|sp|Q9LAK5|RL1_CORGL 50S ribosomal protein L1 >gi|7108629|gb|AAF36508.1|AF130462_5 50S ribosomal protein L1 [Corynebacterium glutamicum] >gi|14041189|emb|CAC38385.1| L1 protein [Corynebacterium glutamicum] >gi|21323242|dbj|BAB97870.1| Ribosomal protein L1 [Corynebacterium glutamicum ATCC 13032] >gi|41324709|emb|CAF19191.1| 50S RIBOSOMAL PROTEIN L1 [Corynebacterium glutamicum ATCC 13032] >gi|140844549|dbj|BAF53548.1| hypothetical protein [Corynebacterium glutamicum R] (236 aa)
Score = 425, Expect = 7.1e-40, Identities = 93/220 (42%), Positives = 136/220 (61%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   D  + Y+  EA NL K+TS+  + +SID+AI+L +D  K+DQ +RGTVSLP   GK  R+ V  +G    +A++ G +  G  EL+ +I  GW DFD+ I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K I E K G   +R D   N+H  +GKA+ D  K+ EN   LL  I   + +S KGI++++V LSST GPG+ V
  S:     5 SKAYREAAEKIDAGRIYSPLEAANLVKETSSKNYDASIDVAIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAQGEKATEAEAAGADFVGTDELVEKIQGGWTDFDVAIATPDQMAKIGRIARVLGPRGLMPNPKTGTVTNDVAKAIEEVKGGKISFRVDKASNLHAAIGKASFDAKKLAENYGALLDEIIRIKPSSAKGIYVKRVTLSSTTGPGVEV 224
>gi|163938106|ref|YP_001642990.1| 50S ribosomal protein L1 [Bacillus weihenstephanensis KBAB4] >gi|163860303|gb|ABY41362.1| ribosomal protein L1 [Bacillus weihenstephanensis KBAB4] (230 aa)
Score = 424, Expect = 8.0e-40, Identities = 95/215 (44%), Positives = 141/215 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DR   Y+  EAV L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G    GD++ I +I KGW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + + AK+VEN   +   +   +  + KG +++   ++STMGPG+RV V+  A
  S:    16 DRASAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGAEFVGDADYIGKIQKGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFKTIADTLQKAKPAAAKGTYMKNATVASTMGPGVRVDVSTLA 230
>gi|194017639|ref|ZP_03056250.1| ribosomal protein L1 [Bacillus pumilus ATCC 7061] >gi|194010911|gb|EDW20482.1| ribosomal protein L1 [Bacillus pumilus ATCC 7061] (232 aa)
Score = 424, Expect = 8.5e-40, Identities = 93/209 (44%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +RTK Y + EAV+L K+ + AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GDS+ I +I +GW DFD+I+ TP MM E+ K+G++LG +GLMPNPK G VT ++ K I E K G  +YR D  GNIH  +GK + +  K+VEN   +   I   +  + KG++++ V+++STMGPG++V
  S:    16 ERTKAYDVAEAVSLTKKANTAKFDATVEVAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDSDYITKIQQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAINEIKAGKVEYRVDKAGNIHAPIGKVSFEDEKLVENFATIYDTILKAKPAAAKGVYVKNVSVTSTMGPGVKV 224
>gi|46446235|ref|YP_007600.1| 50S ribosomal protein L1 [Candidatus Protochlamydia amoebophila UWE25] >gi|61215576|sp|Q6MDM4|RL1_PARUW 50S ribosomal protein L1 >gi|46399876|emb|CAF23325.1| probable 50S ribosomal protein L1 [Candidatus Protochlamydia amoebophila UWE25] (236 aa)
Score = 424, Expect = 9.0e-40, Identities = 94/232 (40%), Positives = 147/232 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           +K  ++ + + D  K YTI EA+++ K+    KF  ++++++KL +D  +SDQ +RGTVSLP   GK  +ILV  KG   K+A   G ++AG  EL+ +++ GW DFD ++ TP MM E+ KLGK+LG RGLMP PK G VTTD+ K I E K G  +++ D +G I+  VGK + ++ K+ ENI   L  I   +  S KG ++  + +SSTMGPG+++ + ++ +  K +
  S:     5 SKRIREIAKSLDAAKAYTIREAIDILKKCPPVKFDQTVEVSLKLGVDPRRSDQSVRGTVSLPNGTGKTMKILVFAKGDKVKEALEAGADYAGHDELLEKVNGGWTDFDAVVATPDMMREVGKLGKVLGPRGLMPTPKAGTVTTDIAKAIQELKAGKIEFKLDRHGVINNGVGKVSFESNKLEENIRAFLIAIQRAKPASAKGHYMRSLAISSTMGPGLKIDLRESDLAAKES 236
>gi|29377196|ref|NP_816350.1| 50S ribosomal protein L1 [Enterococcus faecalis V583] >gi|33301434|sp|Q830Q6|RL1_ENTFA 50S ribosomal protein L1 >gi|29344662|gb|AAO82420.1| ribosomal protein L1 [Enterococcus faecalis V583] (229 aa)
Score = 423, Expect = 9.9e-40, Identities = 100/228 (43%), Positives = 148/228 (64%)
  Q:     1 MANQKKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           MA + K   +  KK     D TK Y++EEAV LAK T+ AKF +++++A KLN+D  K+DQQ+RG V LP   GK + +LV  KG   K+A++ G +  GD +++A+I  GW DFD+++ TP MM  + KLG++LG +GLMPNPK G VT D+ K + E K G   YR D  GNIH+ +GK + D  K+VEN N +   +   + ++ KG +I+ +++++T GPGI V
  S:     1 MAKKSKKMQEALKK----VDATKAYSVEEAVALAKDTNIAKFDATVEVAYKLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGEKAKEAEAAGADFVGDDDMVAKIQGGWFDFDVVVATPDMMATVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVEEVKAGKVTYRVDKAGNIHVPIGKVSFDNEKLVENFNTINDVLLKAKPSTAKGQYIKNISVTTTFGPGIHV 224
>gi|16799358|ref|NP_469626.1| 50S ribosomal protein L1 [Listeria innocua Clip11262] >gi|46906482|ref|YP_012871.1| 50S ribosomal protein L1 [Listeria monocytogenes str. 4b F2365] >gi|47094526|ref|ZP_00232193.1| ribosomal protein L1 [Listeria monocytogenes str. 4b H7858] >gi|116871632|ref|YP_848413.1| 50S ribosomal protein L1 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153165279|ref|ZP_01926230.1| ribosomal protein L1 [Listeria monocytogenes FSL N1-017] >gi|153172936|ref|ZP_01928871.1| hypothetical protein LMIG_01793 [Listeria monocytogenes FSL N3-165] >gi|153177976|ref|ZP_01931668.1| ribosomal protein L1 [Listeria monocytogenes F6900] >gi|153186397|ref|ZP_01936715.1| ribosomal protein L1 [Listeria monocytogenes J0161] >gi|153189503|ref|ZP_01937087.1| ribosomal protein L1 [Listeria monocytogenes J2818] >gi|153198257|ref|ZP_01942362.1| ribosomal protein L1 [Listeria monocytogenes 10403S] >gi|153200709|ref|ZP_01942790.1| ribosomal protein L1 [Listeria monocytogenes HPB2262] >gi|167013699|ref|ZP_02276232.1| 50S ribosomal protein L1 [Listeria monocytogenes FSL J1-194] >gi|168264885|ref|ZP_02686850.1| 50S ribosomal protein L1 [Listeria monocytogenes FSL J2-071] >gi|123465954|sp|A0AF48|RL1_LISW6 50S ribosomal protein L1 >gi|33301463|sp|Q92F26|RL1_LISIN 50S ribosomal protein L1 >gi|61215606|sp|Q724G3|RL1_LISMF 50S ribosomal protein L1 >gi|16412710|emb|CAC95514.1| ribosomal protein L1 [Listeria innocua] >gi|46879746|gb|AAT03048.1| ribosomal protein L1 [Listeria monocytogenes str. 4b F2365] >gi|47017098|gb|EAL07964.1| ribosomal protein L1 [Listeria monocytogenes str. 4b H7858] >gi|116740510|emb|CAK19630.1| rplA [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126941165|gb|EBA19058.1| ribosomal protein L1 [Listeria monocytogenes J0161] >gi|127632088|gb|EBA21801.1| ribosomal protein L1 [Listeria monocytogenes 10403S] >gi|127766678|gb|EBA27008.1| ribosomal protein L1 [Listeria monocytogenes J2818] >gi|133728312|gb|EBA30010.1| ribosomal protein L1 [Listeria monocytogenes FSL N1-017] >gi|133731243|gb|EBA32941.1| hypothetical protein LMIG_01793 [Listeria monocytogenes FSL N3-165] >gi|133733881|gb|EBA35579.1| ribosomal protein L1 [Listeria monocytogenes F6900] >gi|133736451|gb|EBA38149.1| ribosomal protein L1 [Listeria monocytogenes HPB2262] (229 aa)
Score = 423, Expect = 1.2e-39, Identities = 92/209 (44%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YT EEAV LAK+   AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ G+SE + +I++GW +FD+I+ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GN+H  +GK + D AK+VEN   +   +   +  + KG +++ +++++T GPGI+V
  S:    16 DANKVYTAEEAVELAKKIDFAKFDATVEVAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKINQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEYRVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGIKV 224
>gi|110005482|emb|CAK99804.1| 50s ribosomal protein l1 [Spiroplasma citri] (228 aa)
Score = 423, Expect = 1.2e-39, Identities = 97/211 (45%), Positives = 138/211 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           D+ K Y I EA+ LAKQT+  KF S++++A  LN+D   +DQQ+RG V LP   GK +RILVL     + DAK+ G +  G  +LI +I K  W D+D+II TP +M EL K+GK+LG +GLMPNPK G VT D+ K I + KKG  +YR D  GNIH ++GKA+     +  N + +   I   +  +VKG +I+ + +++TMGPGI+VL+
  S:    16 DKNKVYPIVEAIELAKQTATTKFDSTVEVAFNLNVDPRHADQQIRGAVVLPKGTGKTQRILVLTNS-KEADAKAAGADFVGGKDLIEKIQKENWFDYDVIIATPDIMAELGKIGKLLGPKGLMPNPKTGTVTPDVAKAIGDVKKGKVEYRVDKNGNIHSIIGKASYKVEALKANYDVIYETIRKAKPAAVKGTYIKNIAITTTMGPGIKVLI 226
>gi|118411124|ref|YP_874518.1| 50S ribosomal protein L1 [Thalassiosira pseudonana] >gi|125987547|sp|A0T0Q6|RK1_THAPS Chloroplast 50S ribosomal protein L1 >gi|116739871|gb|ABK20741.1| 50S ribosomal protein L1 [Thalassiosira pseudonana] (230 aa)
Score = 422, Expect = 1.2e-39, Identities = 88/206 (42%), Positives = 139/206 (67%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           ++EEA+ L + T+ AKF+ S+++   LN+DT  +DQQLR TV+LP+  GK  RI VL       +A   G +  G  ELI +IS+G L+FDL++ TP MMP+L+KLG++LG +GLMP+PK+G V+T+L +T+++FKKG  +Y+ D  G +H+  GKAN    +++EN+  L   I   R + VKG + + + + ++MGP I++ +N
  S:    22 SLEEAITLLQDTATAKFIESVELHANLNIDTKYADQQLRTTVTLPHGIGKSMRIAVLTNEANFNEANEGGADIVGSQELIDDISQGNLNFDLLVATPDMMPKLAKLGRVLGPKGLMPSPKSGTVSTNLTETLSDFKKGKFEYKADKTGVVHVNFGKANFSKDQLMENLTSLYQSIEQNRPSGVKGKYFKSLFICTSMGPSIQLDLN 227
>gi|167216527|ref|ZP_02286163.1| 50S ribosomal protein L1 [Listeria monocytogenes FSL J1-175] (237 aa)
Score = 422, Expect = 1.2e-39, Identities = 92/209 (44%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YT EEAV LAK+   AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ G+SE + +I++GW +FD+I+ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GN+H  +GK + D AK+VEN   +   +   +  + KG +++ +++++T GPGI+V
  S:    24 DANKVYTAEEAVELAKKIDFAKFDATVEVAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKINQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEYRVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGIKV 232
>gi|160941937|ref|ZP_02089262.1| hypothetical protein CLOBOL_06831 [Clostridium bolteae ATCC BAA-613] >gi|158435144|gb|EDP12911.1| hypothetical protein CLOBOL_06831 [Clostridium bolteae ATCC BAA-613] (267 aa)
Score = 422, Expect = 1.3e-39, Identities = 90/215 (41%), Positives = 136/215 (63%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           N DR   Y I +A+ L K+ ++AKF  ++++ I+   D   +DQQ+RG V LP+  GK  RILV  KG    +A++ G ++ G  ELI  I + GWLDFD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ VGKA+    ++ +N   L+  I   + ++VKG +++ V L+STMGPG+++ V K
  S:    49 NVDRAALYDIADAITLVKKNASAKFDETVELHIRTGCDGRHADQQIRGAVVLPHGTGKTVRILVFAKGPKADEAQAAGADYVGAEELIPRIQNDGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAINDIKAGKIEYRLDKTNIIHVPVGKASFTEEQLADNFQTLIDAIMKAKPSTVKGAYLKSVALTSTMGPGVKLNVAK 264
>gi|85858135|ref|YP_460337.1| 50S ribosomal protein L1P [Syntrophus aciditrophicus SB] >gi|123515677|sp|Q2LQ90|RL1_SYNAS 50S ribosomal protein L1 >gi|85721226|gb|ABC76169.1| LSU ribosomal protein L1P [Syntrophus aciditrophicus SB] (232 aa)
Score = 422, Expect = 1.3e-39, Identities = 89/204 (43%), Positives = 129/204 (63%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           YT+ EA+ L   T+ AKF  +++ A++L ++ + +DQ +RG+V LP   GK  R+LV  KG  +K+A   G ++AG  E I +I  GWL+FD +I TP MM  + KLGKILG RGLMPNPK G VT D+   + E K G  ++R +  G +H  VGK +    +++ENI  L+  I   +  + KG +I+ + LSSTMGPG+RV
  S:    21 YTLSEALALVTDTARAKFDETVEAAVRLGVNPAHADQMVRGSVVLPNGLGKTVRVLVFAKGEKEKEALDAGADYAGSDEFIEKIKSGWLEFDRVIATPDMMGNVGKLGKILGPRGLMPNPKVGTVTFDVATAVKEVKAGKVEFRVEKAGIVHSPVGKVSFGPDRLMENIQALIEMIIKLKPATSKGTYIKGIALSSTMGPGVRV 224
>gi|89100745|ref|ZP_01173600.1| 50S ribosomal protein L1 [Bacillus sp. NRRL B-14911] >gi|89084562|gb|EAR63708.1| 50S ribosomal protein L1 [Bacillus sp. NRRL B-14911] (232 aa)
Score = 422, Expect = 1.4e-39, Identities = 96/216 (44%), Positives = 146/216 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           DR+K Y + EA+ LAK+T+ AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GDSE I +IS+GW +FD+I+ TP MM E+ KLG+ LG +GLMPNPK G VT D+ K + E K G  +YR D  G IH+ +GK + + AK+ EN N +   +   +  + KG +++ V +++TMGPG++V  +  AV
  S:    16 DRSKAYPVAEAIELAKKTNYAKFDATVEVAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDSEYINKISQGWFEFDVIVATPDMMGEVGKLGRTLGPKGLMPNPKTGTVTFDVEKAVNEIKAGKVEYRLDKAGIIHVPIGKTSFEDAKLAENFNTIYDTMLKVKPAAAKGTYVKSVTVTTTMGPGVKVDPSTAAV 231
>gi|78221836|ref|YP_383583.1| 50S ribosomal protein L1 [Geobacter metallireducens GS-15] >gi|91207354|sp|Q39Y16|RL1_GEOMG 50S ribosomal protein L1 >gi|78193091|gb|ABB30858.1| LSU ribosomal protein L1P [Geobacter metallireducens GS-15] (234 aa)
Score = 422, Expect = 1.5e-39, Identities = 89/221 (40%), Positives = 139/221 (62%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T K  ++     DR++ Y + E +   K  + AKF  ++++A++L +D   +DQ +RG V LP   GK+ R+LV  KG  +K+A+  G +H G  +L+A+I +GW DFD  I TP MM  + K+GK+LG RGLMPNPK G VT D+ + + E K G  ++R +  G +H  VGKA+ D  K+ EN+  L+  +   + ++ KG +I+K++LSSTMGPG+ +
  S:     4 TAKKHREALAKIDRSRTYPLVEGIESVKSVAYAKFDETVEVAVRLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEKEKEARDAGADHVGAEDLVAKIQEGWFDFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDVGRAVKESKAGKVEFRVEKAGIVHAPVGKASFDADKLKENLLALVEALVKAKPSAAKGTYIKKISLSSTMGPGLNL 224
>gi|29831454|ref|NP_826088.1| 50S ribosomal protein L1 [Streptomyces avermitilis MA-4680] >gi|33301549|sp|Q82DQ8|RL1_STRAW 50S ribosomal protein L1 >gi|29608569|dbj|BAC72623.1| putative ribosomal protein L1 [Streptomyces avermitilis MA-4680] (241 aa)
Score = 422, Expect = 1.5e-39, Identities = 94/225 (41%), Positives = 143/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +K  +      DR K Y   EAV LAK+TS +KF  ++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A++ G +  G  ELI E+SKG LDFD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + E K G  ++R D + N+H ++GK + D  ++VEN    L  I   + ++ KG +I+K  +S+T+GPGI +  N+T
  S:     5 SKALRAADAKIDREKLYAPLEAVRLAKETSTSKFDGTVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAEAARAAGADIVGSDELIDEVSKGRLDFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTPDVVKAVNEIKGGKIEFRVDKHSNLHFIIGKTSFDDTQLVENYGAALDEILRLKPSAAKGRYIKKAAISTTIGPGIPIDSNRT 229
>gi|152973945|ref|YP_001373462.1| 50S ribosomal protein L1 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189041802|sp|A7GK09|RL1_BACCN 50S ribosomal protein L1 >gi|152022697|gb|ABS20467.1| ribosomal protein L1 [Bacillus cereus subsp. cytotoxis NVH 391-98] (230 aa)
Score = 421, Expect = 1.8e-39, Identities = 93/212 (43%), Positives = 142/212 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +R   Y+  EAV L K+T+ AKF ++++ A +L +D  K+DQQ+RG V LP+  GK +R+LV  KG   K+A++ G +  GD++ I +I +GW DFD+++ TP MM E+ KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GK + + AK+VEN   +   +   +  + KG +++ V ++STMGPG+RV V+
  S:    16 ERATAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYINKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEDAKLVENFKTIADTLLKAKPAAAKGTYMKNVTVTSTMGPGVRVDVS 227
>gi|189485235|ref|YP_001956176.1| 50S ribosomal protein L1 [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287194|dbj|BAG13715.1| 50S ribosomal protein L1 [uncultured Termite group 1 bacterium phylotype Rs-D17] (227 aa)
Score = 421, Expect = 1.9e-39, Identities = 99/209 (47%), Positives = 146/209 (69%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLD--FDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   Y + EAV L K+T+ AKF  +I+I IKL +D  +SDQ +RGT+S+P+  G+ ++I VL KG  QK+A++ G +  G  +LI +ISKG L   FD+++ TP +M +LS++ KILG +GLMPNPK+G VT ++ KT+ E KKG  +Y+ DS+G IH+ VGKA+ +  K+  NI  LL  +A  +  S KG +I+ +++SSTMGPGI V
  S:    13 DKNMVYKLTEAVILVKETAKAKFDETIEIHIKLGIDPKRSDQMVRGTISIPHGIGRTRKIAVLAKGEKQKEAEAAGADIIGSDDLIEDISKGKLGSGFDVLVATPDVMKDLSRVAKILGPKGLMPNPKSGTVTFEIGKTVEELKKGRVEYKNDSFGIIHVPVGKASFEKEKLENNIKTLLEAVAKAKPLSSKGQYIKSISISSTMGPGIFV 223
>gi|16077171|ref|NP_387984.1| 50S ribosomal protein L1 [Bacillus subtilis subsp. subtilis str. 168] >gi|1172984|sp|Q06797|RL1_BACSU 50S ribosomal protein L1 (BL1) >gi|2632370|emb|CAB11879.1| ribosomal protein L1 (BL1) [Bacillus subtilis subsp. subtilis str. 168] (232 aa)
Score = 421, Expect = 1.9e-39, Identities = 92/209 (44%), Positives = 141/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D +K Y + EAV L K+T+ AKF +++++A +L +D SK+ QQ+RG V LP   GK +R+LV  KG   K+A++ G +  GD++ I +I +GW DFD+I+ TP MM E+ K+G++LG +GLMPNPK G VT ++ K I E K G  +YR D  GNIH+ +GK + +  K+VEN   +   I   +  + KG++++ V ++STMGPG++V
  S:    16 DHSKAYDVSEAVALVKKTNTAKFDATVEVAFRLGVDPSKNHQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKIQQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEYRVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKV 224
>gi|24216122|ref|NP_713603.1| 50S ribosomal protein L1 [Leptospira interrogans serovar Lai str. 56601] >gi|45656644|ref|YP_000730.1| 50S ribosomal protein L1 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|33301448|sp|Q8F0R9|RL1_LEPIN 50S ribosomal protein L1 >gi|61215624|sp|Q72UB1|RL1_LEPIC 50S ribosomal protein L1 >gi|24197365|gb|AAN50621.1|AE011500_8 ribosomal protein L1 [Leptospira interrogans serovar Lai str. 56601] >gi|45599880|gb|AAS69367.1| 50S ribosomal protein L1 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (230 aa)
Score = 421, Expect = 2.0e-39, Identities = 95/213 (44%), Positives = 140/213 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           D TKF++I++AV LAK TS  KF  +++IA K+N    KS Q +RGT+SLP+  GK+ R+LV  KG  Q DAK+ G +  GD++LI +++ GW DFD  + TP MM ++ KLG ILG +GLMP PK G VTTD+ K + E K G  +YR D  G +H+ VGK + D  K++ENI  ++  +   + +  KG +++  ++S TMG G++V V +
  S:    15 DSTKFFSIDKAVELAKSTSYTKFDGTLEIATKVNY---KSLQNIRGTISLPHGTGKKIRVLVFCKGDKQNDAKAAGADFVGDTDLIEKVAGGWTDFDACVATPDMMKDVGKLGPILGRKGLMPKPKAGTVTTDVAKAVNELKAGRIEYRPDKGGVVHLGVGKVSFDNTKLIENIRTVVQTLMRDKPSDAKGEYLKTFSISPTMGVGVKVDVKE 224
>gi|89898124|ref|YP_515234.1| 50S ribosomal protein L1 [Chlamydophila felis Fe/C-56] >gi|123722319|sp|Q255E9|RL1_CHLFF 50S ribosomal protein L1 >gi|89331496|dbj|BAE81089.1| 50S ribosomal protein L1 [Chlamydophila felis Fe/C-56] (232 aa)
Score = 421, Expect = 2.0e-39, Identities = 92/211 (43%), Positives = 133/211 (63%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++D +K Y+++EA+++ KQ    +F  ++D++IKL +D  KSDQQ+RG+VSLP   GK  RILV   G   K+A   G +  G  +L+ +I  GW+DFD+ + TP MM E+ KLGK+LG R LMP PK G VTTD+ K IAE +KG  +++ D  G  +  VGK + D   + ENI  L S +   +  + KG ++    +SSTMGPGI V
  S:    14 SYDFSKSYSLQEAIDILKQCPTVRFDQTVDVSIKLGIDPKKSDQQIRGSVSLPNGTGKTLRILVFAAGEKAKEALDAGADFVGSDDLVEKIKGGWVDFDVAVATPDMMREVGKLGKVLGPRNLMPTPKAGTVTTDVVKAIAELRKGKIEFKADRAGVCNAGVGKLSFDGQLLKENIEALCSALIKAKPPAAKGQYLVSFTVSSTMGPGISV 224
>gi|116327513|ref|YP_797233.1| 50S ribosomal protein L1 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|122284687|sp|Q054E5|RL1_LEPBL 50S ribosomal protein L1 >gi|116120257|gb|ABJ78300.1| 50S Ribosomal protein L1 [Leptospira borgpetersenii serovar Hardjo-bovis L550] (230 aa)
Score = 421, Expect = 2.1e-39, Identities = 97/213 (45%), Positives = 138/213 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           D TKF+ I++AV LAK TS  KF  +++IA K+N    KS Q +RGT+SLP+  GK+ R+LV  KG  Q DAK+ G    GD +LI +++ GW DFD  + TP MM ++ KLG ILG +GLMP PK G VTTD+ K + E K G  +YR D  G +H+ VGK + D AK+VENI  ++  +   + +  KG +++  ++S TMG G++V V +
  S:    15 DSTKFFNIDQAVELAKSTSYTKFDGTVEIATKVNY---KSLQNIRGTISLPHGNGKKVRVLVFCKGDKQNDAKAAGAEFVGDMDLIEKVAGGWTDFDACVATPDMMKDVGKLGPILGRKGLMPKPKAGTVTTDVAKAVNELKSGRVEYRPDKGGVVHLGVGKVSFDNAKLVENIRTVVQTLMRDKPSDAKGDYLKTFSVSPTMGVGVKVDVKE 224
>gi|7767184|pdb|487D|H Chain H, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution (224 aa)
Score = 420, Expect = 2.2e-39, Identities = 88/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA +L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +M  + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA     K+ +NI   +  + A +    KG F+  V +++TMGP +R+
  S:    11 DPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKACFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRI 220
>gi|46200041|ref|YP_005708.1| 50S ribosomal protein L1 [Thermus thermophilus HB27] >gi|730540|sp|P27150|RL1_THETH 50S ribosomal protein L1 >gi|61215616|sp|Q72GV9|RL1_THET2 50S ribosomal protein L1 >gi|7245459|pdb|1EG0|N Chain N, Fitting Of Components With Known Structure Into An 11.5 A Cryo-Em Map Of The E.Coli 70s Ribosome >gi|119389735|pdb|2HGJ|C Chain C, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. >gi|119389792|pdb|2HGQ|C Chain C, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgp. >gi|119389848|pdb|2HGU|C Chain C, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgr. >gi|149240886|pdb|1VSA|A Chain A, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2ow8 >gi|160285428|pdb|1VSP|A Chain A, Interactions And Dynamics Of The Shine-Dalgarno Helix In The 70s Ribosome. This File, 1vsp, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2qnh >gi|587584|emb|CAA57139.1| ribosomal protein L1 [Thermus thermophilus] >gi|46197669|gb|AAS82081.1| LSU ribosomal protein L1P [Thermus thermophilus HB27] (229 aa)
Score = 420, Expect = 2.2e-39, Identities = 88/209 (42%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA +L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +M  + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +    KG F+  V +++TMGP +R+
  S:    16 DPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRI 225
>gi|7674196|sp|Q9X521|RL1_STRAU 50S ribosomal protein L1 >gi|4580993|gb|AAD24569.1|AF120458_2 ribosomal protein L1 [Streptomyces aureofaciens] (242 aa)
Score = 420, Expect = 2.3e-39, Identities = 97/225 (43%), Positives = 143/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKG--WLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +KT +      DR K Y   EAV LAK+TS  KF S++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G     A++ G +  GD ELI EI+KG    +FD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + E K G  ++R D + N+H ++GK +    K+VEN    L  I   + ++ KG +I+K  LS+TMGPGI++  N+T
  S:     4 SKTLRAADAKVDREKLYAPLEAVRLAKETSATKFDSTVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAAAAEAAGADIVGDDELINEIAKGNRLNEFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTMDVAKAVTEIKGGKIEFRVDKHSNLHFIIGKVSFSDEKLVENYAAALDEIIRLKPSAAKGRYIKKAALSTTMGPGIQLDSNRT 230
>gi|84494811|ref|ZP_00993930.1| 50S ribosomal protein L1 [Janibacter sp. HTCC2649] >gi|84384304|gb|EAQ00184.1| 50S ribosomal protein L1 [Janibacter sp. HTCC2649] (240 aa)
Score = 420, Expect = 2.5e-39, Identities = 92/214 (42%), Positives = 137/214 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           D    YT  EAV LAK  + AK+  ++++A++L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A++ G +  G  +L+ +++ GWLDFD I+ TP +M ++ +LGK+LG RGLMPNPK G VT D  K + + K G  ++R D + N+H ++GKA+ D +K+VEN    L  I   + +S KG +I K  +S+TMGPGI V   KT
  S:    15 DADNAYTPLEAVRLAKTGAKAKYDETVEVAMRLGIDPRKADQMVRGTVNLPHGTGKTARVLVFANGDKAEAARAAGADFVGSDDLLEKVAGGWLDFDAIVATPDLMGKVGRLGKVLGPRGLMPNPKTGTVTMDTAKAVTDIKGGKIEFRADKHSNLHFIIGKASFDESKLVENYAAALEEILRLKPSSSKGRYISKATMSTTMGPGIPVDFTKT 228
>gi|157690886|ref|YP_001485348.1| 50S ribosomal protein L1 [Bacillus pumilus SAFR-032] >gi|166984508|sp|A8F971|RL1_BACP2 50S ribosomal protein L1 >gi|157679644|gb|ABV60788.1| ribosomal protein L1 [Bacillus pumilus SAFR-032] (232 aa)
Score = 420, Expect = 2.5e-39, Identities = 92/209 (44%), Positives = 143/209 (68%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +RTK Y + EAV+L K+ + AKF +++++A +L +D  K+DQQ+RG V LP   GK +R+LV  KG   K+A++ G ++ GDS+ I +I +GW +FD+I+ TP MM E+ K+G++LG +GLMPNPK G VT ++ K I E K G  +YR D  GNIH  +GK + +  K+VEN   +   I   +  + KG++++ V+++STMGPG++V
  S:    16 ERTKAYDVAEAVSLTKKANTAKFDATVEVAFRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDSDYITKIQQGWFEFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAINEIKAGKVEYRVDKAGNIHAPIGKVSFEDEKLVENFATIYDTILKAKPAAAKGVYVKNVSVTSTMGPGVKV 224
>gi|14278033|pdb|1GIY|C Chain C, Crystal Structure Of The Ribosome At 5.5 A Resolution. This File, 1giy, Contains The 50s Ribosome Subunit. The 30s Ribosome Subunit, Three Trna, And Mrna Molecules Are In The File 1gix >gi|28373722|pdb|1ML5|CC Chain c, Structure Of The E. Coli Ribosomal Termination Complex With Release Factor 2 >gi|66361019|pdb|1YL3|C Chain C, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. Large Subunit. The Coordinates For The Small Subunit Are In The Pdb Entry 1yl4. >gi|546099|gb|AAB30332.1| ribosomal protein L1, ribosomal protein TL2 [Thermus thermophilus, VK-1, Peptide, 228 aa] (228 aa)
Score = 420, Expect = 2.5e-39, Identities = 88/209 (42%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA +L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +M  + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +    KG F+  V +++TMGP +R+
  S:    15 DPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRI 224
>gi|157829807|pdb|1AD2|A Chain A, Ribosomal Protein L1 Mutant With Serine 179 Replaced By Cysteine (228 aa)
Score = 420, Expect = 2.6e-39, Identities = 88/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA +L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +M  + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA     K+ +NI   +  + A +    KG F+  V +++TMGP +R+
  S:    15 DPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKACFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRI 224
>gi|77918305|ref|YP_356120.1| 50S ribosomal protein L1 [Pelobacter carbinolicus DSM 2380] >gi|91207365|sp|Q3A6Q7|RL1_PELCD 50S ribosomal protein L1 >gi|77544388|gb|ABA87950.1| LSU ribosomal protein L1P [Pelobacter carbinolicus DSM 2380] (233 aa)
Score = 420, Expect = 2.7e-39, Identities = 91/219 (41%), Positives = 137/219 (62%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     DR++ Y I EA+ L K+ ++AKF  +++I+++L +D  K+DQ +RG V LP   GK+ ++LV  KG    +AK  G ++ G  +L+A+I +GW DFD  I TP MM  + K+G++LG RGLMPNPK G VT ++ K  +E K G  +YR +  G +H  VGK + D  K+ EN+  L   +   +  + KG + +K++LSSTMGPGI V
  S:     5 KLHKQAKEKVDRSQVYPIGEALALVKEVAHAKFDETVEISVRLGVDPRKADQMVRGAVVLPNGLGKDVKVLVFAKGEKAIEAKEAGADYVGGDDLVAKIQEGWFDFDTAIATPDMMGTVGKIGRLLGPRGLMPNPKVGTVTFEVGKATSEAKSGKVEYRVEKAGIVHAPVGKVSFDAEKLQENLVALFDALVKAKPATAKGTYFKKMSLSSTMGPGINV 223
>gi|194342085|gb|EDX23051.1| 50S ribosomal protein L1 [Streptomyces sp. Mg1] >gi|194346216|gb|EDX27182.1| 50S ribosomal protein L1 [Streptomyces sp. Mg1] (242 aa)
Score = 419, Expect = 2.8e-39, Identities = 95/225 (42%), Positives = 142/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKG--WLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +KT +      DR K Y   EAV LAK+TS  KF  ++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G     A++ G +  GD ELI EI+KG    +FD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + E K G  ++R D + N+H ++GK +    ++VEN    L  I   + ++ KG +I+K  LS+TMGPGI++  N+T
  S:     4 SKTLRAADAKVDREKLYAPLEAVRLAKETSTTKFDGTVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAAAAEAAGADIVGDDELINEIAKGNRLNEFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTMDVAKAVTEIKGGKIEFRVDKHSNLHFIIGKVSFSDEQLVENYGAALDEILRLKPSAAKGRYIKKAALSTTMGPGIQLDSNRT 230
>gi|95930696|ref|ZP_01313429.1| ribosomal protein L1 [Desulfuromonas acetoxidans DSM 684] >gi|95133176|gb|EAT14842.1| ribosomal protein L1 [Desulfuromonas acetoxidans DSM 684] (233 aa)
Score = 419, Expect = 3.1e-39, Identities = 88/211 (41%), Positives = 132/211 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           DR   Y++ +AV L K  + AKF  ++D+ ++L +D  K+DQ +RG V LP+  GK  R+LV  KG   ++A   G +  G  +L+ +I  GW DFD  I TP MM  + K+G++LG RGLMPNPK G VT D+ + + E K G  +YR +  G IH  VGK + D  K+ +N+  L+  +   + ++ KG +++K++LSSTMGPGI+V V
  S:    15 DRAVAYSLSDAVELVKGAAFAKFDETVDLTVRLGVDPRKADQMVRGAVVLPHGLGKSVRVLVFAKGEKAQEALDAGADFVGGDDLVEKIQGGWFDFDTAIATPDMMGVVGKIGRLLGPRGLMPNPKVGTVTFDVGRAVGESKSGKVEYRVEKAGIIHAPVGKVSFDADKLQDNVVSLMDALVKAKPSTAKGTYLKKISLSSTMGPGIQVDV 225
>gi|117927505|ref|YP_872056.1| 50S ribosomal protein L1P [Acidothermus cellulolyticus 11B] >gi|160165572|sp|A0LRL0|RL1_ACIC1 50S ribosomal protein L1 >gi|117647968|gb|ABK52070.1| LSU ribosomal protein L1P [Acidothermus cellulolyticus 11B] (239 aa)
Score = 419, Expect = 3.2e-39, Identities = 88/213 (41%), Positives = 142/213 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           DRTK Y+  EA+ LAKQT+  +  +++++A++L +D  K+DQ +RGTV+LP+  GK  R+LV       ++A++ G ++ G  ELI +++ G+LDFD ++ TP +M ++ +LG+ILG RGLMPNPK G VT D+ K +A+ K G  ++R D   N+H+V+GK +    ++VEN    L  +   +  + KG +++KV +S+TMGPGI V  N+
  S:    15 DRTKLYSPLEAMRLAKQTNTMRVPATVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTPRVLVFATAERAEEARAAGADYVGADELIEQVANGFLDFDAVVATPDLMGKVGRLGRILGPRGLMPNPKTGTVTNDVAKAVADIKSGKIEFRVDRQANLHLVIGKTDFTEQQLVENYAAALDEVLRLKPPTAKGRYLKKVTISTTMGPGIPVDPNR 227
>gi|146297206|ref|YP_001180977.1| ribosomal protein L1 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|160165768|sp|A4XLK1|RL1_CALS8 50S ribosomal protein L1 >gi|145410782|gb|ABP67786.1| LSU ribosomal protein L1P [Caldicellulosiruptor saccharolyticus DSM 8903] (229 aa)
Score = 419, Expect = 3.3e-39, Identities = 94/209 (44%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+TK Y  EEA++LA +TS AKF  ++++ ++LN+D   +DQQ+RGTV LP   GK  R+LV  KG   K+A+  G ++ G  EL+A+I ++GW DFD+ I TP MM  + +LGK+LG +GLMPNPK+G VT D+ K + E K G  ++R D    IH  +GK +    K++EN   L+  I   R  + KG FI+ + +++TMGPGI+V
  S:    15 DKTKLYDPEEAIDLALKTSYAKFDETVEVHVRLNVDPRHADQQVRGTVVLPNGTGKNVRVLVFAKGDKAKEAEEAGADYVGAEELVAKIQNEGWTDFDVCIATPDMMGLVGRLGKVLGPKGLMPNPKSGTVTMDIAKAVKEAKAGRVEFRLDKTAIIHCPIGKVSFGKEKLLENYRTLMDAIIKAR-PAAKGQFIKSITVATTMGPGIKV 223
>gi|187251892|ref|YP_001876374.1| ribosomal protein L1 [Elusimicrobium minutum Pei191] >gi|186972052|gb|ACC99037.1| ribosomal protein L1 [Elusimicrobium minutum Pei191] (226 aa)
Score = 419, Expect = 3.4e-39, Identities = 94/215 (43%), Positives = 142/215 (66%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           N D  K Y++ EA  L K+ + AKF  ++++ I L +DT K+DQQ+R TV LP   GK K+I V+ KG   K+A+  G +  G  ++I ++ KG ++FD+++ TP  M +LSK  K+LG RGLMPNPK+G VT DL K I+E K G  +++ D+YG +H +VGKA+ D  K+ +N   ++  I   + T+ KG +++ ++LSSTMGPG+RV  NK
  S:    11 NIDVKKLYSVSEAAALVKENAKAKFDETVELHIALGIDTRKADQQVRSTVVLPNGTGKTKKIAVVAKGEKAKEAQEAGADLVGGDDIIEDVMKGVINFDVLLATPDTMKDLSKAAKVLGPRGLMPNPKSGTVTFDLAKAISELKAGRIEFKADAYGIVHTIVGKASFDADKLAQNAKAIIDTILRIKPTTAKGQYVKSISLSSTMGPGVRVDGNK 225
>gi|167041786|gb|ABZ06528.1| putative ribosomal protein L1p/L10e family protein [uncultured marine microorganism HF4000_093M11] (229 aa)
Score = 419, Expect = 3.5e-39, Identities = 92/220 (41%), Positives = 137/220 (62%)
  Q:     9 NKTPKKPSV---NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           NK  K+  V     D  K Y ++EA+ + K+    KF  S+D+A++L +DT K++Q +RGT S+P   GKE R+LV  K      A+  G ++ G  E   +I +GWL+FD ++ TP MM  + ++GKILG RGLMPNPK G VT ++   I   K G  ++R D  GN+H  VGK + DT KI EN++ L+  +   + +S KGI++   ++SSTMGPG++V
  S:     2 NKQSKRTKVFQEKVDAEKLYPLKEAIEILKEVKATKFDESVDVALRLGVDTRKAEQMVRGTCSMPNGLGKEVRVLVFAKADKAIAAQDAGADYVGGEEYAKKIQEGWLEFDRVVATPDMMAVVGRIGKILGPRGLMPNPKVGTVTFEVESIIKNIKAGQVEFRADKQGNLHASVGKISFDTDKICENVSALVDTVKRMKPSSSKGIYLRNFSVSSTMGPGLKV 224
>gi|182436666|ref|YP_001824385.1| putative 50S ribosomal protein L1 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|548758|sp|P36256|RL1_STRGR 50S ribosomal protein L1 >gi|1333827|emb|CAA51298.1| ribosomal protein L1 [Streptomyces griseus] >gi|2447005|dbj|BAA22446.1| ribosomal protein L1 [Streptomyces griseus] >gi|178465182|dbj|BAG19702.1| putative 50S ribosomal protein L1 [Streptomyces griseus subsp. griseus NBRC 13350] (240 aa)
Score = 418, Expect = 3.6e-39, Identities = 93/225 (41%), Positives = 141/225 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +K  +      DR + Y   EAV LAK+TS+ KF  ++++A  L +D  K+DQ +RGTV+LP+  GK  R+LV   G     A++ G +  G  ELI E++KG LDFD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + + K G  ++R D + N+H ++GK + D  K+VEN    L  I   + ++ KG +I+K  L++TMGPGI +  N+T
  S:     4 SKNLRAADAKVDRERNYAPLEAVRLAKETSSTKFDGTVEVAFALGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAAAAEAAGADIVGADELIDEVAKGRLDFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTPDVVKAVNDIKGGKIEFRVDKHSNLHFIIGKVSFDETKLVENYAAALEEILRLKPSAAKGRYIKKATLATTMGPGIPLDANRT 228
>gi|1350684|sp|P48951|RL1_STRVG 50S ribosomal protein L1 >gi|1217913|dbj|BAA09303.1| ribosomal protein L1 [Streptomyces virginiae] (242 aa)
Score = 418, Expect = 4.0e-39, Identities = 95/225 (42%), Positives = 141/225 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKG--WLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +KT +      DR K Y   EAV LAK+TS  KF  ++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G     A++ G +  GD ELI EI+KG    +FD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + E K G  ++R D + N+H ++GK +    ++VEN    L  I   + ++ KG +I+K  LS+TMGPGI +  N+T
  S:     4 SKTLRAADAKVDREKLYAPLEAVRLAKETSTTKFDGTVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAAAAEAAGADIVGDDELINEIAKGNRLNEFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTMDVAKAVTEIKGGKIEFRVDKHSNLHFIIGKVSFTDEQLVENYGAALDEILRLKPSAAKGRYIKKAALSTTMGPGIHLDSNRT 230
>gi|71903030|ref|YP_279833.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS6180] >gi|91207382|sp|Q48UX8|RL1_STRPM 50S ribosomal protein L1 >gi|71802125|gb|AAX71478.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS6180] (229 aa)
Score = 418, Expect = 4.2e-39, Identities = 93/209 (44%), Positives = 139/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV L K+T+ AKF +S+++A  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  +S+LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D  K+VEN       +A  +  + KG ++  V+++ST G GI+V
  S:    16 DSTKAYSVEEAVALVKETNFAKFDASVEVAYNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKINGGWLDFDVVIATPDMMAIVSRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGIKV 224
>gi|116331874|ref|YP_801592.1| 50S ribosomal protein L1 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122280391|sp|Q04QI6|RL1_LEPBJ 50S ribosomal protein L1 >gi|116125563|gb|ABJ76834.1| 50S Ribosomal protein L1 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (230 aa)
Score = 418, Expect = 4.4e-39, Identities = 96/213 (45%), Positives = 138/213 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           D TKF+ I++AV LAK TS  KF  +++IA K++    KS Q +RGT+SLP+  GK+ R+LV  KG  Q DAK+ G    GD +LI +++ GW DFD  + TP MM ++ KLG ILG +GLMP PK G VTTD+ K + E K G  +YR D  G +H+ VGK + D AK+VENI  ++  +   + +  KG +++  ++S TMG G++V V +
  S:    15 DSTKFFNIDQAVELAKSTSYTKFDGTVEIATKVDY---KSLQNIRGTISLPHGNGKKVRVLVFCKGDKQNDAKAAGAEFVGDMDLIEKVAGGWTDFDACVATPDMMKDVGKLGPILGRKGLMPKPKAGTVTTDVAKAVNELKSGRVEYRPDKGGVVHLGVGKVSFDNAKLVENIRTVVQTLMRDKPSDAKGDYLKTFSVSPTMGVGVKVDVKE 224
>gi|139438534|ref|ZP_01772050.1| Hypothetical protein COLAER_01048 [Collinsella aerofaciens ATCC 25986] >gi|133776073|gb|EBA39893.1| Hypothetical protein COLAER_01048 [Collinsella aerofaciens ATCC 25986] (237 aa)
Score = 418, Expect = 4.4e-39, Identities = 92/228 (40%), Positives = 140/228 (61%)
  Q:     1 MANQKKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           MA   K  N   +K     DR   YT  +A  L K+   AKF  +++   +L +DT K+DQ +RG++SLP+  GK  R+ V  +G   ++A++ G +  G  EL+A+I KG ++FD  I TP MM ++ ++GKILG RGLMPNPK G VT D+ K ++E K G  +YR D YG  H+ +GK +    ++VEN   L + I   + +S KG +++ +++SSTMGPG++V
  S:     3 MAKHGKSYNAAAEK----IDRATLYTPLQAAKLIKELDTAKFDETVEAHFRLGIDTRKADQNIRGSISLPHGTGKTVRVAVFAEGEKAREAEAAGADIIGSDELVAQIQKGEINFDAAIATPNMMAKVGRIGKILGPRGLMPNPKLGTVTMDVAKMVSELKAGRVEYRADRYGICHVPLGKKSFSEQQLVENYAALYTEILRVKPSSAKGKYVKSISVSSTMGPGVKV 226
>gi|55980215|ref|YP_143512.1| 50S ribosomal protein L1 [Thermus thermophilus HB8] >gi|62287206|sp|Q5SLP7|RL1_THET8 50S ribosomal protein L1 >gi|116668234|pdb|2J01|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. >gi|116668295|pdb|2J03|C Chain C, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4). This File Contains The 50s Subunit From Molecule Ii. >gi|157836521|pdb|2V47|C Chain C, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 2 Of 4). This File Contains The 50s Subunit For Molecule 1. >gi|165760895|pdb|2OM7|K Chain K, Structural Basis For Interaction Of The Ribosome With The Switch Regions Of Gtp-Bound Elongation Factors >gi|55771628|dbj|BAD70069.1| 50S ribosomal protein L1 [Thermus thermophilus HB8] (229 aa)
Score = 418, Expect = 4.6e-39, Identities = 88/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA  L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +M  + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +    KG F+  V +++TMGP +R+
  S:    16 DPNKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRI 225
>gi|169190360|ref|ZP_02850332.1| ribosomal protein L1 [Paenibacillus sp. JDR-2] >gi|169002967|gb|EDS49842.1| ribosomal protein L1 [Paenibacillus sp. JDR-2] (230 aa)
Score = 417, Expect = 4.9e-39, Identities = 90/204 (44%), Positives = 134/204 (65%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y   EA+ L K+ + AKF  S+++A++L +D  K DQ +RG V LP+  GK KR+LV  KG   K+A++ G +  GDS++I +I +GW +FD+ + TP MM E+ KLG+ILG +GLMPNPK G VT D+ K + E K G  +YR D  G IH  +GK + D  K+ EN+  L+  +   +  + KG++++ +++SSTMGPG RV
  S:    21 YESLEAIELVKKAATAKFDESVEVAVRLGVDPRKQDQAVRGVVVLPHGTGKTKRVLVFAKGDKAKEAEAAGADFVGDSDMINKIQQGWFEFDVCVATPDMMAEVGKLGRILGGKGLMPNPKAGTVTFDVTKAVQEIKAGKIEYRLDKAGQIHAPIGKVSFDAEKLNENLKSLIDALNRAKPAAAKGVYLKNISVSSTMGPGARV 224
>gi|163764753|ref|ZP_02171807.1| ribosomal protein S9 [Bacillus selenitireducens MLS10] >gi|160354779|gb|EDP81438.1| ribosomal protein S9 [Bacillus selenitireducens MLS10] (231 aa)
Score = 417, Expect = 5.4e-39, Identities = 89/212 (41%), Positives = 142/212 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           DR K Y I EAV L ++ + +KF  +I++A +L +D  K+DQQ+RG + LP+  GK + +LV  KG   K+A++ G +  G+ +LI ++++GW+DFD+++ TP MM ++ KLG+ LG +GLMPNPK G VT D+ K + E K G  +YR D  GNIH+ +GKA+ D  K+ EN   ++  +   +  + KG ++  V+++STMGPG++V V+
  S:    16 DREKLYNISEAVELVQKNATSKFDETIEMAARLGVDPKKADQQIRGAMVLPHGTGKTQTVLVFAKGDKAKEAEAAGADFVGEDDLINKVAQGWMDFDVVVATPDMMAQVGKLGRTLGPKGLMPNPKTGTVTFDVTKAVEEIKAGKVEYRVDKSGNIHVPLGKASFDQQKLEENFTAMVDQLVKIKPAASKGTYLRNVSITSTMGPGLKVDVS 227
>gi|196235914|ref|ZP_03134714.1| ribosomal protein L1 [Thermus aquaticus Y51MC23] >gi|196219811|gb|EDY14430.1| ribosomal protein L1 [Thermus aquaticus Y51MC23] (229 aa)
Score = 416, Expect = 6.4e-39, Identities = 91/209 (43%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA  L K+ + AKF  ++++  KL +D  KSDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +M  + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +  + KG F+  V ++STMGP IR+
  S:    16 DPGKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPRKSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIKEIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIKALEASKPEAAKGTFLRSVYVTSTMGPSIRI 225
>gi|114567853|ref|YP_755007.1| ribosomal protein L1 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317275|sp|Q0AUG8|RL1_SYNWW 50S ribosomal protein L1 >gi|114338788|gb|ABI69636.1| LSU ribosomal protein L1P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (233 aa)
Score = 416, Expect = 6.4e-39, Identities = 88/219 (40%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++    FDR   Y  +EA+ L K+ + AKF  ++++ IKL +D   +DQQ+RGTVSLP   GK +++LV  KG   K+A+  G ++ G  +L  +I  GW DFD+ + TP MM  + K+GKILG RGLMPNPK G VT D+ +TI E K G  +YR D    +H  +G+ + +  K+ EN+N     +   R  + KG ++  V + STM PG+++
  S:     5 KNYQQAGEKFDRLTLYEPKEALELVKEIAKAKFDETVEVHIKLGVDPRHADQQVRGTVSLPNGTGKTRKVLVFAKGEKIKEAELAGADYVGGEDLAEKIQGGWFDFDVAVATPDMMAVVGKMGKILGPRGLMPNPKAGTVTFDIERTIKELKAGRIEYRVDKSAIVHAPIGRISFEVDKLQENLNAFAEALLKARPAAAKGQYMRSVTVCSTMSPGVKI 223
>gi|171780177|ref|ZP_02921081.1| hypothetical protein STRINF_01965 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281525|gb|EDT46960.1| hypothetical protein STRINF_01965 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (229 aa)
Score = 416, Expect = 6.6e-39, Identities = 91/209 (43%), Positives = 140/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+T+ AKF +S+++A KLN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D  K+VEN   +   +   +  + KG ++  +++++T G GI+V
  S:    16 DSTKAYSVEEAVALAKETNFAKFDASVEVAYKLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKINDGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQAIIGKVSFDADKLVENFKAIHEVMVKSKPATAKGTYMTNLSITTTQGVGIKV 224
>gi|157150680|ref|YP_001450734.1| 50S ribosomal protein L1 [Streptococcus gordonii str. Challis substr. CH1] >gi|189041844|sp|A8AY74|RL1_STRGC 50S ribosomal protein L1 >gi|157075474|gb|ABV10157.1| ribosomal protein L1 [Streptococcus gordonii str. Challis substr. CH1] (229 aa)
Score = 416, Expect = 6.7e-39, Identities = 91/212 (42%), Positives = 138/212 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D TK Y++EEAV LAK+T+ AKF +++++A  LN+D  K+DQQ+RG + LP+  GK  R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  G +  ++GK + D  K+ EN       I   +  + KG ++  + +++T GPGI+V VN
  S:    16 DSTKAYSVEEAVALAKETNFAKFDATVEVAYNLNIDVKKADQQIRGAMVLPHGTGKTARVLVFARGAKAEEAKAAGADFVGEDDLVAKINDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADRAGIVQAIIGKVSFDADKLAENFKAFNEVIQKAKPATAKGTYVTSLTITTTQGPGIKVDVN 227
>gi|109942288|emb|CAJ84544.1| L1 ribosomal protein [Streptomyces clavuligerus] (240 aa)
Score = 416, Expect = 7.1e-39, Identities = 93/225 (41%), Positives = 144/225 (64%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +K  +      DR + Y   EAV LAK T+++KF  ++++A++L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A++ G +  G  ELI E+SKG LDFD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + + K G  ++R D + N+H ++GK + D  K+VEN    L  I   + ++ KG +I+K  L++TMGPGI +  N+T
  S:     4 SKNLRAADAKIDRERNYAPLEAVRLAKDTASSKFDGTVEVALRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAEAARAAGADIIGADELIDEVSKGRLDFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTPDVAKAVTDIKGGKIEFRVDKHSNLHFIIGKVSFDETKLVENYAAALEEILRLKPSAAKGRYIKKATLTTTMGPGIPLDSNRT 228
>gi|58336698|ref|YP_193283.1| 50S ribosomal protein L1 [Lactobacillus acidophilus NCFM] >gi|75358038|sp|Q5FM22|RL1_LACAC 50S ribosomal protein L1 >gi|58254015|gb|AAV42252.1| 50S ribosomal protein L1 [Lactobacillus acidophilus NCFM] (230 aa)
Score = 416, Expect = 7.7e-39, Identities = 85/209 (40%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K Y++ EA+ L K+TS A F ++ID+A  L++D  ++DQQ+RG++ LP   GK + ++V  +G   + AK+ G +  G  +L+ +I  GWLDFD+++ TP MM ++ +LG++LG +GLMPNPK G VT D+ K +   K G  +YR D    IH  +GK +    ++VEN + L   I   R  S KG +I+ V +S+T GPGI++
  S:    16 DSNKLYSVAEAMKLVKETSYANFDATIDVAYNLSVDPKQADQQIRGSIVLPNGTGKTQTVVVFAEGPQAEQAKAAGADFVGSDDLVEKIQGGWLDFDVVVATPMMMAKVGRLGRVLGPKGLMPNPKTGTVTMDIEKAVKNVKAGQVEYRVDRQAAIHTPIGKVSFTEDQLVENFDALRDVILRARPASAKGQYIKSVAVSATFGPGIKL 224
>gi|15618002|ref|NP_224286.1| 50S ribosomal protein L1 [Chlamydophila pneumoniae CWL029] >gi|15835613|ref|NP_300137.1| 50S ribosomal protein L1 [Chlamydophila pneumoniae J138] >gi|16752966|ref|NP_445239.1| 50S ribosomal protein L1 [Chlamydophila pneumoniae AR39] >gi|33241413|ref|NP_876354.1| 50S ribosomal protein L1 [Chlamydophila pneumoniae TW-183] >gi|6919961|sp|Q9Z9A3|RL1_CHLPN 50S ribosomal protein L1 >gi|4376336|gb|AAD18231.1| L1 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|7189611|gb|AAF38505.1| ribosomal protein L1 [Chlamydophila pneumoniae AR39] >gi|8978451|dbj|BAA98288.1| L1 ribosomal protein [Chlamydophila pneumoniae J138] >gi|33235921|gb|AAP98011.1| ribosomal protein L1 [Chlamydophila pneumoniae TW-183] (232 aa)
Score = 416, Expect = 7.7e-39, Identities = 90/211 (42%), Positives = 134/211 (63%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           N+D +K Y++ EA+++ KQ    +F  ++D++IKL +D  KSDQQ+RG V LP   GK  RILV   G   K+A   G +  G  +L+ +I  GWL+FD+ + TP MM E+ KLGK+LG R LMP PK G VTTD+ K I+E +KG  +++ D  G  ++ VGK + ++++I ENI  L S +   +  + KG ++    +SSTMGPGI +
  S:    14 NYDFSKSYSLREAIDILKQCPPVRFDQTVDVSIKLGIDPKKSDQQIRGAVFLPNGTGKTLRILVFASGNKVKEAVEAGADFMGSDDLVEKIKSGWLEFDVAVATPDMMREVGKLGKVLGPRNLMPTPKTGTVTTDVAKAISELRKGKIEFKADRAGVCNVGVGKLSFESSQIKENIEALSSALIKAKPPAAKGQYLVSFTISSTMGPGISI 224
>gi|21909861|ref|NP_664129.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS315] >gi|28896444|ref|NP_802794.1| 50S ribosomal protein L1 [Streptococcus pyogenes SSI-1] >gi|33301570|sp|Q8K8E6|RL1_STRP3 50S ribosomal protein L1 >gi|21904048|gb|AAM78932.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS315] >gi|28811695|dbj|BAC64627.1| 50S ribosomal protein L1 [Streptococcus pyogenes SSI-1] (229 aa)
Score = 416, Expect = 7.9e-39, Identities = 92/209 (44%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV L K+T+ AKF +S+++A  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D  K+VEN       +A  +  + KG ++  V+++ST G GI+V
  S:    16 DSTKAYSVEEAVALVKETNFAKFDASVEVAYNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKINGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGIKV 224
>gi|585871|sp|Q07976|RL1_STRSF 50S ribosomal protein L1 >gi|303916|dbj|BAA03345.1| L1 equivalent ribosomal protein [Streptomyces sp. FRI-5] (242 aa)
Score = 415, Expect = 8.4e-39, Identities = 94/225 (41%), Positives = 143/225 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKG--WLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +KT +      DR K Y   EAV LAK+TS  KF +++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G     A++ G +  GD ELI EI+KG    +FD ++ TP +M ++ +LG++LG RGLMPNPK G VT D+ K + + K G  ++R D + N+H ++GK +    ++VEN    L  I   + ++ KG +I+K  LS+TMGPGI++  N+T
  S:     4 SKTLRAADAKVDREKLYAPLEAVRLAKETSTTKFDATVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAAAAEAAGADIVGDDELINEIAKGNRLNEFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTMDVAKAVTDIKGGKIEFRVDKHSNLHFIIGKVSFSDEQLVENYAAALDEIVRLKPSAAKGRYIKKAALSTTMGPGIQLDSNRT 230
>gi|90962213|ref|YP_536129.1| 50S ribosomal protein L1 [Lactobacillus salivarius UCC118] >gi|122448741|sp|Q1WST3|RL1_LACS1 50S ribosomal protein L1 >gi|90821407|gb|ABE00046.1| LSU ribosomal protein L1P [Lactobacillus salivarius UCC118] (230 aa)
Score = 415, Expect = 8.5e-39, Identities = 87/204 (42%), Positives = 128/204 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           K Y   EA  L K+   A F ++I++A  LN+DT ++DQQLRG + LP   GK++ ++V  KG   ++AK  G +  GD +L+A I  GWLDFD+ I TP MM ++ +LG++LG +GLMPNPK G VT D+ K + + K G   YRTD  GN+H+ +GK +     +  N   +   IA  R  SVKG++I+ V+++ST GP +
  S:    20 KLYNASEAFGLVKKIDFANFDATIEVAFNLNVDTKQADQQLRGAMVLPNGTGKDQTVVVFAKGAKAQEAKDAGADVVGDDDLVARIQDGWLDFDVAIATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVTDAKSGQVTYRTDRDGNVHVPLGKVSFTEEALEGNFKAVYDVIAKARPASVKGVYIKHVSVASTFGPSV 223
>gi|81299444|ref|YP_399652.1| 50S ribosomal protein L1 [Synechococcus elongatus PCC 7942] >gi|123557307|sp|Q31QK4|RL1_SYNP7 50S ribosomal protein L1 >gi|81168325|gb|ABB56665.1| LSU ribosomal protein L1P [Synechococcus elongatus PCC 7942] (237 aa)
Score = 415, Expect = 8.7e-39, Identities = 92/202 (45%), Positives = 130/202 (64%)
  Q:    30 AVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           A+NL K+T+ AKF  S +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +AK+ G + AG  ELI EISKG+LDFDL+I TP +MP+++KLG+ LG RGLMP+PK G VT DL + I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +   V +S+TMGP I V +N
  S:    26 ALNLLKETATAKFPESAEAHIRLGIDPKYTDQQLRTTVALPKGTGQTIRVAVIARGEKVAEAKAAGADIAGSEELIEEISKGFLDFDLLIATPDVMPQVAKLGRQLGPRGLMPSPKGGTVTFDLEQAINEFKAGKLEFRADRTGIVHVLFGKASFSADDLLANLKALQETIDRNRPSGAKGRYWRSVYISATMGPAIEVDIN 227
>gi|195978561|ref|YP_002123805.1| 50S ribosomal protein L1 RplA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975266|gb|ACG62792.1| 50S ribosomal protein L1 RplA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (229 aa)
Score = 415, Expect = 8.8e-39, Identities = 91/209 (43%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+T+ AKF +S+++A  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D  K+VEN       +   +  + KG ++  V++++T G GI+V
  S:    16 DSTKAYSVEEAVTLAKETNFAKFDASVEVAYNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKINGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQAIIGKVSFDADKLVENFKAFHEVMVKAKPATAKGTYMTNVSITTTQGVGIKV 224
>gi|15674580|ref|NP_268754.1| 50S ribosomal protein L1 [Streptococcus pyogenes M1 GAS] >gi|19745587|ref|NP_606723.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS8232] >gi|50913748|ref|YP_059720.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS10394] >gi|71910188|ref|YP_281738.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS5005] >gi|94988009|ref|YP_596110.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS9429] >gi|94989888|ref|YP_597988.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS10270] >gi|94991893|ref|YP_599992.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS2096] >gi|94993773|ref|YP_601871.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS10750] >gi|139474299|ref|YP_001129015.1| 50S ribosomal protein L1 [Streptococcus pyogenes str. Manfredo] >gi|160174426|sp|Q1JD60|RL1_STRPB 50S ribosomal protein L1 >gi|160174431|sp|Q1JN33|RL1_STRPC 50S ribosomal protein L1 >gi|160174437|sp|Q1JI79|RL1_STRPD 50S ribosomal protein L1 >gi|160174441|sp|Q1J834|RL1_STRPF 50S ribosomal protein L1 >gi|160174448|sp|A2RG32|RL1_STRPG 50S ribosomal protein L1 >gi|54039111|sp|P66098|RL1_STRP8 50S ribosomal protein L1 >gi|54041605|sp|P66097|RL1_STRP1 50S ribosomal protein L1 >gi|61215414|sp|Q5XDH6|RL1_STRP6 50S ribosomal protein L1 >gi|13621689|gb|AAK33475.1| 50S ribosomal protein L1 [Streptococcus pyogenes M1 GAS] >gi|19747712|gb|AAL97222.1| 50S ribosomal protein L1 [Streptococcus pyogenes MGAS8232] >gi|50902822|gb|AAT86537.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS10394] >gi|71852970|gb|AAZ50993.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS5005] >gi|94541517|gb|ABF31566.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS9429] >gi|94543396|gb|ABF33444.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS10270] >gi|94545401|gb|ABF35448.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS2096] >gi|94547281|gb|ABF37327.1| LSU ribosomal protein L1P [Streptococcus pyogenes MGAS10750] >gi|134272546|emb|CAM30811.1| 50S ribosomal protein L1 [Streptococcus pyogenes str. Manfredo] (229 aa)
Score = 415, Expect = 9.2e-39, Identities = 92/209 (44%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV L K+T+ AKF +S+++A  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D  K+VEN       +A  +  + KG ++  V+++ST G GI+V
  S:    16 DSTKAYSVEEAVALVKETNFAKFDASVEVAYNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKINGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMANVSITSTQGVGIKV 224
>gi|62185277|ref|YP_220062.1| 50S ribosomal protein L1 [Chlamydophila abortus S26/3] >gi|81312567|sp|Q5L5I0|RL1_CHLAB 50S ribosomal protein L1 >gi|62148344|emb|CAH64111.1| putative 50S ribosomal protein L1 [Chlamydophila abortus S26/3] (232 aa)
Score = 415, Expect = 9.5e-39, Identities = 90/211 (42%), Positives = 133/211 (63%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++D +K Y+++EA+++ KQ    +F  ++D++IKL +D  KSDQQ+RG+VSLP+  GK  +ILV   G   K+A   G +  G  +L+ +I  GW+D D+ + TP MM E+ KLGK+LG R LMP PK G VT D+ KTIAE +KG  +++ D  G  +  VGK + D   + ENI  L S +   +  + KG ++    +SSTMGPGI V
  S:    14 SYDFSKSYSLQEAIDILKQCPPVRFDQTVDVSIKLGIDPKKSDQQIRGSVSLPHGTGKTLKILVFAAGEKAKEALDAGADFVGSDDLVEKIRGGWVDCDVAVATPDMMREVGKLGKVLGPRNLMPTPKAGTVTMDVTKTIAELRKGKIEFKADRAGVCNAGVGKLSFDGHLLKENIETLCSALIKAKPPAAKGQYLVSFTVSSTMGPGISV 224
>gi|168181853|ref|ZP_02616517.1| ribosomal protein L1 [Clostridium botulinum Bf] >gi|182674765|gb|EDT86726.1| ribosomal protein L1 [Clostridium botulinum Bf] (229 aa)
Score = 414, Expect = 1.1e-38, Identities = 87/209 (41%), Positives = 135/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   YT++EA+ L  +TS AKF  ++++A++L +D   +DQQ+RG V LP+  GK  R+LV  KG    +A+  G +  G  EL+ +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K IA+ K G  +YR D    IH+ +GKA+    K+ +N + L+  +   +  + KG +I+ V +SSTMGPGI++
  S:    13 DKNTLYTVQEAIELVTKTSKAKFDETVELAVRLGVDPRHADQQVRGAVVLPHGTGKTVRVLVFAKGDKVNEAQEAGADFVGAEELVEKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIADIKAGKVEYRVDKTAIIHVPIGKASFGEGKLSDNFHVLMEAVVKAKPAAAKGQYIKSVAISSTMGPGIKI 222
>gi|22297840|ref|NP_681087.1| 50S ribosomal protein L1 [Thermosynechococcus elongatus BP-1] >gi|33301564|sp|Q8DM27|RL1_SYNEL 50S ribosomal protein L1 >gi|22294017|dbj|BAC07849.1| 50S ribosomal protein L1 [Thermosynechococcus elongatus BP-1] (237 aa)
Score = 414, Expect = 1.3e-38, Identities = 90/207 (43%), Positives = 130/207 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A + G +  G  ELI EI KG +DFDL+I TP MMP+++K+G+ILG RGLMP+PK G VT DLP+ I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +   V +++TMGP I+V +N
  S:    20 YAPLEALQLLKETATAKFPESAEAHIRLGIDPKYTDQQLRTTVALPKGTGQTIRVAVIARGEKVTEASAAGADVVGSEELIDEIQKGRMDFDLLIATPDMMPQVAKVGRILGPRGLMPSPKAGTVTFDLPQAIQEFKAGKVEFRADRSGIVHVLFGKASFSAEDLLVNLKALQESIDRNRPSGAKGRYWRSVYVAATMGPSIQVDIN 226
>gi|55737774|gb|AAV61416.1| 50S ribosomal protein L1 [Streptococcus thermophilus LMG 18311] >gi|55739692|gb|AAV63333.1| 50S ribosomal protein L1 [Streptococcus thermophilus CNRZ1066] (246 aa)
Score = 414, Expect = 1.3e-38, Identities = 88/209 (42%), Positives = 139/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LA++T+ AKF ++++++  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ EL+ +I+ GWLDFD+++ TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + +  K+VEN       I   +  + KG++I  +++++T GPGI+V
  S:    33 DSTKAYSVEEAVALAQETNFAKFDATVEVSYNLNIDVKKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDELVDKINGGWLDFDVVVATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQAIIGKVSFEAEKLVENFKAFNDAIQKAKPATAKGVYITNLSITTTQGPGIKV 241
>gi|168037869|ref|XP_001771425.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162677343|gb|EDQ63815.1| predicted protein [Physcomitrella patens subsp. patens] (264 aa)
Score = 413, Expect = 1.4e-38, Identities = 86/213 (40%), Positives = 141/213 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           ++ K Y  + A+ L K T++ KF+ +++   +LN+D   +DQQLR TVSLP   G+  R+ VL +G  Q++AK+ G +  G  +LI EI++G +DFD +I TP MMP++++LG++LG RGLMPNPK G VT D+   IAEFK G  +YR D  G +H++ GK++     ++EN+  + + + A + +  KG++ +  ++ +TMGP IR+ V++
  S:    47 EKKKEYDPDTAIRLLKDTASLKFVETVEAHFRLNIDPKYTDQQLRATVSLPKGTGQTIRVAVLTQGEKQQEAKNAGADFVGADDLIDEIARGMMDFDKLIATPDMMPKVARLGRLLGPRGLMPNPKAGTVTVDVTSAIAEFKAGKVEYRADKTGIVHVLFGKSDFSGDDLLENLVAVANSVDANKPSGAKGVYWKSAHVCTTMGPSIRINVSE 259
>gi|152964646|ref|YP_001360430.1| 50S ribosomal protein L1 [Kineococcus radiotolerans SRS30216] >gi|189041821|sp|A6W5S7|RL1_KINRD 50S ribosomal protein L1 >gi|151359163|gb|ABS02166.1| ribosomal protein L1 [Kineococcus radiotolerans SRS30216] (238 aa)
Score = 413, Expect = 1.4e-38, Identities = 89/220 (40%), Positives = 143/220 (65%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K+ +  +   D  + Y   +AV LA++TS  K+ +++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G     A++ G +  G  ELI E++KG LDFD  + TP +M ++ +LGK+LG RGLMPNPK G VT D+ K ++E K G  ++RTD + N+H V+GKA+ D  ++VEN +  L  +   + +S KG +++K  +++TMGPG+ V
  S:     4 SKSYRAAAEKIDFEELYAPLDAVKLARETSTVKYDATVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFAVGDRAAQAEAAGADIVGGDELIDEVAKGRLDFDAAVATPDLMGKVGRLGKVLGPRGLMPNPKTGTVTMDVAKAVSEIKGGKIEFRTDKHANLHFVIGKASFDDTQLVENYSAALDEVLRLKPSSSKGRYLKKATITTTMGPGVPV 223
>gi|161506936|ref|YP_001576890.1| 50S ribosomal protein L1 [Lactobacillus helveticus DPC 4571] >gi|172048175|sp|A8YTE3|RL1_LACH4 50S ribosomal protein L1 >gi|160347925|gb|ABX26599.1| 50S ribosomal protein L1 [Lactobacillus helveticus DPC 4571] (230 aa)
Score = 413, Expect = 1.4e-38, Identities = 85/209 (40%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K Y++ EA+ L K+TS A F +++D+A  L++D  ++DQQ+RG++ LP   GK + ++V  +G     AK+ G +  G  +L+ +I  GWLDFD+++ TP MM ++ +LG+ILG +GLMPNPK G VT D+ K +   K G  +YR D    IH  +GK +    ++VEN + L   I   R  S KG +I+ V +S+T GPGI++
  S:    16 DSNKLYSVAEAMKLVKETSYANFDATVDVAYNLSVDPKQADQQIRGSLVLPNGTGKTQTVVVFAEGPQADQAKAAGADFVGSDDLVQKIQDGWLDFDVVVATPMMMAKVGRLGRILGPKGLMPNPKTGTVTMDIEKAVKNVKAGQVEYRVDRQAAIHTPIGKVSFTEDQLVENFDALRDVILRARPASAKGQYIKSVAVSATFGPGIKL 224
>gi|196188736|gb|EDX83700.1| ribosomal protein L1 [Synechococcus sp. PCC 7335] (235 aa)
Score = 413, Expect = 1.4e-38, Identities = 91/207 (43%), Positives = 129/207 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           Y   EAVNL K+T+ AKF  + +  I+L +D   +DQQLR TV+LP   G++ R+ V+ +G    +A   G   AG  ELI +ISKG +DFD+++ TP MMP+++KLG++LG RGLMP+PK G VT +L   I EFK G  ++R D  G +H+  GK +     ++EN+  L   I   R +  KG F   V++SSTMGP I V V+
  S:    14 YQPLEAVNLLKETATAKFTETAEAHIRLGIDPKYTDQQLRTTVALPKGTGQDVRVAVVARGEKVNEASEAGATIAGSEELIEDISKGMMDFDVLVATPDMMPKVAKLGRVLGPRGLMPSPKGGTVTFELASAIEEFKAGKLEFRADKTGIVHVKFGKVDFSAEDLLENLKALQETIDRNRPSGAKGRFWRSVSVSSTMGPSISVDVS 220
>gi|114764158|ref|ZP_01443396.1| 50S ribosomal protein L1 [Roseovarius sp. HTCC2601] >gi|114543310|gb|EAU46326.1| 50S ribosomal protein L1 [Roseovarius sp. HTCC2601] (233 aa)
Score = 413, Expect = 1.6e-38, Identities = 91/212 (42%), Positives = 135/212 (63%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           T+EEAV L K  ++AKF  +++IA+ L +DT  +DQ +RG + LP   GK  R+ V  +G   ++A++ G +  G  +L+  I  G ++FD  I TP MMP + +LGKILG R LMPNPK G VT D+ + + + K G  Q+R +  G +H  VGKA+ D A++VENI   +S +A  + T  KG +++K++LSSTMGPG+ V V   A V+
  S:    22 TVEEAVALIKSAASAKFDETVEIAMNLGVDTRHADQMVRGVIGLPNGTGKTMRVAVFARGPKAEEAQAAGADIVGAEDLMETIQGGTIEFDRCIATPDMMPIVGRLGKILGPRNLMPNPKVGTVTMDVAQAVKDAKGGQVQFRAEKGGVVHAGVGKASFDEAQLVENIRAFVSAVAKAKPTGAKGTYMKKISLSSTMGPGVTVDVANAASVE 233
>gi|158336007|ref|YP_001517181.1| 50S ribosomal protein L1 [Acaryochloris marina MBIC11017] >gi|189041800|sp|B0CAD0|RL1_ACAM1 50S ribosomal protein L1 >gi|158306248|gb|ABW27865.1| 50S ribosomal protein L1 [Acaryochloris marina MBIC11017] (236 aa)
Score = 413, Expect = 1.7e-38, Identities = 96/224 (42%), Positives = 135/224 (60%)
  Q:     5 KKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           KKV+ +  +      DR   Y   EA+ L  +T+ AKF  S +  I+L +D   +DQQLR TV+LP   G+E RI V+ +G   K+A   G +  G  ELI EI +G +DFDL+I TP MMP+++K+G+ILG RGLMP+PK G VT DLP+ I EFK G  ++R D  G +H++ GKA      ++EN+  L   I   R +  KG +   + +S+TMGP I V
  S:     3 KKVSRRMRELKQQVEDRA--YEPLEALELLCKTATAKFPESAEAHIRLGIDPKYTDQQLRTTVALPKGTGQEVRIAVVARGEKVKEATDAGADVVGSEELITEIQQGRMDFDLLIATPDMMPQVAKVGRILGPRGLMPSPKAGTVTFDLPQAIEEFKAGKLEFRADRTGIVHVMFGKAKFSAQDLLENLKALQDTIDRNRPSGAKGRYWRSLYVSATMGPSIEV 224
>gi|56750901|ref|YP_171602.1| 50S ribosomal protein L1 [Synechococcus elongatus PCC 6301] >gi|61215370|sp|Q5N3N8|RL1_SYNP6 50S ribosomal protein L1 >gi|56685860|dbj|BAD79082.1| 50S ribosomal protein L1 [Synechococcus elongatus PCC 6301] (237 aa)
Score = 413, Expect = 1.7e-38, Identities = 91/202 (45%), Positives = 130/202 (64%)
  Q:    30 AVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           A+NL K+T+ AKF  S +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +AK+ G + AG  ELI EISKG+LDFDL+I TP +MP+++KLG+ LG RGLMP+PK G VT DL + + EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +   V +S+TMGP I V +N
  S:    26 ALNLLKETATAKFPESAEAHIRLGIDPKYTDQQLRTTVALPKGTGQTIRVAVIARGEKVAEAKAAGADIAGSEELIEEISKGFLDFDLLIATPDVMPQVAKLGRQLGPRGLMPSPKGGTVTFDLEQAVNEFKAGKLEFRADRTGIVHVLFGKASFSADDLLANLKALQETIDRNRPSGAKGRYWRSVYISATMGPAIEVDIN 227
>gi|160934070|ref|ZP_02081457.1| hypothetical protein CLOLEP_02933 [Clostridium leptum DSM 753] >gi|156866743|gb|EDO60115.1| hypothetical protein CLOLEP_02933 [Clostridium leptum DSM 753] (231 aa)
Score = 413, Expect = 1.7e-38, Identities = 91/213 (42%), Positives = 134/213 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           DR K Y  EEA+++  +T+ AKF  +++  IKL +D+  +DQQ+RG + LP   GK  R+L + KG   + A++ G    G  E+ A+I + GW+DFD++ITTP MM  + +LGK+LG RGLMPNPK G VT D+ K + E K G  +YR D    IH  +GKA+    K+ EN + L+  I   +  + KG +I+   +++TMGPGIR+  NK
  S:    15 DRAKLYDAEEALDVCIKTAKAKFDETVEAHIKLGVDSRHADQQVRGAIVLPNGTGKNVRVLAICKGDNVEKAQAAGAEFVGGEEMAAKIQQEGWMDFDVVITTPDMMGVVGRLGKVLGPRGLMPNPKAGTVTPDIAKAVTEAKAGKIEYRLDKTNIIHCPIGKASFGVQKLQENFDTLMGAIVKAKPAAAKGQYIKSCVVATTMGPGIRLNPNK 228
>gi|188159045|ref|ZP_02998486.1| 50S ribosomal protein L1 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (226 aa)
Score = 413, Expect = 1.7e-38, Identities = 96/209 (45%), Positives = 140/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++ K Y + +A++LAKQTS  KF S++++A  LN+D  K+DQQ+RG V LP   GK +R+LVL    T K+A+    +  G  ELI  I ++ W DFD+I+ TP+MM +L  +GKILG +GLMPNPK G VT D+ K + + KKG  +YR D  GNIH+++GK + +  K+ EN   ++  I   +  +VKG +I+ V LS+TMGPGI+V
  S:    16 EKNKVYPLTQALDLAKQTSTTKFDSTVEVAFNLNIDPRKADQQIRGAVVLPAGTGKTQRVLVLTNTKT-KEAEQAKADIVGGEELINRIKNENWFDFDIIVATPEMMAKLGAIGKILGPKGLMPNPKTGTVTLDVAKAVDDIKKGKVEYRADKEGNIHLIIGKVSFEIEKLEENFKAVIDEIRRVKPQTVKGDYIKNVTLSTTMGPGIKV 224
>gi|29840452|ref|NP_829558.1| 50S ribosomal protein L1 [Chlamydophila caviae GPIC] >gi|33301430|sp|Q822I8|RL1_CHLCV 50S ribosomal protein L1 >gi|29834801|gb|AAP05436.1| ribosomal protein L1 [Chlamydophila caviae GPIC] (232 aa)
Score = 412, Expect = 1.8e-38, Identities = 90/211 (42%), Positives = 131/211 (62%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++D +K Y+++EA+++ KQ    +F  ++D++IKL +D  KSDQQ+RG+VSLP   GK  +ILV   G   K+A   G +  G  +L+  I  GW+DFD+ + TP MM E+ KLGK+LG R LMP PK G VT D+ K IAE +KG  +++ D  G  +  VGK + D   + ENI  L S +   +  + KG ++    +SSTMGPGI V
  S:    14 SYDFSKSYSLQEAIDILKQCPTVRFDQTVDVSIKLGIDPKKSDQQIRGSVSLPNGTGKTLKILVFAAGEKAKEALDAGADFVGSDDLVERIKGGWVDFDVAVATPDMMREVGKLGKVLGPRNLMPTPKAGTVTMDVTKAIAELRKGKIEFKADRAGVCNAGVGKLSFDRNLLKENIEALCSALIKAKPPAAKGQYLVSFTVSSTMGPGISV 224
>gi|88856013|ref|ZP_01130675.1| 50S ribosomal protein L1 [marine actinobacterium PHSC20C1] >gi|88814880|gb|EAR24740.1| 50S ribosomal protein L1 [marine actinobacterium PHSC20C1] (229 aa)
Score = 412, Expect = 1.8e-38, Identities = 93/223 (41%), Positives = 142/223 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +K  K  +   +  KFYT  EAV +A++TS+ KF S+I++A++L +D  K+DQ +RGTV LP+  GK  R++V   G   + A + G +  G SELI +++ G+ +FD  ++TP++M ++ +LGK+LG RGLMPNPK G VT D  K ++E K G  ++R D + N+H +VGKA     ++ ENI   L  +   + +S KG +I K  +S+T GPGI V VN
  S:     5 SKAYKAAADKLEEGKFYTPTEAVTVARETSSKKFDSTIEVALRLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPAAEAALAAGADEVGGSELIEKVAAGYTNFDAAVSTPELMGQVGRLGKVLGPRGLMPNPKTGTVTPDTAKAVSEIKGGKIEFRVDKHSNVHFIVGKAGFTVEQLDENIKAALEEVVRAKPSSSKGRYITKATVSTTFGPGIPVDVN 227
>gi|124024466|ref|YP_001018773.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9303] >gi|123964752|gb|ABM79508.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9303] (244 aa)
Score = 412, Expect = 1.9e-38, Identities = 90/218 (41%), Positives = 134/218 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           + Y   EA+ L K+ + AKF  +I+  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AGD +L+  I KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I   + +  KG + + + ++STMGP + V V     +++ A
  S:    27 RVYQPIEAIQLVKENATAKFDETIEAHVRLGIDPKYTDQQLRTTVALPQGTGQSVRIAVITRGEKLAEAKTAGAELAGDDDLVESIGKGQMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAIKEFKAGKLEFRADRAGIVHVRFGKASFSADALLENLKTLQETIDRNKPSGAKGRYWKSLYITSTMGPSVEVDVTALQDIEEDA 244
>gi|118579109|ref|YP_900359.1| 50S ribosomal protein L1 [Pelobacter propionicus DSM 2379] >gi|160166291|sp|A1ALT1|RL1_PELPD 50S ribosomal protein L1 >gi|118501819|gb|ABK98301.1| LSU ribosomal protein L1P [Pelobacter propionicus DSM 2379] (233 aa)
Score = 412, Expect = 1.9e-38, Identities = 90/220 (40%), Positives = 141/220 (64%)
  Q:     9 NKTPKK---PSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +KT KK    S   DRTK Y +  A+++ KQ + AKF  ++D+A++L +D   +DQ +RG V LP   GK+ R+LV  KG  +K+A   G ++ G  +L+++I +GW +FD  I TP MM  + K+GK+LG RGLMPNPK G VT ++ + + E K G  ++R +  G +H  VGK + D   +  N+  L+  +   + ++ KGI+I+K+++SSTMGPGI +
  S:     2 SKTAKKLAAASEKIDRTKVYPVAAAIDVVKQAAYAKFDETVDVAVRLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEKEKEALDAGADYVGAEDLVSKIQEGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFEVSRAVKESKAGKVEFRVEKAGIVHAPVGKVSFDADSLKGNLLALVEALVKAKPSAAKGIYIKKISMSSTMGPGINL 224
>gi|86608698|ref|YP_477460.1| 50S ribosomal protein L1 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123502652|sp|Q2JM50|RL1_SYNJB 50S ribosomal protein L1 >gi|86557240|gb|ABD02197.1| ribosomal protein L1 [Synechococcus sp. JA-2-3B'a(2-13)] (236 aa)
Score = 412, Expect = 2.0e-38, Identities = 88/207 (42%), Positives = 131/207 (63%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           Y  E A+ L K+T+ AKF  + ++ I+L +D   +DQQLR TV LP   G+E R+ V+ +G    +A++ G +  G  +LI EISKG +DFDL+I TP +MP+++KLG++LG RGLMP+PK G VT DL + I EFK G  +YR D  G +H++ GK       ++EN+  +   I   R +  KG +   +++S+TMGP I V +N
  S:    21 YAPEAALALMKETATAKFEEAAEVHIRLGIDPKYADQQLRTTVVLPRGTGQEIRVAVIARGEKVVEAQNAGADRVGYEDLIEEISKGMMDFDLLIATPDVMPQVAKLGRLLGPRGLMPSPKGGTVTMDLAQAIKEFKAGKLEYRADRTGIVHLIFGKCKFPVEALLENLKAVQESIDRNRPSGAKGKYWRTLHVSATMGPSIEVDIN 227
>gi|194476828|ref|YP_002049007.1| 50S ribosomal protein L1 [Paulinella chromatophora] >gi|171191835|gb|ACB42797.1| 50S ribosomal protein L1 [Paulinella chromatophora] (235 aa)
Score = 412, Expect = 2.0e-38, Identities = 92/217 (42%), Positives = 140/217 (64%)
  Q:    22 TKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           ++ Y   EA++L K+ + AKF  +I+  I+L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G + AGD EL+  I+KG ++FDL+I TP MMP+++KLG+ILG RGLMPNPK+G VTTDL   I EFK G  ++R D  G +H+  GKA+  T  +++N+  L   I   + +  KG + + + ++STMGP I + V+    +K+
  S:    17 SRLYMPIEALDLVKKNATAKFDETIEAHIRLGIDPKYTDQQLRTTVALPQGTGQTVRIAVIARGEKVAEAKAAGADIAGDDELVETIAKGEMNFDLLIATPDMMPKVAKLGRILGPRGLMPNPKSGTVTTDLVSAIKEFKAGKLEFRADRTGIVHVRFGKASFSTEALLDNLKTLQESIDRNKPSGAKGRYWKSLYITSTMGPSIPIDVSSLQDIKQ 233
>gi|147676642|ref|YP_001210857.1| ribosomal protein L1 [Pelotomaculum thermopropionicum SI] >gi|189041826|sp|A5D5H7|RL1_PELTS 50S ribosomal protein L1 >gi|146272739|dbj|BAF58488.1| ribosomal protein L1 [Pelotomaculum thermopropionicum SI] (232 aa)
Score = 412, Expect = 2.1e-38, Identities = 89/213 (41%), Positives = 134/213 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           DR+  Y   EA  L K+ + AKF  ++++A++L +D   +DQQ+RG V LP+  GK + +LV  KG   ++A+  G +  G  +++A I + GWL FD+ I TP MM  + KLG+ILG RGLMPNPK G VT D+ + + E K G  +YR D  G IH  +GK +  T K+VEN+  L+  +   +  + KG +++ +++SSTMGPGI+V   K
  S:    16 DRSVLYDPAEAFELLKKVAPAKFDETVEVAVRLGVDPRHADQQVRGAVVLPHGTGKTRTVLVFAKGDKAREAEEAGADFVGAEDMVARIQQEGWLGFDVAIATPDMMGMVGKLGRILGPRGLMPNPKTGTVTFDIARAVKEVKAGKIEYRVDKAGIIHAPIGKVSFSTEKLVENLRTLIEALIRAKPAAAKGQYLKGISVSSTMGPGIKVNTQK 229
>gi|170782940|ref|YP_001711274.1| 50S ribosomal protein L1 [Clavibacter michiganensis subsp. sepedonicus] >gi|189041808|sp|B0RIR8|RL1_CLAMS 50S ribosomal protein L1 >gi|169157510|emb|CAQ02701.1| 50S ribosomal protein L1 [Clavibacter michiganensis subsp. sepedonicus] (228 aa)
Score = 412, Expect = 2.2e-38, Identities = 90/223 (40%), Positives = 143/223 (64%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +K  +  +   D TK YT  EAV LA++T ++KF S++++A+KL +D  K+DQ +RGTV LP+  GK  R++V   G   + A + G +  G  ELI +++ G+  FD  ++TP++M ++ +LGK+LG RGLMPNPK G VT D+ + +++ K G  ++R D + N+H VVGKA+    ++ EN+   L  I   + +S KG +++K  +S+T GPGI V VN
  S:     4 SKAYRAAAEKIDLTKAYTASEAVELARETGSSKFDSTVEVALKLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPAAEAAIAAGADEVGGDELIEKVAGGYTSFDSAVSTPELMGKVGRLGKVLGPRGLMPNPKTGTVTPDVARAVSDIKGGKIEFRVDKHANVHFVVGKASFSPEQLSENVGAALEEIVRLKPSSSKGRYVQKATVSTTFGPGIPVDVN 226
>gi|87300790|ref|ZP_01083632.1| 50S ribosomal protein L1 [Synechococcus sp. WH 5701] >gi|87284661|gb|EAQ76613.1| 50S ribosomal protein L1 [Synechococcus sp. WH 5701] (235 aa)
Score = 411, Expect = 2.3e-38, Identities = 92/213 (43%), Positives = 131/213 (61%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           YT  EA+ L K  +NAKF  +I+   +L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G + AGD EL+  I+ G +DFDL+I TP MMP+++KLG++LG RGLMPNPK G V TDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I  ++ +  KG +   + L+STMGP + V V     +K
  S:    20 YTPLEALELVKANANAKFDETIEAHARLGIDPKYTDQQLRTTVALPKGTGQTIRIAVIARGEKVAEAKAAGADLAGDDELVEAIAGGQIDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVATDLAGAINEFKAGKLEFRADRTGIVHVRFGKASFSLDDLLENLKALQETIDRQKPSGAKGRYWRSLYLTSTMGPSVSVDVTALQDIK 232
>gi|149922220|ref|ZP_01910658.1| 50S ribosomal protein L1 [Plesiocystis pacifica SIR-1] >gi|149816960|gb|EDM76445.1| 50S ribosomal protein L1 [Plesiocystis pacifica SIR-1] (241 aa)
Score = 411, Expect = 2.7e-38, Identities = 91/223 (40%), Positives = 133/223 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           K  K+     DR K Y + EA  L K  + AKF  +++ A +L ++   +DQ +R +VSLP+  GK  R+LV  KG     AK  G +  G  +++A+I +GWLDFD+ I TP MM  + +LG+ILG R LMPNPK G VT D+ K + E K G  ++RT+  G IH  +GK + +  K+ EN+   L  +   +  + KG + + V+LSSTMGPGIR+  N+
  S:    11 KKYKEARSKIDRDKRYGLVEACELVKVVAPAKFDETVECAARLGVNPRHADQMIRSSVSLPHGTGKSVRVLVFAKGDRVNQAKDAGADFVGSDDIVAKIQEGWLDFDVAIATPDMMGLVGRLGRILGPRNLMPNPKVGTVTMDVKKAVTERKAGRIEFRTERTGIIHAPIGKVSFEAVKLQENLETFLRTLQRLKPATAKGKYFKSVSLSSTMGPGIRLDTNE 233
>gi|187776565|ref|ZP_02993038.1| hypothetical protein CLOSPO_00079 [Clostridium sporogenes ATCC 15579] >gi|187775224|gb|EDU39026.1| hypothetical protein CLOSPO_00079 [Clostridium sporogenes ATCC 15579] (229 aa)
Score = 411, Expect = 2.9e-38, Identities = 86/209 (41%), Positives = 136/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   YT++EA+ L  +TS AKF  ++++A++L +D   +DQQ+RG V LP+  GK+ R+LV  KG    +A+  G +  G  EL+ +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K IA+ K G  +YR D    IH+ +GK++    K+ +N + L+  +   +  + KG +I+ V +SSTMGPGI++
  S:    13 DKNTLYTVQEAIELVTKTSKAKFDETVELAVRLGVDPRHADQQVRGAVVLPHGTGKKVRVLVFAKGDKVNEAQEAGADFVGAEELVEKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIADIKAGKVEYRVDKTAIIHVPIGKSSFGEGKLSDNFHVLMEAVVKAKPAAAKGQYIKSVAISSTMGPGIKI 222
>gi|154484469|ref|ZP_02026917.1| hypothetical protein EUBVEN_02183 [Eubacterium ventriosum ATCC 27560] >gi|149734317|gb|EDM50234.1| hypothetical protein EUBVEN_02183 [Eubacterium ventriosum ATCC 27560] (234 aa)
Score = 410, Expect = 3.1e-38, Identities = 95/221 (42%), Positives = 136/221 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           DR   Y  EEA++L K+ + AKF  +I+  I+   D   +DQQ+RG V LP   GK  ++LV  KG    +A++ G +  G  ELI  I + GWLDFD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ VGKA+    ++VEN N L+  I   +  +VKG +++ V L+STMGPG++  VN T +V   A
  S:    15 DRAAQYDTEEAISLVKKAAVAKFDETIECHIRTGCDGRHADQQIRGAVVLPNGTGKTVKVLVFAKGAKADEAQAAGADFVGGEELIPRIQNDGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAIDDIKAGKIEYRLDKANIIHVPVGKASFTEEQLVENFNALMGAINKAKPAAVKGAYLKSVTLTSTMGPGVK--VNPTKLVNANA 234
>gi|33864353|ref|NP_895913.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9313] >gi|61215699|sp|Q7V478|RL1_PROMM 50S ribosomal protein L1 >gi|33641133|emb|CAE22263.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9313] (235 aa)
Score = 410, Expect = 3.4e-38, Identities = 89/208 (42%), Positives = 130/208 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           + Y   EA+ L K+ + AKF  +I+  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AGD +L+  I KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I   + +  KG + + + ++STMGP + V V
  S:    18 RVYQPLEAIQLVKENATAKFDETIEAHVRLGIDPKYTDQQLRTTVALPQGTGQSVRIAVISRGEKLAEAKTAGAELAGDDDLVESIGKGQMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAIKEFKAGKLEFRADRAGIVHVRFGKASFSADALLENLKTLQETIDRNKPSGAKGRYWKSLYITSTMGPSVEVDV 225
>gi|170758870|ref|YP_001788832.1| ribosomal protein L1 [Clostridium botulinum A3 str. Loch Maree] >gi|169405859|gb|ACA54270.1| ribosomal protein L1 [Clostridium botulinum A3 str. Loch Maree] (229 aa)
Score = 410, Expect = 3.5e-38, Identities = 86/209 (41%), Positives = 135/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   YT++EA+ L  +TS AKF  ++++A++L +D   +DQQ+RG V LP+  GK  R+LV  KG    +A+  G +  G  EL+ +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K IA+ K G  +YR D    IH+ +GK++    K+ +N + L+  +   +  + KG +I+ V +SSTMGPGI++
  S:    13 DKNALYTVQEAIELVTKTSKAKFDETVELAVRLGVDPRHADQQVRGAVVLPHGTGKTVRVLVFAKGDKVNEAQEAGADFVGAEELVEKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIADIKAGKVEYRVDKTAIIHVPIGKSSFGEEKLSDNFHVLMEAVVKAKPAAAKGQYIKSVAISSTMGPGIKI 222
>gi|186900150|ref|ZP_02973109.1| ribosomal protein L1 [Cyanothece sp. PCC 7424] >gi|186692640|gb|EDU17257.1| ribosomal protein L1 [Cyanothece sp. PCC 7424] (238 aa)
Score = 410, Expect = 3.6e-38, Identities = 92/227 (40%), Positives = 138/227 (60%)
  Q:    13 KKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKT 239
           K+     D+ K Y   EA+NL K+T+ AKF  + ++ ++L +D   +DQQLR TV+ P   G+  R+ V+ +G   ++A S G +  G  ELI EI  G +DF+++I TP MMP+++KLG++LG RGLMP+PK G VTTDL   I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +   V +S++MGP I+V VN    +K T
  S:    10 KEALAKVDQDKAYEPLEALNLLKETATAKFDETAEVHVRLGIDPKYTDQQLRTTVTFPKGTGQTVRVAVIARGEKVQEASSAGADIVGSEELIDEIQNGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTTDLAAAIQEFKAGKQEFRADRTGIVHVMFGKASFTAEDLLVNLKALQETIDRNRPSGAKGRYWRTVFVSASMGPSIQVDVNSLRDLKVT 236
>gi|83816790|ref|YP_445879.1| ribosomal protein L1 [Salinibacter ruber DSM 13855] >gi|123528578|sp|Q2S1Q2|RL1_SALRD 50S ribosomal protein L1 >gi|83758184|gb|ABC46297.1| ribosomal protein L1 [Salinibacter ruber DSM 13855] (237 aa)
Score = 410, Expect = 3.7e-38, Identities = 84/202 (41%), Positives = 125/202 (61%)
  Q:    27 IEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           + EA  LAK T+ A F  SID+ ++L +D   +DQ +RG+++LP   G+E  +LVL     Q++A+  G ++ G  E I  I +  WLDFD+ I TP +M ++ +LG+ILG RGLMPNPK+G VT D+   I E K G  ++R D  GN+H  +GKA+    ++ EN   LL  +   R  S  G+++  + LS+TMGP +RV
  S:    25 LREAAGLAKDTATANFDESIDLDLRLGVDPQHADQMVRGSITLPNGTGREVTVLVLASEGKQQEAEEAGADYVGLDEYIERIEEENWLDFDVAIATPDVMGQVGQLGRILGPRGLMPNPKSGTVTMDVADAIEEIKAGKIEFRVDQSGNLHTPIGKASFSPDELYENAQALLREVIRLRPASAGGLYLRSITLSATMGPPVRV 227
>gi|116748981|ref|YP_845668.1| ribosomal protein L1 [Syntrophobacter fumaroxidans MPOB] >gi|160174513|sp|A0LII1|RL1_SYNFM 50S ribosomal protein L1 >gi|116698045|gb|ABK17233.1| LSU ribosomal protein L1P [Syntrophobacter fumaroxidans MPOB] (234 aa)
Score = 410, Expect = 3.8e-38, Identities = 88/219 (40%), Positives = 130/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  +      D  K YT +EA+ LA  +   KF  ++DIA++L +D   +DQ +RGTV LP   GK  R+LV  KG   K+A   G +HAG  EL+  I +GWL+FD  + TP MM  + K+GK+LG RGLMPN K G VT DL K + E K G   +R +  G +H  +GK +    K+++NI+  +  +   + T+ KG ++  + +S+TMGPGI++
  S:     6 KKYRAARATIDPAKRYTFQEALELATGSIFCKFDETLDIAVRLGVDPRHADQMVRGTVVLPNGLGKPVRVLVFAKGEKVKEALDAGADHAGGDELVDRIKEGWLEFDKTVATPDMMGAVGKIGKVLGPRGLMPNAKLGTVTFDLQKVVKEIKAGKVDFRVEKTGIVHAPMGKVSFGQEKLIQNISAFIDTLIRLKPTAAKGTYVRGIAISTTMGPGIQI 224
>gi|116628505|ref|YP_821124.1| 50S ribosomal protein L1 [Streptococcus thermophilus LMD-9] >gi|161611278|ref|YP_140231.2| 50S ribosomal protein L1 [Streptococcus thermophilus LMG 18311] >gi|161936361|ref|YP_142148.2| 50S ribosomal protein L1 [Streptococcus thermophilus CNRZ1066] >gi|122266900|sp|Q03IP4|RL1_STRTD 50S ribosomal protein L1 >gi|161784293|sp|Q5M2K0|RL1_STRT2 50S ribosomal protein L1 >gi|161784294|sp|Q5LXZ6|RL1_STRT1 50S ribosomal protein L1 >gi|116101782|gb|ABJ66928.1| LSU ribosomal protein L1P [Streptococcus thermophilus LMD-9] (229 aa)
Score = 410, Expect = 3.9e-38, Identities = 88/209 (42%), Positives = 139/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LA++T+ AKF ++++++  LN+D  K+DQQ+RG + LP   GK +R+LV  +G   ++AK+ G +  G+ EL+ +I+ GWLDFD+++ TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + +  K+VEN       I   +  + KG++I  +++++T GPGI+V
  S:    16 DSTKAYSVEEAVALAQETNFAKFDATVEVSYNLNIDVKKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDELVDKINGGWLDFDVVVATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQAIIGKVSFEAEKLVENFKAFNDAIQKAKPATAKGVYITNLSITTTQGPGIKV 224
>gi|16330010|ref|NP_440738.1| 50S ribosomal protein L1 [Synechocystis sp. PCC 6803] >gi|548759|sp|P36236|RL1_SYNY3 50S ribosomal protein L1 >gi|452793|emb|CAA51492.1| ribosomal protein L1 [Synechocystis sp. PCC 6803] >gi|1652497|dbj|BAA17418.1| 50S ribosomal protein L1 [Synechocystis sp. PCC 6803] (238 aa)
Score = 410, Expect = 3.9e-38, Identities = 94/212 (44%), Positives = 131/212 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D +K Y+  EA+ L K+T+ AKF  + +  I+L +D   SDQQ+R TVSLP   G+  R+ VL +G   K+A   G + AG  ELI EI KG +DFD++I TP MMP++++LGK LG RGLMP+PK G VT DL   + EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG F   V +SS+MGP I V +N
  S:    17 DDSKLYSPLEAMELLKETATAKFDETAEAHIRLGIDPKYSDQQIRTTVSLPKGTGQTVRVAVLARGEKVKEATDAGADIAGSEELIEEIQKGMMDFDVLIATPDMMPKIARLGKQLGPRGLMPSPKGGTVTADLAAAVNEFKAGKLEFRADRTGIVHVMFGKASFSADDLLANLKALQETIDRNRPSGAKGRFWRTVFVSSSMGPSIPVDIN 228
>gi|146318985|ref|YP_001198697.1| 50S ribosomal protein L1 [Streptococcus suis 05ZYH33] >gi|160174492|sp|A4VW08|RL1_STRSY 50S ribosomal protein L1 >gi|145689791|gb|ABP90297.1| 50S ribosomal protein L1 [Streptococcus suis 05ZYH33] (229 aa)
Score = 410, Expect = 3.9e-38, Identities = 91/209 (43%), Positives = 136/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+T+ AKF +S+++A  LN+D  K+DQQ+RG + LP   GK  R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  G +  ++GK + D  K+VEN       +A  +  + KG ++  V +++T G GI+V
  S:    16 DSTKLYSVEEAVALAKETNFAKFDASVEVAYNLNIDVRKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKINGGWLDFDVVIATPDMMAVVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGIVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMTSVFITTTQGVGIKV 224
>gi|148381432|ref|YP_001255973.1| ribosomal protein L1 [Clostridium botulinum A str. ATCC 3502] >gi|153932159|ref|YP_001385807.1| 50S ribosomal protein L1 [Clostridium botulinum A str. ATCC 19397] >gi|153935858|ref|YP_001389214.1| 50S ribosomal protein L1 [Clostridium botulinum A str. Hall] >gi|153938062|ref|YP_001392845.1| 50S ribosomal protein L1 [Clostridium botulinum F str. Langeland] >gi|168178821|ref|ZP_02613485.1| ribosomal protein L1 [Clostridium botulinum NCTC 2916] >gi|170754393|ref|YP_001783132.1| ribosomal protein L1 [Clostridium botulinum B1 str. Okra] >gi|160165813|sp|A7FZ80|RL1_CLOB1 50S ribosomal protein L1 >gi|160165817|sp|A7GJ85|RL1_CLOBL 50S ribosomal protein L1 >gi|160419194|sp|A5I7L7|RL1_CLOBH 50S ribosomal protein L1 >gi|148290916|emb|CAL85052.1| 50S ribosomal protein L1 [Clostridium botulinum A str. ATCC 3502] >gi|152928203|gb|ABS33703.1| ribosomal protein L1 [Clostridium botulinum A str. ATCC 19397] >gi|152931772|gb|ABS37271.1| ribosomal protein L1 [Clostridium botulinum A str. Hall] >gi|152933958|gb|ABS39456.1| ribosomal protein L1 [Clostridium botulinum F str. Langeland] >gi|169119605|gb|ACA43441.1| ribosomal protein L1 [Clostridium botulinum B1 str. Okra] >gi|182669995|gb|EDT81971.1| ribosomal protein L1 [Clostridium botulinum NCTC 2916] (229 aa)
Score = 409, Expect = 4.0e-38, Identities = 86/209 (41%), Positives = 135/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   YT++EA+ L  +TS AKF  ++++A++L +D   +DQQ+RG V LP+  GK  R+LV  KG    +A+  G +  G  EL+ +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K IA+ K G  +YR D    IH+ +GK++    K+ +N + L+  +   +  + KG +I+ V +SSTMGPGI++
  S:    13 DKNTLYTVQEAIELVTKTSKAKFDETVELAVRLGVDPRHADQQVRGAVVLPHGTGKTVRVLVFAKGDKVNEAQEAGADFVGAEELVEKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIADIKAGKVEYRVDKTAIIHVPIGKSSFGEEKLSDNFHVLMEAVVKAKPAAAKGQYIKSVAISSTMGPGIKI 222
>gi|160166817|sp|A2CDE8|RL1_PROM3 50S ribosomal protein L1 (235 aa)
Score = 409, Expect = 4.3e-38, Identities = 90/218 (41%), Positives = 134/218 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           + Y   EA+ L K+ + AKF  +I+  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AGD +L+  I KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I   + +  KG + + + ++STMGP + V V     +++ A
  S:    18 RVYQPIEAIQLVKENATAKFDETIEAHVRLGIDPKYTDQQLRTTVALPQGTGQSVRIAVITRGEKLAEAKTAGAELAGDDDLVESIGKGQMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAIKEFKAGKLEFRADRAGIVHVRFGKASFSADALLENLKTLQETIDRNKPSGAKGRYWKSLYITSTMGPSVEVDVTALQDIEEDA 235
>gi|168001940|ref|XP_001753672.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162695079|gb|EDQ81424.1| predicted protein [Physcomitrella patens subsp. patens] (264 aa)
Score = 409, Expect = 4.8e-38, Identities = 86/211 (40%), Positives = 137/211 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           ++ K Y  + AV L K T++ KF+ +++   +LN+D   +DQQLR TVSLP   G+  R+ VL +G  Q++AK+ G +  G  +LI EI++G +DFD +I TP MMP++++LG++LG RGLMPNPK G VT D+   I EFK G  +YR D  G +H++ GK++     ++ N+  + + + A R +  KG++ +  ++ +TMGP IR+ V
  S:    47 EKKKEYDPDTAVRLLKDTASLKFVETVEAHFRLNIDPKYTDQQLRATVSLPKGTGQTIRVAVLTQGEKQQEAKNAGADFVGADDLIDEIARGMMDFDKLIATPDMMPKVARLGRLLGPRGLMPNPKAGTVTVDVTSAIGEFKAGKVEYRADKTGIVHVLFGKSDFSAEDLLLNLVAVANSVDANRPSGAKGVYWKSAHICTTMGPSIRLNV 257
>gi|78043380|ref|YP_361131.1| ribosomal protein L1 [Carboxydothermus hydrogenoformans Z-2901] >gi|91207345|sp|Q3A9Q3|RL1_CARHZ 50S ribosomal protein L1 >gi|77995495|gb|ABB14394.1| ribosomal protein L1 [Carboxydothermus hydrogenoformans Z-2901] (231 aa)
Score = 409, Expect = 4.8e-38, Identities = 91/209 (43%), Positives = 139/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+TK Y   EA +L K+ S AKF  ++++A+KL +D   +DQQ+RG V LP+  GK +++LV  KG   K+A++ G ++ G  E I +I++GW+DFD+++ TP MM  + +LGKILG +GLMP+PK G VT ++ K IAE K G  +YR D  G +H+ +GK +    K+VEN N L+  +   +    KG +++ V +SSTMGPGI++
  S:    16 DKTKLYEPAEAFSLVKELSFAKFDETVEVAVKLGVDPRHADQQVRGAVVLPHGTGKTRKVLVFAKGEKAKEAEAAGADYVGAEEYIEKIAQGWIDFDVVVATPDMMGAVGRLGKILGPKGLMPSPKTGTVTFEVAKAIAEIKAGKIEYRVDKAGIVHVPIGKVSFPVEKLVENFNTLMDALIKAKPAGAKGQYLKGVTVSSTMGPGIKI 224
>gi|15900538|ref|NP_345142.1| 50S ribosomal protein L1 [Streptococcus pneumoniae TIGR4] >gi|15902600|ref|NP_358150.1| 50S ribosomal protein L1 [Streptococcus pneumoniae R6] >gi|111656808|ref|ZP_01407665.1| hypothetical protein SpneT_02001920 [Streptococcus pneumoniae TIGR4] >gi|116515704|ref|YP_816052.1| 50S ribosomal protein L1 [Streptococcus pneumoniae D39] >gi|148984013|ref|ZP_01817332.1| ribosomal protein L1 [Streptococcus pneumoniae SP3-BS71] >gi|148992260|ref|ZP_01821983.1| 50S ribosomal protein L1 [Streptococcus pneumoniae SP9-BS68] >gi|148998306|ref|ZP_01825775.1| ribosomal protein L1 [Streptococcus pneumoniae SP11-BS70] >gi|149002314|ref|ZP_01827256.1| ribosomal protein L1 [Streptococcus pneumoniae SP14-BS69] >gi|149010749|ref|ZP_01832120.1| 50S ribosomal protein L1 [Streptococcus pneumoniae SP19-BS75] >gi|149021592|ref|ZP_01835647.1| ribosomal protein L1 [Streptococcus pneumoniae SP23-BS72] >gi|168482864|ref|ZP_02707816.1| ribosomal protein L1 [Streptococcus pneumoniae CDC1873-00] >gi|168485743|ref|ZP_02710251.1| ribosomal protein L1 [Streptococcus pneumoniae CDC1087-00] >gi|168488316|ref|ZP_02712515.1| ribosomal protein L1 [Streptococcus pneumoniae SP195] >gi|168492292|ref|ZP_02716435.1| ribosomal protein L1 [Streptococcus pneumoniae CDC0288-04] >gi|168576468|ref|ZP_02722342.1| ribosomal protein L1 [Streptococcus pneumoniae MLV-016] >gi|169834197|ref|YP_001694109.1| ribosomal protein L1 [Streptococcus pneumoniae Hungary19A-6] >gi|194397100|ref|YP_002037290.1| 50S ribosomal protein L1 [Streptococcus pneumoniae G54] >gi|122279062|sp|Q04LP6|RL1_STRP2 50S ribosomal protein L1 >gi|54039110|sp|P66096|RL1_STRR6 50S ribosomal protein L1 >gi|54041604|sp|P66095|RL1_STRPN 50S ribosomal protein L1 >gi|14972107|gb|AAK74782.1| ribosomal protein L1 [Streptococcus pneumoniae TIGR4] >gi|15458133|gb|AAK99360.1| 50S Ribosomal protein L1 [Streptococcus pneumoniae R6] >gi|116076280|gb|ABJ54000.1| ribosomal protein L1 [Streptococcus pneumoniae D39] >gi|147755949|gb|EDK62993.1| ribosomal protein L1 [Streptococcus pneumoniae SP11-BS70] >gi|147759629|gb|EDK66620.1| ribosomal protein L1 [Streptococcus pneumoniae SP14-BS69] >gi|147765230|gb|EDK72159.1| 50S ribosomal protein L1 [Streptococcus pneumoniae SP19-BS75] >gi|147924160|gb|EDK75272.1| ribosomal protein L1 [Streptococcus pneumoniae SP3-BS71] >gi|147928886|gb|EDK79898.1| 50S ribosomal protein L1 [Streptococcus pneumoniae SP9-BS68] >gi|147930288|gb|EDK81273.1| ribosomal protein L1 [Streptococcus pneumoniae SP23-BS72] >gi|168996699|gb|ACA37311.1| ribosomal protein L1 [Streptococcus pneumoniae Hungary19A-6] >gi|172043583|gb|EDT51629.1| ribosomal protein L1 [Streptococcus pneumoniae CDC1873-00] >gi|183571144|gb|EDT91672.1| ribosomal protein L1 [Streptococcus pneumoniae CDC1087-00] >gi|183573100|gb|EDT93628.1| ribosomal protein L1 [Streptococcus pneumoniae SP195] >gi|183573507|gb|EDT94035.1| ribosomal protein L1 [Streptococcus pneumoniae CDC0288-04] >gi|183577701|gb|EDT98229.1| ribosomal protein L1 [Streptococcus pneumoniae MLV-016] >gi|194356767|gb|ACF55215.1| 50S ribosomal protein L1 [Streptococcus pneumoniae G54] (229 aa)
Score = 409, Expect = 4.9e-38, Identities = 91/212 (42%), Positives = 138/212 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D TK Y++EEAV LAK+T+ AKF +++++A  LN+D  K+DQQ+RG + LP   GK  R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + +  K+VEN       I   +  + KG ++  + +++T G GI+V VN
  S:    16 DSTKAYSVEEAVALAKETNFAKFDATVEVAYNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKINDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKAKPATAKGTYVTNLTITTTQGVGIKVDVN 227
>gi|125718427|ref|YP_001035560.1| 50S ribosomal protein L1 [Streptococcus sanguinis SK36] >gi|160174474|sp|A3CPA5|RL1_STRSV 50S ribosomal protein L1 >gi|125498344|gb|ABN45010.1| 50S ribosomal protein L1, putative [Streptococcus sanguinis SK36] (229 aa)
Score = 409, Expect = 5.1e-38, Identities = 91/212 (42%), Positives = 138/212 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D TK Y++EEAV LAK+T+ AKF +++++A  LN+D  K+DQQ+RG + LP   GK  R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + +  K+VEN       I   +  + KG ++  + +++T G GI+V VN
  S:    16 DSTKAYSVEEAVALAKETNFAKFDATVEVAYNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKINDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADRAGNVQAIIGKVSFEADKLVENFKAFNDTIQKAKPATAKGTYVTNLTITTTQGVGIKVDVN 227
>gi|168715540|ref|ZP_02747817.1| 50S ribosomal protein L1 [Clostridium difficile QCD-63q42] (232 aa)
Score = 408, Expect = 5.6e-38, Identities = 89/215 (41%), Positives = 133/215 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DRTKFY   EA+ L    + AKF  +++  IKL +D+  +DQQ+RG V LP+  GK KR+LV  KG   K+A+  G +  G  EL+ +I  + W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K I E K G  +YR D    IH+ VGK +    K+ EN   L+  I   +  + KG ++  + ++S+MGPG+++   +TA
  S:    16 DRTKFYDASEALTLVSDIAGAKFDETVEAHIKLGVDSRHADQQVRGAVVLPHGTGKTKRVLVFAKGEKAKEAEQAGADFVGAEELVQKIQGENWFDFDIVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIDEIKAGKVEYRLDKTNIIHVPVGKVSFGGEKLTENFTALMDAIIKAKPAAAKGQYLRSITVASSMGPGVKINPARTA 231
>gi|126697629|ref|YP_001086526.1| 50S ribosomal protein L1 [Clostridium difficile 630] >gi|145956374|ref|ZP_01805370.1| hypothetical protein CdifQ_04000070 [Clostridium difficile QCD-32g58] >gi|168696858|ref|ZP_02729135.1| 50S ribosomal protein L1 [Clostridium difficile QCD-37x79] >gi|168726728|ref|ZP_02759005.1| 50S ribosomal protein L1 [Clostridium difficile QCD-76w55] >gi|168730442|ref|ZP_02762719.1| 50S ribosomal protein L1 [Clostridium difficile QCD-97b34] >gi|196127777|ref|ZP_03119526.1| 50S ribosomal protein L1 [Clostridium difficile ATCC 43255] >gi|196160588|ref|ZP_03121149.1| 50S ribosomal protein L1 [Clostridium difficile CIP 107932] >gi|196165499|ref|ZP_03126030.1| 50S ribosomal protein L1 [Clostridium difficile QCD-23m63] >gi|123067152|sp|Q18CE9|RL1_CLOD6 50S ribosomal protein L1 >gi|115249066|emb|CAJ66877.1| 50S ribosomal protein L1 [Clostridium difficile 630] (232 aa)
Score = 408, Expect = 5.6e-38, Identities = 89/215 (41%), Positives = 133/215 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DRTKFY   EA+ L    + AKF  +++  IKL +D+  +DQQ+RG V LP+  GK KR+LV  KG   K+A+  G +  G  EL+ +I  + W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K I E K G  +YR D    IH+ VGK +    K+ EN   L+  I   +  + KG ++  + ++S+MGPG+++   +TA
  S:    16 DRTKFYDASEALTLVSDIAGAKFDETVEAHIKLGVDSRHADQQVRGAVVLPHGTGKTKRVLVFAKGEKAKEAEQAGADFVGAEELVQKIQGENWFDFDIVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIDEIKAGKVEYRLDKTNIIHVPVGKVSFGGEKLTENFTALMDAIIKAKPAAAKGQYLRSITVASSMGPGVKINPARTA 231
>gi|118727013|ref|ZP_01575625.1| ribosomal protein L1 [Clostridium cellulolyticum H10] >gi|118663578|gb|EAV70227.1| ribosomal protein L1 [Clostridium cellulolyticum H10] (230 aa)
Score = 408, Expect = 5.7e-38, Identities = 92/219 (42%), Positives = 141/219 (64%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++ S   DR K Y   EA+ LA++T+ AKF  +I++ IKL +D+  +DQQ+RG V LP+  GK+ R+LV  KG   K+A+  G +  G  ELI++I ++ W D+D+++ TP MM  + +LGK+LG +GLMPNPK G V+ D+ K IA+ K G  +YR D    IH  +GKA+    K+++N   LL  I   +  + KG +++ V ++STMGPGI++
  S:     5 KKYQESSKLIDRLKLYEPSEALELAQKTAKAKFDETIEVHIKLGVDSRHADQQVRGAVVLPHGTGKKVRVLVFAKGDKAKEAEQAGADFVGGEELISKIQNENWFDYDVVVATPDMMGVVGRLGKVLGPKGLMPNPKAGTVSMDVAKAIADIKAGKIEYRLDKTNIIHCPIGKASFGNEKLMDNFRTLLGAIIKAKPAAAKGQYLKSVVVTSTMGPGIKI 224
>gi|148988998|ref|ZP_01820398.1| ribosomal protein L1 [Streptococcus pneumoniae SP6-BS73] >gi|168492792|ref|ZP_02716935.1| ribosomal protein L1 [Streptococcus pneumoniae CDC3059-06] >gi|182683562|ref|YP_001835309.1| 50S ribosomal protein L1 [Streptococcus pneumoniae CGSP14] >gi|147925495|gb|EDK76572.1| ribosomal protein L1 [Streptococcus pneumoniae SP6-BS73] >gi|182628896|gb|ACB89844.1| 50S ribosomal protein L1 [Streptococcus pneumoniae CGSP14] >gi|183576906|gb|EDT97434.1| ribosomal protein L1 [Streptococcus pneumoniae CDC3059-06] (229 aa)
Score = 408, Expect = 5.9e-38, Identities = 91/212 (42%), Positives = 138/212 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D TK Y++EEAV LAK+T+ AKF +++++A  LN+D  K+DQQ+RG + LP   GK  R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + +  K+VEN       I   +  + KG ++  + +++T G GI+V VN
  S:    16 DSTKAYSVEEAVALAKETNFAKFDATVEVAYNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKINDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKVKPATAKGTYVTNLTITTTQGVGIKVDVN 227
>gi|50365424|ref|YP_053849.1| 50S ribosomal protein L1 [Mesoplasma florum L1] >gi|61215525|sp|Q6F0K8|RL1_MESFL 50S ribosomal protein L1 >gi|50363980|gb|AAT75965.1| 50S ribosomal protein L1 [Mesoplasma florum L1] (227 aa)
Score = 408, Expect = 6.3e-38, Identities = 93/212 (43%), Positives = 141/212 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D+ K Y ++EA+ LAK+TS  KF S+++++  LN+D  K+DQQ+RG + LP   GK +++LVL      K+A+  G +  G  ELI +I K  W +FD+I+ TP+MM +L  +GK+LG +GLMPNPK G VT D+ K I E KKG  ++R D  GNIH ++GKA+    ++ EN   +L+ +   +  +VKG +I  + +S+TMGPGI+V +N
  S:    16 DKQKVYALDEAIKLAKETSTTKFDSTVELSFNLNIDPRKADQQIRGALVLPAGTGKTQKVLVL-TNTKVKEAQDAGADFVGGEELITKIQKENWFEFDVIVATPEMMAKLGAIGKVLGPKGLMPNPKTGTVTMDVAKAIDEIKKGKIEFRADKEGNIHTIIGKASFTAEQLKENFTTILNEMKRVKPQTVKGDYIINITISTTMGPGIKVEIN 227
>gi|159902762|ref|YP_001550106.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9211] >gi|159887938|gb|ABX08152.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9211] (234 aa)
Score = 408, Expect = 6.3e-38, Identities = 91/200 (45%), Positives = 130/200 (65%)
  Q:    29 EAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           EA+NL K++S AKF  +I+  ++L +D   +DQQ+R TV+LP   G+  RI V+ +G    +AKS G + AG+ EL+  ISKG + FDL+I TP MMP+++KLG++LG RGLMPNPK G VT DL   I EFK G  ++R D  G IH+  GKA+ +   ++EN+  L   I   + +  KG F + + ++STMGP I V
  S:    24 EAINLVKESSTAKFDETIEAHVRLGIDPKYTDQQIRTTVTLPNGTGQTIRIAVIARGEKVAEAKSAGADLAGEEELVDSISKGEMGFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKTGTVTADLVGAIKEFKAGKLEFRADKAGIIHVRFGKASFNADALLENLKTLQETIDRNKPSGAKGRFWKTLYITSTMGPSIEV 223
>gi|193214887|ref|YP_001996086.1| ribosomal protein L1 [Chloroherpeton thalassium ATCC 35110] >gi|193088364|gb|ACF13639.1| ribosomal protein L1 [Chloroherpeton thalassium ATCC 35110] (228 aa)
Score = 408, Expect = 6.3e-38, Identities = 86/203 (42%), Positives = 131/203 (64%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +IE+AV   K+ +  KF +++D+A+ L +D   +DQ +RGTV LP+  GK  R+LV+     +++A+  G +H G +E + +I  GW D D+I+ TP +M E+ KLGKILG RGLMPNPK+G VT D+ K + E K G  ++R D  GN+H  VGK + D  K+VEN    +S I   + ++ KG +++ + LSSTM P I++
  S:    20 SIEDAVARIKEITTVKFDATVDVAMNLGVDPKHADQIVRGTVMLPHGLGKTVRVLVMCNAAKEEEARLAGADHVGLAEYVEKIQGGWTDVDVIVATPDVMGEVGKLGKILGPRGLMPNPKSGTVTMDVAKAVNESKAGRIEFRVDKAGNMHAPVGKVSFDNQKLVENAKAFISAIMRAKPSAAKGQYVKSIYLSSTMSPSIQI 222
>gi|146321194|ref|YP_001200905.1| 50S ribosomal protein L1 [Streptococcus suis 98HAH33] >gi|160174465|sp|A4W2B6|RL1_STRS2 50S ribosomal protein L1 >gi|145692000|gb|ABP92505.1| LSU ribosomal protein L1P [Streptococcus suis 98HAH33] (229 aa)
Score = 407, Expect = 6.8e-38, Identities = 91/209 (43%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+T+ AKF +S+++A  LN+D  K+DQQ+RG + LP   GK  R+LV  +G   ++AK+ G +  G+ +L+A+I+ GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  G +  ++GK + D  K+VEN       +A  +  + KG ++  V++++T G GI+V
  S:    16 DSTKLYSVEEAVALAKKTNFAKFDASVEVAYNLNIDVRKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKINGGWLDFDVVIATPDMMAVVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGIVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMTSVSITTTQGVGIKV 224
>gi|150392171|ref|YP_001322220.1| ribosomal protein L1 [Alkaliphilus metalliredigens QYMF] >gi|166984463|sp|A6TWJ3|RL1_ALKMQ 50S ribosomal protein L1 >gi|149952033|gb|ABR50561.1| ribosomal protein L1 [Alkaliphilus metalliredigens QYMF] (232 aa)
Score = 407, Expect = 7.2e-38, Identities = 92/216 (42%), Positives = 140/216 (64%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           FDR K Y   EAV L K+T+ AKF  +I+  IKL +D+  +DQQ+RG + LP+  GK  ++LV  KG    +A+  G ++ G  +L+A+I  + W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT DL + + E K G  +YR D    IH+ +GKA+ + A++ EN   LL  +A  +  + KG + + V+++STMGPGIRV  +K +
  S:    15 FDREKSYDPNEAVVLVKKTATAKFDETIEAHIKLGVDSRHADQQVRGAIVLPHGTGKTAKVLVFAKGEKVTEAEKAGADYVGSDDLVAKIQGENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDLERAVKEIKAGKVEYRLDKTNIIHVPIGKASFEEAQLAENFKTLLEAVAKAKPAAAKGQYFKSVSVTSTMGPGIRVNPSKVS 231
>gi|196245467|ref|ZP_03144191.1| ribosomal protein L1 [Cyanothece sp. PCC 8802] >gi|196206996|gb|EDY01791.1| ribosomal protein L1 [Cyanothece sp. PCC 8802] (238 aa)
Score = 407, Expect = 7.5e-38, Identities = 97/228 (42%), Positives = 141/228 (61%)
  Q:    12 PKKPSVNF-------DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKT 239
           PKK S  F       D+ + Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TVSLP   G+E R+ V+ +G   ++A + G +  G  ELI EI KG +DF+++I TP MMP+++KLG++LG RGLMP+PK G VT DL   IAEFK G  ++R D  G +H++ GKA+     ++ N+  L   +   R +  KG +   V +S++MGP I V +N    +K T
  S:     2 PKKLSKRFKEALAKVDQNQTYAPLEALQLLKETATAKFNESAEAHIRLGIDPKYTDQQLRTTVSLPKGTGQEVRVAVIARGEKVQEANNAGADIVGSEELIEEIFKGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTADLTNAIAEFKAGKLEFRADRTGIVHVMFGKASFTPEDLLANLKALQETVDRNRPSGAKGRYWRSVFVSASMGPSIAVDINALRDLKLT 236
>gi|23097563|ref|NP_691029.1| 50S ribosomal protein L1 [Oceanobacillus iheyensis HTE831] >gi|33301446|sp|Q8ETZ2|RL1_OCEIH 50S ribosomal protein L1 >gi|22775786|dbj|BAC12064.1| 50S ribosomal protein L1 [Oceanobacillus iheyensis HTE831] (230 aa)
Score = 407, Expect = 7.5e-38, Identities = 91/212 (42%), Positives = 142/212 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           DR+K Y I+EAV LAK+ + A F  +++ A +L +D  K+DQQ+RG   LP+  GK +R+LV  KG   K+A++ G ++ G+ + I +I++GW +FD+I+ TP MM E+ KLG++LG +GLMPNPK G VT ++ K + + K G  +YR D   NIH+ +GK + D  K+V+N   L   +   +  S KGI+++  +++STMGPGI+V V+
  S:    16 DRSKSYEIKEAVELAKKAAKANFDETVEAAFRLGVDPKKADQQIRGAFVLPHGTGKTQRVLVFAKGEKAKEAEAAGADYVGEGDYINKINQGWFEFDVIVATPDMMAEVGKLGRVLGPKGLMPNPKTGTVTFEVEKAVNDIKAGKVEYRVDKSANIHVPIGKISFDDQKLVDNFVALTEQLVKVKPQSSKGIYMKNASITSTMGPGIKVDVS 227
>gi|22537662|ref|NP_688513.1| 50S ribosomal protein L1 [Streptococcus agalactiae 2603V/R] >gi|25011619|ref|NP_736014.1| 50S ribosomal protein L1 [Streptococcus agalactiae NEM316] >gi|76787201|ref|YP_330149.1| 50S ribosomal protein L1 [Streptococcus agalactiae A909] >gi|76799123|ref|ZP_00781310.1| ribosomal protein L1 [Streptococcus agalactiae 18RS21] >gi|77405192|ref|ZP_00782290.1| ribosomal protein L1 [Streptococcus agalactiae H36B] >gi|77408550|ref|ZP_00785286.1| ribosomal protein L1 [Streptococcus agalactiae COH1] >gi|77411680|ref|ZP_00788019.1| ribosomal protein L1 [Streptococcus agalactiae CJB111] >gi|77413997|ref|ZP_00790170.1| ribosomal protein L1 [Streptococcus agalactiae 515] >gi|54039109|sp|P66094|RL1_STRA5 50S ribosomal protein L1 >gi|54041603|sp|P66093|RL1_STRA3 50S ribosomal protein L1 >gi|91207381|sp|Q3K004|RL1_STRA1 50S ribosomal protein L1 >gi|22534549|gb|AAN00386.1|AE014261_14 ribosomal protein L1 [Streptococcus agalactiae 2603V/R] >gi|24413159|emb|CAD47237.1| ribosomal protein L1 [Streptococcus agalactiae NEM316] >gi|76562258|gb|ABA44842.1| ribosomal protein L1 [Streptococcus agalactiae A909] >gi|76585527|gb|EAO62098.1| ribosomal protein L1 [Streptococcus agalactiae 18RS21] >gi|77159977|gb|EAO71115.1| ribosomal protein L1 [Streptococcus agalactiae 515] >gi|77162252|gb|EAO73224.1| ribosomal protein L1 [Streptococcus agalactiae CJB111] >gi|77172824|gb|EAO75957.1| ribosomal protein L1 [Streptococcus agalactiae COH1] >gi|77176194|gb|EAO78965.1| ribosomal protein L1 [Streptococcus agalactiae H36B] (229 aa)
Score = 407, Expect = 8.5e-38, Identities = 90/209 (43%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++EEAV LAK+T+ AKF ++++++  LN+D  K+DQQ+RG + LP   GK  R+LV  +G   ++AK+ G +  G+ +L+A+I  GWLDFD++I TP MM  + +LG++LG R LMPNPK G VT D+ K + E K G   YR D  GN+  ++GK + D AK+V+N       I   +  + KG +I  +++++T G GI+V
  S:    16 DSTKAYSVEEAVALAKETNFAKFDATVEVSYNLNIDVKKADQQIRGAMVLPAGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKIQGGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITYRADKAGNVQALIGKVSFDDAKLVDNFKAFNDVIVKAKPATAKGTYITNLSITTTQGVGIKV 224
>gi|83319637|ref|YP_424061.1| 50S ribosomal protein L1 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|91207357|sp|Q2ST52|RL1_MYCCT 50S ribosomal protein L1 >gi|83283523|gb|ABC01455.1| ribosomal protein L1 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (226 aa)
Score = 406, Expect = 8.9e-38, Identities = 94/209 (44%), Positives = 140/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++ K Y + +A++LAKQT+  KF S++++A  LN+D  K+DQQ+RG V LP   GK +R+LVL    T K+A+    +  G  ELI  I ++ W DFD+I+ TP+MM +L  +GKILG +GLMPNPK G VT D+ K + + KKG  +YR D  GNIH+++GK + +  K+ EN   ++  I   +  +VKG +I+ + LS+TMGPGI+V
  S:    16 EKNKVYPLNKALDLAKQTATTKFDSTVEVAFNLNIDPRKADQQIRGAVVLPAGTGKTQRVLVLTNTKT-KEAEQAKADIVGGEELINRIKNENWFDFDIIVATPEMMAKLGAIGKILGPKGLMPNPKTGTVTMDVAKAVDDIKKGKVEYRADKEGNIHLIIGKVSFEAEKLEENFKAVIDEIRRVKPQTVKGDYIKNITLSTTMGPGIKV 224
>gi|148273970|ref|YP_001223531.1| 50S ribosomal protein L1 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|160165806|sp|A5CUT3|RL1_CLAM3 50S ribosomal protein L1 >gi|147831900|emb|CAN02871.1| 50S ribosomal protein L1 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (228 aa)
Score = 406, Expect = 9.1e-38, Identities = 89/223 (39%), Positives = 142/223 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +K  +  +   D  K YT  EAV LA++T ++KF S++++A+KL +D  K+DQ +RGTV LP+  GK  R++V   G   + A + G +  G  ELI +++ G+  FD  ++TP++M ++ +LGK+LG RGLMPNPK G VT D+ + +++ K G  ++R D + N+H VVGKA+    ++ EN+   L  I   + +S KG +++K  +S+T GPGI V VN
  S:     4 SKAYRAAAEKIDPAKAYTASEAVELARETGSSKFDSTVEVALKLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPAAEAAIAAGADEVGGDELIEKVAGGYTSFDSAVSTPELMGKVGRLGKVLGPRGLMPNPKTGTVTPDVARAVSDIKGGKIEFRVDKHANVHFVVGKASFSPEQLSENVGAALEEIVRLKPSSSKGRYVQKATVSTTFGPGIPVDVN 226
>gi|11467315|ref|NP_043172.1| ribosomal protein L1 [Cyanophora paradoxa] >gi|1350623|sp|P48125|RK1_CYAPA Cyanelle 50S ribosomal protein L1 >gi|1016116|gb|AAA81203.1| ribosomal protein L1 (237 aa)
Score = 406, Expect = 9.6e-38, Identities = 85/209 (40%), Positives = 128/209 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           + Y   EA+ L KQ S AKF+ ++++  +L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A + G +  G  ELI EI  G LDFD +I TP MMP+++KLG++LG RGLMP+PK G VT DL + I +FK G  ++R D  G +H++ GKAN     ++ N+  +   +   R + VKG + + + ++STM P I V  N
  S:    18 QLYEPLEAIQLLKQISTAKFIETVEVHCRLGIDPKYNDQQLRATVTLPNGTGQTLRVAVITRGEKINEASTAGADLVGAEELIDEIQNGRLDFDCLIATPDMMPQVAKLGRVLGPRGLMPSPKGGTVTFDLAQAINDFKAGKLEFRNDRTGIVHVLFGKANFSEEALLGNLKAVQEAVDRNRPSGVKGKYWKSIYITSTMSPSIEVDYN 226
>gi|28493680|ref|NP_787841.1| 50S ribosomal protein L1 [Tropheryma whipplei str. Twist] >gi|28572871|ref|NP_789651.1| 50S ribosomal protein L1 [Tropheryma whipplei TW08/27] >gi|54039112|sp|P66100|RL1_TROW8 50S ribosomal protein L1 >gi|54041606|sp|P66099|RL1_TROWT 50S ribosomal protein L1 >gi|28411004|emb|CAD67389.1| 50S ribosomal protein L1 [Tropheryma whipplei TW08/27] >gi|28476722|gb|AAO44810.1| 50S ribosomal protein L1 [Tropheryma whipplei str. Twist] (227 aa)
Score = 406, Expect = 9.6e-38, Identities = 83/206 (40%), Positives = 132/206 (64%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +E+A+ L K+T+ AK  S+ ++A+KL +D  K+DQ +RG V LP+  GK  R++V   G + + A   G +  G S+L+A ++ G++DFD+ I+TP++M ++ +LG++LG RGLMPNPK G VT D+ K + +   G  +++TD + NIH V+GK +     + EN++  L  I   R    KG +I+K+  SST GP +RV
  S:    19 KLYPVEDAIGLVKETAYAKIDSAFEVALKLGIDPRKTDQLVRGVVMLPHGTGKAVRVVVFATGPSAQAALDSGASEVGGSDLVARVADGYVDFDVAISTPELMAQVGQLGRVLGPRGLMPNPKTGTVTADVGKAVKDALGGRIEFKTDKHANIHFVIGKTSFSVESLSENLSVALDEINRARPQKHKGRYIKKMFFSSTFGPSVRV 224
>gi|124514453|gb|EAY55966.1| Ribosomal protein L1 [Leptospirillum sp. Group II UBA] (232 aa)
Score = 406, Expect = 9.9e-38, Identities = 84/209 (40%), Positives = 133/209 (63%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           + Y+++EA+ L K+   A F  S+D+A+ L +D   SDQ +R  V LP+  GK+ R+LV  KG  +K+A     ++ G  +L+A I +GWLDFD +I TP +M  + +LGK+LG RGLMPNPK G VT ++ + + E K+G  ++++D  G +H  +G+A+ D  +I EN+    S IA  +  + KG +I +  +S+TMGPG+ + VN
  S:    17 RLYSVDEAIALIKEIKFAAFDESVDLAVNLGVDPRHSDQMVRAAVLLPHGIGKKVRVLVFAKGEKEKEALDEKADYVGADDLVARIQEGWLDFDTVIATPDLMGMVGRLGKVLGPRGLMPNPKTGTVTFEIGRAVKEAKQGKVEFKSDKGGVLHFPIGRASFDVPQIRENLMTAFSAIAKAKPQTSKGKYIRQAVISTTMGPGVIIDVN 225
>gi|159487501|ref|XP_001701761.1| plastid ribosomal protein L1 [Chlamydomonas reinhardtii] >gi|158280980|gb|EDP06736.1| plastid ribosomal protein L1 [Chlamydomonas reinhardtii] (297 aa)
Score = 406, Expect = 9.9e-38, Identities = 95/237 (40%), Positives = 143/237 (60%)
  Q:     5 KKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAK 241
           K +  KTP        RT     +EA+ L KQT++ KF  S++   ++ LD   SDQQLR TVSLP+  GKE R+ VL +    K AK  G +  G  +LI +IS G+++FD +I TP MMP+++KLG++LG RGLMPNPK G VTTD+  T+ +FK G  +YR D  GN+H++ G+A+     ++ N+  +   I A +    KG++ + + + +TMGP +R+ V+     K  A+
  S:    68 KAMQTKTP-------GRTSELDPKEAIRLVKQTASTKFTESVEFHARMGLDPKFSDQQLRATVSLPFGTGKELRVAVLTQNDNIKLAKDAGADVVGGDDLIEKISGGFMEFDKLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDVAGTVKDFKGGKVEYRLDKTGNLHVLFGRADFKEEDLLFNLKAVQESIDANKPPGAKGVYWKSMYVCTTMGPSLRIGVSALQNTKGKAE 297
>gi|191163804|ref|ZP_03025675.1| ribosomal protein L1 [Geobacter sp. M21] >gi|190994969|gb|EDV70426.1| ribosomal protein L1 [Geobacter sp. M21] (233 aa)
Score = 406, Expect = 1.0e-37, Identities = 89/229 (38%), Positives = 141/229 (61%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV-LVNKTAVVK 237
           +K  K+     DRTK Y + + + L K  + AKF  ++D+ +KL +D   +DQ +RG V LP   GK+ R+LV  KG  +++A+  G ++ G  +L+A+I  GW DFD  I TP MM  + K+GK+LG RGLMPNPK G VT DL + I E K G  ++R +  G +H  VGK +     + +N+  L+  +   +  + KG +++K+++SSTMGPG+ + L + +A++K
  S:     4 SKKLKEARAKVDRTKTYPLADGIELVKGAAFAKFDETVDLVVKLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEKEREAREAGADYVGADDLVAKIQAGWFDFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDLARAIKESKSGKVEFRVEKAGIVHAPVGKVSFAADVLKQNVVALVEALQKAKPAAAKGTYMKKISVSSTMGPGVNIDLADISAILK 233
>gi|194246779|ref|YP_002004418.1| 50S ribosomal protein L1 [Candidatus Phytoplasma mali] >gi|193807136|emb|CAP18574.1| 50S ribosomal protein L1 [Candidatus Phytoplasma mali] (231 aa)
Score = 406, Expect = 1.0e-37, Identities = 86/209 (41%), Positives = 142/209 (67%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKG-LTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ K Y+++EA+ L KQ S  KF +S+D + + N++ +K+DQ +RG + LP+  GK  ++ V+ K    Q+ AK  G ++ G+ ELI +ISK W DFD++++TP+MMP+LSKLG++LG +GLMPNPK   VT D+ K + + K G  +YRTD  GNI++++GK +    +I+EN   L   +   +  ++K + I+ +++SSTM PG+++
  S:    16 DKNKLYSLQEAIELIKQISTVKFDASVDCSFRFNINPNKADQNIRGVIVLPHGIGKVLKVAVIAKSNEAQEAAKKAGADYIGEQELINKISKNWFDFDVLVSTPEMMPQLSKLGRVLGPKGLMPNPKTETVTNDVFKAVQDIKNGKVEYRTDKTGNINLMIGKISFSAQQILENFKTLYENLMLAK-QNIKNLHIKNISISSTMSPGVKI 224
>gi|11467548|ref|NP_043694.1| ribosomal protein L1 [Odontella sinensis] >gi|1350624|sp|P49544|RK1_ODOSI Chloroplast 50S ribosomal protein L1 >gi|1185243|emb|CAA91726.1| 50S ribosomal protein L1 [Odontella sinensis] (230 aa)
Score = 406, Expect = 1.0e-37, Identities = 88/222 (39%), Positives = 143/222 (64%)
  Q:    10 KTPKKPSVNFDRTK---FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           K  ++   N  +TK   +  +E+A+ + ++T+ AKF  ++++   LN+D   +DQQLR TV+LP+  GK   I VL       +A+  G +  G  +LI EIS+G + FDL+I TP MMP+L+KLG++LG +GLMP+PK+G V+T L  T++EFKKG  +Y+ D  G +H+  GK+N   ++++EN+  L   I   R + VKG + + + + +TMGP I++ +N
  S:     3 KLSRRQKENRAKTKDSIYSNLEDAITILQETATAKFTETVELHANLNIDPKYADQQLRTTVTLPHGIGKTINIAVLTNDSNFTEAREAGADRVGSDDLIEEISQGNISFDLLIATPDMMPKLAKLGRVLGPKGLMPSPKSGTVSTTLTATLSEFKKGKFEYKADKAGVVHVSFGKSNFTHSQLMENLTALYKSIEQNRPSGVKGKYFKSLFICTTMGPSIQLDLN 227
>gi|157836577|pdb|2V49|C Chain C, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 4 Of 4). This File Contains The 50s Subunit Of Molecule 2. (229 aa)
Score = 406, Expect = 1.1e-37, Identities = 86/209 (41%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA  L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I   W+DFD ++ TP +M  + SKLG+IL  RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +    KG F+  V +++TMGP +R+
  S:    16 DPNKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDAWMDFDAVVATPDVMGAVGSKLGRILAPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRI 225
>gi|33239681|ref|NP_874623.1| 50S ribosomal protein L1 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|61215707|sp|Q7VDY6|RL1_PROMA 50S ribosomal protein L1 >gi|33237206|gb|AAP99275.1| Ribosomal protein L1 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (234 aa)
Score = 406, Expect = 1.1e-37, Identities = 92/206 (44%), Positives = 134/206 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y   EA+ L K+ +NAKF  +I+  I+L +D   +DQQ+R TVSLP   G++ RI V+ KG    +A S G + AG+ ELI  ISKG ++FDL+I+TP MMP+++KLG++LG RGLMPNPK G VTTDL  +I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I   + +  KG + + + ++STMGP + +
  S:    18 KSYAPLEAIQLVKENANAKFDETIEAHIRLGIDPKYTDQQIRTTVSLPKGTGQKVRIAVIAKGEKVAEANSAGADLAGEEELIDSISKGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLISSIKEFKAGKLEFRADRAGIVHVRFGKASFSPEDLLENLKVLHEAIDRNKPSGAKGRYWKSLYITSTMGPSVEI 223
>gi|50954137|ref|YP_061425.1| 50S ribosomal protein L1 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|61215516|sp|Q6AH25|RL1_LEIXX 50S ribosomal protein L1 >gi|50950619|gb|AAT88320.1| 50S ribosomal protein L1 [Leifsonia xyli subsp. xyli str. CTCB07] (229 aa)
Score = 406, Expect = 1.1e-37, Identities = 89/209 (42%), Positives = 138/209 (66%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           K+YT  EAV LAK+T +AKF S++++A+KL +D  K+DQ +RGTV LP+  GK  R++V   G   + A + G +  G S+LI +++ G+ DFD  ++TP++M ++ +LGK+LG RGLMPNPK G VT D+ K + + K G  ++R D + N+H VVGKA     ++ +NI   L  +   + ++ KG +I+K  +S+T GPGI + VN
  S:    19 KYYTPTEAVALAKETGSAKFNSTVEVALKLGVDPRKADQMVRGTVILPHGTGKTARVIVFATGPAAEAAIAAGADEVGGSDLIEKVAGGYTDFDSAVSTPELMGQVGRLGKVLGPRGLMPNPKTGTVTPDVAKAVFDIKGGKIEFRVDKHANVHFVVGKAGFTADQLNDNIKVALDEVVRLKPSAAKGRYIQKGAVSTTFGPGIPLDVN 227
>gi|116495731|ref|YP_807465.1| ribosomal protein L1 [Lactobacillus casei ATCC 334] >gi|191639219|ref|YP_001988385.1| 50S ribosomal protein L1 [Lactobacillus casei] >gi|122262867|sp|Q035U9|RL1_LACC3 50S ribosomal protein L1 >gi|116105881|gb|ABJ71023.1| LSU ribosomal protein L1P [Lactobacillus casei ATCC 334] >gi|190713521|emb|CAQ67527.1| 50S ribosomal protein L1 [Lactobacillus casei BL23] (229 aa)
Score = 405, Expect = 1.2e-37, Identities = 89/209 (42%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK YT EEAV+L K+   AKF  ++++A +LN+D  ++DQQ+RG V LP   GK  +++V  +G   K A+  G +  G  +L+ +I  GWLDFD+ + TP MM ++ +LG++LG +GLMPNPK G VT D  K + + K G   YR D  G IH  +GK + D  K++EN   +   +   R  S KGI+I+ + L++TM PGI+V
  S:    16 DPTKQYTPEEAVDLLKKIDFAKFDETVEVAYRLNVDPKQADQQIRGAVVLPNGTGKTAKVIVFAQGDQAKAAEDAGADIVGAEDLVQKIQDGWLDFDVAVATPPMMAQVGRLGRVLGPKGLMPNPKTGTVTMDTAKAVKDIKAGQVAYRVDKAGIIHAPIGKKSFDADKLLENFKAMNDIVLKARPASTKGIYIKSLALTATMAPGIKV 224
>gi|25027045|ref|NP_737099.1| 50S ribosomal protein L1 [Corynebacterium efficiens YS-314] >gi|33301449|sp|Q8FSA5|RL1_COREF 50S ribosomal protein L1 >gi|23492325|dbj|BAC17299.1| putative 50S ribosomal protein L1 [Corynebacterium efficiens YS-314] (236 aa)
Score = 405, Expect = 1.4e-37, Identities = 88/220 (40%), Positives = 132/220 (60%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   D  + YT  +A  L K+TS+  F +S+D+AI+L +D  K+DQ +RGTVSLP   GK  R+ V   G    +A++ G +  G  EL+  I  GW DFD+ I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K I E K G   +R D   N+H  +GKA+ D   + EN   L+  +   + +S KGI+++K+ +SST GPG+ V
  S:     5 SKAYREAAAKIDAGREYTPLQAAELVKETSSKNFDASVDVAIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAAGEKATEAEAAGADFVGTDELVERIQGGWTDFDVAIATPDQMAKIGRIARVLGPRGLMPNPKTGTVTNDVAKAIEEVKGGKISFRVDKASNLHAAIGKASFDAKALAENYGALIDELLRIKPSSSKGIYLKKITMSSTTGPGVAV 224
>gi|169630971|ref|YP_001704620.1| 50S ribosomal protein L1 [Mycobacterium abscessus] >gi|169242938|emb|CAM63966.1| 50S ribosomal protein L1 [Mycobacterium abscessus] (235 aa)
Score = 405, Expect = 1.4e-37, Identities = 88/220 (40%), Positives = 140/220 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   DR K YT  EA  LAK+TS+ K+ +++++A++L +D  K+DQ +RGTV+LP+  GK  R++V   G   + A + G +  G  +LI  I  GW+DFD  I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K + + K G   +R D + N+H+++GKA+ D  K+ EN   +L  I   + +S KG +++KV +S+T GPGI+V
  S:     5 SKAYREAAEKVDREKLYTPLEATKLAKETSSKKYDATVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAVGDKAEAAAAAGADVVGSDDLIERIQGGWVDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVAKAVTDIKGGKINFRVDKHSNLHLIIGKASFDAEKLTENYGAVLDEILRAKPSSAKGRYLKKVVVSTTTGPGIQV 224
>gi|163768269|ref|ZP_02175266.1| ribosomal protein L1 [Anaeromyxobacter sp. K] >gi|167459100|ref|ZP_02325292.1| ribosomal protein L1 [Anaeromyxobacter dehalogenans 2CP-1] >gi|167414585|gb|EDR81330.1| ribosomal protein L1 [Anaeromyxobacter dehalogenans 2CP-1] >gi|196172528|gb|ACG73501.1| ribosomal protein L1 [Anaeromyxobacter sp. K] (234 aa)
Score = 405, Expect = 1.4e-37, Identities = 89/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y ++EA++L KQT+  KF  ++D +I L +D   +DQ +RG V LP+  GK  R+ V  KG   K+A+  G +  G  +L  +I  G++DFD +I TP MM  + +LGKILG RGLMPNPK G VT DL + + E K G  ++R +  G +H+  GKA+ D  K+  N + ++  I   +  + KG++++ V LS+TMGPGI+V
  S:    16 DRTKRYKLDEAMSLVKQTATKKFDETVDASINLGVDPKHADQVVRGAVVLPHGMGKTVRLAVFAKGDKAKEAQEAGADIVGAEDLAEKIQGGFMDFDKLIATPDMMGVVGRLGKILGPRGLMPNPKVGTVTMDLARAVKEQKAGKVEFRVEKAGIVHVPFGKASFDPDKLKANFSAIMEVIYKAKPQTAKGVYVKNVTLSTTMGPGIKV 224
>gi|172039968|ref|YP_001799682.1| 50S ribosomal protein L1 [Corynebacterium urealyticum DSM 7109] >gi|171851272|emb|CAQ04248.1| 50S ribosomal protein L1 [Corynebacterium urealyticum DSM 7109] (238 aa)
Score = 404, Expect = 1.6e-37, Identities = 92/220 (41%), Positives = 137/220 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   DR   YT  +A  LAK TS+  + ++ID+AI+L +D  K+DQ +RGTV+LP   GK+ R++V  +G     A+  G +  G +ELI +I  GW DFD  I TP  M ++ ++ ++LG RGLMPNPK G VTTD+ K ++E K G   +R D   N+H ++GKA+ D  K+ EN   L+  +   + +S KG +I+KV LSST GPG+ V
  S:     5 SKAYREAAAKVDRDNKYTPLQAAKLAKATSSKNYDATIDVAIRLGVDPRKADQLVRGTVALPNGTGKDVRVVVFAEGPNATAAEEAGADFVGSAELIEKIQGGWTDFDAAIATPDQMAKVGRVARVLGPRGLMPNPKTGTVTTDVAKAVSEIKGGKISFRVDKASNLHALIGKASFDEKKLAENYGALIDELLRIKPSSSKGKYIKKVTLSSTNGPGVPV 224
>gi|153952850|ref|YP_001393615.1| hypothetical protein CKL_0213 [Clostridium kluyveri DSM 555] >gi|189041810|sp|A5N4N6|RL1_CLOK5 50S ribosomal protein L1 >gi|146345731|gb|EDK32267.1| RplA [Clostridium kluyveri DSM 555] (229 aa)
Score = 404, Expect = 1.7e-37, Identities = 91/219 (41%), Positives = 140/219 (63%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+ +   DR   YT  EA+ LA +T+ A F  +I+++IKL +D   +DQQ+RG V LP+  GK+ R+LVL KG   K+A+  G ++ G  E + +I K  W DFD+++ TP MM  + +LG+ILG +GLMPNPK+G VT D+ K I E K G  +YR D    +H+ +GK + +  K+++N   L+  I   + ++ KG +++ V +SSTMGPGI++
  S:     3 KKYKESTKLIDRKTLYTPLEAMELALKTAKANFDETIELSIKLGVDPRHADQQVRGAVVLPHGTGKKVRVLVLAKGDRIKEAEDAGADYVGAEEYVEKIQKENWFDFDVVVATPDMMGVVGRLGRILGPKGLMPNPKSGTVTFDVAKAIQEIKAGKVEYRVDKTSIVHVPIGKKSFEVQKLLDNFRVLMEAIIKAKPSAAKGQYLKSVAVSSTMGPGIKI 222
>gi|42561511|ref|NP_975962.1| 50S ribosomal protein L1 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61215583|sp|Q6MRY7|RL1_MYCMS 50S ribosomal protein L1 >gi|42493010|emb|CAE77604.1| 50S ribosomal protein L1 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (226 aa)
Score = 404, Expect = 1.8e-37, Identities = 94/209 (44%), Positives = 139/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++ K Y + +A++LAKQTS  KF S++++A  LN+D  K+DQQ+RG V LP   GK +R+LVL    T K+A+    +  G  ELI  I ++ W DFD+I+ TP+MM +L  +GKILG +GLMPNPK G VT D+ K + + KK   +YR D  GNIH+++GK + +  K+ EN   ++  I   +  +VKG +I+ + LS+TMGPGI+V
  S:    16 EKNKVYPLTQALDLAKQTSTTKFDSTVEVAFNLNIDPRKADQQIRGAVVLPAGTGKTQRVLVLTNTKT-KEAEQAKADIVGGEELINRIKNENWFDFDIIVATPEMMAKLGAIGKILGPKGLMPNPKTGTVTIDVAKAVDDIKKRKVEYRADKEGNIHLIIGKVSFEIEKLEENFKAVIDEIRRVKPQTVKGDYIKNITLSTTMGPGIKV 224
>gi|189502707|ref|YP_001958424.1| hypothetical protein Aasi_1399 [Candidatus Amoebophilus asiaticus 5a2] >gi|189498148|gb|ACE06695.1| hypothetical protein Aasi_1399 [Candidatus Amoebophilus asiaticus 5a2] (232 aa)
Score = 404, Expect = 1.9e-37, Identities = 88/209 (42%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K Y +EEA+ L ++ +  KF +SIDIA+ L +D  K+DQ +RGTV LP+  GK KRILVL     +K+A+  G +H G  + I +I +GW+D D+IIT P++M ++ +LGKILG RGLMPNPK G VT ++ K +   K G  +Y+ D YG +H  VG+ +     + +N   LL+ +   +  S KG +++ ++L+STM  G+ V
  S:    16 DFQKSYKLEEAIELVQKITYTKFDASIDIAVHLGVDPRKADQMVRGTVVLPHGTGKNKRILVLCTPEKEKEAREAGADHVGLDDYIKKIEEGWVDIDVIITMPEIMAKVGRLGKILGPRGLMPNPKTGTVTVEIAKAVQAVKSGKIEYKVDKYGIVHASVGRVSFSKEALRDNAKELLATLLKAKPASAKGSYLKSISLASTMSKGVDV 224
>gi|111115221|ref|YP_709839.1| 50S ribosomal protein L1 [Borrelia afzelii PKo] >gi|167942725|ref|ZP_02529799.1| 50S ribosomal protein L1 [Borrelia afzelii ACA-1] >gi|123046995|sp|Q0SNB5|RL1_BORAP 50S ribosomal protein L1 >gi|110890495|gb|ABH01663.1| ribosomal protein L1 [Borrelia afzelii PKo] (226 aa)
Score = 404, Expect = 1.9e-37, Identities = 91/209 (43%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D++KFY+IE+A++L K+    KF  +IDI++ LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP IRV
  S:    16 DKSKFYSIEDAISLLKEIKFVKFDETIDISVNLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDIVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFIKEVVKKRPSDLKGTFIDSIYISSTMGPSIRV 221
>gi|145620215|ref|ZP_01776251.1| ribosomal protein L1 [Geobacter bemidjiensis Bem] >gi|144943441|gb|EDJ78530.1| ribosomal protein L1 [Geobacter bemidjiensis Bem] >gi|197086673|gb|ACH37944.1| ribosomal protein L1 [Geobacter bemidjiensis Bem] (233 aa)
Score = 403, Expect = 2.0e-37, Identities = 90/229 (39%), Positives = 141/229 (61%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV-LVNKTAVVK 237
           +K  K+     DRTK Y + + + L K  + AKF  ++D+ +KL +D   +DQ +RG V LP   GK+ R+LV  KG  +K+A+  G ++ G  +L+A+I  GW +FD  I TP MM  + K+GK+LG RGLMPNPK G VT DL + I E K G  ++R +  G +H  VGK +     + +N+  L+  +   +  + KG +++KV++SSTMGPG+ + L + +A++K
  S:     4 SKKLKEARAKVDRTKTYPLADGIELVKGAAFAKFDETVDLVVKLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEKEKEAREAGADYVGADDLVAKIQGGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDLARAIKESKSGKVEFRVEKAGIVHAPVGKVSFAADTLKQNVVALVEALQKAKPAAAKGTYMKKVSVSSTMGPGVNIDLADISAILK 233
>gi|51598649|ref|YP_072837.1| 50S ribosomal protein L1 [Borrelia garinii PBi] >gi|61214603|sp|Q661M6|RL1_BORGA 50S ribosomal protein L1 >gi|51573220|gb|AAU07245.1| ribosomal protein L1 [Borrelia garinii PBi] (226 aa)
Score = 403, Expect = 2.2e-37, Identities = 91/209 (43%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D++KFY+IE+A++L K+    KF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D AKI EN +  +  +  KR + +KG FI+ + +SSTMGP I++
  S:    16 DKSKFYSIEDAISLLKEIKFVKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYIGDDDLINKIKSGWDEFDIVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNAKIKENYDEFIKEVVKKRPSDLKGAFIDSIYISSTMGPSIKI 221
>gi|167575195|ref|ZP_02368069.1| 50S ribosomal protein L1 [Borrelia valaisiana VS116] (226 aa)
Score = 403, Expect = 2.2e-37, Identities = 92/209 (44%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR+KFY IE+A++L K+    KF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP+MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DRSKFYNIEDAISLLKEIKFVKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDVVVATPEMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFIKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|158319532|ref|YP_001512039.1| ribosomal protein L1 [Alkaliphilus oremlandii OhILAs] >gi|166984506|sp|A8MLC9|RL1_ALKOO 50S ribosomal protein L1 >gi|158139731|gb|ABW18043.1| ribosomal protein L1 [Alkaliphilus oremlandii OhILAs] (232 aa)
Score = 403, Expect = 2.2e-37, Identities = 88/209 (42%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+T  Y  +EA+ LAK+T+ AKF  +++  IKL +D+  +DQQ+RG V LP+  GK  RILV  KG    +A+  G ++ G  EL+A+I  + W +FD+++ TP MM  + +LG++LG +GLMPNPK+G VT DL K + E K G  +YR D    IH+ +GKA+ +  ++VEN   LL  +   +  + KG +++ + ++STMGPGI++
  S:    16 DKTNLYDPKEAIELAKKTATAKFDETVEAHIKLGVDSRHADQQVRGAVVLPHGTGKTVRILVFAKGEKAIEAEKAGADYVGGDELVAKIQGENWFEFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDLTKAVNEIKAGKVEYRLDKTNIIHVPLGKASFEETQLVENFRTLLDAVVKAKPAAAKGQYLKSITVTSTMGPGIKI 225
>gi|160892865|ref|ZP_02073654.1| hypothetical protein CLOL250_00395 [Clostridium sp. L2-50] >gi|156865424|gb|EDO58855.1| hypothetical protein CLOL250_00395 [Clostridium sp. L2-50] (230 aa)
Score = 403, Expect = 2.2e-37, Identities = 88/216 (40%), Positives = 137/216 (63%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           +D+T  Y  EEAV L K+ + AKF  +I+  ++L +D   +DQQ+RG V LP+  GK  ++LV  KG    +A + G ++AG  EL+ +I K GWLDFD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K + + K G  +YR D    IH+ VGKA+    ++ EN   L+  I   + ++ KG +++ V ++STMGPG+++   + A
  S:    14 YDKTAVYEFEEAVALVKKMATAKFDETIEAHLRLGVDGRHADQQVRGAVVLPHGTGKTVKVLVFAKGAKVDEALAAGADYAGGEELVPKIQKDGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAVNDIKAGKIEYRLDKANIIHVPVGKASFTEEQLDENFQTLMDAIVKAKPSAAKGQYLKSVVIASTMGPGVKINTTRFA 230
>gi|116793980|gb|ABK26955.1| unknown [Picea sitchensis] (368 aa)
Score = 403, Expect = 2.2e-37, Identities = 82/204 (40%), Positives = 133/204 (65%)
  Q:    30 AVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           A++L KQTS+ KF+ + +   +LN+D   +DQQLR TV LP   G+  R+ VL +G    +A++ G +  G  +LIA+I  G+++FD +I +P MMP+++ LGK+LG RGLMPNPK G VTTD+P+ I+EFKKG  +YR D  G +H+  GK +     ++ N+   ++ +   + +  KG++ +  ++ +TMGP IR+++  T
  S:   158 AISLLKQTSSTKFVETTEAHFRLNIDPKYNDQQLRATVILPKGTGQAVRVAVLAQGEKLIEAENAGADLVGGEDLIAQIKGGFMEFDKLIASPDMMPKVASLGKLLGPRGLMPNPKAGTVTTDIPQAISEFKKGKVEYRADKTGIVHIPFGKTDFPEEDLLTNLIAAVNSVDTNKPSGAKGVYWKTAHICATMGPSIRLIIKDT 361
>gi|177667720|ref|ZP_02943226.1| ribosomal protein L1 [Cyanothece sp. PCC 8801] >gi|172073543|gb|EDT58967.1| ribosomal protein L1 [Cyanothece sp. PCC 8801] (238 aa)
Score = 403, Expect = 2.3e-37, Identities = 96/228 (42%), Positives = 140/228 (61%)
  Q:    12 PKKPSVNF-------DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKT 239
           PKK S  F       D+ + Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TVSLP   G+E R+ V+ +G   ++A + G +  G  ELI EI KG +DF+++I TP MMP+++KLG++LG RGLMP+PK G VT DL   I EFK G  ++R D  G +H++ GKA+     ++ N+  L   +   R +  KG +   V +S++MGP I V +N    +K T
  S:     2 PKKLSKRFKEALAKVDQNQTYAPLEALQLLKETATAKFNESAEAHIRLGIDPKYTDQQLRTTVSLPKGTGQEVRVAVIARGEKVQEANNAGADIVGSEELIEEIFKGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTADLTNAITEFKAGKLEFRADRTGIVHVMFGKASFTPEDLLANLKALQETVDRNRPSGAKGRYWRSVFVSASMGPSIAVDINALRDLKLT 236
>gi|183221357|ref|YP_001839353.1| 50S ribosomal protein L1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911450|ref|YP_001963005.1| 50S Ribosomal protein L1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776126|gb|ABZ94427.1| 50S Ribosomal protein L1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779779|gb|ABZ98077.1| 50S ribosomal protein L1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (230 aa)
Score = 403, Expect = 2.3e-37, Identities = 92/213 (43%), Positives = 138/213 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           DRTK YT+ EAV LAK TS +KF  +++I+ K+N    KS Q +RGT+SLP+  GK  ++LV  KG  Q +A+  G +  GD +LI ++S GW DFD  + TP MM E+ KLG +LG +GLMP PK G VTTD+ K + E K G  +YR D  G +H+ VGK +    K+ +NIN +++ +   + +  KG +++  ++++TMG G++V V +
  S:    15 DRTKAYTLGEAVGLAKATSYSKFDGTLEISTKINY---KSLQNVRGTISLPHGTGKTIKVLVFCKGDKQNEAREAGADFVGDMDLIEKVSGGWTDFDACVATPDMMKEVGKLGPVLGRKGLMPKPKAGTVTTDVSKAVKELKAGRIEYRPDKGGVVHLGVGKCSFSDDKLSDNINAVVAALMKDKPSDAKGDYLKSFSVAATMGIGVKVDVKE 224
>gi|196180484|gb|EDX75475.1| ribosomal protein L1 [Microcoleus chthonoplastes PCC 7420] (238 aa)
Score = 403, Expect = 2.3e-37, Identities = 90/204 (44%), Positives = 125/204 (61%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TVSLP   G+  R+ V+ KG    +A + G + AG  ELI EI  G +DFD +I TP MMP+++KLG++LG RGLMP+PK G VT DL + I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG F   + +S+TMGP I V
  S:    21 YEPTEALKLLKETATAKFPESAEAHIRLGIDPKYTDQQLRTTVSLPKGTGQVVRVAVIAKGEKVTEATNAGADIAGSEELIGEIQNGMMDFDRLIATPDMMPQVAKLGRLLGPRGLMPSPKGGTVTFDLTQAIEEFKAGKLEFRADRTGIVHVMFGKASFSAEDLLVNLKSLQETIDRNRPSGAKGRFWRSIFISATMGPAIEV 224
>gi|147669525|ref|YP_001214343.1| 50S ribosomal protein L1 [Dehalococcoides sp. BAV1] >gi|189041813|sp|A5FQR1|RL1_DEHSB 50S ribosomal protein L1 >gi|146270473|gb|ABQ17465.1| LSU ribosomal protein L1P [Dehalococcoides sp. BAV1] (237 aa)
Score = 403, Expect = 2.3e-37, Identities = 87/210 (41%), Positives = 135/210 (64%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNV--TTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
            D++  Y   EA++LAK+ S AKF  ++++ +K+ LD   + QQLRG   LP+  GK  R+LV  +G  +K A+  G +  G  ELI +I  G+LDFD+ I+TP MM ++ KLGK+LG RGLMPNPK+G V    D  K I E +KG  +++ D  G +H+++GKA+ +   ++EN+  ++  I   + T  KG +I+   L++TMGPG+R+
  S:    15 LDQSAAYAPAEAIDLAKKMSAAKFDETVEMHLKMGLDPKNATQQLRGVAVLPHGLGKTVRVLVFAQGEAEKAAQVAGADVYGGDELIKKIEAGFLDFDVAISTPDMMSKVGKLGKVLGRRGLMPNPKSGTVVPAEDFKKVIEEARKGRVEFKLDRSGIVHIILGKASFEGQMLLENMTSVVDAIIRSKPTGAKGQYIKSAYLATTMGPGVRL 226
>gi|109156960|pdb|1ZHO|A Chain A, The Structure Of A Ribosomal Protein L1 In Complex With Mrna >gi|109156962|pdb|1ZHO|C Chain C, The Structure Of A Ribosomal Protein L1 In Complex With Mrna >gi|109156964|pdb|1ZHO|E Chain E, The Structure Of A Ribosomal Protein L1 In Complex With Mrna >gi|109156966|pdb|1ZHO|G Chain G, The Structure Of A Ribosomal Protein L1 In Complex With Mrna (228 aa)
Score = 403, Expect = 2.4e-37, Identities = 86/209 (41%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA +L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW DFD ++ TP +   + SKLG+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +    KG F+  V +++T GP +R+
  S:    15 DPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWXDFDAVVATPDVXGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTXGPSVRI 224
>gi|134298082|ref|YP_001111578.1| ribosomal protein L1 [Desulfotomaculum reducens MI-1] >gi|172044212|sp|A4J100|RL1_DESRM 50S ribosomal protein L1 >gi|134050782|gb|ABO48753.1| LSU ribosomal protein L1P [Desulfotomaculum reducens MI-1] (229 aa)
Score = 403, Expect = 2.5e-37, Identities = 90/214 (42%), Positives = 133/214 (62%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           FD+   Y   EA+ + K+T+ AKF  ++++A +L +D   +DQQLRG V LP+  GK K +LV  KG   K+A++ G +  G  +++ +I  GWL FD+ I TP MM  + +LG++LG RGLMPNPK G VT ++   + + K G   YRTD  G IH  +GKA+ DT K+ EN   L   +   +  S KG +++ + +SSTMGPG+R+  NK
  S:    15 FDKNTLYEPLEALEMVKKTATAKFDETVEVAFRLGVDPRHADQQLRGAVVLPHGTGKTKTVLVFAKGDKAKEAEAAGADFVGAEDMLEKIQGGWLGFDVAIATPDMMGTVGRLGRVLGPRGLMPNPKTGTVTFEVGDAVRDAKGGKITYRTDKVGIIHAPIGKASFDTQKLAENFKTLADTLVRIKPASAKGTYMKTITVSSTMGPGVRINPNK 228
>gi|182678327|ref|YP_001832473.1| ribosomal protein L1 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634210|gb|ACB94984.1| ribosomal protein L1 [Beijerinckia indica subsp. indica ATCC 9039] (231 aa)
Score = 402, Expect = 2.8e-37, Identities = 86/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y ++EAV L K+ +NAKF  +++IA+ L +D   +DQ +RG V+LP   G+  R+ V  +G    +A + G +  G  +L+A +  G + FD  I TP MMP + +LGK+LG RGLMPNPK G VT D+   +   K G  ++R +  G I   VGKA+ +T K++ENI   +  +A  +    KG +I++V LSSTMGPG+++
  S:    16 DRVKLYPVDEAVKLIKERANAKFDETVEIAMNLGVDPKHADQMVRGVVNLPNGTGRTLRVAVFARGAKADEALAAGADIVGAEDLVATVQGGTIAFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTMDVAGAVKASKGGAVEFRVEKAGIIQGSVGKASFETEKLLENIAAFVDAVAKAKPQGAKGTYIQRVALSSTMGPGVKI 224
>gi|110639545|ref|YP_679754.1| 50S ribosomal protein L1 [Cytophaga hutchinsonii ATCC 33406] >gi|123354296|sp|Q11QA2|RL1_CYTH3 50S ribosomal protein L1 >gi|110282226|gb|ABG60412.1| LSU ribosomal protein L1P [Cytophaga hutchinsonii ATCC 33406] (232 aa)
Score = 402, Expect = 2.9e-37, Identities = 91/219 (41%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K     FD    Y++ +A  L K+ +  KF +S+DI ++L +D  K+DQ +RG V+LP+  GK+ R+LVL      +DAK  G +H G  + I +I  GWLD D+IIT P +M ++ KLGKILG R LMPNPK G VT D+ K + + K G   ++ D +G +H  VGK +     I+EN N +L  +A  +  S KG ++  + LSSTM PGI +
  S:     6 KKQKDALSKFDVNNSYSLSDASALIKEITYTKFDASVDIDVRLGVDPKKADQMVRGIVTLPHGTGKDVRVLVLCTPDKAQDAKDAGADHVGLDDYIQKIEGGWLDIDVIITMPTVMAKVGKLGKILGPRNLMPNPKAGTVTLDVAKAVKDVKAGKIDFKVDKFGIVHTSVGKVSFSPEMILENANEVLQVLAKLKPASAKGTYVRSITLSSTMSPGITI 224
>gi|189424400|ref|YP_001951577.1| ribosomal protein L1 [Geobacter lovleyi SZ] >gi|189420659|gb|ACD95057.1| ribosomal protein L1 [Geobacter lovleyi SZ] (233 aa)
Score = 402, Expect = 3.0e-37, Identities = 90/220 (40%), Positives = 139/220 (63%)
  Q:     9 NKTPKKPS---VNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K+ KK S      DR+  Y ++ AV + K T+ AKF  ++D+A+KL +D   +DQ +RG V LP   GK  R+LV  KG  +K+A   G ++ G  +L+A+I +GW +FD  I TP MM  + K+GK+LG RGLMPNPK G VT ++ + + E K G  ++R +  G +H  +GK + D  K+  N+  L+  +   + ++ KG +I+K++LSSTMGPGI +
  S:     2 SKSTKKHSAAMTKVDRSTVYPLKTAVEVVKDTAYAKFDETVDVAVKLGVDPRHADQMVRGAVVLPNGLGKNVRVLVFAKGEKEKEALDAGADYVGADDLVAKIQEGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFEVGRAVKESKAGKVEFRVEKAGIVHAPIGKVSFDAEKLQGNLVALVEALVKAKPSAAKGTYIKKISLSSTMGPGINL 224
>gi|116491400|ref|YP_810944.1| 50S ribosomal protein L1P [Oenococcus oeni PSU-1] >gi|122276418|sp|Q04E43|RL1_OENOB 50S ribosomal protein L1 >gi|116092125|gb|ABJ57279.1| LSU ribosomal protein L1P [Oenococcus oeni PSU-1] (230 aa)
Score = 402, Expect = 3.0e-37, Identities = 87/212 (41%), Positives = 131/212 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D +K Y++ +A  L K  S   F S++++   LN+DT+K+DQQLRG + LP   G  K ++V   G   KDA   G +  G  +LI ++  GW DFD+ I TP  M ++ ++G+ LG +GLMPNPK G VT D+ K +++ K G   YRTD  GN+ + VGK + D+ K+ ENI  + S I   R ++VKG ++   +L+STMGPG+ + V+
  S:    17 DHSKKYSLADAATLVKDISFTNFDSNVEVVFDLNVDTTKADQQLRGAIVLPNGSGNPKTVVVFADGEKAKDATQAGADFVGTDDLIQKVQSGWTDFDVAIATPDQMAKVGRVGRALGPKGLMPNPKEGTVTMDVTKAVSDAKGGQVTYRTDKNGNVAVPVGKVSFDSDKLAENIKSVSSTILGARPSTVKGTYVLSAHLASTMGPGVELDVS 228
>gi|172035141|ref|YP_001801642.1| 50S ribosomal protein L1 [Cyanothece sp. ATCC 51142] >gi|171696595|gb|ACB49576.1| 50S ribosomal protein L1 [Cyanothece sp. ATCC 51142] (238 aa)
Score = 402, Expect = 3.1e-37, Identities = 88/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ + Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TVSLP   G+E R+ V+ +G   ++A + G +  G  ELI EI KG +DF+++I TP MMP+++KLG++LG RGLMP+PK G VT DL   I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I  +R +  KG +   V +S++MGP I++
  S:    16 DQDRAYEPLEALTLLKETATAKFNESAEAHIRLGIDPKYTDQQLRTTVSLPKGTGQEIRVAVIARGEKVQEASNAGADIVGSEELIDEIQKGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTADLETAINEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLANLKALQETIDRQRPSGAKGRYWRSVFVSASMGPSIQI 224
>gi|87306548|ref|ZP_01088695.1| 50S ribosomal protein L1 [Blastopirellula marina DSM 3645] >gi|87290727|gb|EAQ82614.1| 50S ribosomal protein L1 [Blastopirellula marina DSM 3645] (225 aa)
Score = 402, Expect = 3.3e-37, Identities = 80/202 (39%), Positives = 127/202 (62%)
  Q:    27 IEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +E+AV + K  +  KF  ++D A++L +D  ++DQ +RG + LP+  GKE R++V  KG   + A+  G +  G  +L  +I  GWLDFD  I TP MM  +  LG++LG RGLMP+P+ G VT D+ + + E+K G  ++R DS G +H VVGK + D  K++ENI    + I + +  + KGI+++ + ++ TM PG+RV
  S:    22 LEKAVEILKGYNTTKFDQTVDCAMRLGIDPKQADQLVRGAIVLPHGIGKELRVVVFAKGDNVRLAEEAGADSVGAEDLAKKIKDGWLDFDACIATPDMMGLVGPLGRVLGPRGLMPSPRAGTVTPDVARVVKEYKAGKVEFRNDSTGIVHAVVGKMSFDQEKLIENIRAFTNQILSMKPAAAKGIYVKSIAIAGTMSPGVRV 223
>gi|83858576|ref|ZP_00952098.1| 50S ribosomal protein L1 [Oceanicaulis alexandrii HTCC2633] >gi|83853399|gb|EAP91251.1| 50S ribosomal protein L1 [Oceanicaulis alexandrii HTCC2633] (236 aa)
Score = 402, Expect = 3.3e-37, Identities = 87/222 (39%), Positives = 133/222 (59%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
            DR K +T+ EAV L K+ + AKF  +I++A+ L +D   +DQ +RG  +LP   G+  R+ V  +G    +AK+ G    G  +L+ +I  G ++FD +I TP MMP + +LGK+LG RG+MPNPK G VT D+ K +   K G  ++R +  G +H  VGKA+   A I EN+  LL  +   + T  KG +++ + LSSTMGPG++V V + +   + A
  S:    15 LDREKLHTVTEAVKLVKERATAKFDETIEVAVNLGVDPRHADQMVRGVANLPNGTGRSMRVAVFARGPKADEAKAAGAEVVGAEDLVEQIQGGEINFDKVIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTMDVTKAVEASKGGAVEFRAEKAGIVHCGVGKASFSEAAIAENVRALLEALVKAKPTGAKGQYVKAIALSSTMGPGVKVDVAEASAPAENA 236
>gi|54020520|ref|YP_115968.1| 50S ribosomal protein L1 [Mycoplasma hyopneumoniae 232] >gi|71893807|ref|YP_279253.1| 50S ribosomal protein L1 [Mycoplasma hyopneumoniae J] >gi|72080791|ref|YP_287849.1| 50S ribosomal protein L1 [Mycoplasma hyopneumoniae 7448] >gi|61215436|sp|Q600J7|RL1_MYCH2 50S ribosomal protein L1 >gi|91207358|sp|Q4A7R3|RL1_MYCH7 50S ribosomal protein L1 >gi|91207359|sp|Q4A9M9|RL1_MYCHJ 50S ribosomal protein L1 >gi|53987693|gb|AAV27894.1| 50s ribosomal protein L1 [Mycoplasma hyopneumoniae 232] >gi|71851934|gb|AAZ44542.1| 50S ribosomal protein L1 [Mycoplasma hyopneumoniae J] >gi|71913915|gb|AAZ53826.1| 50S ribosomal protein L1 [Mycoplasma hyopneumoniae 7448] (231 aa)
Score = 402, Expect = 3.3e-37, Identities = 94/209 (44%), Positives = 134/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHA---GDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ +FY++EEA+ L K+TS  KF  S+D+AI+LNLDT K+DQQLRG V LP+  GK  R+LV     ++  AKSL          +EL   +     +FD+I+  PK+MP L + GK LG +GLMPNPK G V+ +  K +AE KKG   YR D YG IH ++GK N +  ++VEN N LL  I   +  +VKG + + + +S++MGP I++
  S:    16 DKNRFYSLEEAMELVKKTSYTKFSGSVDLAIRLNLDTRKADQQLRGAVVLPHGTGKSVRVLVATDS-SEVAAKSLEAGADLIYSTAELEQNLKIDNFNFDVIVVEPKLMPILGRYGKKLGPKGLMPNPKTGTVSPNPEKAVAEIKKGKANYRADRYGIIHSLIGKTNMEVPQLVENANTLLRLIKRLKPNTVKGNYFKNLTVSASMGPSIKI 226
>gi|86739283|ref|YP_479683.1| 50S ribosomal protein L1P [Frankia sp. CcI3] >gi|86566145|gb|ABD09954.1| LSU ribosomal protein L1P [Frankia sp. CcI3] (259 aa)
Score = 401, Expect = 3.4e-37, Identities = 84/210 (40%), Positives = 135/210 (64%)
  Q:    24 FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           FY+  EAV LA+QTS  K+ +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G    +A + G +  G  +L+A I +G+L+FD  + TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +++ K G   +R D  GN+H+V+GK N    +++EN    L  I   + ++ KG +++K+  ++TMGPGI V  N+T
  S:    40 FYSPLEAVRLAQQTSTTKYDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKSPRVAVFAAGEKAAEASAAGADIVGSDDLVARIQEGFLEFDATVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTLDIGKAVSDIKGGKINFRVDKQGNLHIVIGKTNFTDTQLIENYTVALDEIVRVKPSAAKGRYLKKITFTTTMGPGIPVDPNRT 249
>gi|73748759|ref|YP_307998.1| 50S ribosomal protein L1 [Dehalococcoides sp. CBDB1] >gi|91207352|sp|Q3ZXX8|RL1_DEHSC 50S ribosomal protein L1 >gi|73660475|emb|CAI83082.1| ribosomal protein L1 [Dehalococcoides sp. CBDB1] (237 aa)
Score = 401, Expect = 3.5e-37, Identities = 87/210 (41%), Positives = 135/210 (64%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNV--TTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
            D++  Y   EA++LAK+ S AKF  ++++ +K+ LD   + QQLRG   LP+  GK  R+LV  +G  +K A+  G +  G  ELI +I  G+LDFD+ I+TP MM ++ KLGK+LG RGLMPNPK+G V    D  K I E +KG  +++ D  G +H+++GKA+ +   ++EN+  ++  I   + T  KG +I+   L++TMGPG+R+
  S:    15 LDQSVAYAPAEAIDLAKKMSAAKFDETVEMHLKMGLDPKNATQQLRGVAVLPHGLGKTVRVLVFAQGEAEKAAQVAGADVYGGDELIKKIEAGFLDFDVAISTPDMMSKVGKLGKVLGRRGLMPNPKSGTVVPAEDFKKVIEEARKGRVEFKLDRSGIVHIILGKASFEGQMLLENMTSVVDAIIRSKPTGAKGQYIKSAYLATTMGPGVRL 226
>gi|196256110|ref|ZP_03154648.1| ribosomal protein L1 [Cyanothece sp. PCC 7822] >gi|196203290|gb|EDX98107.1| ribosomal protein L1 [Cyanothece sp. PCC 7822] (237 aa)
Score = 401, Expect = 3.6e-37, Identities = 92/236 (38%), Positives = 141/236 (59%)
  Q:     5 KKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           KK++ +  K+     D  K Y   EA+NL K+T+ AKF  + +  ++L +D   +DQQLR TV+ P   G+  R+ V+ +G   ++A + G +  G  ELI EI  G +DF+++I TP MMP+++KLG++LG RGLMP+PK G VTTDL   I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +   + +S++MGP I+V VN    +K  A
  S:     3 KKISRRL-KEALAKVDENKAYEPLEALNLLKETATAKFDETAEAHVRLGIDPKYTDQQLRTTVTFPKGTGQTVRVAVIARGEKVQEASNGGADIVGSEELIDEIQNGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTTDLAAAIQEFKAGKQEFRADRTGIVHVMFGKASFSAEDLLVNLKALQETIDRNRPSGAKGRYWRTIYVSASMGPSIQVDVNSLRDLKAEA 237
>gi|86606434|ref|YP_475197.1| 50S ribosomal protein L1 [Synechococcus sp. JA-3-3Ab] >gi|123506051|sp|Q2JTQ5|RL1_SYNJA 50S ribosomal protein L1 >gi|86554976|gb|ABC99934.1| ribosomal protein L1 [Synechococcus sp. JA-3-3Ab] (236 aa)
Score = 401, Expect = 3.8e-37, Identities = 88/216 (40%), Positives = 131/216 (60%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           Y   EA+ L K+T+ AKF  + ++ I+L +D   +DQQLR TV LP   G+E R+ V+ +G    +A++ G +  G  +LI EI KG +DFDL+I TP +MP+++KLG++LG RGLMP+PK G VT DL + I EFK G  +YR D  G +H++ GK       ++EN+  +   I   R    KG +   +++ +TMGP I V +N    +K  A
  S:    21 YPPAEALALMKETATAKFDEAAEVHIRLGIDPKYADQQLRTTVVLPRGTGQEIRVAVIARGEKVTEAQNAGADRVGFEDLIEEIGKGVIDFDLLIATPDVMPQVAKLGRLLGPRGLMPSPKGGTVTMDLAQAIKEFKAGKLEYRADKTGIVHLIFGKCKFPVEALLENLKAVQESIDRNRPPGAKGKYWRALHVCATMGPSIEVDINALRELKLVA 236
>gi|126646992|ref|ZP_01719502.1| 50S ribosomal protein L1 [Algoriphagus sp. PR1] >gi|126577040|gb|EAZ81288.1| 50S ribosomal protein L1 [Algoriphagus sp. PR1] (232 aa)
Score = 401, Expect = 3.9e-37, Identities = 88/219 (40%), Positives = 138/219 (63%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+    +D ++ Y++E A ++ K+ +  KF SS+D+ I+L +D  K+DQ +RG V+LP+  GK+ ++LVL      ++A   G ++ G  + IA+I  GW D D+IIT P +M ++ +LG++LG RGLMPNPK+G VT D+ K + E K G   ++ D +G IH  VGKA+    +I EN   L+  I+  + +S KG + + ++LSSTM PGI V
  S:     6 KKQKEALSKYDASQVYSLEAASSIVKEITTTKFDSSVDLDIRLGVDPRKADQMVRGVVALPHGTGKDIKVLVLCSPDKVEEATEAGADYVGLDDYIAKIEGGWTDIDVIITMPNVMAKVGRLGRVLGPRGLMPNPKSGTVTLDVAKAVKEVKAGKIDFKVDKFGIIHAAVGKASFSAEQIEENAKELIQTISKLKPSSSKGTYFKSIHLSSTMSPGIAV 224
>gi|148240709|ref|YP_001226096.1| 50S ribosomal protein L1 [Synechococcus sp. WH 7803] >gi|160174526|sp|A5GPD4|RL1_SYNPW 50S ribosomal protein L1 >gi|147849248|emb|CAK24799.1| 50S ribosomal protein L1 [Synechococcus sp. WH 7803] (235 aa)
Score = 401, Expect = 4.1e-37, Identities = 89/212 (41%), Positives = 132/212 (62%)
  Q:    17 VNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           VN    + Y   EA+ L K+ + AKF  +++   +L +D   +DQQLR TV+LP+  G+  RI V+ +G    +AK+ G   AGD +L+  ISKG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     +++N+  L   I   + +  KG + + + ++STMGP + V
  S:    12 VNKIEERAYEPLEAIKLVKENATAKFDETVEAHARLGIDPKYTDQQLRTTVALPHGTGQTVRIAVITRGEKVAEAKAAGAELAGDEDLVETISKGEMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAINEFKAGKLEFRADRTGIVHVRFGKASFSEGNLLDNLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEV 223
>gi|167933370|ref|ZP_02520445.1| 50S ribosomal protein L1 [Borrelia burgdorferi ZS7] >gi|167944268|ref|ZP_02531342.1| 50S ribosomal protein L1 [Borrelia burgdorferi Bol26] >gi|168692029|ref|ZP_02724821.1| 50S ribosomal protein L1 [Borrelia burgdorferi 94a] (226 aa)
Score = 401, Expect = 4.1e-37, Identities = 93/209 (44%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ KFY IE+A+ L K+   AKF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  H GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKNKFYNIEDAILLLKEIKFAKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATHVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFVKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|38233047|ref|NP_938814.1| 50S ribosomal protein L1 [Corynebacterium diphtheriae NCTC 13129] >gi|61214635|sp|Q6NJG9|RL1_CORDI 50S ribosomal protein L1 >gi|38199306|emb|CAE48937.1| 50S ribosomal protein L1 [Corynebacterium diphtheriae] (235 aa)
Score = 401, Expect = 4.1e-37, Identities = 91/220 (41%), Positives = 138/220 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  K  +   D+ + YT  +A  L K+TS+    +++D+AI+L +D  K+DQ +RGTVSLP   GK  R+ V  +G    +A++ G +  G +ELI +I+ G ++FD+ I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K IAE K G   +R D   N+H ++GKA+ D  K+ EN   LL  I   + +S KGI+++KV L+ST GPG+ V
  S:     5 SKAYKAAAEKIDKGRLYTPLKAAELVKETSSKNCDATVDVAIRLGVDPRKADQLVRGTVSLPNGTGKSVRVAVFAEGEKATEAQAAGADIVGTTELIEQITAGTIEFDVAIATPDQMAKVGRVARVLGPRGLMPNPKTGTVTNDVAKAIAEVKGGKISFRVDKASNLHAIIGKASFDAEKLAENYGALLDEINRIKPSSAKGIYVKKVTLTSTFGPGVPV 224
>gi|122920476|pdb|2HW8|A Chain A, Structure Of Ribosomal Protein L1-Mrna Complex At 2.1 Resolution. (228 aa)
Score = 401, Expect = 4.2e-37, Identities = 85/209 (40%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K YTI+EA +L K+ + AKF  ++++  KL +D  +SDQ +RGTVSLP+  GK+ R+L + KG   K+A+  G ++ G  E+I +I  GW+DFD ++ TP +   + SK G+ILG RGL+PNPK G V  ++ + I E K G  ++R D  G IH  VGKA+    K+ +NI   +  + A +    KG F+  V +++T GP +R+
  S:    15 DPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVXGAVGSKXGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTXGPSVRI 224
>gi|39997957|ref|NP_953908.1| 50S ribosomal protein L1 [Geobacter sulfurreducens PCA] >gi|61214646|sp|Q748Y3|RL1_GEOSL 50S ribosomal protein L1 >gi|39984902|gb|AAR36258.1| ribosomal protein L1 [Geobacter sulfurreducens PCA] (234 aa)
Score = 401, Expect = 4.2e-37, Identities = 83/221 (37%), Positives = 137/221 (61%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T K  ++     DR++ Y + E +   K  + AKF  ++++A++L +D   +DQ +RG V LP   GK+ R+LV  KG  +K+A+  G ++ G  +L+ +I +GW +FD  I TP MM  + K+GK+LG RGLMPNPK G VT D+ + + E K G  ++R +  G +H  VGK + D  K+ EN+  L+  +   + ++ KG +++K+++SSTMGPG+ +
  S:     4 TAKKHREALAKIDRSRTYPLVEGIESVKSAAYAKFDETVEVAVRLGVDPRHADQMVRGAVVLPNGLGKDVRVLVFAKGEKEKEAREAGADYVGAEDLVTKIQEGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDVGRAVKESKAGKVEFRVEKAGIVHAPVGKVSFDADKLKENLLALVEALLKAKPSAAKGTYVKKISISSTMGPGLNL 224
>gi|42524386|ref|NP_969766.1| 50S ribosomal protein L1 [Bdellovibrio bacteriovorus HD100] >gi|61214630|sp|Q6MJ04|RL1_BDEBA 50S ribosomal protein L1 >gi|39576595|emb|CAE80759.1| 50S ribosomal protein L1 [Bdellovibrio bacteriovorus HD100] (234 aa)
Score = 401, Expect = 4.2e-37, Identities = 93/212 (43%), Positives = 136/212 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D  K YT+EEA  L  +T+ AKF  SID+A++L +D  +SDQQ+RG ++LP+  GKE +++V  KG  + +AK+ G +  G  +L+A+I  GWLDFD  I TP MM  +SK+ KILG RGLMPNPK G VT ++ + +   KKG   +R D  G +H  +GK +   AK+ +N   LL  I   +  S KGI++  + ++STMGPG+++  N
  S:    14 DSAKKYTVEEAFKLVVETAPAKFDESIDVALRLGIDPKQSDQQVRGAIALPHGLGKEVKVVVFAKGPKEAEAKAAGADFVGADDLVAKIQGGWLDFDKCIATPDMMATVSKVAKILGPRGLMPNPKIGTVTMNVGEAVTAEKKGKLDFRVDKAGIVHAGIGKKSMGDAKLKDNFMTLLGAIVKAKPASSKGIYLRSIAVASTMGPGVKIEPN 225
>gi|195948030|ref|ZP_03089216.1| 50S ribosomal protein L1 [Borrelia garinii PBr] (226 aa)
Score = 400, Expect = 4.7e-37, Identities = 91/209 (43%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D++KFY+IE+A++L K+    KF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN +  +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKSKFYSIEDAISLLKEIKFVKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYDEFIKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|116493230|ref|YP_804965.1| 50S ribosomal protein L1 [Pediococcus pentosaceus ATCC 25745] >gi|122265306|sp|Q03E49|RL1_PEDPA 50S ribosomal protein L1 >gi|116103380|gb|ABJ68523.1| LSU ribosomal protein L1P [Pediococcus pentosaceus ATCC 25745] (229 aa)
Score = 400, Expect = 4.9e-37, Identities = 89/206 (43%), Positives = 134/206 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y  +EA+ L K+   AKF ++++   KLN+DT ++DQQLRG V LP   GKE+ ++V  KG   + AK+ G +  GD +L+  I  GWLDFD+ I TP MM ++ +LG++LG + LMPNPK G VT D+ K +A+ K G   YRTD  GN+H+ +GK + D  +++ N+  +   I   R  SVKG +++ V+++ST GPG++V
  S:    19 KAYAPKEALELVKKIDFAKFDATVETVYKLNVDTKQADQQLRGAVVLPNGTGKEQTVIVFAKGAKAEAAKAAGADVVGDDDLVQRIQDGWLDFDVAIATPDMMGQVGRLGRVLGPKNLMPNPKTGTVTMDVEKAVADSKSGKVTYRTDRDGNVHVPIGKVSFDVDQLLGNLQTINDTIVRLRPASVKGAYVQNVSVASTFGPGVKV 224
>gi|108804984|ref|YP_644921.1| 50S ribosomal protein L1P [Rubrobacter xylanophilus DSM 9941] >gi|123368027|sp|Q1AU19|RL1_RUBXD 50S ribosomal protein L1 >gi|108766227|gb|ABG05109.1| ribosomal protein L1 [Rubrobacter xylanophilus DSM 9941] (230 aa)
Score = 400, Expect = 5.1e-37, Identities = 82/209 (39%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +R + Y+  EA+ L K+   A+F  +++  + LN+D  ++DQ +RGT+ LP   GK +R+ V   G   ++A+  G +  G  EL A I ++G++DFD+ + TP  M  + +LG ILG RGLMPNPK+G VT D+ + + E K+G  +YR D YG IH V+GK + D   ++EN   L   +   R  +VKG +I+ V  ++TMGP ++V
  S:    14 ERERLYSPREALELLKELDGARFDETVEAHVHLNVDPRRADQMVRGTLMLPNGTGKTRRVAVFAVGEKAREAEEAGADIVGSEELAARIQNEGFMDFDVAVATPDQMSIVGRLGPILGPRGLMPNPKSGTVTMDVGRAVEEIKRGKVEYRVDRYGIIHTVLGKKSFDVDSLLENYFALREELVRARPAAVKGRYIKSVAFTTTMGPSVKV 223
>gi|126659910|ref|ZP_01731034.1| 50S ribosomal protein L1 [Cyanothece sp. CCY0110] >gi|126618774|gb|EAZ89519.1| 50S ribosomal protein L1 [Cyanothece sp. CCY0110] (239 aa)
Score = 400, Expect = 5.2e-37, Identities = 88/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ + Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TVSLP   G+E R+ V+ +G   ++A + G +  G  ELI EI KG +DF+++I TP MMP+++KLG++LG RGLMP+PK G VT DL   I EFK G  ++R D  G +H++ GKA+     ++ N+  L   I  +R +  KG +   V +S++MGP I++
  S:    17 DQDRAYEPLEALKLLKETATAKFDESAEAHIRLGIDPKYTDQQLRTTVSLPKGTGQEIRVAVIARGEKVQEASNAGADVVGSEELIDEIQKGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTADLETAINEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLANLKALQETIDRQRPSGAKGRYWRSVFVSASMGPSIQI 225
>gi|119511570|ref|ZP_01630678.1| 50S ribosomal protein L1 [Nodularia spumigena CCY9414] >gi|119463805|gb|EAW44734.1| 50S ribosomal protein L1 [Nodularia spumigena CCY9414] (238 aa)
Score = 400, Expect = 5.4e-37, Identities = 88/207 (42%), Positives = 130/207 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           YT  EA+NL K+T+ AKF  + +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A + G +  G  ELI EI +G +DFD +I TP +MP+++KLGK+LG RGLMP+PK G VT D+   IAEFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +   + ++STMGP I+V +N
  S:    21 YTPLEALNLLKETATAKFPEAAEAHIRLGIDPKYTDQQLRTTVTLPKGTGQTVRVAVIARGEKVTEASNAGADVVGSDELINEIQQGMMDFDKLIATPDVMPQVAKLGKLLGPRGLMPSPKGGTVTFDVASAIAEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLVNLKALQETIDRNRPSGAKGRYWRTIYVTSTMGPSIKVDIN 227
>gi|51894224|ref|YP_076915.1| 50S ribosomal protein L1 [Symbiobacterium thermophilum IAM 14863] >gi|61215494|sp|Q67JS9|RL1_SYMTH 50S ribosomal protein L1 >gi|51857913|dbj|BAD42071.1| 50S ribosomal protein L1 [Symbiobacterium thermophilum IAM 14863] (235 aa)
Score = 400, Expect = 5.5e-37, Identities = 90/209 (43%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y   EA+ L K+T+ A F  +I++A +L +D   +DQQ+RG V LP   GKE ++LV  KG   K+A++ G ++ G  +L+A+I +GWLDFD+ + TP MM  + +LG+ILG RGLMPNPK G VT D+   I E K G  +YRTD  G +   +GKA+ D  ++  N   L   +   +  + KG +++ V +S+TMGPGI+V
  S:    16 DRNKLYDPMEALELVKKTATANFDETIEVAYRLGVDVRHADQQIRGAVVLPGGTGKEVKVLVFAKGEKAKEAEAAGADYVGAEDLVAKIQEGWLDFDVAVATPDMMSLVGRLGRILGPRGLMPNPKTGTVTFDVANAIQEIKAGKVEYRTDKAGIVAAPIGKASFDVERLAANFRALTEALLRAKPAAAKGQYMKSVTISATMGPGIKV 224
>gi|87123510|ref|ZP_01079361.1| 50S ribosomal protein L1 [Synechococcus sp. RS9917] >gi|86169230|gb|EAQ70486.1| 50S ribosomal protein L1 [Synechococcus sp. RS9917] (235 aa)
Score = 400, Expect = 5.6e-37, Identities = 91/222 (40%), Positives = 135/222 (60%)
  Q:    17 VNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           VN    + Y   EA+ L K  + AKF  +++  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AGD +L+  I+KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I   + +  KG + + + ++STMGP + V V     +K+
  S:    12 VNKIEERAYEPLEAIQLVKDNATAKFDETMEAHVRLGIDPKYTDQQLRTTVALPNGTGQTVRIAVVTRGEKVAEAKAAGAELAGDDDLVESIAKGEMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAGAIQEFKAGKLEFRADRTGIVHVRFGKASFAADALLENLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDVAALQDIKQ 233
>gi|78213978|ref|YP_382757.1| 50S ribosomal protein L1 [Synechococcus sp. CC9605] >gi|123577412|sp|Q3AGT0|RL1_SYNSC 50S ribosomal protein L1 >gi|78198437|gb|ABB36202.1| ribosomal protein L1 [Synechococcus sp. CC9605] (235 aa)
Score = 399, Expect = 5.8e-37, Identities = 87/204 (42%), Positives = 129/204 (63%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y   EA+ L K  +NAKF  +++  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AG+ +L+  ISKG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     +++N+  L   I   + +  KG + + + ++STMGP + V
  S:    20 YAPLEAIALVKDNANAKFDETMEAHVRLGIDPKYTDQQLRTTVALPNGTGQSVRIAVVTRGEKVAEAKAAGAELAGEEDLVESISKGEMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEAAIKEFKAGKLEFRADRTGIVHVRFGKASFSADALLQNLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEV 223
>gi|167365735|ref|ZP_02299879.1| ribosomal protein L1 [Rhodopseudomonas palustris TIE-1] >gi|192292061|ref|YP_001992666.1| ribosomal protein L1 [Rhodopseudomonas palustris TIE-1] >gi|192285810|gb|ACF02191.1| ribosomal protein L1 [Rhodopseudomonas palustris TIE-1] (229 aa)
Score = 399, Expect = 6.0e-37, Identities = 90/219 (41%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  KK     DRTK Y ++EAV L K+ + +KF  +I++AI L +D   +DQ +RG V LP   G+  R+ V  +G    +AK+ G +  G  +L+ ++  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G I   VGKA+ D  K+VENI  L   +   + T  KG +I++V +SSTMGPG++V
  S:     5 KRLKKIREGIDRTKLYPLDEAVKLVKERAISKFDETIEVAINLGVDPRHADQMVRGVVMLPNGTGRTVRVGVFARGAKADEAKAAGADVVGAEDLVEQVQAGNINFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVKGAKGGSVEFRVEKAGIIQAGVGKASFDADKLVENIKALADAVNKAKPTGAKGTYIQRVAVSSTMGPGVKV 223
>gi|163740210|ref|ZP_02147604.1| 50S ribosomal protein L1 [Phaeobacter gallaeciensis 2.10] >gi|161386068|gb|EDQ10443.1| 50S ribosomal protein L1 [Phaeobacter gallaeciensis 2.10] (232 aa)
Score = 399, Expect = 6.3e-37, Identities = 91/212 (42%), Positives = 132/212 (62%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           ++EEAV L K  +NAKF  +I+IA+ L +DT  +DQ +RG + LP   GK+ R+ V  +G    +AK  G +  G  +L+  I  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK++EN+   +S +A  +    KG +++K+ LSSTMGPG+ V V +TAV +
  S:    22 SVEEAVALIKANANAKFDETIEIALNLGVDTRHADQMVRGVIGLPNGTGKDMRVAVFARGAKADEAKEAGADIVGAEDLMEAIQGGTIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQFKAEKGGVVHAGVGKASFDEAKLIENVKAFISAVAKAKPAGAKGAYMKKIALSSTMGPGVTVDV-ETAVTE 232
>gi|88809793|ref|ZP_01125299.1| 50S ribosomal protein L1 [Synechococcus sp. WH 7805] >gi|88786177|gb|EAR17338.1| 50S ribosomal protein L1 [Synechococcus sp. WH 7805] (235 aa)
Score = 399, Expect = 6.8e-37, Identities = 90/224 (40%), Positives = 137/224 (61%)
  Q:    17 VNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTA 240
           VN    + Y   EA+ L K+ + AKF  +++   +L +D   +DQQLR TV+LP+  G+  RI V+ +G    +AK+ G   AGD +L+  ISKG ++FDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     +++N+  L   I   + +  KG + + + ++STMGP + V ++    + K A
  S:    12 VNKIEERAYEPLEAIKLVKENATAKFDETVEAHARLGIDPKYTDQQLRTTVALPHGTGQTVRIAVITRGEKVAEAKAAGAELAGDEDLVETISKGEMNFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLASAINEFKAGKLEFRADRTGIVHVRFGKASFSEVNLLDNLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDISALQDINKDA 235
>gi|113952883|ref|YP_731914.1| 50S ribosomal protein L1 [Synechococcus sp. CC9311] >gi|123132348|sp|Q0I6K8|RL1_SYNS3 50S ribosomal protein L1 >gi|113880234|gb|ABI45192.1| ribosomal protein L1 [Synechococcus sp. CC9311] (235 aa)
Score = 399, Expect = 6.9e-37, Identities = 86/204 (42%), Positives = 129/204 (63%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y   EA+ L K+ + AKF  +++  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   +GD +L+  ISKG ++FDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L   I   + +  KG + + + ++STMGP + V
  S:    20 YQPLEAIQLVKENATAKFDETMEAHVRLGIDPKYTDQQLRTTVALPQGTGQTVRIAVITRGEKVAEAKAAGAELSGDEDLVEAISKGEMNFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLASAIQEFKAGKLEFRADRTGIVHVRFGKASFTAEALLENLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEV 223
>gi|163739422|ref|ZP_02146832.1| 50S ribosomal protein L1 [Phaeobacter gallaeciensis BS107] >gi|161387175|gb|EDQ11534.1| 50S ribosomal protein L1 [Phaeobacter gallaeciensis BS107] (232 aa)
Score = 399, Expect = 7.0e-37, Identities = 91/212 (42%), Positives = 132/212 (62%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVK 237
           ++EEAV L K  +NAKF  +I+IA+ L +DT  +DQ +RG + LP   GK+ R+ V  +G    +AK  G +  G  +L+  I  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK++EN+   +S +A  +    KG +++K+ LSSTMGPG+ V V +TAV +
  S:    22 SVEEAVALIKANANAKFDETIEIALNLGVDTRHADQMVRGVIGLPNGTGKDMRVAVFARGAKADEAKEAGADIVGAEDLMETIQGGTIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQFKAEKGGVVHAGVGKASFDEAKLIENVKAFISAVAKAKPAGAKGAYMKKIALSSTMGPGVTVDV-ETAVTE 232
>gi|42527925|ref|NP_973023.1| 50S ribosomal protein L1 [Treponema denticola ATCC 35405] >gi|61215633|sp|Q73JJ4|RL1_TREDE 50S ribosomal protein L1 >gi|41818970|gb|AAS12942.1| ribosomal protein L1 [Treponema denticola ATCC 35405] (226 aa)
Score = 399, Expect = 7.1e-37, Identities = 88/219 (40%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K     +D    Y + +AV++ K+   AKF  ++++ + L L      Q +R T+ LP+ F  EK++LV       K+A   G  +AG +E I ++  GWLDFD+ + TP MM ++ +LG +LG RGLMPNPK G VTTD+   I E KKG  ++R D  G +H+ VGK + D++KIVEN+  L++    K+    KG +I  V++SSTMGPG+ V
  S:     5 KNYKNALAKYDSAASYELPKAVDIVKELKYAKFDETVEVHVSLTLGKG---QSVRDTLVLPHQFRGEKKVLVFCTDDRVKEALDAGAAYAGSTEYIEKVKGGWLDFDIAVATPDMMKDVGRLGMVLGRRGLMPNPKTGTVTTDIASAINELKKGRVEFRADKGGVVHLPVGKVSMDSSKIVENVQALINETMRKKPADAKGDYIRSVSISSTMGPGVWV 220
>gi|86158014|ref|YP_464799.1| 50S ribosomal protein L1 [Anaeromyxobacter dehalogenans 2CP-C] >gi|123497596|sp|Q2II81|RL1_ANADE 50S ribosomal protein L1 >gi|85774525|gb|ABC81362.1| LSU ribosomal protein L1P [Anaeromyxobacter dehalogenans 2CP-C] (234 aa)
Score = 399, Expect = 7.2e-37, Identities = 87/209 (41%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y ++EA++L KQT+  KF  ++D +I L +D   +DQ +RG V LP+  GK  R+ V  KG   K+A+  G +  G  +L  +I  G++DFD +I TP MM  + +LGKILG RGLMPNPK G VT DL + + E K G  ++R +  G +H+  GKA+ D  K+  N + ++  I   +  + KG++++ V LS+TMGPGI++
  S:    16 DRAKRYKLDEAMSLVKQTATKKFDETVDASINLGVDPKHADQVVRGAVVLPHGMGKTVRLAVFAKGDKAKEAQEAGADIVGAEDLAEKIQGGFMDFDKLIATPDMMGVVGRLGKILGPRGLMPNPKVGTVTMDLARAVKEQKAGKVEFRVEKAGIVHVPFGKASFDPEKLKANFSAIMEVIYKAKPQTAKGVYVKNVTLSTTMGPGIKL 224
>gi|158317802|ref|YP_001510310.1| ribosomal protein L1 [Frankia sp. EAN1pec] >gi|158113207|gb|ABW15404.1| ribosomal protein L1 [Frankia sp. EAN1pec] (237 aa)
Score = 399, Expect = 7.2e-37, Identities = 86/225 (38%), Positives = 140/225 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           +K  +  +   D T  Y+  +A  LA++TS+ K+ +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G    +A + G +  G  +L+A I +G+LDFD  + TP  M ++ ++ +ILG RGLMPNPK G VT D+ K + + K G   +R D  GN+H+V+GK +   A+++EN    L  I   + ++ KG +++KV  ++TMGPGI V  N+T
  S:     4 SKAYRAAAEKIDATALYSPLDAARLARETSSTKYDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKSPRVAVFAAGEKAAEATAAGADVVGSDDLVARIQEGFLDFDATVATPDQMAKVGRIARILGPRGLMPNPKTGTVTLDVAKVVGDIKGGKINFRVDKQGNLHIVIGKVSFSEAQLIENYTVALDEIVRVKPSAAKGRYLKKVTFATTMGPGIPVDPNRT 228
>gi|54310501|ref|YP_131521.1| 50S ribosomal protein L1 [Photobacterium profundum SS9] >gi|61215565|sp|Q6LLV9|RL1_PHOPR 50S ribosomal protein L1 >gi|46914944|emb|CAG21719.1| putative ribosomal protein L1 [Photobacterium profundum SS9] (233 aa)
Score = 398, Expect = 7.5e-37, Identities = 88/209 (42%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y I EAV L K+ + AKF+ S+D+AI L +D  KSDQ +RG   LP+  G++ R+ V  +G   + AK  G +  G  +L  ++ KG +DFD++I +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK + D A++ EN+  LL  +   + +S KGIFI+K+++S+TMG G+ +
  S:    16 DATKSYDINEAVVLLKELATAKFVESVDVAINLGIDARKSDQNVRGATVLPHGTGRDIRVAVFTQGANAEAAKEAGADLIGMDDLADQVKKGIMDFDVVIASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAQAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDAAQLKENLESLLVALKKSKPSSAKGIFIKKISISTTMGAGVSL 224
>gi|124005809|ref|ZP_01690647.1| ribosomal protein L1 [Microscilla marina ATCC 23134] >gi|123988492|gb|EAY28133.1| ribosomal protein L1 [Microscilla marina ATCC 23134] (231 aa)
Score = 398, Expect = 8.1e-37, Identities = 88/219 (40%), Positives = 136/219 (62%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+    FD+++ Y + EAV++ K  +  KF +S+D+ ++L +D  K+DQ +RGTV+LP+  GK+ R+LVL     +++AK  G +H G  E I +I  GW D D++IT P +M ++ +LG++LG RGLMPNPK+G VT D+   + E K G   ++ D  G IH  VGKA+    K+ +N   L++ +   R  S KG +I+ + LSSTM P + V
  S:     6 KKKKEALSKFDKSREYPLNEAVSVIKDITFTKFDASVDVDVRLGVDPRKADQMVRGTVTLPHGLGKDVRVLVLCSPDKEQEAKDAGADHVGLDEYIKKIEGGWTDIDVVITMPTVMAKVGRLGRVLGPRGLMPNPKSGTVTLDVANAVKEVKAGKVDFKVDKTGIIHTSVGKASFTAEKLNDNARELINTLVKLRPASAKGTYIKSIYLSSTMSPSVMV 224
>gi|195962773|ref|ZP_03098978.1| 50S ribosomal protein L1 [Borrelia spielmanii A14S] (226 aa)
Score = 398, Expect = 8.2e-37, Identities = 93/209 (44%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D++KFY IEEA++L K+    KF  +IDI++ LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ KLG ILG +GLMPNPK   VT +L  TI   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ V +SSTMGP I+V
  S:    16 DKSKFYNIEEAISLLKEIKFVKFDETIDISVNLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDIVVATPDMMKDVGKLGPILGKKGLMPNPKTQTVTNNLKDTINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFIKEVVKKRPSDLKGAFIDSVYISSTMGPSIKV 221
>gi|161544992|ref|YP_153617.2| 50S ribosomal protein L1 [Anaplasma marginale str. St. Maries] (224 aa)
Score = 398, Expect = 8.3e-37, Identities = 87/213 (40%), Positives = 129/213 (60%)
  Q:    16 SVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGW-LDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           S++ D +  Y+ EE +    Q++ AKF  S+D+AIKL++  SKS + +RG V LP   G+E R+ V  KG   K A S G +  GD ELI EI KG  LD D  I TP  MP++S + KILG RGLMPNPK G VT +L + +   K G  ++++D YG +H+ +G        ++EN N +++ +   R T++KG ++  V ++STMG   R+
  S:     7 SMSGDGSCSYSAEEGIRELLQSAKAKFRESVDVAIKLSVADSKSGESIRGAVVLPKGLGREVRVAVFAKGEHAKQASSAGADVVGDEELIEEIKKGRRLDVDWCIATPDFMPQISAIAKILGPRGLMPNPKFGTVTLELAEMVGIIKSGQVKFKSDRYGIVHVKIGDIGFTPEDLLENFNAVVAAVQGLRPTTIKGSYVRGVFVNSTMGRSFRI 220
>gi|157350678|emb|CAO40769.1| unnamed protein product [Vitis vinifera] (347 aa)
Score = 398, Expect = 8.6e-37, Identities = 81/209 (38%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +  K Y ++ A++L KQ ++ +F+ + +   +LN+D   +DQQLR TV+LP   G+  ++ VL +G    +AK+ G +  G  +LI +I  G++DFD +I +P MMP+++ LGK+LG RGLMPNPK G VTT++P+ IAEFKKG  +YR D  G +H+  GKA+     ++ N+   +  +   + +  KG++    ++ S+MGP IR+
  S:   125 ENKKEYDLQTAISLLKQMASTRFVETAEAHFRLNIDPKYNDQQLRATVNLPKGTGQTVKVAVLTQGEKFDEAKNAGADLVGGEDLIEQIKGGFMDFDKLIASPDMMPKVASLGKLLGPRGLMPNPKAGTVTTNIPQAIAEFKKGKVEYRADKTGIVHLPFGKADFSEEDLLANLIAAVKSVETNKPSGAKGVYWRSAHICSSMGPSIRL 333
>gi|72383406|ref|YP_292761.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. NATL2A] >gi|124024992|ref|YP_001014108.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. NATL1A] >gi|160166294|sp|A2C033|RL1_PROM1 50S ribosomal protein L1 >gi|91207368|sp|Q46HH0|RL1_PROMT 50S ribosomal protein L1 >gi|72003256|gb|AAZ59058.1| LSU ribosomal protein L1P [Prochlorococcus marinus str. NATL2A] >gi|123960060|gb|ABM74843.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. NATL1A] (235 aa)
Score = 398, Expect = 9.6e-37, Identities = 90/214 (42%), Positives = 137/214 (64%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           Y+  EA+ L K+ +NAKF  +I+  I+L +D   +DQQLR TV+LP   G++ RI V+ +G    +A   G + AG+ +L+  I+KG ++FDL+I+TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++EN+  L + I   + +  KG F     ++STMGP + V +N+   ++K
  S:    20 YSPIEAIKLVKENANAKFDETIEAHIRLGIDPKYTDQQLRTTVALPSGTGQKIRIAVVTRGEKVNEATKAGADLAGEEDLVDSINKGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEGAIKEFKAGKLEFRADKAGIVHVRFGKASFSEEALLENLKTLQTTIEKNKPSGAKGKFWRSFFITSTMGPSVEVDINELQDLQK 233
>gi|148377349|ref|YP_001256225.1| 50S ribosomal protein L1 [Mycoplasma agalactiae PG2] >gi|148291395|emb|CAL58779.1| 50S ribosomal protein L1 [Mycoplasma agalactiae PG2] (231 aa)
Score = 397, Expect = 1.1e-36, Identities = 98/215 (45%), Positives = 138/215 (64%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGL-TQKDAKSLGVNHAGDSELIAE-ISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           +FD+   Y + EAV + K+TS AKF +S+D+  KLNLD  K+DQQLRG+V LP   GK   +LV+   +  QK A + G +   D + + + I +   DFD+++  P MMP L K GK LG +GLMPNPK G VT    K + E KKG   YRTD  G +H +VGK + DT K+VENI  ++S I   + ++VKG +I+ + LS+TMGPG++V + K
  S:    15 SFDKNIAYDLAEAVEIVKRTSYAKFDASVDLVFKLNLDVRKADQQLRGSVLLPNGTGKSISVLVVTNNVEKQKLATAAGADQVVDGQTLEQKIKEDIFDFDVMVADPAMMPLLGKYGKKLGPKGLMPNPKTGTVTPTPEKAVEELKKGKANYRTDKAGVVHTLVGKVSMDTEKLVENIKTVISLIKRLKPSAVKGTYIQNIVLSATMGPGVKVKIEK 231
>gi|160947358|ref|ZP_02094525.1| hypothetical protein PEPMIC_01292 [Peptostreptococcus micros ATCC 33270] >gi|158446492|gb|EDP23487.1| hypothetical protein PEPMIC_01292 [Peptostreptococcus micros ATCC 33270] (231 aa)
Score = 397, Expect = 1.2e-36, Identities = 88/213 (41%), Positives = 138/213 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           D+T  Y ++EA  LA +TS AKF  ++++ +KL +D+  +DQQ+RGTV LP+  GK  R+LVL K    ++AK  G ++ G  + I +I ++ W DFD+I+ TP MM  + ++GKILG +GLMPNPK+G VT D+   + E K G  +YR D    +H  VGK +    KI EN+  ++S I   + ++ KG +++ V++++TMGPGI++   K
  S:    15 DKTNLYDLKEACELAVKTSTAKFDETVELHVKLGVDSRHADQQVRGTVVLPHGTGKTLRVLVLCKENKVQEAKDAGADYVGADDYIQKIQNENWFDFDVIVATPDMMGVVGRIGKILGPKGLMPNPKSGTVTFDIANAVKEIKAGKVEYRVDKANIVHCPVGKVSFGAEKIEENLRTIISAIIKAKPSAAKGKYLKSVSIATTMGPGIKLASTK 228
>gi|167039509|ref|YP_001662494.1| 50S ribosomal protein L1 [Thermoanaerobacter sp. X514] >gi|166853749|gb|ABY92158.1| ribosomal protein L1 [Thermoanaerobacter sp. X514] (230 aa)
Score = 397, Expect = 1.2e-36, Identities = 91/210 (43%), Positives = 142/210 (67%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D+T+ Y+ +EA+++  +T+ A F  +ID+A++L +D   +DQQ+RGTV LP+  GK  ++LV  KG   K+A++ G ++ G  EL+A+I ++ W D+D+++ TP MM  + +LGKILG +GLMPNPK+G VT DL K I E K G  +YR D  G IH+ +GK +    K++EN   ++  I   +  + KG +I+ V LSSTMGPG++V
  S:    14 YDKTQQYSSDEAIDIVLKTAKANFDETIDLAVRLGVDPRHADQQVRGTVVLPHGTGKSVKVLVFAKGEKAKEAEAAGADYVGAEELVAKIQNENWFDYDVVVATPDMMGVVGRLGKILGPKGLMPNPKSGTVTFDLEKAIKEIKAGKIEYRVDKAGIIHVPIGKKSFGKEKLLENFRAVMDAIIKSKPAAAKGQYIKSVVLSSTMGPGVKV 224
>gi|111018975|ref|YP_701947.1| 50S ribosomal protein L1 [Rhodococcus sp. RHA1] >gi|123340759|sp|Q0SF97|RL1_RHOSR 50S ribosomal protein L1 >gi|110818505|gb|ABG93789.1| 50S ribosomal protein L1 [Rhodococcus sp. RHA1] (238 aa)
Score = 397, Expect = 1.2e-36, Identities = 92/217 (42%), Positives = 140/217 (64%)
  Q:    17 VNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           ++FD  K Y+  +A  LAK+TS++K  +++++A++L +D  K+DQ +RGTV+LP+  GK  R++V   G    +A++ G +  G  +LI  I  GWLDFD  I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +A+ K G   +R D   N+H V+GKA+ D AK+VEN    L  I   + +S KG +++KV +S+T GPGI V  N+T
  S:    15 IDFD--KLYSPLQAAKLAKETSSSKMDATVEVAVRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAVGEKAAEAEAAGADAVGAEDLIERIQGGWLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVTKAVADIKGGKINFRVDKQANLHFVIGKASFDDAKLVENYGAALDEILRAKPSSAKGRYVKKVTVSTTTGPGIPVDPNRT 229
>gi|160166858|sp|Q2JFI8|RL1_FRASC 50S ribosomal protein L1 (238 aa)
Score = 397, Expect = 1.2e-36, Identities = 84/210 (40%), Positives = 135/210 (64%)
  Q:    24 FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           FY+  EAV LA+QTS  K+ +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G    +A + G +  G  +L+A I +G+L+FD  + TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +++ K G   +R D  GN+H+V+GK N    +++EN    L  I   + ++ KG +++K+  ++TMGPGI V  N+T
  S:    19 FYSPLEAVRLAQQTSTTKYDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKSPRVAVFAAGEKAAEASAAGADIVGSDDLVARIQEGFLEFDATVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTLDIGKAVSDIKGGKINFRVDKQGNLHIVIGKTNFTDTQLIENYTVALDEIVRVKPSAAKGRYLKKITFTTTMGPGIPVDPNRT 228
>gi|114327208|ref|YP_744365.1| 50S ribosomal protein L1 [Granulibacter bethesdensis CGDNIH1] >gi|122327811|sp|Q0BUR0|RL1_GRABC 50S ribosomal protein L1 >gi|114315382|gb|ABI61442.1| LSU ribosomal protein L1P [Granulibacter bethesdensis CGDNIH1] (230 aa)
Score = 396, Expect = 1.3e-36, Identities = 96/227 (42%), Positives = 135/227 (59%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           NK  K    + D TKFY + EAV LAK  + AKF  +I+I++ L +D   +DQ +RG VSLP   GK  R+ V  +G   ++AK+ G +  G  +L   +  G ++FD  I TP MM  + +LGKILG RGLMPNPK G VT D+   +   K G  ++R +  G IH  +GKA+ D  K+VENI  L+  I   + T  KG +++K  LSS+MGPG+R+ V+   V
  S:     4 NKRLKAARASVDSTKFYPLTEAVALAKTNARAKFDETIEISLNLGIDPRHADQMVRGLVSLPNGTGKTLRVGVFARGPKAEEAKAAGADVVGAEDLAELVQNGTIEFDRCIATPDMMALVGRLGKILGPRGLMPNPKLGTVTMDVKGAVTAAKSGQIEFRAEKAGIIHAGIGKASFDADKLVENIRALVDAIQKAKPTGAKGTYLQKAALSSSMGPGMRLDVSSLTV 230
>gi|39936335|ref|NP_948611.1| 50S ribosomal protein L1 [Rhodopseudomonas palustris CGA009] >gi|61215589|sp|Q6N4R5|RL1_RHOPA 50S ribosomal protein L1 (RRP-L1) >gi|39650190|emb|CAE28713.1| 50S ribosomal protein L1 [Rhodopseudomonas palustris CGA009] (229 aa)
Score = 396, Expect = 1.3e-36, Identities = 89/219 (40%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  KK     DRTK Y ++EAV L K+ + +KF  +I++AI L +D   +DQ +RG V LP   G+  R+ V  +G    +AK+ G +  G  +L+ ++  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G I   VGKA+ D  K+VENI  L   +   + +  KG +I++V +SSTMGPG++V
  S:     5 KRLKKIREGIDRTKLYPLDEAVKLVKERAISKFDETIEVAINLGVDPRHADQMVRGVVMLPNGTGRTVRVGVFARGAKADEAKAAGADVVGAEDLVEQVQAGNINFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVKGAKGGSVEFRVEKAGIIQAGVGKASFDADKLVENIKALADAVNKAKPSGAKGTYIQRVAVSSTMGPGVKV 223
>gi|163783793|ref|ZP_02178777.1| 50S ribosomal protein L1 [Hydrogenivirga sp. 128-5-R1-1] >gi|159880946|gb|EDP74466.1| 50S ribosomal protein L1 [Hydrogenivirga sp. 128-5-R1-1] (242 aa)
Score = 396, Expect = 1.4e-36, Identities = 88/215 (40%), Positives = 144/215 (66%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAK---FLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKG-WLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           FDR K Y++EEAV++ K+ +      F  ++++A++LN+D   +DQ +RG+V LP+  GK  ++LVL +G   K A+  G ++ G   LI +I K  W+D+D++I TP++M +++KLG+ILG RGLMPNPK G VT ++ + I + KKG  +++ D  GNIHM VGK + D  K+ ENI   +  +   +    KG +++ + +S+TMGPGI++ + +T
  S:    15 FDRNKTYSVEEAVDILKKVAEVAQRGFDETVELAMRLNVDPKYADQMVRGSVVLPHGLGKPIKVLVLAEGEDAKKAEEAGADYVGGENLINKILKEEWIDYDVVIATPEIMSKVAKLGRILGPRGLMPNPKTGTVTKNVEQAIKDAKKGRVEFKVDKAGNIHMPVGKVSFDKDKLAENIYAAIDAVVRAKPPGAKGQYVKSITVSTTMGPGIKIDIPET 233
>gi|91200657|emb|CAJ73707.1| strongly similar to 50S ribosomal protein L1 [Candidatus Kuenenia stuttgartiensis] (226 aa)
Score = 396, Expect = 1.5e-36, Identities = 86/209 (41%), Positives = 128/209 (61%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           + D  K Y +E+A+   K    AKF  S+++ IKL +D  +SDQ +RG +SLP   GK  +++V   G     AK  G    G  +L+ ++  GW DFD+ I+TP MM  + KLGK+LG +G MP+PK+G VT D+   + EFK G  ++R D+ GN+H + GK +   A + +NIN  +  I   R ++ KG++IEKV+LSSTM PG+
  S:    14 HIDINKKYELEDALKHLKSFKTAKFDESVEVVIKLGIDAKQSDQLVRGAISLPKGIGKSLKVIVFAVGEKATIAKDAGAEEVGAEDLVKKVEGGWGDFDVAISTPDMMRIVGKLGKVLGPQGKMPSPKSGTVTDDVETAVREFKAGKIEFRNDAGGNVHAIAGKLSFSVADLADNINTFIKHILNLRPSAAKGMYIEKVSLSSTMSPGV 222
>gi|111220532|ref|YP_711326.1| 50S ribosomal subunit protein L1, regulates synthesis of L1 and L11 [Frankia alni ACN14a] >gi|122954584|sp|Q0RRT5|RL1_FRAAA 50S ribosomal protein L1 >gi|111148064|emb|CAJ59731.1| 50S ribosomal subunit protein L1, regulates synthesis of L1 and L11 [Frankia alni ACN14a] (238 aa)
Score = 396, Expect = 1.5e-36, Identities = 86/210 (40%), Positives = 135/210 (64%)
  Q:    24 FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
            Y+  +AV LA++TS  K+ +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G    +A + G +  G  +L+A I +G+LDFD  + TP  M ++ ++ +ILG RGLMPNPK G VT D+ K +A+ K G   +R D  GN+H+V+GK N   A+++EN    L  I   + ++ KG +++KV  ++TMGPGI V  N+T
  S:    19 LYSPLDAVRLAQETSTTKYDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKSPRVAVFAAGEKAAEATAAGADIVGSDDLVARIQEGFLDFDATVATPDQMAKVGRIARILGPRGLMPNPKTGTVTLDIGKAVADIKGGKINFRVDKQGNLHIVIGKTNFTDAQLIENYTAALDEIVRVKPSAAKGRYLKKVTFATTMGPGIPVDPNRT 228
>gi|118046214|ref|ZP_01514866.1| ribosomal protein L1 [Chloroflexus aggregans DSM 9485] >gi|117997176|gb|EAV11365.1| ribosomal protein L1 [Chloroflexus aggregans DSM 9485] (237 aa)
Score = 396, Expect = 1.6e-36, Identities = 86/209 (41%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVT--TDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR++FYT  EA+ L K+TS  KF ++++  ++L +D   +DQ +R TV+LP+  GK  R+LV  +G   + A   G ++AG  +LIA I +  + DFD+ I TP MM ++ ++G+ LG RGLMPNPK+G V    DL +TI E K G  + R D  G +H+ +GK +  + ++ EN+  L+  + A + +  KG +I  V L+STMGPG+ V
  S:    16 DRSRFYTPAEAIALVKETSYTKFDATVEAHLRLGIDPRHADQNIRTTVALPHGTGKTVRVLVFAQGEALQTALDAGADYAGSDDLIARIDRENFFDFDVAIATPDMMGKVGRIGRKLGPRGLMPNPKSGTVVQPADLARTIREVKGGRVEIRNDKTGILHVAIGKVSFTSQQLSENLAALMEAVKAAKPSGAKGTYIRSVTLTSTMGPGVPV 227
>gi|91785476|ref|YP_560682.1| 50S ribosomal protein L1 [Burkholderia xenovorans LB400] >gi|123062492|sp|Q13TF9|RL1_BURXL 50S ribosomal protein L1 >gi|91689430|gb|ABE32630.1| LSU ribosomal protein L1P [Burkholderia xenovorans LB400] (232 aa)
Score = 396, Expect = 1.6e-36, Identities = 87/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I+EA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  ++  G LDFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N+N L+  +   +  + KG+++ KV LSSTMG G+RV
  S:    16 DRQKLYAIDEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQVKAGKLDFDIVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLNALVDALQKAKPATSKGVYLRKVALSSTMGVGVRV 224
>gi|167036790|ref|YP_001664368.1| 50S ribosomal protein L1 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855624|gb|ABY94032.1| ribosomal protein L1 [Thermoanaerobacter pseudethanolicus ATCC 33223] (230 aa)
Score = 396, Expect = 1.6e-36, Identities = 90/210 (42%), Positives = 142/210 (67%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D+T+ Y+ +EA+++  +T+ A F  +ID+A++L +D   +DQQ+RGTV LP+  GK  ++LV  KG   K+A++ G ++ G  EL+A+I ++ W D+D+++ TP MM  + +LGKILG +GLMPNPK+G VT DL K I E K G  +YR D  G IH+ +GK +    K++EN   ++  I   +  + KG +I+ + LSSTMGPG++V
  S:    14 YDKTQQYSSDEAIDIVLKTAKANFDETIDLAVRLGVDPRHADQQVRGTVVLPHGTGKSVKVLVFAKGEKAKEAEAAGADYVGAEELVAKIQNENWFDYDVVVATPDMMGAVGRLGKILGPKGLMPNPKSGTVTFDLEKAIKEIKAGKIEYRVDKAGIIHVPIGKKSFGKEKLLENFRAVMDAIIKSKPAAAKGQYIKSLVLSSTMGPGVKV 224
>gi|195959071|ref|ZP_03095280.1| 50S ribosomal protein L1 [Borrelia sp. SV1] (226 aa)
Score = 396, Expect = 1.7e-36, Identities = 91/209 (43%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ KFY IE+A+ L K+   AKF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   K+G  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKNKFYNIEDAILLLKEIKFAKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKRGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFIKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|115350311|ref|YP_772150.1| 50S ribosomal protein L1 [Burkholderia ambifaria AMMD] >gi|171319355|ref|ZP_02908465.1| ribosomal protein L1 [Burkholderia ambifaria MEX-5] >gi|172059330|ref|YP_001806982.1| ribosomal protein L1 [Burkholderia ambifaria MC40-6] >gi|122324277|sp|Q0BJ57|RL1_BURCM 50S ribosomal protein L1 >gi|115280299|gb|ABI85816.1| LSU ribosomal protein L1P [Burkholderia ambifaria AMMD] >gi|171095426|gb|EDT40398.1| ribosomal protein L1 [Burkholderia ambifaria MEX-5] >gi|171991847|gb|ACB62766.1| ribosomal protein L1 [Burkholderia ambifaria MC40-6] (232 aa)
Score = 396, Expect = 1.7e-36, Identities = 87/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IE+A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ + A +  N++ L+  +   +  + KG+++ KV LSSTMG G+RV
  S:    16 DRQKLYAIEDALALVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEAAALRSNLSALIEALQKAKPATSKGVYLRKVALSSTMGVGLRV 224
>gi|78064913|ref|YP_367682.1| 50S ribosomal protein L1 [Burkholderia sp. 383] >gi|91207344|sp|Q39KH8|RL1_BURS3 50S ribosomal protein L1 >gi|77965658|gb|ABB07038.1| LSU ribosomal protein L1P [Burkholderia sp. 383] (232 aa)
Score = 395, Expect = 1.7e-36, Identities = 86/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IEEA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|116671539|ref|YP_832472.1| 50S ribosomal protein L1 [Arthrobacter sp. FB24] >gi|160165651|sp|A0JZA2|RL1_ARTS2 50S ribosomal protein L1 >gi|116611648|gb|ABK04372.1| LSU ribosomal protein L1P [Arthrobacter sp. FB24] (235 aa)
Score = 395, Expect = 1.7e-36, Identities = 89/230 (38%), Positives = 139/230 (60%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           +K  +  +   D  KFY   EAV LAK T+ +KF +++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A + G +  G  +LI +I+ GW DFD  + TP +M ++ +LGK+LG R LMPNPK G VT D+ K + + K G   +R D + N+H ++GK + D  K+ EN    L  +   + ++ KG +I+K  +++T GPGI V  N T V+ +
  S:     5 SKAYEAAAAKIDAEKFYAPFEAVTLAKDTNPSKFDATVEVAFRLGVDPRKADQMVRGTVNLPHGTGKVARVLVFATGDKAEAAIAAGADFVGSDDLIEKIAAGWTDFDAAVATPDLMGKVGRLGKVLGPRNLMPNPKTGTVTPDVTKAVNDIKGGKIDFRVDKHSNLHFIIGKVSFDAIKLAENYAAALEEVLRLKPSASKGRYIQKATVATTFGPGISVDPNVTKVLTE 234
>gi|15594737|ref|NP_212526.1| 50S ribosomal protein L1 [Borrelia burgdorferi B31] >gi|167931612|ref|ZP_02518699.1| 50S ribosomal protein L1 [Borrelia burgdorferi 156a] >gi|195949966|ref|ZP_03091066.1| 50S ribosomal protein L1 [Borrelia burgdorferi WI91-23] >gi|195960184|ref|ZP_03096389.1| 50S ribosomal protein L1 [Borrelia burgdorferi 64b] >gi|3914706|sp|O51353|RL1_BORBU 50S ribosomal protein L1 >gi|2688305|gb|AAC66773.1| ribosomal protein L1 (rplA) [Borrelia burgdorferi B31] (226 aa)
Score = 395, Expect = 1.8e-36, Identities = 92/209 (44%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ KFY IE+A+ L K+   AKF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKNKFYNIEDAILLLKEIKFAKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFVKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|21672993|ref|NP_661058.1| 50S ribosomal protein L1 [Chlorobium tepidum TLS] >gi|33301452|sp|Q8KG18|RL1_CHLTE 50S ribosomal protein L1 >gi|21646055|gb|AAM71400.1| ribosomal protein L1 [Chlorobium tepidum TLS] (231 aa)
Score = 395, Expect = 1.8e-36, Identities = 86/226 (38%), Positives = 136/226 (60%)
  Q:     7 VTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           +  K  +  S   +R + Y + EA+   K+ +  KF +++D+AIKL +D   +DQ +RGTV LPY  GK   +LV+ K    ++A+  G +  G  + I +I  GW D D+I+ TP +M +L K+ +ILG RGLMPNPK+G VT D+ K + E K G  ++R D  GNIH  VGK + D+A +  NI   +  +   + ++ KG +++ + +SSTM PG++V  +K
  S:     3 MAGKNYRNASAKVNRAQEYELAEAIEKVKEITTTKFDATVDVAIKLGVDPRHADQVVRGTVMLPYGTGKTVSVLVVCKENKAEEAREAGADFVGFEDYIEKIQNGWTDVDVIVATPDVMGQLGKVARILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRVDKAGNIHAPVGKVSFDSANLAGNITSFIKEVVRLKPSAAKGQYLQGITISSTMSPGVKVKKDK 228
>gi|116333238|ref|YP_794765.1| 50S ribosomal protein L1 [Lactobacillus brevis ATCC 367] >gi|122270074|sp|Q03ST8|RL1_LACBA 50S ribosomal protein L1 >gi|116098585|gb|ABJ63734.1| LSU ribosomal protein L1P [Lactobacillus brevis ATCC 367] (232 aa)
Score = 395, Expect = 1.8e-36, Identities = 84/206 (40%), Positives = 132/206 (64%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y + +A++L K+   AKF +++++A KLN+DT ++DQQLRG + LP   GKE  ++V  KG   K A++ G +  G+ +L+  I  GWLDFD+ I TP MM ++ +LG++LG +GLMPNPK G VT ++ K +++ K G   YRTD  GN+ +  GK + D  K+  N+  +   I   R  +V+G +++ V++SST GP + V
  S:    20 KVYGMGDAIDLVKKIDFAKFDATVEVAFKLNVDTKQADQQLRGALVLPNGTGKETTVIVFAKGDQAKAAEAAGADVVGEQDLVERIQDGWLDFDVAIATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTMNVEKAVSDAKNGQVTYRTDRDGNVAVPFGKVSFDADKLAGNLKSIAETIVRIRPAAVRGTYVQHVSISSTFGPSVDV 225
>gi|118473196|ref|YP_885734.1| 50S ribosomal protein L1 [Mycobacterium smegmatis str. MC2 155] >gi|160166279|sp|A0QS46|RL1_MYCS2 50S ribosomal protein L1 >gi|118174483|gb|ABK75379.1| ribosomal protein L1 [Mycobacterium smegmatis str. MC2 155] (235 aa)
Score = 395, Expect = 1.8e-36, Identities = 89/220 (40%), Positives = 137/220 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   DRTK YT  EA  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G   + A++ G +  G  +LI +I  G+LDFD  I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K + + K G   +R D   N+H ++GKA+ D  K+ EN    L  +   + +S KG +++KV +S+T GPGI V
  S:     5 SKAYREAAEKVDRTKLYTPLEAAKLAKETSSKKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKAEQAQAAGADIVGSDDLIEKIQGGFLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVAKAVQDIKGGKINFRVDKQANLHFIIGKASFDETKLAENYGAALDEVLRAKPSSSKGRYLKKVTVSTTTGPGIPV 224
>gi|148657433|ref|YP_001277638.1| ribosomal protein L1 [Roseiflexus sp. RS-1] >gi|148569543|gb|ABQ91688.1| LSU ribosomal protein L1P [Roseiflexus sp. RS-1] (240 aa)
Score = 395, Expect = 1.9e-36, Identities = 91/209 (43%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTT--DLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR + YT EEA+ L K+TS   F  ++++ ++L +D   +DQ +R TVSLP+  GK  R+LV  +G   + A+  G +  G  +LIA I K  + DFD+ I TP MM ++ +LG+ LG RGLMPNPK+G V    DLP+TI E + G  ++R D  G +H+ VGK + +  +I ENI  L+  + A R ++ KG +I+ V  +STM PGIRV
  S:    17 DRQRLYTPEEAIKLLKETSFTTFDPTVEVHLRLGIDPRHADQTIRSTVSLPHGTGKTVRVLVFAQGEAAQAAREAGADFVGADDLIARIDKENFFDFDIAIATPDMMGKVGRLGRKLGPRGLMPNPKSGTVVQPDDLPRTIREVRGGRVEFRNDKTGLLHVAVGKLSFNEQQIYENIAALMEAVKAARPSAAKGTYIKSVTFTSTMSPGIRV 228
>gi|187925627|ref|YP_001897269.1| ribosomal protein L1 [Burkholderia phytofirmans PsJN] >gi|187716821|gb|ACD18045.1| ribosomal protein L1 [Burkholderia phytofirmans PsJN] (232 aa)
Score = 395, Expect = 1.9e-36, Identities = 87/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I+EA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  ++  G LDFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N+N L+  +   +  + KG+++ KV LSSTMG G+RV
  S:    16 DRQKLYAIDEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQVKAGKLDFDIVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLNALVDALQKAKPATSKGVYLRKVALSSTMGVGVRV 224
>gi|154508678|ref|ZP_02044320.1| hypothetical protein ACTODO_01183 [Actinomyces odontolyticus ATCC 17982] >gi|153798312|gb|EDN80732.1| hypothetical protein ACTODO_01183 [Actinomyces odontolyticus ATCC 17982] (235 aa)
Score = 395, Expect = 1.9e-36, Identities = 85/209 (40%), Positives = 133/209 (63%)
  Q:    24 FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
            YT  EA+ LAK+T+  KF S++++  +L +D  ++DQ +RGTVSLP+  GK  R+LV   G   ++A   G +  G  ELI +++KG+ DFD+ + TP +M ++ +LG++LG RGLMPNPK G VT D+ K + E K G  ++R D + N+  +VGKA+    ++ EN   +L  +   + TS KG ++ K  +++TMGPGI + V K
  S:    20 LYTPFEAMKLAKETTVTKFDSTVEVVFRLGVDPRQADQMVRGTVSLPHGTGKTARVLVFAVGPRAQEAIDAGADEVGGDELIEKVAKGYTDFDVAVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTMDVAKAVKEIKGGRIEFRVDKHANLAFIVGKASFTAEQLTENYAAVLDEVLRLKPTSSKGRYLLKGAVATTMGPGIPLDVTK 228
>gi|168525995|ref|ZP_02719634.1| 50S ribosomal protein L1 [Borrelia burgdorferi 118a] >gi|168579402|ref|ZP_02723430.1| 50S ribosomal protein L1 [Borrelia burgdorferi 72a] >gi|195941258|ref|ZP_03086640.1| 50S ribosomal protein L1 [Borrelia burgdorferi 80a] (226 aa)
Score = 395, Expect = 2.0e-36, Identities = 91/209 (43%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ KFY IE+A+ L K+   AKF  +IDI+I LNL   K +  +R T+ LP  F + KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKNKFYNIEDAILLLKEIKFAKFDETIDISINLNL---KKNHTVRDTIVLPNQFMRPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFVKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|134103298|ref|YP_001108959.1| 50S ribosomal protein L1 [Saccharopolyspora erythraea NRRL 2338] >gi|160166307|sp|A4FPQ9|RL1_SACEN 50S ribosomal protein L1 >gi|133915921|emb|CAM06034.1| 50S ribosomal protein L1 [Saccharopolyspora erythraea NRRL 2338] (238 aa)
Score = 395, Expect = 2.0e-36, Identities = 90/214 (42%), Positives = 135/214 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           DR + Y   EA  LAK+T+  K   ++++A++L +D  K+DQ +RGTV+LP+  GK  R++V   G    +A++ G +  G  +LI  I  GWLDFD  I TP  M ++ K+ ++LG RGLMPNPK G VT ++ K +A+ K G   +R D   N+H+V+GKA+ DT K+VEN    L  I   + ++ KG +++KV  ++TMGPGI V  N+T
  S:    16 DRARLYAPLEAAELAKKTAKVKMDPTVEVAMRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAVGDKAAEAEAAGADAVGSEDLIERIQGGWLDFDAAIATPDQMAKVGKIARVLGPRGLMPNPKTGTVTPNVTKAVADIKGGKINFRVDKQANLHIVIGKASFDTDKLVENYAAALDEILRAKPSTSKGRYLKKVTFTTTMGPGIPVDPNRT 229
>gi|195952040|ref|ZP_03093137.1| 50S ribosomal protein L1 [Borrelia burgdorferi 29805] (226 aa)
Score = 395, Expect = 2.1e-36, Identities = 92/209 (44%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ KFY IE+A+ L K+   AKF  +IDI+I LNL   K +  +R T+ LP  F K KRILV  KG    +A++ G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKNKFYNIEDAILLLKEIKFAKFDETIDISINLNL---KKNHTVRDTIVLPNQFMKPKRILVFAKGDRADEARAFGATYVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFVKEVIKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|170701417|ref|ZP_02892375.1| ribosomal protein L1 [Burkholderia ambifaria IOP40-10] >gi|170133669|gb|EDT02039.1| ribosomal protein L1 [Burkholderia ambifaria IOP40-10] (232 aa)
Score = 394, Expect = 2.3e-36, Identities = 86/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IE+A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ + A +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEDALALVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEAAALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGLRV 224
>gi|125975203|ref|YP_001039113.1| 50S ribosomal protein L1P [Clostridium thermocellum ATCC 27405] >gi|160165847|sp|A3DIZ1|RL1_CLOTH 50S ribosomal protein L1 >gi|125715428|gb|ABN53920.1| LSU ribosomal protein L1P [Clostridium thermocellum ATCC 27405] (231 aa)
Score = 394, Expect = 2.4e-36, Identities = 88/209 (42%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+TK Y   EA+ L ++T+ AKF  +++  I+L +D+  +DQQ+RG V LP+  GK+ R+LV  KG    +A+  G ++ G  EL+++I ++ W +FD+++ TP MM  + +LGK+LG +GLMPNPK G VT D+ K IA+ K G  +YR D    IH  +GK +  T K+V+N   L+S I   +  + KG +++ V ++STMGPGI+V
  S:    15 DKTKLYDPVEAMELVQKTAKAKFDETVEAHIRLGVDSRHADQQVRGAVVLPHGTGKKVRVLVFAKGEKATEAEKAGADYVGAEELVSKIQNENWFEFDVVVATPDMMGVVGRLGKVLGPKGLMPNPKAGTVTMDVAKAIADIKAGKIEYRLDKTNIIHCPIGKVSFGTEKLVDNFRTLMSAIIKAKPAAAKGQYLKSVVVTSTMGPGIKV 224
>gi|16272460|ref|NP_438674.1| 50S ribosomal protein L1 [Haemophilus influenzae Rd KW20] >gi|53733303|ref|ZP_00156343.2| COG0081: Ribosomal protein L1 [Haemophilus influenzae R2866] >gi|68249113|ref|YP_248225.1| 50S ribosomal protein L1 [Haemophilus influenzae 86-028NP] >gi|145628897|ref|ZP_01784697.1| DNA-directed RNA polymerase subunit beta [Haemophilus influenzae 22.1-21] >gi|145633532|ref|ZP_01789261.1| 50S ribosomal protein L11 [Haemophilus influenzae 3655] >gi|145635403|ref|ZP_01791105.1| 50S ribosomal protein L11 [Haemophilus influenzae PittAA] >gi|145637445|ref|ZP_01793104.1| 50S ribosomal protein L11 [Haemophilus influenzae PittHH] >gi|145638569|ref|ZP_01794178.1| 50S ribosomal protein L11 [Haemophilus influenzae PittII] >gi|148827707|ref|YP_001292460.1| 50S ribosomal protein L1 [Haemophilus influenzae PittGG] >gi|160166025|sp|A5UH21|RL1_HAEIG 50S ribosomal protein L1 >gi|1172985|sp|P44342|RL1_HAEIN 50S ribosomal protein L1 >gi|81336481|sp|Q4QN32|RL1_HAEI8 50S ribosomal protein L1 >gi|1573499|gb|AAC22174.1| ribosomal protein L1 (rpL1) [Haemophilus influenzae Rd KW20] >gi|68057312|gb|AAX87565.1| 50S ribosomal protein L1 [Haemophilus influenzae 86-028NP] >gi|144979367|gb|EDJ89053.1| DNA-directed RNA polymerase subunit beta [Haemophilus influenzae 22.1-21] >gi|144985901|gb|EDJ92509.1| 50S ribosomal protein L11 [Haemophilus influenzae 3655] >gi|145267409|gb|EDK07411.1| 50S ribosomal protein L11 [Haemophilus influenzae PittAA] >gi|145269391|gb|EDK09335.1| 50S ribosomal protein L11 [Haemophilus influenzae PittHH] >gi|145272164|gb|EDK12072.1| 50S ribosomal protein L11 [Haemophilus influenzae PittII] >gi|148718949|gb|ABR00077.1| 50S ribosomal protein L1 [Haemophilus influenzae PittGG] (229 aa)
Score = 394, Expect = 2.5e-36, Identities = 90/219 (41%), Positives = 133/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G     AK  G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    ++ EN+  LL+ +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANADAAKEAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANFSEVQLKENLQALLAALNKAKPTTAKGIFIKKVSISTTMGAGVAV 224
>gi|58038864|ref|YP_190828.1| 50S ribosomal protein L1 [Gluconobacter oxydans 621H] >gi|81352515|sp|Q5FTX4|RL1_GLUOX 50S ribosomal protein L1 >gi|58001278|gb|AAW60172.1| LSU ribosomal protein L1P [Gluconobacter oxydans 621H] (230 aa)
Score = 394, Expect = 2.5e-36, Identities = 97/222 (43%), Positives = 130/222 (58%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           NK         +R K Y + EAV L K  + AKF  +I+I++ L +D   +DQ +RG +SLP   GK  R+ V  +G   ++A + G    G  +L  +I  G +DFD  I TP MM  + +LGKILG RGLMPNP+ G VT D+   I   K G  +YR +  G IH  VGKA+ D AK+VENIN L+  +   R T  KG +++K  LSSTMGPG+RV V
  S:     4 NKRLTAAQATVERNKPYGLSEAVALVKSNAKAKFDETIEISLNLGIDPRHADQMVRGLISLPNGTGKTLRVGVFARGPKAEEALAAGAEVVGAEDLAEKIQAGEIDFDRCIATPDMMALVGRLGKILGPRGLMPNPRLGTVTMDVKGAITAAKSGQVEYRAEKAGIIHAGVGKASFDEAKLVENINALVDAVQKARPTGAKGTYLKKAALSSTMGPGVRVDV 225
>gi|54027088|ref|YP_121330.1| 50S ribosomal protein L1 [Nocardia farcinica IFM 10152] >gi|61215420|sp|Q5YPC5|RL1_NOCFA 50S ribosomal protein L1 >gi|54018596|dbj|BAD59966.1| putative ribosomal protein L1 [Nocardia farcinica IFM 10152] (237 aa)
Score = 394, Expect = 2.5e-36, Identities = 90/214 (42%), Positives = 136/214 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKT 233
           DRTK Y+   A  LAK+T+  K  +++++A++L +D  K+DQ +RGTV+LP+  GK  R++V   G    +A++ G +  G  +LI  I  GWLDFD  I TP  M ++ ++ ++LG RGLMPNPK G VTTD+ K +++ K G   +R D   N+H V+GKA+ D AK+VEN    L  I   + ++ KG +++KV +S+  GPGI V  N+T
  S:    16 DRTKLYSPLAAARLAKETATTKTDATVEVAVRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAAGEKAAEAEAAGADAVGAEDLIERIQGGWLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTTDVAKAVSDIKGGKINFRVDKQANLHFVIGKASFDEAKLVENYGAALDEILRAKPSTAKGRYVKKVTVSTNTGPGIPVDPNRT 229
>gi|189218813|ref|YP_001939454.1| Ribosomal protein L1 [Methylokorus infernorum V4] >gi|189185671|gb|ACD82856.1| Ribosomal protein L1 [Methylacidiphilum infernorum V4] (237 aa)
Score = 394, Expect = 2.6e-36, Identities = 92/227 (40%), Positives = 133/227 (58%)
  Q:     2 ANQKKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           A   K  +K  +  +   DR K Y++ EA+ L K    AK+  S+D+A  L +D  +SDQ +RG VSLPY  GK  RI V  KG     AK  G +  G  +LI ++ +G+ DFD+ I TP  M E+ KLGKILG RGLMPNP+ G VT D+   I EF+KG  +++ D   N+H+V GKA+  T  + ENI  ++  +A  +  S KG + + + +S ++ P IR+
  S:     4 AQMAKKRSKRYRLAAEKIDRKKTYSLTEALELLKSMPKAKYDESVDVAFHLGVDPKQSDQMVRGMVSLPYGSGKTVRIAVFAKGTVADQAKEAGADIVGYEDLIKKVQEGYTDFDVAIATPDAMQEVRKLGKILGPRGLMPNPRTGTVTEDVVGAIREFRKGRVEFKVDKAANLHVVAGKASFQTEALEENIKAVVDAVAKAKPQSSKGKYFQSMAVSLSVSPSIRL 230
>gi|163787868|ref|ZP_02182315.1| 50S ribosomal protein L1 [Flavobacteriales bacterium ALC-1] >gi|159877756|gb|EDP71813.1| 50S ribosomal protein L1 [Flavobacteriales bacterium ALC-1] (229 aa)
Score = 394, Expect = 2.8e-36, Identities = 89/219 (40%), Positives = 134/219 (61%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     D  K Y++EEA  L K+ +  KF +S+D+AI+L +D  K++Q +RG VSLP+  GK+ ++L L     + +AK+ G ++ G  E + +I  GW D D+I+T P +M +L  LG++LG RGLMPNPK G VT D+ K + E K G   ++ D  G +H  +GKA+  T KI+ N   LLS I   + TS KG +++ + +SSTM P I +
  S:     6 KKQKEAHAKVDSNKVYSLEEASALLKEITFTKFDASVDLAIRLGVDPRKANQMVRGVVSLPHGTGKDMKVLALVTPDKEDEAKAAGADYVGLDEYLQKIKDGWTDVDVIVTMPSIMGKLGPLGRVLGPRGLMPNPKTGTVTMDVAKAVTEVKAGKIDFKVDKTGIVHAPIGKASFSTEKIIGNAQELLSTIMKLKPTSSKGTYVKSIYMSSTMSPSISI 224
>gi|145630306|ref|ZP_01786087.1| 50S ribosomal protein L11 [Haemophilus influenzae 22.4-21] >gi|145640492|ref|ZP_01796076.1| DNA-directed RNA polymerase subunit beta [Haemophilus influenzae R3021] >gi|144984041|gb|EDJ91478.1| 50S ribosomal protein L11 [Haemophilus influenzae R3021] >gi|145275078|gb|EDK14940.1| DNA-directed RNA polymerase subunit beta [Haemophilus influenzae 22.4-21] (229 aa)
Score = 394, Expect = 2.8e-36, Identities = 90/219 (41%), Positives = 133/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G     AK  G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    ++ EN+  LL+ +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANADAAKEAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANFSEVQLKENLQALLAALNKAKPTTAKGIFIKKVSISTTMGAGVAV 224
>gi|68536952|ref|YP_251657.1| 50S ribosomal protein L1 [Corynebacterium jeikeium K411] >gi|91207349|sp|Q4JT18|RL1_CORJK 50S ribosomal protein L1 >gi|68264551|emb|CAI38039.1| 50S ribosomal protein L1 [Corynebacterium jeikeium K411] (236 aa)
Score = 393, Expect = 2.9e-36, Identities = 89/221 (40%), Positives = 133/221 (60%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T+K  +  +   D  + YT   A    K+TS+  F +++D+AI+L +D  K+DQ +RGTVSLP   GKE R++V  +G     A+  G +  G +ELI +I  GW DFD  I TP  M ++ ++ ++LG RGLMPNPK G VTTD+ K +AE K G   +R D   N+H ++GKA+    ++ EN   L+  +   + +S KG + +KV +SST GPG+ V
  S:     4 TSKAYRAAAEKIDAGRLYTPLAAAKAVKETSSKNFDATVDVAIRLGVDPRKADQLVRGTVSLPNGTGKEVRVVVFAEGPNATAAEEAGADVVGTAELIEKIQGGWTDFDAAIATPDQMAKVGRVARVLGPRGLMPNPKTGTVTTDVAKAVAEIKGGKISFRVDKAANLHAILGKASFTEKQLAENYGALIDELLRLKPSSSKGRYFKKVTMSSTNGPGVPV 224
>gi|118486868|gb|ABK95268.1| unknown [Populus trichocarpa] (355 aa)
Score = 393, Expect = 2.9e-36, Identities = 84/206 (40%), Positives = 133/206 (64%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +  A+++ K+T+N KF+ S++   +LN+D   +DQQLR TV+LP   G+  ++ VL +G    +AK+ G +  G  +LI +I  G++ FD +I +P MMP+++ LGKILG RGLMPNPK G VTTD+P+ IAEFK+G  +YR D  G +H+  GKA+     ++ N+   +    A + +  KG++ +  ++ S+MGP IR+
  S:   136 KEYDLGTAISMLKKTANTKFVESVEAHFRLNIDPKYNDQQLRATVNLPKGTGQTVKVAVLTQGEKFDEAKNAGADLVGGEDLIQQIKGGFMQFDKLIASPDMMPKVASLGKILGPRGLMPNPKAGTVTTDIPQAIAEFKRGKVEYRADKTGIVHIPFGKADFSEEDLLVNLLAAVKSAEANKPSGAKGVYWKSAHICSSMGPSIRL 341
>gi|94971705|ref|YP_593753.1| 50S ribosomal protein L1P [Acidobacteria bacterium Ellin345] >gi|160165475|sp|Q1IHH1|RL1_ACIBL 50S ribosomal protein L1 >gi|94553755|gb|ABF43679.1| LSU ribosomal protein L1P [Acidobacteria bacterium Ellin345] (235 aa)
Score = 393, Expect = 3.0e-36, Identities = 85/204 (41%), Positives = 134/204 (65%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y +++AV L ++   AKF  ++D+ ++L +D   +DQ +RGTV LP+  GK K +LV+  G  Q++A++ G +  G  +++ +I+K GW D+D +I+TP MM  + KLGK+LG RGLMPNPK G VTTD+   + E K G  ++RTD  G +H+ VGK +    K+V+N   L++ +   + ++ KG +I+   LSSTMGPGI +
  S:    20 YALQDAVPLLQKVKFAKFDETVDLTLRLGVDPKHADQMVRGTVVLPHGLGKTKIVLVIASGEKQREAEAAGADFVGGEDMVEKIAKEGWTDYDAVISTPDMMRSVGKLGKVLGPRGLMPNPKTGTVTTDVASAVREVKAGKVEFRTDKTGLVHVPVGKISFPPDKLVDNATTLITSVVKAKPSAAKGKYIKGCYLSSTMGPGISI 224
>gi|89893202|ref|YP_516689.1| 50S ribosomal protein L1 [Desulfitobacterium hafniense Y51] >gi|109647484|ref|ZP_01371387.1| ribosomal protein L1 [Desulfitobacterium hafniense DCB-2] >gi|122483931|sp|Q250P7|RL1_DESHY 50S ribosomal protein L1 >gi|89332650|dbj|BAE82245.1| 50S ribosomal protein L1 [Desulfitobacterium hafniense Y51] >gi|109640574|gb|EAT50129.1| ribosomal protein L1 [Desulfitobacterium hafniense DCB-2] (230 aa)
Score = 393, Expect = 3.1e-36, Identities = 84/210 (40%), Positives = 131/210 (62%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FDR   +   EA+ + K+ + AKF  ++++A KL +DT  +DQQ+RG + LP+  GK + +LV  KG   K+A++ G +  G  ++IA+I +GW  FD+++ TP MM  + KLG++LG +GLMPNPK G VT D+ K + E K G  +YR D  G IH  +GK +    ++ +N   L+  +   +  + KG +I  V +SSTMGPG+R+
  S:    15 FDRAALHEPMEALAVVKKIAKAKFDETVEVAFKLGIDTRHADQQIRGALVLPHGTGKTRSVLVFAKGDKAKEAEAAGADFVGAEDMIAKIEQGWFGFDVVVATPDMMGMVGKLGRVLGPKGLMPNPKTGTVTFDVAKAVKEIKAGKIEYRADKAGIIHAPIGKVSFSEEQLYQNYKVLVETLVKAKPAAAKGQYIRSVTVSSTMGPGVRI 224
>gi|107024314|ref|YP_622641.1| 50S ribosomal protein L1 [Burkholderia cenocepacia AU 1054] >gi|116688361|ref|YP_833984.1| 50S ribosomal protein L1 [Burkholderia cenocepacia HI2424] >gi|170731671|ref|YP_001763618.1| ribosomal protein L1 [Burkholderia cenocepacia MC0-3] >gi|194557590|ref|YP_002092616.1| Ribosomal protein L1 [Burkholderia cenocepacia PC184] >gi|123244302|sp|Q1BRT7|RL1_BURCA 50S ribosomal protein L1 >gi|160165724|sp|A0K3L4|RL1_BURCH 50S ribosomal protein L1 >gi|105894503|gb|ABF77668.1| LSU ribosomal protein L1P [Burkholderia cenocepacia AU 1054] >gi|116646450|gb|ABK07091.1| LSU ribosomal protein L1P [Burkholderia cenocepacia HI2424] >gi|124871381|gb|EAY63097.1| Ribosomal protein L1 [Burkholderia cenocepacia PC184] >gi|169814913|gb|ACA89496.1| ribosomal protein L1 [Burkholderia cenocepacia MC0-3] (232 aa)
Score = 393, Expect = 3.2e-36, Identities = 85/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IE+A++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEDALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|81359249|sp|Q5PBG7|RL1_ANAMM 50S ribosomal protein L1 >gi|56387775|gb|AAV86362.1| ribosomal protein L1 [Anaplasma marginale str. St. Maries] (217 aa)
Score = 393, Expect = 3.2e-36, Identities = 85/204 (41%), Positives = 124/204 (60%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGW-LDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y+ EE +    Q++ AKF  S+D+AIKL++  SKS + +RG V LP   G+E R+ V  KG   K A S G +  GD ELI EI KG  LD D  I TP  MP++S + KILG RGLMPNPK G VT +L + +   K G  ++++D YG +H+ +G        ++EN N +++ +   R T++KG ++  V ++STMG   R+
  S:     9 YSAEEGIRELLQSAKAKFRESVDVAIKLSVADSKSGESIRGAVVLPKGLGREVRVAVFAKGEHAKQASSAGADVVGDEELIEEIKKGRRLDVDWCIATPDFMPQISAIAKILGPRGLMPNPKFGTVTLELAEMVGIIKSGQVKFKSDRYGIVHVKIGDIGFTPEDLLENFNAVVAAVQGLRPTTIKGSYVRGVFVNSTMGRSFRI 213
>gi|30139096|emb|CAD85960.1| Ribosomal protein L1 [Nitrosomonas europaea ATCC 19718] (234 aa)
Score = 393, Expect = 3.2e-36, Identities = 92/229 (40%), Positives = 137/229 (59%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVV 236
           T+K  ++     DR++ Y++ +A+ L K+T+ AKF  S+DIAI L +D  KSDQ +RG+V LP   GK  R+ V  +G   K+A   G +  G  +L   +  G ++FDL I +P  M  + +LG+ILG RGLMPNPK G VT D+   I   K G  Q+R D  G +H  VG+A+ D   +  NI  L+  +   + T+ KG+++ K+ +SSTMG G+R  V+ TA+V
  S:     8 TSKRYREIVQKIDRSQLYSLVDALALVKETAVAKFDESVDIAINLGIDVRKSDQVVRGSVVLPSGTGKSVRVAVFAQGDKAKEALDAGADIVGFEDLAERVKAGEINFDLAIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTVDVINAIRNAKAGQVQFRADKAGIVHCTVGRASFDVEALRANIMALVDALNKSKPTTSKGVYLRKMAISSTMGVGVR--VDHTAIV 234
>gi|186477599|ref|YP_001859069.1| ribosomal protein L1 [Burkholderia phymatum STM815] >gi|184194058|gb|ACC72023.1| ribosomal protein L1 [Burkholderia phymatum STM815] (232 aa)
Score = 393, Expect = 3.4e-36, Identities = 86/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IEEA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  ++  G L+FD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N+N L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQVKAGNLNFDVVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLNALVEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|114570355|ref|YP_757035.1| 50S ribosomal protein L1P [Maricaulis maris MCS10] >gi|122315777|sp|Q0ANP0|RL1_MARMM 50S ribosomal protein L1 >gi|114340817|gb|ABI66097.1| LSU ribosomal protein L1P [Maricaulis maris MCS10] (232 aa)
Score = 393, Expect = 3.4e-36, Identities = 83/210 (39%), Positives = 128/210 (60%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FDR   YTI++AV   K  + AKF  +I++AI L +D   +DQ +RG  +LP   G+  R+ V  KG   ++A   G +  G  +L+ +I  G ++FD +I TP MMP + +LGK+LG RG+MPNPK G VT  + K + + K G  ++R +  G IH  VGKA+   A + EN+  L+  I   + +  KG+++ ++ LSSTMGPG+++
  S:    15 FDRDTLYTIDDAVAHVKSNAKAKFDETIELAINLGVDPRHADQMVRGVCNLPNGTGRSVRVAVFAKGPKAEEATKAGADVVGAEDLMEQIQGGNINFDKVIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTMGVTKAVNDSKGGAVEFRVEKAGIIHAGVGKASFTEAALAENVRALVDAIVKAKPSGAKGLYVRRIALSSTMGPGVKI 224
>gi|193213525|ref|YP_001999478.1| ribosomal protein L1 [Chlorobaculum parvum NCIB 8327] >gi|193087002|gb|ACF12278.1| ribosomal protein L1 [Chlorobaculum parvum NCIB 8327] (229 aa)
Score = 392, Expect = 3.9e-36, Identities = 85/226 (37%), Positives = 137/226 (60%)
  Q:     7 VTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           +  K  K  +   DR + Y + EA+   K+ +  KF ++ID+A+KL +D   +DQ +RGTV LP+  GK   +LV+ K    ++A+  G +  G  + I +I  GW D D+++ TP +M +L K+ +ILG RGLMPNPK+G VT D+ K ++E K G  ++R D  GNIH  VGK + D+ K+  NI   +  +   + ++ KG +++ + +SSTM PG++V  +K
  S:     1 MAGKNYKNAAAKVDRAQEYELAEAIEKVKEITTTKFDATIDVAMKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKENKAEEAREAGADFVGFEDYIEKIQNGWTDVDVVVATPDVMGQLGKVARILGPRGLMPNPKSGTVTMDVAKAVSEVKAGKIEFRVDKAGNIHAPVGKVSFDSDKLAGNIGSFIKEVVRLKPSAAKGQYLQGITISSTMSPGVKVKKDK 226
>gi|188584824|ref|YP_001916369.1| LSU ribosomal protein L1P [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349511|gb|ACB83781.1| LSU ribosomal protein L1P [Natranaerobius thermophilus JW/NM-WN-LF] (233 aa)
Score = 392, Expect = 4.2e-36, Identities = 86/209 (41%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y  EEA+ L K+T  A F  ++++A +L ++   +DQQ+RG + LP   GK  +++V  KG   K+A+  G +  G  EL+ +I  G+LDFD+ I TP MM  + KLG++LG +GLMPNPK G VT D+ K + E K G  ++R D  GN+H+ +GK + +  K+ EN + L+  I   R  + KG ++  V +S+TMGPGI++
  S:    17 DREKLYDPEEALELVKETGVANFDETVEVACRLGVNPKYNDQQVRGALVLPNGTGKTAKVVVFAKGDKAKEAEDAGADIVGAEELVNKIEGGFLDFDVAIATPDMMSMVGKLGRVLGPKGLMPNPKAGTVTNDISKAVEEAKAGKVEFRVDRSGNVHVPIGKESFEADKLKENFDALMDAILKARPAAAKGQYLRGVAVSTTMGPGIKI 225
>gi|118489924|gb|ABK96759.1| unknown [Populus trichocarpa x Populus deltoides] (355 aa)
Score = 392, Expect = 4.2e-36, Identities = 85/206 (41%), Positives = 134/206 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +  A++L K+T++ KF+ S +   +LN+D   +DQQLR TV+LP   G+  ++ VL +G    +AK+ G +  G  +LI +I  G+++FD +I +P MMP+++ LGKILG RGLMPNPK G VTTD+P+ IAEFKKG  +YR D  G +H+  GKA+     ++ N+   +  + A + +  KG++ +  ++ S+MGP IR+
  S:   136 KEYDLGAAISLLKKTASTKFVESAEAHFRLNIDPKYNDQQLRATVNLPKGTGQTIKVAVLTQGEKFDEAKNAGADLVGGEDLIQQIKGGYMEFDKLIASPDMMPKVASLGKILGPRGLMPNPKAGTVTTDIPQAIAEFKKGKVEYRADKTGIVHIPFGKADFSEEDLLVNLLAAVKSVEANKPSGAKGVYWKSAHICSSMGPSIRL 341
>gi|148243456|ref|YP_001228613.1| 50S ribosomal protein L1 [Synechococcus sp. RCC307] >gi|160174528|sp|A5GWK1|RL1_SYNR3 50S ribosomal protein L1 >gi|147851766|emb|CAK29260.1| 50S ribosomal protein L1 [Synechococcus sp. RCC307] (235 aa)
Score = 392, Expect = 4.4e-36, Identities = 85/204 (41%), Positives = 127/204 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y   EAV+L K  + AKF  +I+  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G    GD EL+  I+ G +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTD+   I EFK G  ++R D  G +H+  GKA+     ++EN+  +   +   + +  KG + + + ++STMGP + V
  S:    20 YAPLEAVSLVKANATAKFDETIEAHVRLGIDPKYTDQQLRTTVALPKGTGRSIRIAVITRGEKVAEAKAAGAELVGDEELVDSIAGGQMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKTGTVTTDVTNAINEFKAGKLEFRADRSGIVHVQFGKASFSADDLLENLKSVQETVDRNKPSGAKGRYWKSLYITSTMGPSVEV 223
>gi|37521169|ref|NP_924546.1| 50S ribosomal protein L1 [Gloeobacter violaceus PCC 7421] >gi|61214652|sp|Q7NK78|RL1_GLOVI 50S ribosomal protein L1 >gi|35212165|dbj|BAC89541.1| 50S ribosomal protein L1 [Gloeobacter violaceus PCC 7421] (238 aa)
Score = 392, Expect = 4.4e-36, Identities = 86/212 (40%), Positives = 129/212 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           DR   Y  ++A+ L KQT+NAKF  + +  I+L ++   +DQQ+R TV LP   GK  RI VL KG   ++A+  G + AG  ELI  I  G+++FDL+I TP +MP++++LGK+LG RGLMP+PK G VT DL   I EFK G  ++R D  G +H+  GK +     +++N+  +   I   + +  KG +    ++ STMGP I + +N
  S:    16 DRQTIYAPQKALELLKQTANAKFDETAETHIRLGINPKYADQQVRSTVVLPRGTGKAIRIAVLAKGEKVREAEKAGADIAGSEELIERIQGGFMEFDLMIATPDIMPQVARLGKLLGPRGLMPSPKGGTVTMDLVGAIREFKAGKLEFRADRTGIVHIPFGKVSFTPEALMDNLKSVQDAIDRAKPSGAKGRYWRTFHIKSTMGPSIEIDIN 227
>gi|53733051|ref|ZP_00155509.2| COG0081: Ribosomal protein L1 [Haemophilus influenzae R2846] >gi|148825208|ref|YP_001289961.1| 50S ribosomal protein L1 [Haemophilus influenzae PittEE] >gi|160166012|sp|A5U9X7|RL1_HAEIE 50S ribosomal protein L1 >gi|148715368|gb|ABQ97578.1| 50S ribosomal protein L1 [Haemophilus influenzae PittEE] (229 aa)
Score = 392, Expect = 4.6e-36, Identities = 90/219 (41%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G     AK  G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    ++ EN+  LL  +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANADAAKEAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANFSEVQLKENLQALLVALNKAKPTTAKGIFIKKVSISTTMGAGVAV 224
>gi|15605039|ref|NP_219823.1| 50S ribosomal protein L1 [Chlamydia trachomatis D/UW-3/CX] >gi|76789040|ref|YP_328126.1| 50S ribosomal protein L1 [Chlamydia trachomatis A/HAR-13] >gi|6919960|sp|O84320|RL1_CHLTR 50S ribosomal protein L1 >gi|91207347|sp|Q3KM44|RL1_CHLTA 50S ribosomal protein L1 >gi|3328735|gb|AAC67911.1| L1 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX] >gi|76167570|gb|AAX50578.1| LSU ribosomal protein L1P [Chlamydia trachomatis A/HAR-13] (232 aa)
Score = 392, Expect = 4.6e-36, Identities = 88/210 (41%), Positives = 134/210 (63%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D  K Y++ EA+++ KQ    +F  ++D+++KL +D  KSDQQ+RG+VSLP+  GK  RILV   G    +A   G +  G  +L+ +I  GW+DFD+ + TP MM E+ KLGK+LG R LMP PK G VTTD+ KT+AE +KG  +++ D  G  ++ V K + D+A+I EN+  L + +   +  + KG ++    +SSTMGPG+ V
  S:    15 YDLAKSYSLGEAIDILKQCPTVRFDQTVDVSVKLGIDPRKSDQQIRGSVSLPHGTGKVLRILVFAAGDKAAEAIEAGADFVGSDDLVEKIKGGWVDFDVAVATPDMMREVGKLGKVLGPRNLMPTPKAGTVTTDVVKTVAELRKGKIEFKADRAGVCNVGVAKLSFDSAQIKENVEALCAALVKAKPATAKGQYLVNFTISSTMGPGVTV 224
>gi|15828481|ref|NP_325841.1| 50S ribosomal protein L1 [Mycoplasma pulmonis UAB CTIP] >gi|33301465|sp|Q98RJ8|RL1_MYCPU 50S ribosomal protein L1 >gi|14089423|emb|CAC13183.1| 50S RIBOSOMAL PROTEIN L1 [Mycoplasma pulmonis] (229 aa)
Score = 392, Expect = 4.7e-36, Identities = 94/209 (44%), Positives = 136/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILV-LDKGLTQKDAKSLGVNHAGDS-ELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ +FY + EA+ LAK+TS +KF +SID+A +LNLDT K+DQQLRG++ LP+  GK  R+LV  D    QK +K  G +   D  EL   I +   DFD+I+  PKMMP L + GK+LG +GLMPNPK G VT +  K + E KKG   YR D YG +H ++GK +    ++++N   L+  I   + + VKG +I+ + +SS+MGP I++
  S:    16 DKNQFYPLIEAIQLAKKTSYSKFDASIDLAFRLNLDTRKADQQLRGSILLPHGNGKVTRVLVATDSPELQKSSKEAGADFVVDKLELEEIIKQNKFDFDVIVADPKMMPILGRYGKVLGPKGLMPNPKTGTVTPNPDKAVVEIKKGKANYRADKYGIVHSLIGKKSMSDDQLLDNAKVLIDTIKRLKPSVVKGTYIKNLTISSSMGPSIKI 226
>gi|149198912|ref|ZP_01875953.1| 50S ribosomal protein L1 [Lentisphaera araneosa HTCC2155] >gi|149137907|gb|EDM26319.1| 50S ribosomal protein L1 [Lentisphaera araneosa HTCC2155] (229 aa)
Score = 392, Expect = 4.7e-36, Identities = 87/209 (41%), Positives = 125/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K Y I+EA    K     KF  S+DIA KL +DT + +Q +RG +SLP   GK   ++V+  G +  +AK+ G ++AG  ELIA+I  GWLDFD++I TP  M ++  LG+ LG RGLMPNPK G VT D+   +   K G  +YR D  G  H++VGK + D  K+ EN   ++  I   R ++ KG ++    +SSTM PG+++
  S:    15 DMNKAYGIKEAFETLKSLPAVKFDESVDIAFKLGIDTRQPEQNVRGALSLPNGTGKNVTVVVIADGNSADEAKAAGADYAGFDELIAKIKDGWLDFDVLIATPAAMSKVRTLGRALGPRGLMPNPKTGTVTDDVAGAVKASKGGRVEYRADKGGATHVLVGKLSFDADKLTENAQAIVEAIVKARPSATKGTYVVSCTVSSTMSPGLKI 223
>gi|162149183|ref|YP_001603644.1| 50S ribosomal protein L1 [Gluconacetobacter diazotrophicus PAl 5] >gi|187596879|ref|ZP_02983140.1| ribosomal protein L1 [Gluconacetobacter diazotrophicus PAl 5] >gi|189041819|sp|A9H3T0|RL1_GLUDA 50S ribosomal protein L1 >gi|161787760|emb|CAP57356.1| 50S ribosomal protein L1 [Gluconacetobacter diazotrophicus PAl 5] >gi|187491237|gb|EDU29177.1| ribosomal protein L1 [Gluconacetobacter diazotrophicus PAl 5] (231 aa)
Score = 391, Expect = 4.9e-36, Identities = 90/223 (40%), Positives = 128/223 (57%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           NK         DR K Y ++EA+ L KQ + AKF  +I+I++ L +D   +DQ +RG +SLP   GK  R+ V  +G   ++A + G +  G  +L  ++  G + FD  I TP MM  + +LGKILG RGLMPNPK G VT D+   +   K G  +YR +  G IH  +GKA+ +  K+ ENI   +  +   + T  KG ++ K  LSSTMGPGIRV V+
  S:     4 NKRLTAAQATVDRNKAYGLDEAIALVKQVATAKFDETIEISLNLGIDPRHADQMVRGLLSLPNGTGKTLRVGVFARGAKAEEALAAGADVVGAEDLAEKVQAGEIAFDRCIATPDMMALVGRLGKILGPRGLMPNPKLGTVTMDVKGAVTAAKSGQVEYRAEKAGIIHAGIGKASFEGDKLAENIRAFVDAVQKAKPTGAKGTYLRKAALSSTMGPGIRVDVS 226
>gi|120436718|ref|YP_862404.1| 50S ribosomal protein L1 [Gramella forsetii KT0803] >gi|160165991|sp|A0M3Z2|RL1_GRAFK 50S ribosomal protein L1 >gi|117578868|emb|CAL67337.1| 50S ribosomal protein L1 [Gramella forsetii KT0803] (232 aa)
Score = 391, Expect = 4.9e-36, Identities = 86/219 (39%), Positives = 137/219 (62%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     +  K YT+ EA  L K+ SNA F +S+D+A++LN+D  K++Q +RG V+LP+  GK+ ++L L     +++AK  G ++ G  E + +I  GW D D+IIT P +M +L  LG++LG RGLMPNPK G VT D+ K +++ K G   ++ D +G +H  VGKA+ D  KI  N   LL+ +   +  + KG++I+ + +SSTM P +++
  S:     6 KKQKEAQSKIENGKTYTVAEASALIKEVSNANFDASVDLAVRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEEEAKEAGADYVGLDEYLDKIKGGWTDVDVIITMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDIAKAVSDVKAGKIDFKVDKHGIVHAGVGKASFDAEKIAGNARELLTTLVKLKPQAAKGVYIKTIYMSSTMSPSVQI 224
>gi|116074057|ref|ZP_01471319.1| 50S ribosomal protein L1 [Synechococcus sp. RS9916] >gi|116069362|gb|EAU75114.1| 50S ribosomal protein L1 [Synechococcus sp. RS9916] (235 aa)
Score = 391, Expect = 5.1e-36, Identities = 87/206 (42%), Positives = 129/206 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           Y   +A+ + K+ +NAKF  +I+   +L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AGD +L+  I+KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VTTDL   I EFK G  ++R D  G +H+  GKA+     ++ N+  L   I   + +  KG + + + ++STMGP + V V
  S:    20 YEPLDAITIVKENANAKFDETIEAHARLGIDPKYTDQQLRTTVALPEGTGQTVRIAVVARGEKVAEAKAAGAELAGDDDLVETIAKGEMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAIKEFKAGKLEFRADRTGIVHVRFGKASFSADALLNNLKTLQESIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDV 225
>gi|119485146|ref|ZP_01619531.1| 50S ribosomal protein L1 [Lyngbya sp. PCC 8106] >gi|119457374|gb|EAW38499.1| 50S ribosomal protein L1 [Lyngbya sp. PCC 8106] (238 aa)
Score = 391, Expect = 5.4e-36, Identities = 88/204 (43%), Positives = 125/204 (61%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y   EA+ L K+T+ AKF  S +  I+L +D   +DQQLR TV+LP   G+  R+ VL KG    +A + G + AG  +LI +I KG LDFD +I TP MMP+++KLG++LG +GLMP+PK G VTTD+ + I EFK G  ++R D  G +H++ GK       ++ N+  L   I   R +  KG +   V +S+TMGP I V
  S:    21 YEPLEAIQLLKETATAKFPESAEAHIRLGIDPKYTDQQLRTTVTLPKGTGQTIRVAVLAKGEKVNEALTSGADIAGSEDLINDIQKGMLDFDCLIATPDMMPQVAKLGRLLGPKGLMPSPKGGTVTTDVAQAIQEFKAGKLEFRADRTGIVHVMFGKTAFSAEDLLVNLCALQECIDRNRPSGAKGRYWRSVYVSATMGPSIPV 224
>gi|15639230|ref|NP_218678.1| 50S ribosomal protein L1 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025471|ref|YP_001933243.1| ribosomal protein L1 [Treponema pallidum subsp. pallidum SS14] >gi|6094026|sp|O83266|RL1_TREPA 50S ribosomal protein L1 >gi|3322508|gb|AAC65226.1| ribosomal protein L1 (rplA) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018046|gb|ACD70664.1| ribosomal protein L1 [Treponema pallidum subsp. pallidum SS14] (226 aa)
Score = 391, Expect = 5.5e-36, Identities = 83/211 (39%), Positives = 132/211 (62%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVL 229
           +DR + ++++ AV L K+   A F  ++++ + L L   K +Q +R TV LP+ F  E R+LV  K     +A + G  +AG +E + ++  GW DFD+++ +P MM ++ +LG +LG RGLMPNP+ G V+ DL   + E KKG  ++R D  G +H+ VGK   D+A+IVEN++  LS +  K+   VK  F+  ++LSS+MGPGI V+
  S:    14 YDRAERFSLDRAVGLLKEVRYASFDETVEVHVSLRL---KKNQTVRDTVVLPHRFRAEVRVLVFCKEDRVSEALAAGAAYAGGAEYLEKVKGGWFDFDVVVASPDMMKDVGRLGMVLGRRGLMPNPRTGTVSADLGAAVCELKKGRVEFRADKTGVVHLAVGKTTMDSAQIVENVDVFLSEMDRKKPVDVKAGFVRSISLSSSMGPGIWVV 221
>gi|195954859|ref|ZP_03093552.1| 50S ribosomal protein L1 [Borrelia burgdorferi CA-11.2a] (226 aa)
Score = 391, Expect = 5.5e-36, Identities = 91/209 (43%), Positives = 127/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ KFY IE+A+ L K+   AKF  +IDI+I LNL   K +  +R T+ LP  F + KRILV  KG    +A + G  + GD +LI +I  GW +FD+++ TP MM ++ +LG ILG RGLMPNPK   VT +L   I   KKG  ++R +  G I    GK++ D  KI EN    +  +  KR + +KG FI+ + +SSTMGP I+V
  S:    16 DKNKFYNIEDAILLLKEIKFAKFDETIDISINLNL---KKNHTVRDTIVLPNQFMRPKRILVFAKGDRADEAIAFGATYVGDDDLINKIKSGWDEFDVVVATPDMMKDVGRLGPILGKRGLMPNPKTQTVTNNLKDAINSLKKGRTEFRANKNGVISFSFGKSSMDNEKIKENYEEFVKEVVKKRPSDLKGAFIDSIYISSTMGPSIKV 221
>gi|167587782|ref|ZP_02380170.1| 50S ribosomal protein L1 [Burkholderia ubonensis Bu] (232 aa)
Score = 391, Expect = 5.6e-36, Identities = 85/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IE+A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ ++  +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEDALALVKECASAKFNESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFESTALRTNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|15807039|ref|NP_295768.1| 50S ribosomal protein L1 [Deinococcus radiodurans R1] >gi|33301474|sp|Q9RSS8|RL1_DEIRA 50S ribosomal protein L1 >gi|6459833|gb|AAF11592.1|AE002040_9 ribosomal protein L1 [Deinococcus radiodurans R1] (233 aa)
Score = 391, Expect = 5.6e-36, Identities = 80/216 (37%), Positives = 132/216 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPEL-SKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           DR K Y+I+EA  L K+ + AKF  ++++  +L +D  KSDQ +RGTV+LP+  G+  R+ V+ KG   + A++ G +  G  ELI  I+ G++DFD ++ TP MM ++  KL ++LG RGL+PNPK+G V  D+   +   K G  ++R D  G +H  +GKA+ ++  +  N   L+S +   +  + KG+F+    L++TMGP I + +   A+
  S:    16 DRNKQYSIDEAAALVKELATAKFDETVEVHFRLGIDPRKSDQNVRGTVALPHGTGRSVRVAVITKGENVQAAEAAGADVVGSDELIERIAGGFMDFDAVVATPDMMAQIGQKLARLLGPRGLLPNPKSGTVGADVAGMVRGLKAGRIEFRNDKTGVVHAPIGKASFESGNLSANYQALISALEGAKPGTAKGVFLRSAYLTTTMGPSIPLALGGAAL 232
>gi|20808671|ref|NP_623842.1| 50S ribosomal protein L1 [Thermoanaerobacter tengcongensis MB4] >gi|33301572|sp|Q8R7U3|RL1_THETN 50S ribosomal protein L1 >gi|20517307|gb|AAM25446.1| Ribosomal protein L1 [Thermoanaerobacter tengcongensis MB4] (231 aa)
Score = 391, Expect = 5.7e-36, Identities = 90/210 (42%), Positives = 142/210 (67%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D+T+ Y+ +EA+++  +T+NAKF  +ID+A++L +D   +DQQ+RGTV LP+  GK  ++LV  KG   K+A++ G ++ G  EL+ +I K  W D+D++I TP MM  + +LGK+LG +GLMPNPK+G VT ++ K + E K G  +YR D  G IH+ +GK +    K++EN   ++  I   +  + KG +I+ V LSSTMGPG++V
  S:    14 YDKTQQYSSDEAMDIVLKTANAKFDETIDLAVRLGVDPRHADQQVRGTVILPHGTGKTVKVLVFAKGEKAKEAEAAGADYVGAEELVEKIQKENWFDYDVVIATPDMMGVVGRLGKLLGPKGLMPNPKSGTVTFEVEKAVKEAKAGKIEYRIDKAGIIHVPIGKKSFGKEKLLENFRTVMDAIIKSKPAAAKGQYIKSVVLSSTMGPGVKV 224
>gi|177677474|ref|ZP_02947885.1| ribosomal protein L1 [Methylocella silvestris BL2] >gi|172068281|gb|EDT54394.1| ribosomal protein L1 [Methylocella silvestris BL2] (231 aa)
Score = 391, Expect = 6.1e-36, Identities = 86/219 (39%), Positives = 128/219 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K   K     DR K Y I +A+ L K+ ++AKF  +++IA+ L +D   +DQ +RG V+LP   G+  R+ V  +G    +A + G +  G  +L+A +  G + FD  I TP MMP + +LGK+LG RGLMPNPK G VT D+   +   K G  ++R +  G I   VGKA+ D  K+ ENI   +  +A  +    KG +I++V +SSTMGPG++V
  S:     6 KRISKAREGIDRVKLYPIRDAIALIKERASAKFDETVEIAMNLGVDPKHADQMVRGVVNLPNGTGRTLRVAVFARGAKADEATAAGADIVGAEDLVATVQGGTIAFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTMDVAAAVKASKGGAVEFRVEKAGIIQGSVGKASFDDDKLAENIAAFVDAVAKAKPQGAKGTYIQRVAISSTMGPGVKV 224
>gi|134294432|ref|YP_001118167.1| 50S ribosomal protein L1 [Burkholderia vietnamiensis G4] >gi|160165757|sp|A4JAM9|RL1_BURVG 50S ribosomal protein L1 >gi|134137589|gb|ABO53332.1| LSU ribosomal protein L1P [Burkholderia vietnamiensis G4] (232 aa)
Score = 391, Expect = 6.1e-36, Identities = 85/209 (40%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IE+A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEDALALVKECASAKFNESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEATALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|167564427|ref|ZP_02357343.1| 50S ribosomal protein L1 [Burkholderia oklahomensis EO147] >gi|167571573|ref|ZP_02364447.1| 50S ribosomal protein L1 [Burkholderia oklahomensis C6786] (232 aa)
Score = 390, Expect = 6.6e-36, Identities = 85/209 (40%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I+EA+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIDEALALVKECASAKFNESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|83855429|ref|ZP_00948958.1| 50S ribosomal protein L1 [Croceibacter atlanticus HTCC2559] >gi|83849229|gb|EAP87097.1| 50S ribosomal protein L1 [Croceibacter atlanticus HTCC2559] (232 aa)
Score = 390, Expect = 6.6e-36, Identities = 84/219 (38%), Positives = 135/219 (61%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     +    YT+ EA  L K+ +NA F +S+D+A++LN+D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G +  G  E + +I  GW D D+IIT P +M +L  LG++LG RGLMPNPK G VT D+ K +++ K G   ++ D YG +H  +GKA+ D  K+  N   LL+ +   + T+ KG++I+ + +SSTM P +++
  S:     6 KKQKEAQSKIEAGNTYTVAEASALVKEVANANFDASVDLAVRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADFVGLDEYLDKIKGGWTDVDVIITMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDVAKAVSDVKAGKIDFKVDKYGIVHAGIGKASFDADKLAGNARELLTTLVKLKPTAAKGVYIKSIYMSSTMSPSVQI 224
>gi|9957210|gb|AAG09267.1| L1 [EDTA-degrading bacterium BNC1] (232 aa)
Score = 390, Expect = 6.6e-36, Identities = 82/209 (39%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR +FY ++EAV + K+ + AKF  +I++A+ L +D   +DQ +RG V+LP   G+  R+ V  KG    +AK+ G +  G  +L+  + KG ++FD  I TP MMP + +LGK+LG RGLMPNPK G VTTD+   +   K G  Q+R +  G +H  VGK + D   I EN+      +   + +  KG ++++V+++STMGPG+++
  S:    16 DRNRFYPLDEAVKVIKERATAKFDETIEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFAKGDKADEAKAAGADIVGAEDLVETVQKGEINFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTTDVAAAVKASKGGAVQFRVEKAGIVHAGVGKVSFDENAIAENVRAFADAVIKAKPSGAKGNYLKRVSITSTMGPGLKI 224
>gi|159896656|ref|YP_001542903.1| ribosomal protein L1 [Herpetosiphon aurantiacus ATCC 23779] >gi|159889695|gb|ABX02775.1| ribosomal protein L1 [Herpetosiphon aurantiacus ATCC 23779] (237 aa)
Score = 390, Expect = 6.7e-36, Identities = 87/209 (41%), Positives = 132/209 (63%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTT--DLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           + YT EEA  L K+TS   F +++++ ++L +D   +DQ +R T SLP+  GK  R+LV  +G T+  A++ G    G  ELI  I K  ++DFD+ + TP MM ++ +LG+ILG RGLMPNPK+G V    DLP+ I   + G  ++R D  G +H+ +GK +    +I EN+  LL  I A + +  KG++I+ + L+STMGPGI + VN
  S:    20 RLYTPEEAAALVKETSFTNFDATVELHVRLGIDPRHADQTVRSTASLPHGTGKSVRVLVFAQGDTENIARNAGAEIVGGDELIQRIEKENFIDFDVAVATPDMMGKVGRLGRILGRRGLMPNPKSGTVVPPGDLPQAIKALQGGRVEFRNDKTGLLHVAIGKISFTPDQIRENLVVLLDAIKAAKPSGSKGVYIKSLTLTSTMGPGIPLDVN 231
>gi|161523418|ref|YP_001578430.1| 50S ribosomal protein L1 [Burkholderia multivorans ATCC 17616] >gi|189351809|ref|YP_001947437.1| large subunit ribosomal protein L1 [Burkholderia multivorans ATCC 17616] >gi|160340847|gb|ABX13933.1| ribosomal protein L1 [Burkholderia multivorans ATCC 17616] >gi|189335831|dbj|BAG44901.1| large subunit ribosomal protein L1 [Burkholderia multivorans ATCC 17616] (232 aa)
Score = 390, Expect = 6.8e-36, Identities = 85/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I++A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ + A +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIDDALALVKECASAKFNESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPAALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|99080071|ref|YP_612225.1| 50S ribosomal protein L1 [Silicibacter sp. TM1040] >gi|123077812|sp|Q1GK53|RL1_SILST 50S ribosomal protein L1 >gi|99036351|gb|ABF62963.1| LSU ribosomal protein L1P [Silicibacter sp. TM1040] (232 aa)
Score = 390, Expect = 6.8e-36, Identities = 88/206 (42%), Positives = 126/206 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           TIEEAV L K  +  KF  +++IA+ L +DT  +DQ +RG V LP   GK  R+ V  +G    +AK  G +  G  +L+  I  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK+VEN+   +S +A  + +  KG +++K+ LSSTMGPG+ + V+
  S:    22 TIEEAVALVKANATTKFDETVEIAMNLGVDTRHADQMVRGVVGLPNGTGKTMRVAVFARGPKADEAKEAGADIVGAEDLMETIQGGTIDFDRCIATPDMMPVVGRLGKVLGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQFKAEKGGVVHAGVGKASFDEAKLVENVRAFVSAVAKAKPSGAKGAYMKKIVLSSTMGPGVTLDVD 227
>gi|161511226|ref|NP_842059.2| 50S ribosomal protein L1 [Nitrosomonas europaea ATCC 19718] >gi|33301433|sp|Q82T72|RL1_NITEU 50S ribosomal protein L1 (230 aa)
Score = 390, Expect = 7.0e-36, Identities = 92/229 (40%), Positives = 137/229 (59%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVV 236
           T+K  ++     DR++ Y++ +A+ L K+T+ AKF  S+DIAI L +D  KSDQ +RG+V LP   GK  R+ V  +G   K+A   G +  G  +L   +  G ++FDL I +P  M  + +LG+ILG RGLMPNPK G VT D+   I   K G  Q+R D  G +H  VG+A+ D   +  NI  L+  +   + T+ KG+++ K+ +SSTMG G+R  V+ TA+V
  S:     4 TSKRYREIVQKIDRSQLYSLVDALALVKETAVAKFDESVDIAINLGIDVRKSDQVVRGSVVLPSGTGKSVRVAVFAQGDKAKEALDAGADIVGFEDLAERVKAGEINFDLAIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTVDVINAIRNAKAGQVQFRADKAGIVHCTVGRASFDVEALRANIMALVDALNKSKPTTSKGVYLRKMAISSTMGVGVR--VDHTAIV 230
>gi|194564511|ref|YP_002099534.1| Ribosomal protein L1 [Burkholderia dolosa AUO158] >gi|124896135|gb|EAY70015.1| Ribosomal protein L1 [Burkholderia dolosa AUO158] (232 aa)
Score = 390, Expect = 7.2e-36, Identities = 85/209 (40%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y IE+A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYAIEDALALVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEIVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|126732291|ref|ZP_01748091.1| 50S ribosomal protein L1 [Sagittula stellata E-37] >gi|126707160|gb|EBA06226.1| 50S ribosomal protein L1 [Sagittula stellata E-37] (232 aa)
Score = 390, Expect = 7.2e-36, Identities = 89/212 (41%), Positives = 130/212 (61%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           F+  +  TIEEAV+L K  SNAKF  +++IA+ L +D   +DQ +RG V LP   GK  R+ V  +G    +AK  G +  G  +L+  I  G ++FD  I TP MMP + +LGKILG R LMPNPK G VT D+ + +   K G  Q++ +  G +H  VGK + D AK+ ENI   ++ ++A +    KG +++K++LSS+MGPG+ V V
  S:    15 FEGKENVTIEEAVSLIKTNSNAKFDETVEIAMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGPKADEAKEAGADIVGAEDLMETIQGGTIEFDRCIATPDMMPVVGRLGKILGPRNLMPNPKVGTVTMDVKEAVEAAKGGQVQFKAEKAGVVHAGVGKVSFDEAKLAENIRAFVNAVSAAKPAGAKGTYMKKISLSSSMGPGVTVDV 226
>gi|120402248|ref|YP_952077.1| 50S ribosomal protein L1 [Mycobacterium vanbaalenii PYR-1] >gi|160166284|sp|A1T4H1|RL1_MYCVP 50S ribosomal protein L1 >gi|119955066|gb|ABM12071.1| LSU ribosomal protein L1P [Mycobacterium vanbaalenii PYR-1] (235 aa)
Score = 390, Expect = 7.2e-36, Identities = 89/220 (40%), Positives = 139/220 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  K+ +   D+T+ Y+  EA  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G   + A++ G +  G  +LI +I  G+LDFD  I TP  M ++ ++ +ILG RGLMPNPK G VT D+ K +++ K G   +R D   N+H V+GKA+ D +K+ EN    L  +   + +S KG +++KV +S+T GPGI V
  S:     5 SKAYKEAAEKVDKTRLYSPLEAAKLAKETSSKKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGDKAEQAEAAGADIVGSDDLIEKIQGGFLDFDAAIATPDQMAKVGRIARILGPRGLMPNPKTGTVTPDVAKAVSDIKGGKINFRVDKQANLHFVIGKASFDESKLAENYGAALDEVLRAKPSSSKGRYLKKVVVSTTTGPGIPV 224
>gi|196195518|gb|EDX90477.1| ribosomal protein L1 [Alcanivorax sp. DG881] (231 aa)
Score = 390, Expect = 7.3e-36, Identities = 88/206 (42%), Positives = 125/206 (60%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +EEAV L  + S  KF  S+D+A+ L +D  KSDQ +RG   LP+  GK  R+ V  +G   ++AK  G +  G  +L  ++  G LDFD++I +P  M  + KLG ILG RGLMPNPK G VT D+ + +   K G  +YRTD  G IH  VG+   D++ I EN+  L++ +   + +S KG F +KV LS+TMGPG+ +
  S:    19 KLYPVEEAVALLAELSAVKFKESVDVAVNLGVDPRKSDQNVRGASVLPHGTGKTVRVAVFAQGAKAEEAKEAGADVVGFDDLAEKVQAGELDFDVVIASPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAQAVKNAKGGQVRYRTDKGGIIHCTVGQVGFDSSAIKENVEALIADLKKAKPSSAKGTFFKKVTLSTTMGPGLSI 224
>gi|163839738|ref|YP_001624143.1| 50S ribosomal protein L1 [Renibacterium salmoninarum ATCC 33209] >gi|189041830|sp|A9WNU3|RL1_RENSM 50S ribosomal protein L1 >gi|162953214|gb|ABY22729.1| LSU ribosomal protein L1P [Renibacterium salmoninarum ATCC 33209] (235 aa)
Score = 390, Expect = 7.5e-36, Identities = 85/214 (39%), Positives = 132/214 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVV 236
           KFY   +AV LA+ T+ +KF ++I++A +L +D  K+DQ +RGTV LP+  GK  R+LV   G   + A + G +  G  +LI +I+ GW DFD  + TP +M ++ +LGK+LG R LMPNPK G VT D+ K + E K G   +R D + N+H ++GK +    ++VEN    L  +   + ++ KG +++K  +++T GPGI V  N T V+
  S:    19 KFYAPADAVTLAQDTNPSKFDATIEVAFRLGVDPRKADQMVRGTVILPHGTGKTARVLVFATGDRAEAAIAAGADFVGSDDLIEKIAGGWTDFDAAVATPDLMGKVGRLGKVLGPRNLMPNPKTGTVTVDVAKAVNEIKGGKIDFRVDKHSNLHFIIGKVSFGAQQLVENYAAALDEVLRLKPSTSKGRYLQKATVTTTFGPGISVDPNVTKVL 232
>gi|116617399|ref|YP_817770.1| 50S ribosomal protein L1P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272400|sp|Q03ZH5|RL1_LEUMM 50S ribosomal protein L1 >gi|116096246|gb|ABJ61397.1| LSU ribosomal protein L1P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (230 aa)
Score = 390, Expect = 7.5e-36, Identities = 85/209 (40%), Positives = 136/209 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           K Y + +AV+L K+   AKF +S+++  KLN+DT ++DQQLRG V LP   GK+K ++V  +G   K+A++ G +  G ++L+  I  GWLDFD+ + TP MM ++ ++G+ LG +GLMPNPK G VT D+ K +++ K G   YRTD  GN+ + VG+ + +  K+ ENI  +   +   R  +VKG +++ V++SST GP + + +N
  S:    20 KAYALNDAVSLVKEIDFAKFDASVEVVFKLNVDTRQADQQLRGAVVLPNGTGKDKTVVVFAQGDKAKEAEAAGADVVGAADLVQRIQGGWLDFDVAVATPDMMAQVGRVGRALGPKGLMPNPKTGTVTMDVTKAVSDAKGGQVTYRTDRDGNVAVPVGRVSFEEGKLAENIKSIAETVLKARPAAVKGTYVQHVSISSTFGPAVTLDIN 228
>gi|167749968|ref|ZP_02422095.1| hypothetical protein EUBSIR_00936 [Eubacterium siraeum DSM 15702] >gi|167656989|gb|EDS01119.1| hypothetical protein EUBSIR_00936 [Eubacterium siraeum DSM 15702] (230 aa)
Score = 390, Expect = 7.6e-36, Identities = 90/216 (41%), Positives = 131/216 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           D TK Y   EA++L  QT+ AKF  ++++ ++L +D+  +DQQ+RG V LP   GK  R LV  KG   + A   G +   D + + +I+ GW+DFD++I TP MM  + +LGK+LG RGLMPNPK G VT D+ K I+E K G  +YR D    IH  +GKA+    K+ +N N L+  I   +  + KG +++   +SSTMGPG++V   K  V
  S:    15 DSTKAYDSSEALDLVCQTAKAKFDETVELHVRLGVDSRHADQQVRGAVVLPNGTGKTVRTLVFAKGEKIQAAIDAGSDFVADDDTVKKINDGWMDFDVVIATPDMMGVVGRLGKVLGPRGLMPNPKAGTVTPDVAKAISEAKAGKIEYRLDKSNIIHCPIGKASFGKEKLEQNFNTLMDAIVKAKPAAAKGAYLKSCTVSSTMGPGVKVSTAKYGV 230
>gi|196239931|ref|ZP_03138702.1| ribosomal protein L1 [Cyanothece sp. PCC 7425] >gi|196216190|gb|EDY10838.1| ribosomal protein L1 [Cyanothece sp. PCC 7425] (237 aa)
Score = 390, Expect = 7.9e-36, Identities = 85/204 (41%), Positives = 124/204 (60%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y    A+ L K+T+ AKF  S +  ++L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A   G +  G  ELI  I KG +DFDL+I TP MMP+++K+G+ILG RGLMP+PK G VT DL + IA+FK G  ++R D  G +H++ GKA      ++ N+  L   I   R +  KG +   + +S+TMGP I+V
  S:    20 YVPLAALELLKETATAKFPESAEAHVRLGIDPKYTDQQLRTTVALPKGTGQTVRVAVIARGEKVNEASGAGADLVGSEELIDAIQKGMMDFDLLIATPDMMPQVAKVGRILGPRGLMPSPKAGTVTFDLTQAIADFKAGKLEFRADRSGIVHVLFGKATFAAPDLLVNLKALQETIDRNRPSGAKGRYWRSLYVSATMGPSIQV 223
>gi|51244966|ref|YP_064850.1| 50S ribosomal protein L1 [Desulfotalea psychrophila LSv54] >gi|61214609|sp|Q6AP81|RL1_DESPS 50S ribosomal protein L1 >gi|50876003|emb|CAG35843.1| probable 50S ribosomal protein L1 [Desulfotalea psychrophila LSv54] (235 aa)
Score = 390, Expect = 7.9e-36, Identities = 92/229 (40%), Positives = 135/229 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV-LVNKTAVVKK 238
           K     S +FD+ + YT+EEAV     TS AKF  + DIAIKL +D   +DQ +R +V LP+  GK  R+LV  KG  + +A+  G +  G  +L+ +I  GWL+FD  + TP MM  + K+G++LG R LMPN K G VT D+ K I E K G   ++ +  G +H  +GK +    K+  N    +  I   + +S KG++++ V +SSTMGPG++V  V   A+VKK
  S:     6 KNYSNKSQSFDKQQVYTLEEAVGHVLATSYAKFDETFDIAIKLGVDPRHADQMIRSSVVLPHGTGKVTRVLVFAKGAKEAEAREAGADFVGGDDLVEKIQGGWLEFDKTVATPDMMGTVGKIGRVLGPRNLMPNAKLGTVTFDVAKVIEEIKSGKVDFKVEKAGILHAGIGKISFGNEKLTANALAFIEKIIQLKPSSSKGVYLKSVTISSTMGPGVKVDPVYLRALVKK 235
>gi|74316413|ref|YP_314153.1| 50S ribosomal protein L1P [Thiobacillus denitrificans ATCC 25259] >gi|91207385|sp|Q3SLQ9|RL1_THIDA 50S ribosomal protein L1 >gi|74055908|gb|AAZ96348.1| Ribosomal protein L1 [Thiobacillus denitrificans ATCC 25259] (231 aa)
Score = 390, Expect = 8.1e-36, Identities = 86/209 (41%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR++ Y + +A+ L K ++ AKF  SID+A+ L +D  KSDQ +RG V LP   GK  R+ V  +G   + A+  G +  G  +L A+I  G +DFD++I TP  M  + +LG+ILG RGLMPNPK G V+ D+   +   K G  QYRTD  G +H  +G+A+     + EN+  LL  +   +  S KGI+ +++++SSTMG G+RV
  S:    16 DRSRNYPVVDALQLVKDSATAKFDESIDVAVNLGVDARKSDQMVRGAVVLPKGIGKTVRVAVFAQGDNAQKARDAGADIVGFDDLAADIKAGKMDFDVVIATPDAMRVVGQLGQILGPRGLMPNPKVGTVSPDVVGAVKNAKAGQVQYRTDKGGIVHCTIGRASFSVDDLKENLVALLDALQRAKPASSKGIYFKRLSVSSTMGVGVRV 224
>gi|166366404|ref|YP_001658677.1| 50S ribosomal protein L1 [Microcystis aeruginosa NIES-843] >gi|189041823|sp|B0JNQ5|RL1_MICAN 50S ribosomal protein L1 >gi|166088777|dbj|BAG03485.1| 50S ribosomal protein L1 [Microcystis aeruginosa NIES-843] (237 aa)
Score = 389, Expect = 8.3e-36, Identities = 88/206 (42%), Positives = 128/206 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y   EA+ L K+ + AKF  + +  I+L +D   +DQQLR TVSLP   G+  R+ V+ +G   ++A + G +  G  ELI EI+KG +DF+++I TP MMP+++KLG+ LG RGLMP+PK G VTTDL   IAEFK G  ++R D  G +H+  GKA+     ++ N+  L   +   R +  KG +   V +SS+MGP I+V
  S:    19 KAYEPLEALTLLKELATAKFDETAEAHIRLGIDPKYTDQQLRTTVSLPKGTGRTVRVAVITRGEKVQEANNAGADIVGSEELIEEIAKGMMDFEVLIATPDMMPKVAKLGRQLGPRGLMPSPKGGTVTTDLTGAIAEFKAGKLEFRADRTGIVHVQFGKASFSAEDLLVNLKALQETVDRNRPSGAKGRYWRTVYVSSSMGPSIQV 224
>gi|189499296|ref|YP_001958766.1| ribosomal protein L1 [Chlorobium phaeobacteroides BS1] >gi|189494737|gb|ACE03285.1| ribosomal protein L1 [Chlorobium phaeobacteroides BS1] (229 aa)
Score = 389, Expect = 8.3e-36, Identities = 82/204 (40%), Positives = 127/204 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y +++A+ L ++ ++ KF +S+D+A++L +D   +DQ +RGTV LP+  GK   +LV+       +A+  G +  G  + I +I  GW D D+II TP +M +L K+GKILG RGLMPNPK+G VT D+ K + E K G  ++R D  GN+H  VGK +  + ++ EN    L  I   +  + KG +I  +++SSTM PG+RV
  S:    19 YDLQQAMELVREINDTKFDASVDLAVRLGVDPRHADQVVRGTVMLPHGTGKTVSVLVICSEAKASEAQEAGADFVGFEDYIEKIQNGWTDVDVIIATPDVMGKLGKVGKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRVDKAGNVHAPVGKVSFSSEQLFENATSFLKEIVRLKPAAAKGHYIRNISVSSTMSPGLRV 222
>gi|163815633|ref|ZP_02207006.1| hypothetical protein COPEUT_01808 [Coprococcus eutactus ATCC 27759] >gi|158449270|gb|EDP26265.1| hypothetical protein COPEUT_01808 [Coprococcus eutactus ATCC 27759] (230 aa)
Score = 389, Expect = 8.4e-36, Identities = 84/210 (40%), Positives = 135/210 (64%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +D+T  Y   EAV L K+ ++AKF  +++  ++L +D   +DQQ+RG V LP+  GK  ++LV  KG    +A + G ++AG  EL+ +I ++GWLDFD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ VGK +    ++ EN   L++ I   +  + KG +++ V ++STMGPG+++
  S:    14 YDKTAAYEATEAVALVKKMASAKFDETVEAHLRLGVDGRHADQQVRGAVVLPHGTGKTVKVLVFAKGAKVDEALAAGADYAGGDELVPKIQNEGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAITDIKAGKIEYRLDKANIIHVPVGKVSFTEEQLNENFQTLINAIVKAKPAAAKGQYLKSVVIASTMGPGVKI 224
>gi|15828018|ref|NP_302281.1| 50S ribosomal protein L1 [Mycobacterium leprae TN] >gi|13633707|sp|Q9CBK2|RL1_MYCLE 50S ribosomal protein L1 >gi|13093571|emb|CAC30858.1| 50S ribosomal protein L1 [Mycobacterium leprae] (235 aa)
Score = 389, Expect = 8.4e-36, Identities = 88/221 (39%), Positives = 138/221 (62%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           ++K  +  +V  DRT  YT  +A  LAK+TS+ +  +++++AI+L +D+ K+DQ +RGTV+LP+  GK  R+ V   G     A + G +  G  +LI +I  GWL+FD  + TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +A+ K G   +R D   N+H V+GKA+ D  ++ EN    L  +   + +S KG +++KV +S+TMGPGI V
  S:     4 SSKAYRAAAVKVDRTNLYTPLQAAKLAKETSSTRQDATVEVAIRLGVDSRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADVAVAAGADVVGSDDLIEKIQGGWLEFDAAVATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKRLAENYGAALEEVLRLKPSSSKGRYLKKVTVSTTMGPGIPV 224
>gi|118444059|ref|YP_877187.1| 50S ribosomal protein L1 [Clostridium novyi NT] >gi|160165828|sp|A0PXT5|RL1_CLONN 50S ribosomal protein L1 >gi|118134515|gb|ABK61559.1| ribosomal protein L1 [Clostridium novyi NT] (232 aa)
Score = 389, Expect = 9.2e-36, Identities = 87/209 (41%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   YT  EA++L  +T+ AKF  +I+++I+L +D   +DQQ+RG V LP+  GK+ R+LV  KG   K+A++ G ++ G  E + +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K IA+ K G  +YR D    IH+ +GK +    K+ EN N L+  I   +  + KG +I+ +++SSTMGPG+++
  S:    16 DKNSLYTPSEAIDLTLKTAKAKFDETIELSIRLGVDPRHADQQVRGAVVLPHGTGKKVRVLVFAKGDKAKEAEAAGADYVGAEEYLDKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIADIKAGKVEYRLDKTAIIHVPIGKKSFGEEKLAENYNVLMEAIVKAKPAAAKGQYIKSLSISSTMGPGVKI 225
>gi|169338094|ref|ZP_02622460.2| ribosomal protein L1 [Clostridium botulinum C str. Eklund] >gi|169294342|gb|EDS76475.1| ribosomal protein L1 [Clostridium botulinum C str. Eklund] (232 aa)
Score = 389, Expect = 9.5e-36, Identities = 87/209 (41%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   YT  EA++L  +T+ AKF  +I+++I+L +D   +DQQ+RG V LP+  GK+ R+LV  KG   K+A++ G ++ G  E + +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K IA+ K G  +YR D    IH+ +GK +    K+ EN N L+  I   +  + KG +I+ +++SSTMGPG+++
  S:    16 DKNSLYTPSEAIDLTLKTAKAKFDETIELSIRLGVDPRHADQQVRGAVVLPHGTGKKVRVLVFAKGDKAKEAEAAGADYVGAEEYLDKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIADIKAGKVEYRLDKTAIIHVPIGKKSFGEEKLTENYNVLMEAIVKAKPAAAKGQYIKSLSISSTMGPGVKI 225
>gi|11467612|ref|NP_050664.1| ribosomal protein L1 [Guillardia theta] >gi|6093980|sp|O78413|RK1_GUITH Chloroplast 50S ribosomal protein L1 >gi|3602937|gb|AAC35598.1| ribosomal protein L1 [Guillardia theta] (234 aa)
Score = 389, Expect = 9.5e-36, Identities = 96/227 (42%), Positives = 136/227 (59%)
  Q:     6 KVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           +V NK   KP         Y   EA+NL K T+ AKF+ S +  I L LDT  +DQQLR T+ LP   GK+ RI V+ +G    +A + G + AG ++L+ +I KG LDFD +I TP MMP ++KLGK+LG RGLMP+PK+G VT+D+   I EFKKG  +YR D  G +H+  GK N     ++ N+  +   I   R   VKG + +   + STMGP I++ +++
  S:    10 EVRNKIENKP---------YKAIEALNLLKDTATAKFVESAEAHIALKLDTKYADQQLRTTLVLPKGTGKKIRIAVIAEGEKATEAINAGADLAGSTDLVQDIMKGMLDFDRLIATPDMMPLIAKLGKVLGPRGLMPSPKSGTVTSDVKSAIEEFKKGKLEYRADKSGIVHISFGKTNFSVNDLLLNLEAVQESIDKNRPAGVKGKYWKSFYICSTMGPSIQLDISE 227
>gi|86137182|ref|ZP_01055760.1| 50S ribosomal protein L1 [Roseobacter sp. MED193] >gi|85826506|gb|EAQ46703.1| 50S ribosomal protein L1 [Roseobacter sp. MED193] (232 aa)
Score = 389, Expect = 9.7e-36, Identities = 88/206 (42%), Positives = 127/206 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           T+ EAV L K  + +KF  +I+IA+ L +DT  +DQ +RG V LP   GK  R+ V  +G    +AK+ G +  G  +L+  I  G LDFD  I TP MMP + +LGKILG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK+VEN++  +  +A  R +  KG +++K+ L+STMGPG+ + V+
  S:    22 TVAEAVALVKANATSKFDETIEIALNLGVDTRHADQMVRGVVGLPNGTGKTMRVAVFARGPKADEAKAAGADVIGAEDLMESIQAGNLDFDRCIATPDMMPIVGRLGKILGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQFKAEKGGVVHAGVGKASFDEAKLVENVSAFIDAVAKARPSGAKGAYMKKIVLTSTMGPGVTLDVD 227
>gi|17547756|ref|NP_521158.1| 50S ribosomal protein L1 [Ralstonia solanacearum GMI1000] >gi|33301575|sp|Q8XUZ5|RL1_RALSO 50S ribosomal protein L1 >gi|17430061|emb|CAD16746.1| probable 50s ribosomal subunit protein l1 (rrna-binding translation regulation repressor rna-binding) [Ralstonia solanacearum] (231 aa)
Score = 389, Expect = 9.9e-36, Identities = 87/209 (41%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +RTKFY I+EA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + AK+ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+ + + A +  N+  LL  ++  +  S KG+++ K+ +SSTMG G+R+
  S:    16 ERTKFYPIDEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQAKAAGAEIVGMEDLAEQIKAGNMDFDVVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRRSFEPAALKSNLAALLDALSKAKPASSKGVYLRKIAVSSTMGVGVRI 224
>gi|77165797|ref|YP_344322.1| ribosomal protein L1 [Nitrosococcus oceani ATCC 19707] >gi|91207363|sp|Q3J8Q4|RL1_NITOC 50S ribosomal protein L1 >gi|76884111|gb|ABA58792.1| LSU ribosomal protein L1P [Nitrosococcus oceani ATCC 19707] (231 aa)
Score = 389, Expect = 1.0e-35, Identities = 86/206 (41%), Positives = 127/206 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +EEA+NL K+ +  KF  S+D+A+ L +D  KSDQ +RG+  LP   GK  R+ V  +G+  + AK+ G +  G  +L   +  G +DFD+II +P  M  + +LG ILG RGLMPNPK G VTTD+   + + K G  +YRTD  G IH  +GK + +   + +N+  L+  +   +  S KGI+++K+ LS+TMGPGI V
  S:    19 KLYPVEEALNLLKEVAKVKFEESVDVAVNLGVDPRKSDQVVRGSTVLPNGLGKTVRVGVFTQGVNAEAAKNAGADVVGLEDLAETVKSGQIDFDVIIASPDAMRVVGQLGPILGPRGLMPNPKVGTVTTDVAGAVTKAKAGQVRYRTDKAGIIHCSIGKTSFEVDALKQNLRALVEDLGKLKPASAKGIYLKKLTLSTTMGPGIAV 224
>gi|159028395|emb|CAO89837.1| rplA [Microcystis aeruginosa PCC 7806] (237 aa)
Score = 389, Expect = 1.0e-35, Identities = 87/206 (42%), Positives = 128/206 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y   EA+ L K+ + AKF  + +  I+L +D   +DQQLR TVSLP   G+  R+ V+ +G   ++A + G +  G  ELI EI+KG +DF+++I TP MMP+++KLG+ LG RGLMP+PK G VTTDL   I+EFK G  ++R D  G +H+  GKA+     ++ N+  L   +   R +  KG +   V +SS+MGP I+V
  S:    19 KAYEPLEALTLLKELATAKFDETAEAHIRLGIDPKYTDQQLRTTVSLPKGTGRTVRVAVITRGEQVQEANNAGADIVGSEELIEEIAKGMMDFEVLIATPDMMPKVAKLGRQLGPRGLMPSPKGGTVTTDLTGAISEFKAGKLEFRADRTGIVHVQFGKASFSAEDLLVNLKALQETVDRNRPSGAKGRYWRTVYVSSSMGPSIQV 224
>gi|91977667|ref|YP_570326.1| 50S ribosomal protein L1 [Rhodopseudomonas palustris BisB5] >gi|123762618|sp|Q134R4|RL1_RHOPS 50S ribosomal protein L1 >gi|91684123|gb|ABE40425.1| LSU ribosomal protein L1P [Rhodopseudomonas palustris BisB5] (229 aa)
Score = 389, Expect = 1.0e-35, Identities = 85/219 (38%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  KK     DRTK Y ++EAV + K+ + +KF  +I++A+ L +D   +DQ +RG V LP   G+  R+ V  +G    +AK+ G +  G  +L+ ++  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G +   VGKA+    K+VENI  L   +   + T  KG +I++V +SS+MGPG++V
  S:     5 KRLKKAREGVDRTKLYPLDEAVKMVKERATSKFDETIEVALNLGVDPRHADQMVRGVVMLPNGTGRTLRVGVFARGAKADEAKAAGADVVGAEDLVEQVQGGNINFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVKGAKGGSVEFRVEKAGIVQAGVGKASFTEEKLVENIKALADAVTKAKPTGAKGTYIQRVAVSSSMGPGVKV 223
>gi|149913531|ref|ZP_01902064.1| 50S ribosomal protein L1 [Roseobacter sp. AzwK-3b] >gi|149812651|gb|EDM72480.1| 50S ribosomal protein L1 [Roseobacter sp. AzwK-3b] (232 aa)
Score = 388, Expect = 1.1e-35, Identities = 84/209 (40%), Positives = 131/209 (62%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           ++EEAV L K  +NAKF  +++I++ L +D   +DQ +RG V LP   GK+ R+ V  +G   ++A++ G +  G  +L+  I  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK+VEN+   ++ +A  +    KG +++K++L+STMGPG+ + V+  A
  S:    22 SVEEAVALIKANANAKFDETVEISMNLGVDPRHADQMVRGVVGLPNGTGKDVRVAVFARGAKAEEAQAAGADIVGAEDLMETIQGGKIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVGDAVKAAKGGEVQFKAEKAGVVHAGVGKASFDDAKLVENVRAFVTAVAKAKPAGAKGTYMKKISLTSTMGPGVSIDVSNAA 230
>gi|187918258|ref|YP_001883821.1| LSU ribosomal protein L1P [Borrelia hermsii DAH] >gi|119861106|gb|AAX16901.1| LSU ribosomal protein L1P [Borrelia hermsii DAH] (224 aa)
Score = 388, Expect = 1.1e-35, Identities = 90/209 (43%), Positives = 134/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ K Y+I++A++L K+    KF  +ID++I LNL   K +  +R TV LP  F KEKRILV  KG   ++AK  G  + GD +LI ++  G+ DFD+++ TP MM ++ KLG ILG RGLMPNPK   +T DL  TIA  KKG  ++R +  G ++  VGK++ D  KI EN +  +  +  +R + +KG F++ V +SSTMGP +++
  S:    16 DKLKSYSIDDAISLLKEIKFVKFDETIDVSINLNL---KKNHTVRDTVVLPNQFMKEKRILVFAKGDRAQEAKEAGAAYVGDDDLINKVKGGFSDFDIVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIAGLKKGRTEFRANKNGVLNFSVGKSSMDNKKIKENYDEFIKELLKRRPSDLKGTFVDSVYISSTMGPSVKI 221
>gi|170696793|ref|ZP_02887901.1| ribosomal protein L1 [Burkholderia graminis C4D1M] >gi|170138294|gb|EDT06514.1| ribosomal protein L1 [Burkholderia graminis C4D1M] (232 aa)
Score = 388, Expect = 1.1e-35, Identities = 85/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I++A++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  ++  G LDFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ KV LSSTMG G+RV
  S:    16 DRQKLYPIDDALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQVKAGNLDFDIVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRSNLSALIDALQKAKPATSKGVYLRKVALSSTMGVGVRV 224
>gi|86749398|ref|YP_485894.1| 50S ribosomal protein L1 [Rhodopseudomonas palustris HaA2] >gi|123408231|sp|Q2IXS7|RL1_RHOP2 50S ribosomal protein L1 >gi|86572426|gb|ABD06983.1| LSU ribosomal protein L1P [Rhodopseudomonas palustris HaA2] (229 aa)
Score = 388, Expect = 1.3e-35, Identities = 85/219 (38%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  KK     DRTK Y ++EAV + K+ + +KF  +I++A+ L +D   +DQ +RG V LP   G+  R+ V  +G    +AK+ G +  G  +L+ ++  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G +   VGKA+    K+VENI  L   +   + T  KG +I++V +SS+MGPG++V
  S:     5 KRLKKAREGIDRTKLYPLDEAVKMVKERAVSKFDETIEVALNLGVDPRHADQMVRGVVMLPNGTGRTVRVGVFARGAKADEAKAAGADVVGAEDLVEQVQAGNINFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVKGAKGGSVEFRVEKAGIVQAGVGKASFSEEKLVENIKALADAVTKAKPTGAKGTYIQRVAVSSSMGPGVKV 223
>gi|33866872|ref|NP_898431.1| 50S ribosomal protein L1 [Synechococcus sp. WH 8102] >gi|61215689|sp|Q7U3T7|RL1_SYNPX 50S ribosomal protein L1 >gi|33639473|emb|CAE08857.1| 50S ribosomal protein L1 [Synechococcus sp. WH 8102] (235 aa)
Score = 388, Expect = 1.3e-35, Identities = 84/206 (40%), Positives = 128/206 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           + Y   EA+ L K  + AKF  +++  ++L +D   +DQQLR TV+LP   G+  RI V+ +G    +AK+ G   AGD +L+  I+KG ++FDL+I TP MMP+++KLG++LG RGLMPNPK G VT DL   I EFK G  ++R D  G +H+  GKA+     +++N+  L   I   + +  KG + + + ++STMGP + V
  S:    18 RVYEPLEAIALVKDNATAKFDETMEAHVRLGIDPKYTDQQLRTTVALPNGTGQTVRIAVVTRGEKVAEAKAAGAELAGDEDLVETIAKGEMEFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTIDLAGAIQEFKAGKLEFRADRTGIVHVRFGKASFTAEALLQNLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEV 223
>gi|163726944|ref|ZP_02134448.1| ribosomal protein L1 [Desulfatibacillum alkenivorans AK-01] >gi|161399823|gb|EDQ24087.1| ribosomal protein L1 [Desulfatibacillum alkenivorans AK-01] (234 aa)
Score = 388, Expect = 1.3e-35, Identities = 80/209 (38%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +R   Y + EA+  A ++S AKF  ++D+A++L +D   +DQ +RGT  LP+  GK+ R+LV  KG  + +AK  G +  G+ +L+ +I  GWLDFD  I TP MM  + K+G+ILG RGLMPN K G VT D+ K + E K G   +R +  G +H  +GK +    K+++NI+     +   + ++ KG +++ + +S+TMGPG+++
  S:    16 NRDLKYGVLEALQTAIESSYAKFDETVDVAVRLGVDPRHADQMVRGTCVLPHGTGKDVRVLVFAKGEKEAEAKEAGADFVGNDDLVEKIQGGWLDFDKAIATPDMMGTVGKMGRILGPRGLMPNAKTGTVTFDVAKAVQELKAGKIDFRVERAGILHAPMGKVSFGAEKLLDNISAFFETVQRLKPSAAKGTYMKSIAVSTTMGPGVKI 224
>gi|163745523|ref|ZP_02152883.1| 50S ribosomal protein L1 [Oceanibulbus indolifex HEL-45] >gi|161382341|gb|EDQ06750.1| 50S ribosomal protein L1 [Oceanibulbus indolifex HEL-45] (232 aa)
Score = 388, Expect = 1.3e-35, Identities = 88/209 (42%), Positives = 128/209 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV-NKTA 234
           T+EEAV+L K  +NAKF  +I+IA+ L +D   +DQ +RG V LP   GK  R+ V  +G   ++A+  G +  G  +L+  +  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  +GK + D AK+ ENI   +  ++  +    KG +++K+NLSSTMGPG+ V V N TA
  S:    22 TVEEAVSLIKANANAKFDETIEIAMNLGVDPRHADQMVRGVVGLPNGTGKTMRVAVFARGAKAEEAEKAGADIVGAEDLMESVQSGKIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVADAVKAAKGGEVQFKAEKGGVVHAGIGKLSFDEAKLAENIRAFVGAVSKAKPAGAKGTYMKKINLSSTMGPGVSVAVENATA 231
>gi|153887308|ref|ZP_02008460.1| ribosomal protein L1 [Ralstonia pickettii 12D] >gi|187930384|ref|YP_001900871.1| ribosomal protein L1 [Ralstonia pickettii 12J] >gi|151576396|gb|EDN40800.1| ribosomal protein L1 [Ralstonia pickettii 12D] >gi|187727274|gb|ACD28439.1| ribosomal protein L1 [Ralstonia pickettii 12J] (231 aa)
Score = 387, Expect = 1.4e-35, Identities = 89/209 (42%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +RTKFY I+EA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + AK+ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+ + + A +  N+  LL  +   +  S KG+++ KV +SSTMG G+RV
  S:    16 ERTKFYPIDEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGDKAEQAKAAGAEIVGMEDLAEQIKAGKMDFDVVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRRSFEPAALKSNLAALLDALTKAKPASSKGVYLRKVAVSSTMGVGVRV 224
>gi|110634172|ref|YP_674380.1| 50S ribosomal protein L1 [Mesorhizobium sp. BNC1] >gi|123353586|sp|Q11HB0|RL1_MESSB 50S ribosomal protein L1 >gi|110285156|gb|ABG63215.1| LSU ribosomal protein L1P [Mesorhizobium sp. BNC1] (232 aa)
Score = 387, Expect = 1.5e-35, Identities = 81/209 (38%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR +FY ++EAV + K+ + AKF  +I++A+ L +D   +DQ +RG V+LP   G+  R+ V  KG    +AK+ G +  G  +L+  + KG ++FD  I TP MMP + +LGK+LG RGLMPNPK G VTTD+   +   K G  ++R +  G +H  VGK + D   I EN+      +   + +  KG ++++V+++STMGPG+++
  S:    16 DRNRFYPLDEAVKVIKERATAKFDETIEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFAKGDKADEAKAAGADIVGAEDLVETVQKGEINFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTTDVAAAVKASKGGAVEFRVEKAGIVHAGVGKVSFDENAIAENVRAFADAVIKAKPSGAKGNYLKRVSITSTMGPGLKI 224
>gi|167838222|ref|ZP_02465081.1| 50S ribosomal protein L1 [Burkholderia thailandensis MSMB43] (232 aa)
Score = 387, Expect = 1.6e-35, Identities = 84/209 (40%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I++A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYPIDDALALVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRTNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|153005085|ref|YP_001379410.1| 50S ribosomal protein L1 [Anaeromyxobacter sp. Fw109-5] >gi|166219565|sp|A7HCI0|RL1_ANADF 50S ribosomal protein L1 >gi|152028658|gb|ABS26426.1| ribosomal protein L1 [Anaeromyxobacter sp. Fw109-5] (234 aa)
Score = 387, Expect = 1.6e-35, Identities = 82/215 (38%), Positives = 135/215 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DR K Y ++EA++L KQT+  KF  ++D AI L +D   +DQ +RG V LP+  GK  +I V  KG   ++A+  G +  G  +L  ++  G++DFD ++ TP MM  + +LGK+LG RGLMPNPK G V+ D+ + + E K G  ++R +  G +H+  GKA+ +  K+  N + ++  I   +  + KG++++ V LS+TMGPGI++ +++ A
  S:    16 DRVKRYKLDEAMSLVKQTATKKFDETVDAAINLGVDPKHADQVVRGAVVLPHGMGKAVKIAVFAKGDKAREAQEAGADIVGAEDLAEKVQGGFMDFDKVLATPDMMGVVGRLGKVLGPRGLMPNPKVGTVSADIARAVKEQKAGKVEFRVEKAGIVHVPFGKASFEPEKLKANFSAIMEIIYKAKPQTAKGVYVKNVTLSTTMGPGIKLDLSELA 230
>gi|160944616|ref|ZP_02091843.1| hypothetical protein FAEPRAM212_02129 [Faecalibacterium prausnitzii M21/2] >gi|158443800|gb|EDP20804.1| hypothetical protein FAEPRAM212_02129 [Faecalibacterium prausnitzii M21/2] (230 aa)
Score = 387, Expect = 1.7e-35, Identities = 90/216 (41%), Positives = 137/216 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           D TK Y + EA+ LA +T++AKF  ++++ ++L +D   +DQQ+RG V LP   GK  R+  + KG     A++ G +  GD ELIA+I+ G++DFD+++TTP MM  + +LGK+LG RGLMPNPK G V  DL K ++E K G  +YR D    IH+ VGKA+    K+  N++ ++  IA  +  + KG + +   +++TMGPGIR+   K  V
  S:    15 DSTKAYDVNEALELACKTASAKFDETVELHVRLGVDGRHADQQVRGAVVLPNGTGKTVRVCAIAKGPAAAAAEAAGADIVGDDELIAKIAGGFMDFDVVVTTPDMMGRVGRLGKVLGPRGLMPNPKAGTVAPDLGKAVSEAKAGKIEYRLDKQNIIHVPVGKASFGAEKLYTNLDTVMEAIAKAKPAAAKGTYFKSATIATTMGPGIRLNTLKYGV 230
>gi|119953183|ref|YP_945392.1| LSU ribosomal protein L1P [Borrelia turicatae 91E135] >gi|119861954|gb|AAX17722.1| LSU ribosomal protein L1P [Borrelia turicatae 91E135] (224 aa)
Score = 386, Expect = 1.9e-35, Identities = 87/209 (41%), Positives = 134/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ K Y+I++A++L K+    KF  +ID+++ LNL   K +  +R TV LP  F +EKRILV  KG   ++A+  G  + GD +LI ++  G+ DFD+++ TP MM ++ KLG ILG RGLMPNPK   +T DL  TIA  KKG  ++R +  G I+  VGK++ D  K+ EN +  +  +  +R + +KG F++ V +SSTMGP +++
  S:    16 DKLKSYSIDDAISLLKEIKFVKFDETIDVSVNLNL---KKNHTVRDTVVLPNQFMREKRILVFAKGDKAEEAREAGAVYVGDDDLINKVKGGFSDFDVVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIASLKKGRTEFRANKNGVINFSVGKSSMDNNKVKENYDEFIKELLKRRPSDLKGTFVDSVYMSSTMGPSVKI 221
>gi|15896395|ref|NP_349744.1| 50S ribosomal protein L1 [Clostridium acetobutylicum ATCC 824] >gi|33301464|sp|Q97EG6|RL1_CLOAB 50S ribosomal protein L1 >gi|15026213|gb|AAK81084.1|AE007810_3 Ribosomal protein L1 [Clostridium acetobutylicum ATCC 824] (229 aa)
Score = 386, Expect = 1.9e-35, Identities = 88/209 (42%), Positives = 136/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+   Y  +EAV+L  +TS AKF  ++++A++L +D   +DQQ+RG V LP   GK+ R+LV  KG   K+A++ G ++ G  EL  +I S+ W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K + E K G  +YR D    +H+ VGK++    K+ +N + L+  I   +  S KG +++ V LSSTMGPGI++
  S:    13 DKNTLYAPDEAVDLVVKTSKAKFDETVELAVRLGVDPRHADQQVRGVVILPNGTGKKVRVLVFAKGDKAKEAEAAGADYVGAEELATKIQSENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKALTEIKAGKVEYRVDKTAIVHVPVGKSSFGAEKLKQNFHALMDAIVKAKPASAKGQYVKSVALSSTMGPGIKI 222
>gi|88607420|ref|YP_505586.1| 50S ribosomal protein L1 [Anaplasma phagocytophilum HZ] >gi|123494573|sp|Q2GJ65|RL1_ANAPZ 50S ribosomal protein L1 >gi|88598483|gb|ABD43953.1| ribosomal protein L1 [Anaplasma phagocytophilum HZ] (216 aa)
Score = 386, Expect = 1.9e-35, Identities = 87/210 (41%), Positives = 125/210 (59%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGW-LDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
            D+   YT EE ++   +++ A+F  S+D+AIKL+   S+S   +RG   LP   G+E R+ VL KG   K AK  G +  GDS+LI EI KG  LDFD  I TP  M ++S + KILG RGLMPNPK G VT D+ K +   K G  ++R+D YG +H+ +G        ++EN+  ++S +   +  +VKG F + V L+STMG   R+
  S:     2 LDKNIVYTPEEGIDQLLKSTTARFKESVDVAIKLSTGDSRSGDSIRGVAVLPKGLGREVRVAVLAKGEYAKQAKDAGADVVGDSDLIEEIKKGRKLDFDWCIATPDFMSQVSAIAKILGPRGLMPNPKFGTVTFDIAKMVGIVKSGQVRFRSDKYGIVHVKIGDVGFSREDLMENLRAVVSAVQGLKPATVKGAFFKAVFLNSTMGKSFRI 212
>gi|170017872|ref|YP_001728791.1| ribosomal protein L1 [Leuconostoc citreum KM20] >gi|169804729|gb|ACA83347.1| Ribosomal protein L1 [Leuconostoc citreum KM20] (230 aa)
Score = 386, Expect = 1.9e-35, Identities = 84/209 (40%), Positives = 137/209 (65%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           K Y + +AV L K+   A F +S+++A KLN+DT ++DQQLRG V LP   GK+K+++V  +G   K+A++ G +  G ++L+A+I  GW+DFD  I TP MM ++ ++ +ILG +G+MPNPK G VT D+ K +++ K G   YRTD  GN+ + VG+ + +  K+ ENI  +   +   R  +VKG +++ V+++ST GP + + +N
  S:    20 KNYALNDAVALVKEIDYANFDASVEVAFKLNVDTRQADQQLRGAVVLPNGTGKDKKVIVFAQGDKAKEAEAAGADVVGAADLVAQIQGGWMDFDTAIATPDMMAQVGRVARILGPKGMMPNPKTGTVTMDVAKAVSDAKGGQVTYRTDRDGNVAVPVGRVSFEEGKLAENIKTIADTVLKARPAAVKGTYVQHVSIASTFGPAVALDLN 228
>gi|152998281|ref|YP_001343116.1| ribosomal protein L1 [Marinomonas sp. MWYL1] >gi|189041822|sp|A6W3A2|RL1_MARMS 50S ribosomal protein L1 >gi|150839205|gb|ABR73181.1| ribosomal protein L1 [Marinomonas sp. MWYL1] (233 aa)
Score = 386, Expect = 1.9e-35, Identities = 86/209 (41%), Positives = 125/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           + TK Y++EEAV L  + S  KF  SID+++ L +D  KSDQ +RG+  LP+  GK+ R+ V  +G   + AK  G +  G  +L  ++  G LDFD++I +P  M  + +LG++LG RGLMPNPK G VT D+   +   K G  +YRTD  G IH  VG        I  N+  LL+ +   +  S KG+++ KV LSSTMGPG+++
  S:    16 EATKLYSVEEAVALLSELSTVKFKESIDVSVNLGVDPRKSDQVVRGSTVLPHGAGKDVRVAVFAQGANAEAAKEAGADVVGFEDLAEQVKAGNLDFDVVIASPDAMRIVGQLGQVLGPRGLMPNPKVGTVTPDVATAVRNAKAGQARYRTDKNGIIHAAVGSIEFAADAIRGNLEALLTDLRRAKPASSKGVYLRKVTLSSTMGPGLQI 224
>gi|157412561|ref|YP_001483427.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9215] >gi|166984548|sp|A8G2L0|RL1_PROM2 50S ribosomal protein L1 >gi|157387136|gb|ABV49841.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9215] (235 aa)
Score = 386, Expect = 1.9e-35, Identities = 86/209 (41%), Positives = 131/209 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           + Y   EA+++ K+ +NAKF  +I+  I+L +D   +DQQLR TV+LP+  G+  RI V+  G     AKS G +  G+ +L+  I+KG ++FDL+I TP MMP+++KLG++LG RGLMPNPK G VT D+   I EFK G  ++R D  G +H+  GKA+     + EN+  L   I   + +  KG + +   ++STMGP ++V +N
  S:    18 RIYAPLEALSIIKENANAKFDETIEAHIRLGIDPKYTDQQLRTTVALPHGTGQSIRIAVITSGENVSKAKSAGADLFGEEDLVESINKGNMEFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTNDIGNAIKEFKAGKLEFRADKAGIVHVRFGKASFTKEALFENLKTLQESIDKNKPSGAKGKYWKSFYVTSTMGPSVQVDIN 226
>gi|149203667|ref|ZP_01880636.1| 50S ribosomal protein L1 [Roseovarius sp. TM1035] >gi|149142784|gb|EDM30826.1| 50S ribosomal protein L1 [Roseovarius sp. TM1035] (232 aa)
Score = 386, Expect = 1.9e-35, Identities = 84/217 (38%), Positives = 130/217 (59%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           FD     ++E+A+ L K  + AKF  +++I++ L +D   +DQ +RG V LP   GK  R+ V  +G    +A++ G +  G  +L+  I  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+ + + + K G  Q++ +  G +H  +GKA+ D AK+ EN+   +S +   + T  KG +++K++LSSTMG G+ V VN   V
  S:    15 FDGKDNMSVEDAIALIKGNATAKFDETVEISMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGTKADEAQAAGADIVGAEDLMETIQSGKIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKIGTVTMDVAQAVKDAKGGQVQFKAEKAGVVHAGIGKASFDAAKLAENVRAFVSAVQRAKPTGAKGTYVKKISLSSTMGAGVTVDVNSAVV 231
>gi|27380525|ref|NP_772054.1| 50S ribosomal protein L1 [Bradyrhizobium japonicum USDA 110] >gi|33301443|sp|Q89J70|RL1_BRAJA 50S ribosomal protein L1 >gi|27353689|dbj|BAC50679.1| 50S ribosomal protein L1 [Bradyrhizobium japonicum USDA 110] (230 aa)
Score = 386, Expect = 1.9e-35, Identities = 84/209 (40%), Positives = 127/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y + EA+ + K+ + AKF  +I++AI L +D   +DQ +RG V+LP   G+  R+ V  +G    +AK+ G +  G  +L+ ++  G +DFD  I TP MMP + +LGK+LG RGLMPNPK G VT D+   +   K G  ++R +  G +   VGKA+    K+VENI  L   ++  +    KG +I++V +SSTMGPG++V
  S:    15 DREKLYPLAEAIKMVKERAKAKFDETIEVAINLGVDPRHADQMVRGVVTLPNGTGRTLRVGVFARGAKADEAKAAGADVVGAEDLVEKVQNGSIDFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKIGTVTMDVTGAVKGAKGGSVEFRVEKAGILQAGVGKASFSEEKLVENIKALADAVSKAKPAGSKGTYIQRVAVSSTMGPGVKV 223
>gi|75908767|ref|YP_323063.1| 50S ribosomal protein L1 [Anabaena variabilis ATCC 29413] >gi|91207340|sp|Q3MA18|RL1_ANAVT 50S ribosomal protein L1 >gi|75702492|gb|ABA22168.1| LSU ribosomal protein L1P [Anabaena variabilis ATCC 29413] (238 aa)
Score = 386, Expect = 2.0e-35, Identities = 86/203 (42%), Positives = 127/203 (62%)
  Q:    29 EAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +A++L K+T+ AKF  + +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A + G +  G  ELI EI KG +DFD +I TP +MP+++KLGK+LG RGLMP+PK G VT D+   IAEFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +     +S+TMGP IRV +N
  S:    25 DALSLLKETATAKFAEAAEAHIRLGIDPKYTDQQLRTTVALPKGTGQIVRVAVIARGEKVTEASNAGADVFGSEELIDEIQKGRMDFDKLIATPDVMPQVAKLGKMLGPRGLMPSPKGGTVTFDIASAIAEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLVNLKALQETIDRNRPSGAKGRYWRTFYVSATMGPSIRVDIN 227
>gi|154253167|ref|YP_001413991.1| ribosomal protein L1 [Parvibaculum lavamentivorans DS-1] >gi|171769620|sp|A7HWQ1|RL1_PARL1 50S ribosomal protein L1 >gi|154157117|gb|ABS64334.1| ribosomal protein L1 [Parvibaculum lavamentivorans DS-1] (233 aa)
Score = 386, Expect = 2.1e-35, Identities = 87/219 (39%), Positives = 130/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  +K     DR K Y ++EAV + K  ++ KF  +I++AI L +D   +DQ +RG V+LP   G+  R+ V  KG     A++ G +  GD +L   +  G +DFD  I TP MMP + +LGK+LG RGLMPNPK G VT D+ + +   K G  ++R +  G IH  VGKA+    +I+ NI  L+  +   + T  KG +I+++ +SSTMGPG++V
  S:     6 KRIEKAREGIDRKKTYGLDEAVKMVKDRASVKFDETIEVAIALGVDPRHADQMVRGVVALPSGSGRTVRVAVFAKGDKADQARAAGADIVGDDDLAEIVQSGKIDFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTPDVAEAVKAAKGGAVEFRVEKAGIIHAGVGKASFSEDQILVNIRALIDAVQKAKPTGAKGTYIKRIAISSTMGPGVKV 224
>gi|127511082|ref|YP_001092279.1| ribosomal protein L1 [Shewanella loihica PV-4] >gi|160166309|sp|A3Q972|RL1_SHELP 50S ribosomal protein L1 >gi|126636377|gb|ABO22020.1| LSU ribosomal protein L1P [Shewanella loihica PV-4] (233 aa)
Score = 386, Expect = 2.2e-35, Identities = 84/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           + TK Y I EAV L K+ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G     AK  G    G  EL A++  G ++FD++I +P  M  + +LG+ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK + +  ++ EN++ LL  +   +  + KG+F++KV++S+TMG G+ V
  S:    16 EATKSYDINEAVALLKELATAKFVESVDVAVNLGVDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANADAAKEAGAELVGMDELAAQVKAGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFEPVQLKENLDALLGALIKAKPAAAKGVFVKKVSISTTMGAGVAV 224
>gi|78188332|ref|YP_378670.1| 50S ribosomal protein L1 [Chlorobium chlorochromatii CaD3] >gi|91207346|sp|Q3ATP8|RL1_CHLCH 50S ribosomal protein L1 >gi|78170531|gb|ABB27627.1| LSU ribosomal protein L1P [Chlorobium chlorochromatii CaD3] (229 aa)
Score = 386, Expect = 2.2e-35, Identities = 86/226 (38%), Positives = 136/226 (60%)
  Q:     7 VTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           +  K  ++ +   +R + Y + EA+   K+ +  KF +++D+A+KL +D   +DQ +RGTV LP+  GK   +LV+ K    ++AK  G +  G  E I +I +GW   D+II TP +M +L K+ KILG RGLMPNPK+G VT D+ K + E K G  ++R D  GNIH  VGK + D+  +  NI   L  +   + ++ KG +++ + LSSTM P ++V ++K
  S:     1 MAGKKYREAATKIERFRDYELAEAIEKVKEVTTTKFDATVDVAVKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVICKETKAEEAKEAGADFVGFEEYITKIQEGWTGVDVIIATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRVDKAGNIHAPVGKVSFDSEHLNTNIVAFLKEVVRLKPSAAKGQYVQGIALSSTMSPSVKVKMDK 226
>gi|83949810|ref|ZP_00958543.1| 50S ribosomal protein L1 [Roseovarius nubinhibens ISM] >gi|83837709|gb|EAP77005.1| 50S ribosomal protein L1 [Roseovarius nubinhibens ISM] (232 aa)
Score = 386, Expect = 2.2e-35, Identities = 84/209 (40%), Positives = 129/209 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           ++EEAV L K  + AKF  +I+IA+ L +D   +DQ +RG + LP   GK+ R+ V  +G    +AK  G +  G  +L+  +  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+ + +   K G  Q++ +  G +H  VGKA+ D AK+VEN+   ++ +A  + +  KG +++K++L+STMGPG+ + V   A
  S:    22 SVEEAVALVKANAKAKFDETIEIAVNLGVDPRHADQMVRGVIGLPNGTGKDVRVAVFARGAKADEAKEAGADIVGAEDLMETVQNGTIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVAQAVKGAKGGEVQFKAEKAGVVHAGVGKASFDEAKLVENVRAFINAVAKAKPSGAKGAYMKKISLTSTMGPGVTIDVATAA 230
>gi|110833236|ref|YP_692095.1| 50S ribosomal protein L1 [Alcanivorax borkumensis SK2] >gi|123345815|sp|Q0VSM5|RL1_ALCBS 50S ribosomal protein L1 >gi|110646347|emb|CAL15823.1| 50S ribosomal protein L1 [Alcanivorax borkumensis SK2] (231 aa)
Score = 386, Expect = 2.3e-35, Identities = 87/206 (42%), Positives = 124/206 (60%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +EEAV L  + S  KF  S+D+A+ L +D  KSDQ +RG   LP+  GK  R+ V  +G   ++AK  G +  G  +L  ++  G ++FD++I +P  M  + KLG ILG RGLMPNPK G VT D+ + +   K G  +YRTD  G IH  VG+   DT  I EN+  L++ +   + +S KG F +KV LS+TMGPG+ +
  S:    19 KLYPVEEAVALLAELSAVKFKESVDVAVNLGVDPRKSDQNVRGASVLPHGTGKTVRVAVFAQGAKAEEAKEAGADVVGFDDLAEQVQGGEINFDVVIASPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAQAVKNAKGGQVRYRTDKGGIIHCTVGQVGFDTNAIKENVEALIADLKKAKPSSAKGTFFKKVTLSTTMGPGLSI 224
>gi|53720832|ref|YP_109818.1| 50S ribosomal protein L1 [Burkholderia pseudomallei K96243] >gi|53723865|ref|YP_104177.1| 50S ribosomal protein L1 [Burkholderia mallei ATCC 23344] >gi|67640301|ref|ZP_00439113.1| COG0081: Ribosomal protein L1 [Burkholderia mallei GB8 horse 4] >gi|76811593|ref|YP_335153.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1710b] >gi|83719781|ref|YP_443583.1| 50S ribosomal protein L1 [Burkholderia thailandensis E264] >gi|121601256|ref|YP_994468.1| 50S ribosomal protein L1 [Burkholderia mallei SAVP1] >gi|124384109|ref|YP_001027882.1| 50S ribosomal protein L1 [Burkholderia mallei NCTC 10229] >gi|126439404|ref|YP_001060761.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 668] >gi|126450507|ref|YP_001082978.1| 50S ribosomal protein L1 [Burkholderia mallei NCTC 10247] >gi|126452892|ref|YP_001068049.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1106a] >gi|134283316|ref|ZP_01770017.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 305] >gi|161358168|ref|ZP_02104041.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1106b] >gi|161375476|ref|ZP_02115006.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1710a] >gi|167003567|ref|ZP_02269353.1| 50S ribosomal protein L1 [Burkholderia mallei PRL-20] >gi|167582633|ref|ZP_02375507.1| 50S ribosomal protein L1 [Burkholderia thailandensis TXDOH] >gi|167620747|ref|ZP_02389378.1| 50S ribosomal protein L1 [Burkholderia thailandensis Bt4] >gi|167721587|ref|ZP_02404823.1| 50S ribosomal protein L1 [Burkholderia pseudomallei DM98] >gi|167740561|ref|ZP_02413335.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 14] >gi|167817766|ref|ZP_02449446.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 91] >gi|167826163|ref|ZP_02457634.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 9] >gi|167847675|ref|ZP_02473183.1| 50S ribosomal protein L1 [Burkholderia pseudomallei B7210] >gi|167896247|ref|ZP_02483649.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 7894] >gi|167904629|ref|ZP_02491834.1| 50S ribosomal protein L1 [Burkholderia pseudomallei NCTC 13177] >gi|167912894|ref|ZP_02499985.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 112] >gi|167920854|ref|ZP_02507945.1| 50S ribosomal protein L1 [Burkholderia pseudomallei BCC215] >gi|194316550|ref|YP_002012538.1| 50S ribosomal protein L1 [Burkholderia mallei ATCC 10399] >gi|194504982|ref|YP_002034553.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1655] >gi|194508591|ref|YP_002021124.1| 50S ribosomal protein L1 [Burkholderia pseudomallei Pasteur 52237] >gi|194514122|ref|YP_002049730.1| 50S ribosomal protein L1 [Burkholderia pseudomallei S13] >gi|194523134|ref|YP_002058666.1| 50S ribosomal protein L1 [Burkholderia mallei FMH] >gi|194528123|ref|YP_002063645.1| 50S ribosomal protein L1 [Burkholderia mallei JHU] >gi|194567758|ref|YP_002102766.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 406e] >gi|194575873|ref|YP_002110756.1| 50S ribosomal protein L1 [Burkholderia mallei 2002721280] >gi|123536215|sp|Q2SU16|RL1_BURTA 50S ribosomal protein L1 >gi|160165733|sp|A3MRU2|RL1_BURM7 50S ribosomal protein L1 >gi|160165736|sp|A2S7G3|RL1_BURM9 50S ribosomal protein L1 >gi|160165741|sp|A1V8B5|RL1_BURMS 50S ribosomal protein L1 >gi|160165745|sp|A3P0C8|RL1_BURP0 50S ribosomal protein L1 >gi|160165749|sp|A3NEJ0|RL1_BURP6 50S ribosomal protein L1 >gi|61214593|sp|Q62GJ4|RL1_BURMA 50S ribosomal protein L1 >gi|61214597|sp|Q63Q00|RL1_BURPS 50S ribosomal protein L1 >gi|91207343|sp|Q3JMQ0|RL1_BURP1 50S ribosomal protein L1 >gi|52211246|emb|CAH37235.1| 50S ribosomal protein L1 [Burkholderia pseudomallei K96243] >gi|52427288|gb|AAU47881.1| ribosomal protein L1 [Burkholderia mallei ATCC 23344] >gi|76581046|gb|ABA50521.1| ribosomal protein L1 [Burkholderia pseudomallei 1710b] >gi|83653606|gb|ABC37669.1| ribosomal protein L1 [Burkholderia thailandensis E264] >gi|121230066|gb|ABM52584.1| 50S ribosomal protein L1 [Burkholderia mallei SAVP1] >gi|124292129|gb|ABN01398.1| 50S ribosomal protein L1 [Burkholderia mallei NCTC 10229] >gi|126218897|gb|ABN82403.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 668] >gi|126226534|gb|ABN90074.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1106a] >gi|126243377|gb|ABO06470.1| 50S ribosomal protein L1 [Burkholderia mallei NCTC 10247] >gi|134245511|gb|EBA45604.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 305] >gi|147747144|gb|EDK54220.1| 50S ribosomal protein L1 [Burkholderia mallei FMH] >gi|147752133|gb|EDK59199.1| 50S ribosomal protein L1 [Burkholderia mallei JHU] >gi|148026194|gb|EDK84279.1| 50S ribosomal protein L1 [Burkholderia mallei 2002721280] >gi|157810605|gb|EDO87775.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 406e] >gi|157937967|gb|EDO93637.1| 50S ribosomal protein L1 [Burkholderia pseudomallei Pasteur 52237] >gi|160695705|gb|EDP85675.1| 50S ribosomal protein L1 [Burkholderia mallei ATCC 10399] >gi|169655169|gb|EDS87862.1| 50S ribosomal protein L1 [Burkholderia pseudomallei S13] >gi|184210869|gb|EDU07912.1| 50S ribosomal protein L1 [Burkholderia pseudomallei 1655] (232 aa)
Score = 386, Expect = 2.3e-35, Identities = 84/209 (40%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I++A+ L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+A+ +   +  N++ L+  +   +  + KG+++ K+ LSSTMG G+RV
  S:    16 DRQKLYPIDDALALVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRTNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRV 224
>gi|167748129|ref|ZP_02420256.1| hypothetical protein ANACAC_02873 [Anaerostipes caccae DSM 14662] >gi|167652121|gb|EDR96250.1| hypothetical protein ANACAC_02873 [Anaerostipes caccae DSM 14662] (238 aa)
Score = 385, Expect = 2.7e-35, Identities = 89/215 (41%), Positives = 137/215 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DRTK Y ++EAV++ K+ +NAKF  +I+  ++L +D  ++DQQ+RG V LP+  GK+ R+LV  K    ++AK+ G  + G  ELI +I K  W DFD+++ TP MM  + +LG+ LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ VGKA+    ++ +N   L+  I   + ++ KG + + V ++STMGPG+++   K A
  S:    23 DRTKLYDVQEAVSVVKKAANAKFDETIEAHLRLGVDGRQADQQIRGAVVLPHGTGKKVRVLVFAKDAKAEEAKAAGAEYVGAEELIPKIQKENWFDFDVVVATPDMMGIVGRLGRDLGPKGLMPNPKAGTVTMDVTKAIEDIKAGKIEYRLDKNNIIHVPVGKASFTEEQLADNFQTLIDAIIKAKPSAAKGQYFKNVTITSTMGPGVKIDTGKFA 238
>gi|154500411|ref|ZP_02038449.1| hypothetical protein BACCAP_04078 [Bacteroides capillosus ATCC 29799] >gi|150270916|gb|EDM98199.1| hypothetical protein BACCAP_04078 [Bacteroides capillosus ATCC 29799] (230 aa)
Score = 385, Expect = 2.9e-35, Identities = 79/219 (36%), Positives = 134/219 (61%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  ++ +   D+   Y   EA+NL  +T+ AKF  ++++ +KL +D+  +DQQ+RG + LP+  GK  R+LV  KG   + A+  G ++ G+ +++ +I +  W D+D+++ +P MM  + +LGK+LG +GLMP+PK G VT D+ K + E K G  +YR D    IH  +GK +    K+ EN N L+  I   + ++ KG +I    ++STMGPG+++
  S:     5 KKYQESAKQIDKAALYDTAEAMNLVVKTAPAKFDETVELHVKLGVDSRHADQQVRGAIVLPHGTGKTARVLVFAKGDKAEAAREAGADYVGEMDMVQKIQQENWFDYDVVVASPDMMGVVGRLGKVLGPKGLMPSPKAGTVTPDVAKAVKEIKAGKVEYRLDKTNIIHCPIGKVSFGAEKLTENFNALMGAIVKAKPSAAKGQYIRSCVVASTMGPGVKI 224
>gi|88713025|ref|ZP_01107109.1| 50S ribosomal protein L1 [Flavobacteriales bacterium HTCC2170] >gi|88708406|gb|EAR00642.1| 50S ribosomal protein L1 [Flavobacteriales bacterium HTCC2170] (230 aa)
Score = 385, Expect = 2.9e-35, Identities = 85/219 (38%), Positives = 134/219 (61%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     DR K Y+++E   L K+ +NAKF +SID+A++L +D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G ++ G  E + +I  GW D D+IIT P +M +L  LG++LG RGLMPNPK G VT D+ K + E K G   ++ D  G +H  +GKA+    KI  N   LL  +   + +S KG++++ + +SSTM P +++
  S:     6 KKQKEAHAKIDREKLYSVDEGSALIKEITNAKFDASIDLAVRLGVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADYVGLDEYLDKIKGGWTDVDVIITMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDVAKAVTEVKAGKIDFKVDKTGIVHAAIGKASFSADKIAGNAKELLETLNKMKPSSAKGVYMKSIFMSSTMSPSVQL 224
>gi|160881810|ref|YP_001560778.1| ribosomal protein L1 [Clostridium phytofermentans ISDg] >gi|160430476|gb|ABX44039.1| ribosomal protein L1 [Clostridium phytofermentans ISDg] (230 aa)
Score = 385, Expect = 2.9e-35, Identities = 85/215 (39%), Positives = 134/215 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           DRT  Y + +A++L ++++ AKF  +I+  I+L +D   +DQQ+RG V LP+  GK  R+LV  KG    +A + G +  G  ELI +I + GW +FD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K + + K G  +YR D    IH+ VGKA+    ++ +N   L+  I   +  + KG ++  V ++STMGPGI++  +K A
  S:    15 DRTAQYDVADAISLVRKSAVAKFDETIEAHIRLGVDGRHADQQVRGAVVLPHGTGKTVRVLVFAKGDKVNEALAAGADFVGGDELIPKIQNDGWFEFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAVNDIKAGKIEYRLDKTNIIHVPVGKASFTEEQLADNFQALMGAIIKAKPAAAKGQYLRSVTVASTMGPGIKLNTSKLA 230
>gi|83749360|ref|ZP_00946356.1| LSU ribosomal protein L1P [Ralstonia solanacearum UW551] >gi|83723985|gb|EAP71167.1| LSU ribosomal protein L1P [Ralstonia solanacearum UW551] (231 aa)
Score = 385, Expect = 3.0e-35, Identities = 86/209 (41%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +RTKFY I+EA++L K+ ++AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + AK+ G    G  +L  ++  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+ + + A +  N+  LL  +   +  S KG+++ K+ +SSTMG G+R+
  S:    16 ERTKFYPIDEALSLVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQAKAAGAEIVGMEDLAEQVKAGKMDFDVVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRRSFEPAALKSNLAALLDALNKAKPASSKGVYLRKIAVSSTMGVGVRI 224
>gi|56477584|ref|YP_159173.1| 50S ribosomal protein L1 [Azoarcus sp. EbN1] >gi|81357339|sp|Q5P342|RL1_AZOSE 50S ribosomal protein L1 >gi|56313627|emb|CAI08272.1| 50S ribosomal protein L1 [Azoarcus sp. EbN1] (232 aa)
Score = 385, Expect = 3.1e-35, Identities = 89/209 (42%), Positives = 127/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR + Y + EA+ L K+ + AKF  SIDIA+ L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G +  G  +L  ++  G +DFDL I TP  M  + +LG+ILG RGLMPNPK G VT D+   +   K G  QYRTD  G IH  +G+A+  T  + +N+  L+  +   +  + KGI++ +V LSSTMG G+RV
  S:    16 DRNRTYPVTEALALVKECATAKFDESIDIAVNLGIDARKSDQLVRGSVVLPAGTGKSVRVAVFAQGDKAEAARAAGADVVGFEDLAEQVKAGNIDFDLCIATPDAMRVVGQLGQILGPRGLMPNPKVGTVTMDVTTAVKNAKAGQVQYRTDKGGIIHATIGRASFSTEALQQNLGALVDALVKAKPAASKGIYLRRVALSSTMGSGVRV 224
>gi|153209795|ref|ZP_01947512.1| ribosomal protein L1 [Coxiella burnetii 'MSU Goat Q177'] >gi|154705817|ref|YP_001425193.1| 50S ribosomal protein L1 [Coxiella burnetii Dugway 5J108-111] >gi|165918648|ref|ZP_02218734.1| ribosomal protein L1 [Coxiella burnetii RSA 334] >gi|189041811|sp|A9KD42|RL1_COXBN 50S ribosomal protein L1 >gi|120575246|gb|EAX31870.1| ribosomal protein L1 [Coxiella burnetii 'MSU Goat Q177'] >gi|154355103|gb|ABS76565.1| ribosomal protein L1 [Coxiella burnetii Dugway 5J108-111] >gi|165917676|gb|EDR36280.1| ribosomal protein L1 [Coxiella burnetii RSA 334] (232 aa)
Score = 384, Expect = 3.1e-35, Identities = 91/219 (41%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K  +    R K Y + EA+ L K+ + AKF  SID+AI L +D+ KSDQ +RG   LP+  G+  ++ V  +G   + AK+ G +  G  +L   I  G +DFD++I TP+ M  + KLG++LG RGLMPNPK G VTTD+   +   K+G  +YRTD  G IH  +GK N +   + EN   LL+ I   + ++ KG +++K+ LSSTMGPGI +
  S:     7 KKRKTLAEKVQRDKAYPLSEAIKLIKECAKAKFNESIDVAINLGIDSRKSDQAIRGATVLPHGSGRTVKVAVFAQGDNVEKAKAAGADIVGLDDLAERIQGGDIDFDVVIATPETMRVVGKLGQVLGPRGLMPNPKVGTVTTDVASAVKNAKQGQVRYRTDKNGIIHCTIGKVNFEEKALEENFLALLNDIKKAKPSAAKGTYLKKLTLSSTMGPGIAI 225
>gi|94987374|ref|YP_595307.1| 50S ribosomal protein L1 [Lawsonia intracellularis PHE/MN1-00] >gi|160166205|sp|Q1MPU1|RL1_LAWIP 50S ribosomal protein L1 >gi|94731623|emb|CAJ54986.1| ribosomal protein L1 [Lawsonia intracellularis PHE/MN1-00] (235 aa)
Score = 384, Expect = 3.3e-35, Identities = 85/212 (40%), Positives = 128/212 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           D +   + E+AV  + QTS A F  ++DIAI L +D   SDQ +RG V+LPY  GK  R+ V  KG  + +AK  G ++AG  EL+A+I  GWLDFD  + TP +M  + ++G+ LG RGLMPN K G VT ++   I E K G   ++ D  G +H  +GK +  + KI+ N+  L+  +   + +S KG +I+ + +S+TMGPG ++  N
  S:    16 DLSLHLSFEDAVTQSIQTSFANFDETVDIAIGLGVDPKYSDQMVRGAVTLPYGLGKTVRVAVFCKGEKEAEAKEAGADYAGAEELVAKIKDGWLDFDAAVATPDVMALVGQVGRQLGPRGLMPNAKTGTVTFNVTNAIKELKAGRIDFKVDKAGVLHAPLGKVSFGSEKILGNLKSLVETVNRLKPSSAKGTYIKSMAISTTMGPGFKIDTN 227
>gi|121997659|ref|YP_001002446.1| ribosomal protein L1 [Halorhodospira halophila SL1] >gi|160166047|sp|A1WVD2|RL1_HALHL 50S ribosomal protein L1 >gi|121589064|gb|ABM61644.1| LSU ribosomal protein L1P [Halorhodospira halophila SL1] (231 aa)
Score = 384, Expect = 3.3e-35, Identities = 84/219 (38%), Positives = 129/219 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     D    Y ++EA+ L K+ + A+F  SID+A+ L +D  KSDQ +RG+  LP   GK  R+ V  +G     A++ G +  G  +L   +  G LD+D++I +P  M  + KLG +LG RGLMPNPK G V+ D+   +   K G  +YRTD  G IH  +G+AN D   + EN++ LL+ +   + ++ KG++I+ + +SSTMG G+RV
  S:     6 KRQKQIRERVDGNHAYPVDEALALVKELATARFPESIDVAVNLGVDPRKSDQIVRGSTVLPNGTGKSMRVAVFAQGENADAAQAEGADAVGMDDLAERMQGGELDYDVVIASPDAMGVVGKLGPVLGPRGLMPNPKTGTVSADVAGAVRNAKAGQVRYRTDRGGVIHSAIGRANFDEQALRENLDALLADLNKLKPSTSKGVYIKGITVSSTMGAGVRV 224
>gi|177671522|ref|ZP_02944580.1| ribosomal protein L1 [Micrococcus luteus NCTC 2665] >gi|172071454|gb|EDT57496.1| ribosomal protein L1 [Micrococcus luteus NCTC 2665] (235 aa)
Score = 384, Expect = 3.3e-35, Identities = 83/212 (39%), Positives = 138/212 (65%)
  Q:    24 FYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
            Y+  EA+ LAK+T+ +K  +++++A++L++D  K+DQ +RG+VSLP+  GK  R++V   G   + A++ G +  GD +LIA IS+GW+DFD  + +P++M ++ +LGK+LG R LMPNPK G VT D+ K + + K G   +R D + N+H ++GK + +   +VEN    L  I   + +S KG +I K  +++T GPG+ +  N T+V
  S:    19 LYSPVEAIRLAKETNPSKTDATVEVALRLSVDPRKADQMVRGSVSLPHGTGKTARVVVFATGDRAEAARAAGADVVGDDDLIARISEGWVDFDAAVASPELMGKVGRLGKVLGPRNLMPNPKTGTVTPDVAKAVTDIKGGKIDFRVDKHSNLHFIIGKTSFEAKALVENYAAALEEILRLKPSSSKGRYISKATVATTFGPGVPMDPNVTSV 230
>gi|158520716|ref|YP_001528586.1| ribosomal protein L1 [Desulfococcus oleovorans Hxd3] >gi|158509542|gb|ABW66509.1| ribosomal protein L1 [Desulfococcus oleovorans Hxd3] (234 aa)
Score = 384, Expect = 3.4e-35, Identities = 83/209 (39%), Positives = 126/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  + Y I E ++ A Q   A F  S+DIA++L +D   +DQ +RG+V LP+  GKE +ILV  KG  +K+A   G +  G+ ELI +I  GW  FD  + TP MM  + K+GK+LG RGLMPN K G VT D+ + + + K G   +R D  G +H  +GKA+  T K+ +N+  LL  + A +  + KG ++  + +S++MG G+R+
  S:    16 DADRKYDISEGIDTALQARFAGFDESVDIAVRLGVDPRHADQMVRGSVVLPHGTGKEIKILVFAKGEKEKEALDAGADFVGNDELIEDIKNGWFGFDKAVATPDMMGAVGKIGKLLGPRGLMPNAKTGTVTFDVARAVNDLKAGKIDFRVDKAGIVHAPLGKASFGTEKLQDNMLALLRMLVAMKPATSKGAYMRSLAVSTSMGAGVRL 224
>gi|17232793|ref|NP_489341.1| 50S ribosomal protein L1 [Nostoc sp. PCC 7120] >gi|33301461|sp|Q8YLJ7|RL1_ANASP 50S ribosomal protein L1 >gi|17134440|dbj|BAB77000.1| 50S ribosomal protein L1 [Nostoc sp. PCC 7120] (238 aa)
Score = 384, Expect = 3.4e-35, Identities = 86/203 (42%), Positives = 126/203 (62%)
  Q:    29 EAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +A+ L K+T+ AKF  + +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A + G +  G  ELI EI KG +DFD +I TP +MP+++KLGK+LG RGLMP+PK G VT D+   IAEFK G  ++R D  G +H++ GKA+     ++ N+  L   I   R +  KG +     +S+TMGP IRV +N
  S:    25 DALGLLKETATAKFGEAAEAHIRLGIDPKYTDQQLRTTVALPKGTGQIVRVAVIARGEKVTEASNAGADVVGSEELIDEIQKGRMDFDKLIATPDVMPQVAKLGKMLGPRGLMPSPKGGTVTFDVASAIAEFKAGKLEFRADRTGIVHVMFGKASFSPEDLLVNLKALQETIDRNRPSGAKGRYWRTFYVSATMGPSIRVDIN 227
>gi|156972588|ref|YP_001443495.1| 50S ribosomal protein L1 [Vibrio harveyi ATCC BAA-1116] >gi|166219594|sp|A7MXE3|RL1_VIBHB 50S ribosomal protein L1 >gi|156524182|gb|ABU69268.1| hypothetical protein VIBHAR_00228 [Vibrio harveyi ATCC BAA-1116] (233 aa)
Score = 384, Expect = 3.5e-35, Identities = 86/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y I EAV L ++ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G   + AK  G +  G  +L  ++ KG ++FD+++ +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    +I EN+  LL  +   + +S KG F++KV++S+TMG G+ V
  S:    16 DVTKEYEINEAVALLQELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGREIRVAVFTQGANAEAAKEAGADIVGMEDLAEQVKKGEMNFDVVVASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKANFSAEQIKENLEALLVALKKAKPSSAKGTFLKKVSISTTMGAGVAV 224
>gi|29653579|ref|NP_819271.1| ribosomal protein L1 [Coxiella burnetii RSA 493] >gi|161829975|ref|YP_001596172.1| 50S ribosomal protein L1 [Coxiella burnetii RSA 331] >gi|189041812|sp|A9NAL1|RL1_COXBR 50S ribosomal protein L1 >gi|33301435|sp|Q83ET3|RL1_COXBU 50S ribosomal protein L1 >gi|29540841|gb|AAO89785.1| ribosomal protein L1 [Coxiella burnetii RSA 493] >gi|161761842|gb|ABX77484.1| ribosomal protein L1 [Coxiella burnetii RSA 331] (232 aa)
Score = 384, Expect = 3.6e-35, Identities = 91/219 (41%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K  +    R K Y + EA+ L K+ + AKF  SID+AI L +D+ KSDQ +RG   LP+  G+  ++ V  +G   + AK+ G +  G  +L   I  G +DFD++I TP+ M  + KLG++LG RGLMPNPK G VTTD+   +   K+G  +YRTD  G IH  +GK N +   + EN   LL+ I   + ++ KG +++K+ LSSTMGPGI +
  S:     7 KKRKTLAEKVQRDKTYPLSEAIKLIKECAKAKFNESIDVAINLGIDSRKSDQAIRGATVLPHGSGRTVKVAVFAQGDNVEKAKAAGADIVGLDDLAERIQGGDIDFDVVIATPETMRVVGKLGQVLGPRGLMPNPKVGTVTTDVASAVKNAKQGQVRYRTDKNGIIHCTIGKVNFEEKALEENFLALLNDIKKAKPSAAKGTYLKKLTLSSTMGPGIAI 225
>gi|119899716|ref|YP_934929.1| 50S ribosomal protein L1 [Azoarcus sp. BH72] >gi|160166287|sp|A1KB37|RL1_AZOSB 50S ribosomal protein L1 >gi|119672129|emb|CAL96043.1| 50S ribosomal protein L1 [Azoarcus sp. BH72] (231 aa)
Score = 384, Expect = 3.7e-35, Identities = 85/209 (40%), Positives = 126/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR + Y + EA+ L K+ + AKF  SID+A+ L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G +  G  +L  ++  G +DFDL I TP  M  + +LG+ILG RGLMPNPK G VT D+   +   K G  QYRTD  G +H  +G+A+     + +N+N  +  +   R  + KG+++ +V +SSTMG G+RV
  S:    16 DRNRIYPVAEALALVKECATAKFDESIDVAVNLGVDARKSDQVVRGSVVLPAGTGKTVRVAVFAQGDKAEAARAAGADVVGFDDLAEQVKGGTIDFDLCIATPDAMRVVGQLGQILGPRGLMPNPKVGTVTMDVTTAVKNAKAGQVQYRTDKGGLVHATIGRASFGVEALQQNLNAFIEALVKARPAAAKGVYLRRVAVSSTMGAGVRV 224
>gi|123965467|ref|YP_001010548.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9515] >gi|160166295|sp|A2BUI0|RL1_PROM5 50S ribosomal protein L1 >gi|123199833|gb|ABM71441.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9515] (235 aa)
Score = 384, Expect = 3.8e-35, Identities = 91/227 (40%), Positives = 139/227 (61%)
  Q:     5 KKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           KK++ +     +   DRT  Y   EA+ + K+ +NAKF  +I+  I+L +D   +DQQLR TV+LP+  G+  +I V+  G     AKS G +  G+ +L+  I+KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VT+D+   I EFK G  ++R D  G +H+  GKA+     + EN+  L   I   + +  KG + +   ++STMGP ++V +N
  S:     2 KKLSKRMTALSTKIEDRT--YAPLEALAIIKENANAKFDETIEAHIRLGIDPKYTDQQLRTTVALPHGTGQSIKIAVITSGENVAKAKSAGADLFGEEDLVESINKGNMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTSDIASAIKEFKAGKLEFRADKAGIVHVRFGKASFTENALFENLKTLQESIDKNKPSGAKGKYWKTFYVTSTMGPSVQVDIN 226
>gi|2267574|gb|AAB63584.1| ribosomal protein L1 [Haemophilus ducreyi] (253 aa)
Score = 383, Expect = 4.2e-35, Identities = 93/237 (39%), Positives = 143/237 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAKGKVIA 246
           K  K      D TK Y I EA+ L KQ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G   + AK+ G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK +    ++ EN+  LL+ +   + T+ KGIFI+KV++S+TMG G+ V  N T ++  T +G++I 
  S:     6 KKMKAIKAGVDSTKAYEINEAIALLKQFATAKFVESVDVAVNLGIDPRKSDQNVRGATVLPHGTGRSARVAVFTQGANAEAAKAAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTLNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKVDFSEVQLKENLQALLAALNKAKPTTAKGIFIKKVSVSTTMGAGVAV-TNLTLIL--TLQGRIIG 239
>gi|171060540|ref|YP_001792889.1| ribosomal protein L1 [Leptothrix cholodnii SP-6] >gi|170777985|gb|ACB36124.1| ribosomal protein L1 [Leptothrix cholodnii SP-6] (237 aa)
Score = 383, Expect = 4.3e-35, Identities = 87/211 (41%), Positives = 131/211 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           + TK Y +++A+ L K+ + AKF  SID+A++L +D  KSDQ +RG V +P   GK KR+ V  +G    +A++ G +  G  +L AE+  G ++FD++I +P  M  + +LG+ILG RGLMPNPK G VT D+   +   K G  Q+R D  G IH  +G+ + DT K+  N+  LL  +   +  S KG+++ KV +SSTMG G+RV V
  S:    16 ETTKLYAVDDAIALIKEFAVAKFDESIDVAVQLGVDAKKSDQVVRGAVVMPNGTGKTKRVAVFTQGAKADEARAAGADIVGMDDLAAEVKAGNINFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTADVATAVRNAKAGQVQFRVDKGGIIHGTIGRRSFDTDKLKGNLQALLDALNKAKPASSKGVYLRKVAVSSTMGVGVRVEV 226
>gi|33860763|ref|NP_892324.1| 50S ribosomal protein L1 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|61215698|sp|Q7V382|RL1_PROMP 50S ribosomal protein L1 >gi|33633705|emb|CAE18662.1| 50S ribosomal protein L1 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (235 aa)
Score = 383, Expect = 4.4e-35, Identities = 92/227 (40%), Positives = 136/227 (59%)
  Q:     5 KKVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           KK++ +     +   DRT  Y   EA+ + K+ +NAKF  +I+  I+L +D   +DQQLR TV+LP   G+  +I V+  G     AKS G +  G+ +L+  I+KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VT D+   I EFK G  ++R D  G +H+  GKA+     + EN+  L   I   + +  KG +     L+STMGP ++V +N
  S:     2 KKLSKRMKALSTKIEDRT--YAPLEALGIVKENANAKFDETIEAHIRLGIDPKYTDQQLRTTVALPNGTGQSIKIAVITSGENVAKAKSAGADLFGEEDLVESINKGNMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTGDIASAIKEFKAGKLEFRADKAGIVHVRFGKASFTENALFENLKTLQESIDKNKPSGAKGKYWRSFYLTSTMGPSVQVDIN 226
>gi|170718507|ref|YP_001783392.1| ribosomal protein L1 [Haemophilus somnus 2336] >gi|189041820|sp|B0UUZ5|RL1_HAES2 50S ribosomal protein L1 >gi|168826636|gb|ACA32007.1| ribosomal protein L1 [Haemophilus somnus 2336] (229 aa)
Score = 383, Expect = 4.7e-35, Identities = 87/219 (39%), Positives = 130/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ ++ KF+ S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G     AK+ G +  G  +L  +I KG ++FD++I +P  M  + +LG+ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    ++ EN+  LL+ +   +  + KGIFI KV++S+T G G+ V
  S:     6 KRMKAIKAGVDSTKQYEINEAITVLKQFTSTKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANVDSAKAAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAKPATAKGIFIRKVSVSTTQGAGVAV 224
>gi|144900870|emb|CAM77734.1| 50S ribosomal protein L1 [Magnetospirillum gryphiswaldense MSR-1] (231 aa)
Score = 382, Expect = 5.4e-35, Identities = 89/209 (42%), Positives = 126/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  KFYT+EEAV L K  + +KF  +I++A+ L +D   +DQ +RG V LP   GK  R+ V  K    ++A+  G +  G  +L  +I  G +DFD  I TP MM  + +LGK+LG R LMPNPK G VT ++ + I   K G  Q+R +  G IH  VGKA+ D AK+VENI   +  I   +    KG +++KV+LSSTMG G+++
  S:    16 DSNKFYTLEEAVKLIKSGAKSKFDETIEVAMNLGVDPRHADQMVRGVVELPNGTGKTVRVAVFAKADKAEEARKAGADIVGAEDLAEQIQGGMMDFDRCIATPDMMGVVGRLGKVLGPRNLMPNPKLGTVTPNVTEAIRAAKAGQVQFRVEKAGIIHAGVGKASFDEAKLVENIKAFIDAINKAKPAGAKGTYVKKVSLSSTMGVGVKL 224
>gi|23336712|ref|ZP_00121910.1| COG0081: Ribosomal protein L1 [Bifidobacterium longum DJO10A] >gi|23465853|ref|NP_696456.1| 50S ribosomal protein L1 [Bifidobacterium longum NCC2705] >gi|189440486|ref|YP_001955567.1| Ribosomal protein L1 [Bifidobacterium longum DJO10A] >gi|33301451|sp|Q8G4T3|RL1_BIFLO 50S ribosomal protein L1 >gi|23326552|gb|AAN25092.1| 50S ribosomal protein L1 [Bifidobacterium longum NCC2705] >gi|189428921|gb|ACD99069.1| Ribosomal protein L1 [Bifidobacterium longum DJO10A] (230 aa)
Score = 382, Expect = 5.4e-35, Identities = 82/226 (36%), Positives = 135/226 (59%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           +K  ++ +   DR   YT  EA+ L K   +  F  +++   +L++D  K+DQ +RGTV+LP+  GK  ++LV  +G    +A   G +  GD +LIA++  G+LDFD ++ TP MM ++ +LG++LG RGLMPNPK G VT D+ K + + K G  ++R D  GN+  ++GK + D + + EN   +   +   + ++VKG ++ K  ++STM PG+ V  N  A
  S:     5 SKKYREAAERVDRNNLYTANEAIALLKSMPSYNFDQTVEAVFRLSVDPRKADQLVRGTVNLPHGTGKTAKVLVFARGPKATEATEAGADIVGDDDLIAKVQGGFLDFDAVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTMDVTKAVKDIKGGKIEFRVDKNGNLSFLIGKMSFDESALDENFKAVADEVKRLKPSTVKGRYLTKATITSTMNPGVPVDPNTLA 230
>gi|83594030|ref|YP_427782.1| 50S ribosomal protein L1 [Rhodospirillum rubrum ATCC 11170] >gi|91207375|sp|Q2RQV0|RL1_RHORT 50S ribosomal protein L1 >gi|83576944|gb|ABC23495.1| LSU ribosomal protein L1P [Rhodospirillum rubrum ATCC 11170] (233 aa)
Score = 382, Expect = 5.6e-35, Identities = 89/209 (42%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR  FY + +AV+L ++ + AKF  SI++A+ L +D   +DQ +RG V LP+  GK  R+ V  KG   ++AK+ G +  G  EL A+I  G +DFD  I TP MM  + +LGK+LG RGLMPNPK G VT D+   +   K G  Q+R +  G +H  VG+A+    K+V+N+   +  I   + T  KG +++KV+LSSTMGPG++V
  S:    16 DREAFYDLPQAVHLIRERATAKFDESIEVAMNLGVDPRHADQMVRGVVELPHGTGKTMRVAVFAKGAKAEEAKAAGADLVGADELAADIQNGTIDFDRCIATPDMMGVVGRLGKVLGPRGLMPNPKLGTVTMDVATAVKAAKAGQVQFRVEKSGIVHAGVGRASFTEEKLVDNVRAFVDAINKAKPTGAKGTYLKKVSLSSTMGPGLKV 224
>gi|15965098|ref|NP_385451.1| 50S ribosomal protein L1 [Sinorhizobium meliloti 1021] >gi|33301578|sp|Q92QI0|RL1_RHIME 50S ribosomal protein L1 >gi|15074278|emb|CAC45924.1| Probable 50S ribosomal protein L1 [Sinorhizobium meliloti 1021] (232 aa)
Score = 382, Expect = 5.7e-35, Identities = 85/219 (38%), Positives = 128/219 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  +K     D TK Y + EAV L K+ + AKF  +I++A+ L +D   +DQ +RG V+LP   G+  R+ V  +G    +AK+ G +  G  EL+  +  G +DFD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G +H  +GKA+ D   + ENI      +   + T  KG ++++V +SSTMGPG++V
  S:     6 KRVQKSREGVDPTKLYGLTEAVTLVKERATAKFDETIEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFARGAKADEAKAAGADVVGAEELVEIVQGGKIDFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTMDVTGAVKASKGGAVEFRVEKAGIVHAGIGKASFDAKALEENIRAFADAVIKAKPTGAKGNYVKRVAVSSTMGPGLKV 224
>gi|167629455|ref|YP_001679954.1| 50S ribosomal protein L1 [Heliobacterium modesticaldum Ice1] >gi|167592195|gb|ABZ83943.1| 50S ribosomal protein l1 [Heliobacterium modesticaldum Ice1] (236 aa)
Score = 382, Expect = 5.8e-35, Identities = 85/209 (40%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR +     EA+++ K+ + AKF  ++++A +L +D   +DQ +RG V LP+  GK +++ V  KG   K+A++ G +  G  +L+ +I  GWLDFD+ + TP +M  + KLG++LG +GLMPNPK G VT D+ + I E K G  +YR D  G IH  +GKA+ D  K++EN   LL  +   +  + KG +I+ + LSSTM PG+RV
  S:    16 DRDQVLEAREAMDMVKKLATAKFDETVEVAFRLGVDPRHADQMIRGAVVLPHGTGKSRKVAVFAKGDKAKEAEAAGADAVGAEDLVEKIQGGWLDFDVAVATPDVMGLVGKLGRLLGPKGLMPNPKTGTVTFDVARAIQEIKAGKIEYRVDKTGIIHAPIGKASFDVQKLLENYQTLLDTLIKAKPAAAKGQYIKSITLSSTMSPGVRV 224
>gi|41410211|ref|NP_963047.1| 50S ribosomal protein L1 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118464910|ref|YP_883654.1| 50S ribosomal protein L1 [Mycobacterium avium 104] >gi|160166277|sp|A0QL66|RL1_MYCA1 50S ribosomal protein L1 >gi|61215642|sp|Q73SG1|RL1_MYCPA 50S ribosomal protein L1 >gi|41399045|gb|AAS06663.1| RplA [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118166197|gb|ABK67094.1| ribosomal protein L1 [Mycobacterium avium 104] (235 aa)
Score = 382, Expect = 5.9e-35, Identities = 85/220 (38%), Positives = 134/220 (60%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  +  +   DR   YT  +A  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G   + A++ G +  G  +LI +I  G+LDFD  I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +A+ K G   +R D   N+H V+GKA+ D   + EN    L  +   + ++ KG +++K+ +S+T GPGI V
  S:     5 SKAYRAAAEKVDRDNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKAEQAQAAGADIVGSDDLIEKIQGGFLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKALAENYGAALDEVLRLKPSASKGRYLKKITVSTTTGPGIPV 224
>gi|193216541|ref|YP_001999783.1| ribosomal protein L1 [Mycoplasma arthritidis 158L3-1] >gi|193001864|gb|ACF07079.1| ribosomal protein L1 [Mycoplasma arthritidis 158L3-1] (230 aa)
Score = 382, Expect = 6.0e-35, Identities = 101/223 (45%), Positives = 141/223 (63%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILV-LDKGLTQKDAKSLGVNHA-GDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           +K  K      ++T  +++ EA+ LAK+ S AKF  S+DIAI LNLDT KSDQQLRG V+LP+  GK  ++LV  D+   QK AK  G ++    +EL   +++   DFD+I+  PKMM  L K GK LG +GLMPNPK G VTT+  K + E KKG   YR D  G IH  VGK + D+ K+VEN   L+  I   + T+VKG ++  + +S++MGP I+V ++
  S:     6 SKNVKNAKAQVNKTDVFSLLEAIELAKKISFAKFDESLDIAINLNLDTRKSDQQLRGAVALPHGTGKNVKVLVATDEVSAQKAAKDAGADYVYTAAELPEVLNQDKYDFDVIVADPKMMLVLGKYGKKLGPKGLMPNPKTGTVTTNPAKAVEELKKGKANYRADKGGIIHASVGKKSMDSQKLVENAETLIQTIKRLKPTTVKGTYVLNITVSTSMGPSIKVKID 230
>gi|167758526|ref|ZP_02430653.1| hypothetical protein CLOSCI_00866 [Clostridium scindens ATCC 35704] >gi|167663722|gb|EDS07852.1| hypothetical protein CLOSCI_00866 [Clostridium scindens ATCC 35704] (230 aa)
Score = 382, Expect = 6.0e-35, Identities = 89/209 (42%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   Y + EAV+L K+T+ AKF  +I+  I+   D   +DQQ+RG V LP+  GK+ RILV  K     +AK+ G ++ G  ELI +I ++ W +FD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ VGKA+    ++ +N   L+  I   R ++VKG F++ V L+STMGPG+++
  S:    15 DRGTLYDVAEAVSLVKKTAVAKFDETIEAHIRTGCDGRHADQQIRGAVVLPHGTGKKVRILVFAKDAKADEAKAAGADYVGGEELIPKIQNENWFEFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAIQDIKAGKIEYRLDKTNIIHVPVGKASFTEEQLTDNFQTLIDAINKARPSAVKGQFLKSVTLTSTMGPGVKI 224
>gi|32307584|gb|AAP79197.1| ribosomal protein rpL1 [Bigelowiella natans] (259 aa)
Score = 382, Expect = 6.2e-35, Identities = 92/216 (42%), Positives = 137/216 (63%)
  Q:    13 KKPSVNFDRTKF------YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +KPS  F   K       Y   EA+ L KQ ++AKF  ++++   LN+D  K+ Q LR TV LP   GK  ++ VL K    K+ K+ G + AG  +LI +I+KG LDF+ +ITTP MMP++++LG++LG +GLMP+ K+G VTTD+P T+ E K G  + R D  G +HM  GKA  D   +++N+  +   I A + T +K  + + V L+STMGPGI++
  S:    27 RKPSRRFREIKEKVEQKPYKTMEAIQLLKQLASAKFAETMEVHADLNIDPRKATQNLRTTVVLPNGTGKSVKVAVLCKDEDAKEYKAAGADIAGFQDLIDDINKGNLDFERLITTPDMMPQIARLGRVLGPKGLMPSIKSGTVTTDVPTTLKEIKAGRLELRADKKGVVHMPFGKATFDDEALLQNLRAIQDTIDANKPTDIKKQYWKSVYLTSTMGPGIQL 248
>gi|162448677|ref|YP_001611044.1| hypothetical protein sce0407 [Sorangium cellulosum 'So ce 56'] >gi|189041840|sp|A9GRA4|RL1_SORC5 50S ribosomal protein L1 >gi|161159259|emb|CAN90564.1| rplA [Sorangium cellulosum 'So ce 56'] (236 aa)
Score = 382, Expect = 6.5e-35, Identities = 82/209 (39%), Positives = 134/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR + YT++EA  L KQ + AKF  ++D+A++L ++   +DQ +RG V LP+  G+  R+LV  KG   K+A++ G +  G+++L+ ++ +G++DFD +I TP MM  + KLG+ILG RGLMPNPK G VT D+   ++E K G  +YR +  G +H  +GK +     +  N + L+  +   +  + KGI++  + +SSTMGPG+R+
  S:    16 DRARKYTLQEACALVKQAAPAKFDETVDLAVRLGVNPRHADQMVRGAVVLPHGTGQSLRVLVFAKGEKAKEAEAAGADFVGEADLVNKVQEGFMDFDRVIATPDMMGLVGKLGRILGPRGLMPNPKVGTVTFDVKTAVSEAKAGKVEYRVEKAGIVHARIGKVSFAENALHVNADALIQALVRAKPATAKGIYLRSITMSSTMGPGVRI 224
>gi|83312242|ref|YP_422506.1| 50S ribosomal protein L1 [Magnetospirillum magneticum AMB-1] >gi|123541299|sp|Q2W2H8|RL1_MAGMM 50S ribosomal protein L1 >gi|82947083|dbj|BAE51947.1| Ribosomal protein L1 [Magnetospirillum magneticum AMB-1] (230 aa)
Score = 382, Expect = 6.6e-35, Identities = 86/225 (38%), Positives = 132/225 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           K  K    + DR KFY++ +AV   K  + AKF  +I+IA+ L +D   +DQ +RG V LP+  GK  R+ V  KG   ++A+  G +  G+ +L    + G +DFD +I TP +M  + +LGK+LG RGLMPNPK G VT ++ + +   K G  Q+R +  G +H  +GKA+    K+ EN+   +  I   +    KG +++KV+LSSTMGPG+++ V   A
  S:     6 KRLKSAYADIDRDKFYSLADAVKAIKTRAVAKFDETIEIALNLGVDPRHADQMVRGVVELPHGTGKTVRVAVFAKGDKAEEARKAGADIVGEQDLFDACNAGNMDFDRVIATPDLMGLVGRLGKVLGPRGLMPNPKLGTVTANVTEAVRAAKAGQVQFRVEKAGIVHAGIGKASFSEEKLAENVKAFVDAITKAKPQGAKGTYLKKVSLSSTMGPGVKLDVATLA 230
>gi|88812767|ref|ZP_01128013.1| 50S ribosomal protein L1 [Nitrococcus mobilis Nb-231] >gi|88790005|gb|EAR21126.1| 50S ribosomal protein L1 [Nitrococcus mobilis Nb-231] (231 aa)
Score = 382, Expect = 6.7e-35, Identities = 80/209 (38%), Positives = 124/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   ++  EA++L K  S   F  S+D+++ L +D  KSDQ +RG+  LP+  GK  R+ V  +G   + AK  G +  G  +L   I  G LDF ++I  P  M  + +LG+ILG RGLMPNP+ G VT D+   +   K G  +YRTD  G IH  +GK   + A++ +N+  L+  +A  +  + KG++++KV +S+TMGPG++V
  S:    16 DRAAVFSAAEALSLLKDLSTVGFTESVDVSVNLGVDPRKSDQVVRGSTVLPHGTGKTVRVAVFAQGTNAESAKEAGADVVGMDDLAERIQGGELDFGVVIAAPDAMGVVGRLGRILGPRGLMPNPRVGTVTADVAAAVRNAKAGQVRYRTDRGGLIHCTLGKVTFEVAQLQQNLEALIGDLAKIKPAAAKGVYLKKVTVSTTMGPGLQV 224
>gi|119960983|ref|YP_948673.1| 50S ribosomal protein L1 [Arthrobacter aurescens TC1] >gi|160165647|sp|A1R8W1|RL1_ARTAT 50S ribosomal protein L1 >gi|119947842|gb|ABM06753.1| ribosomal protein L1 [Arthrobacter aurescens TC1] (235 aa)
Score = 382, Expect = 6.7e-35, Identities = 85/214 (39%), Positives = 132/214 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVV 236
           K Y   EA+ LAK T+ +KF +++++A +L +D  K+DQ +RGTV+LP+  GK  R+LV   G   + A + G +  G  +LI +I+ GW DFD  + TP +M ++ +LGK+LG R LMPNPK G VT D+ K + + K G   +R D + N+H ++GK + D  K+ EN    L  +   + ++ KG +I+K  +++T GPGI V  N T V+
  S:    19 KVYAPIEAITLAKDTNPSKFDATVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDKAEAAIAAGADFVGSDDLIEKIAAGWTDFDAAVATPDLMGKVGRLGKVLGPRNLMPNPKTGTVTPDVTKAVNDIKGGKIDFRVDKHSNLHFIIGKVSFDVNKLAENYAAALEEVLRLKPSASKGRYIQKATVATTFGPGITVDPNVTKVL 232
>gi|113460316|ref|YP_718377.1| 50S ribosomal protein L1 [Haemophilus somnus 129PT] >gi|123327064|sp|Q0I0V1|RL1_HAES1 50S ribosomal protein L1 >gi|112822359|gb|ABI24448.1| LSU ribosomal protein L1P [Haemophilus somnus 129PT] (229 aa)
Score = 382, Expect = 6.8e-35, Identities = 87/219 (39%), Positives = 130/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ ++ KF+ S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G     AK+ G +  G  +L  +I KG ++FD++I +P  M  + +LG+ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    ++ EN+  LL+ +   +  + KGIFI KV++S+T G G+ V
  S:     6 KRMKAIKAGVDSTKQYEINEAITVLKQFTSTKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANVDAAKAAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAKPATAKGIFIRKVSVSTTQGAGVAV 224
>gi|89890189|ref|ZP_01201700.1| RplA, ribosomal protein L1 [Flavobacteria bacterium BBFL7] >gi|89518462|gb|EAS21118.1| RplA, ribosomal protein L1 [Flavobacteria bacterium BBFL7] (232 aa)
Score = 382, Expect = 7.0e-35, Identities = 83/219 (37%), Positives = 134/219 (61%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     D  + Y++ +A  L K  +N KF +S+D+A++LN+D  K++Q +RG V+LP+  GK+ ++L L     + +A + G ++ G  E + +I  GW D D+IIT P +M +L  LG++LG RGLMPNPK G VT D+ K +++ K G   ++ D  G IH  +GK + D  KI  N   L++ +   + T+ KG++I+ + +SSTM PGI +
  S:     6 KKQKEAHSKIDSAEMYSLADASKLVKDVTNVKFDASVDLAVRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKESEATAAGADYVGLDEYLDKIKGGWTDVDVIITMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDVAKAVSDVKAGKIDFKVDKTGIIHAAIGKVSFDADKIAGNAKELINTLVKLKPTTSKGVYIKSIFMSSTMSPGISI 224
>gi|59802175|ref|YP_208887.1| 50S ribosomal protein L1 [Neisseria gonorrhoeae FA 1090] >gi|194099905|ref|YP_002003042.1| 50S ribosomal protein L1 [Neisseria gonorrhoeae NCCP11945] >gi|75355442|sp|Q5F5R2|RL1_NEIG1 50S ribosomal protein L1 >gi|59719070|gb|AAW90475.1| putative 50S ribosomal protein L1 [Neisseria gonorrhoeae FA 1090] >gi|193935195|gb|ACF31019.1| 50S ribosomal protein L1 [Neisseria gonorrhoeae NCCP11945] (231 aa)
Score = 381, Expect = 7.6e-35, Identities = 88/209 (42%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +  K Y I+EA+ L K+ + AKF  S+D++  L +D+ KSDQ +RG+V LP   GK  R+ V  +G+  + AK  G +  G  +L AEI  G L+FD++I +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  QYRTD  G +H  +G+A+   A + EN + LL  I   +  + KG +++KV +SSTMG G+RV
  S:    16 EANKLYAIDEAIALVKKAATAKFDESVDVSFNLGVDSRKSDQVIRGSVVLPKGTGKTTRVAVFTQGVNAEAAKEAGADVVGFEDLAAEIKAGNLNFDVVIASPDAMRIVGQLGTILGPRGLMPNPKIGTVTPNVAEAVKNAKAGQVQYRTDKAGIVHATIGRASFAEADLKENFDALLDAIVKAKPAAAKGQYLKKVAVSSTMGLGVRV 224
>gi|33591285|ref|NP_878929.1| 50S ribosomal protein L1 [Bordetella pertussis Tohama I] >gi|33594734|ref|NP_882377.1| 50S ribosomal protein L1 [Bordetella parapertussis 12822] >gi|33599004|ref|NP_886564.1| 50S ribosomal protein L1 [Bordetella bronchiseptica RB50] >gi|61214657|sp|Q7W0S2|RL1_BORPE 50S ribosomal protein L1 >gi|61214658|sp|Q7W2H2|RL1_BORPA 50S ribosomal protein L1 >gi|61214659|sp|Q7WRE2|RL1_BORBR 50S ribosomal protein L1 >gi|33564810|emb|CAE39752.1| 50S ribosomal protein L1 [Bordetella parapertussis] >gi|33570927|emb|CAE40391.1| 50S ribosomal protein L1 [Bordetella pertussis Tohama I] >gi|33575050|emb|CAE30513.1| 50S ribosomal protein L1 [Bordetella bronchiseptica RB50] (232 aa)
Score = 381, Expect = 7.7e-35, Identities = 89/209 (42%), Positives = 128/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y + EA+NL K+T+ AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G     A++ G +  G  +L  +I  G +DFD++I +P  M  +  LG++LG RGLMPNPK G VT D+   +   K G  QYRTD  G IH  +G+A+    ++  N+  L+  +   R  + KGI++ K+ +SSTMG G RV
  S:    16 DRTKLYPVGEALNLVKETATAKFDESIDVAVQLGIDPKKSDQLVRGSVVLPAGTGKTVRVAVFAQGEKADAARAAGADIVGLDDLAEQIKAGQMDFDVVIASPDTMRVVGALGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQIQYRTDKAGIIHATIGRASFGVEQLQNNLAALVDALQKARPAAAKGIYLRKLAVSSTMGGGARV 224
>gi|28899699|ref|NP_799304.1| 50S ribosomal protein L1 [Vibrio parahaemolyticus RIMD 2210633] >gi|33301558|sp|Q87KQ1|RL1_VIBPA 50S ribosomal protein L1 >gi|28807951|dbj|BAC61188.1| ribosomal protein L1 [Vibrio parahaemolyticus RIMD 2210633] (233 aa)
Score = 381, Expect = 7.8e-35, Identities = 85/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y I EAV L ++ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G++ R+ V  +G   + AK  G +  G  +L  ++ KG ++FD+++ +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKAN    +I EN+  LL  +   + +S KG F++KV++S+TMG G+ V
  S:    16 DVTKEYEINEAVALLQELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRDIRVAVFTQGANAEAAKEAGADIVGMEDLAEQVKKGEMNFDVVVASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKANFSAEQIKENLEALLVALKKAKPSSAKGTFLKKVSISTTMGAGVAV 224
>gi|83854992|ref|ZP_00948522.1| 50S ribosomal protein L1 [Sulfitobacter sp. NAS-14.1] >gi|83941514|ref|ZP_00953976.1| 50S ribosomal protein L1 [Sulfitobacter sp. EE-36] >gi|83842835|gb|EAP82002.1| 50S ribosomal protein L1 [Sulfitobacter sp. NAS-14.1] >gi|83847334|gb|EAP85209.1| 50S ribosomal protein L1 [Sulfitobacter sp. EE-36] (232 aa)
Score = 381, Expect = 8.1e-35, Identities = 84/206 (40%), Positives = 126/206 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           T+EEAV L K  + AKF  +I+IA+ L +D   +DQ +RG V LP   GK  R+ V  +G    +A++ G +  G  +L+  +  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+ + +   K G  Q++ +  G +H  +GK + D AK+VEN+   +  ++  + T  KG +++K+ LSSTMGPG+ V V+
  S:    22 TVEEAVALIKANATAKFDETIEIAMNLGVDPRHADQMVRGVVGLPNGTGKSVRVAVFARGPKADEAQAAGADIVGAEDLMEAVQGGKIDFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDIKEAVEAAKGGQVQFKAEKGGVVHAGIGKLSFDEAKLVENVRAFVGAVSKAKPTGSKGAYMKKIALSSTMGPGVTVEVD 227
>gi|15606946|ref|NP_214328.1| 50S ribosomal protein L1 [Aquifex aeolicus VF5] >gi|7674194|sp|O67759|RL1_AQUAE 50S ribosomal protein L1 >gi|2984194|gb|AAC07725.1| ribosomal protein L01 [Aquifex aeolicus VF5] (242 aa)
Score = 381, Expect = 8.4e-35, Identities = 84/213 (39%), Positives = 141/213 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNA---KFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKG-WLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           DR K YT+EEAV+L K+       +F  ++++A++LN+D   +DQ +RG+V LP+  GK  +++V  +G   K A+  G ++ G  ELI +I K  W DFD+ I TP+MMP+++KLG+ILG RGLMP+PK G VTT++ + I + K+G  +++ D  GN+HM VGK + +  K+++N+   +  +   +    KG +I+ + +S TM P +++ +N+
  S:    16 DRNKRYTLEEAVDLLKKMEEVLQRRFDETVELAMRLNVDPRYADQMVRGSVVLPHGLGKPIKVVVFAEGEYAKKAEEAGADYVGGDELINKILKEEWTDFDVAIATPEMMPKVAKLGRILGPRGLMPSPKTGTVTTNVEQAIKDAKRGRVEFKVDKAGNVHMPVGKISFEKEKLIDNLYAAIDAVVRAKPPGAKGQYIKNMAVSLTMSPSVKLDINE 232
>gi|114773737|ref|ZP_01450762.1| 50S ribosomal protein L1 [alpha proteobacterium HTCC2255] (232 aa)
Score = 380, Expect = 9.4e-35, Identities = 88/207 (42%), Positives = 125/207 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           D  K Y I EAV L K+ + AKF  S+D+AI L +D  KSDQ +RG   LP   GK+ R+ V  +G   + AK  G +  G  +L  ++ KG ++FD+++ +P  M  + +LG+ILG RGLMPNPK G VT D+   +   K G  QYR D  G IH  +GK   + A I EN+N L+  +   + +S KG +I+KV+LS+TMG G+
  S:    16 DANKEYEINEAVALLKELATAKFAESVDVAINLGIDARKSDQNVRGATVLPNGTGKDVRVAVFTQGANAEAAKEAGADIVGMEDLAEQVKKGEMNFDVVVASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPDVATAVKNAKSGQVQYRNDKNGIIHASIGKIAFEPAHIEENLNALIEALKKAKPSSAKGTYIKKVSLSTTMGAGV 222
>gi|158422508|ref|YP_001523800.1| ribosomal protein L1 [Azorhizobium caulinodans ORS 571] >gi|172047836|sp|A8HTX8|RL1_AZOC5 50S ribosomal protein L1 >gi|158329397|dbj|BAF86882.1| ribosomal protein L1 [Azorhizobium caulinodans ORS 571] (232 aa)
Score = 380, Expect = 1.0e-34, Identities = 84/209 (40%), Positives = 126/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y ++EA+ L K  + AKF  +I++AI L +D   +DQ +RG  +LP   G+  R+ V  +G    +AK+ G +  G  +L+  I  G ++FD  I TP +MP + +LGK+LG RGLMPNPK G VT D+   +A  K G  ++R +  G IH  +GKA+    K+ ENI   +  +   + T  KG ++++V +SSTMGPGI+V
  S:    16 DRLKLYPLDEALALLKARTTAKFDETIEVAINLGVDPRHADQMVRGVCNLPNGSGRTVRVAVFARGAKADEAKAAGADIVGAEDLLETIQGGTIEFDRCIATPDLMPLVGRLGKVLGPRGLMPNPKVGTVTMDVKGAVAAAKGGAVEFRVEKAGIIHGGIGKASFPADKLAENIRAFVDAVVKAKPTGAKGTYVQRVAVSSTMGPGIKV 224
>gi|170738715|ref|YP_001767370.1| ribosomal protein L1 [Methylobacterium sp. 4-46] >gi|168192989|gb|ACA14936.1| ribosomal protein L1 [Methylobacterium sp. 4-46] (235 aa)
Score = 380, Expect = 1.0e-34, Identities = 83/209 (39%), Positives = 124/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++ +AV + K  S AKF  + +I++ L +D   +DQ +RG  +LP   G+  R+ V  +G    +A++ G +  G  +L+  I  G +DFD  I TP MMP + +LGK+LG RGLMPNPK G VT D+   +   K G  ++R +  G +H  +GK + D  KIVEN       +A  + T  KG +I+++ +SSTMGPGI+V
  S:    16 DPTKVYSLTDAVKMIKDRSKAKFDETFEISMNLGVDPRHADQMVRGVCNLPNGSGRTVRVAVFARGAKADEARAAGADIVGAEDLLETIQGGTIDFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTMDVKGAVGAAKGGAVEFRVEKAGIVHAGIGKVSFDDQKIVENARAFADAVARAKPTGAKGTYIQRIAVSSTMGPGIKV 224
>gi|85706807|ref|ZP_01037898.1| 50S ribosomal protein L1 [Roseovarius sp. 217] >gi|85668600|gb|EAQ23470.1| 50S ribosomal protein L1 [Roseovarius sp. 217] (232 aa)
Score = 380, Expect = 1.1e-34, Identities = 80/210 (38%), Positives = 127/210 (60%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           ++E+A++L K  + AKF  +++I++ L +D   +DQ +RG V LP   GK  R+ V  +G    +A + G +  G  +L+  +  G ++FD  I TP MMP + +LGK+LG R LMPNPK G VT D+ + + + K G  Q++ +  G +H  +GKA+ D  K+ EN+   +S +   R T  KG +++K++LSSTMG GI V +N   V
  S:    22 SVEDAISLIKGCATAKFDETVEISMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGAKADEALAAGADIVGAEDLMETVQSGKIEFDRCIATPDMMPVVGRLGKVLGPRNLMPNPKVGTVTMDVAQAVKDAKGGQVQFKAEKAGVVHAGIGKASFDAVKLAENVRAFVSAVQRARPTGAKGTYVKKISLSSTMGAGITVDINSAVV 231
>gi|169634597|ref|YP_001708333.1| 50S ribosomal protein L1 [Acinetobacter baumannii SDF] >gi|169153389|emb|CAP02516.1| 50S ribosomal protein L1 [Acinetobacter baumannii] (231 aa)
Score = 380, Expect = 1.1e-34, Identities = 91/225 (40%), Positives = 127/225 (56%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           K  K  +   +  K YT+EEAV +      AKF  S+DI++ L +D  KSDQ +RG  +LP   GK  R+ V  +G   + AK  G +  G  +L   I  G LDFD++I  P  M  + KLG ILG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +G+   D A I +N+  L++ +   +  + KG++I+K+ LSSTMGPG+ V VN  +
  S:     6 KRQKAIAAAVEANKVYTLEEAVQVLNSLPAAKFKESLDISVNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAESIQGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQARYRVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTMGPGLTVDVNNVS 230
>gi|169797456|ref|YP_001715249.1| 50S ribosomal protein L1 [Acinetobacter baumannii AYE] >gi|169150383|emb|CAM88280.1| 50S ribosomal protein L1 [Acinetobacter baumannii] >gi|193076141|gb|ABO10754.2| 50S ribosomal protein [Acinetobacter baumannii ATCC 17978] (231 aa)
Score = 380, Expect = 1.1e-34, Identities = 91/225 (40%), Positives = 127/225 (56%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           K  K  +   +  K YT+EEAV +      AKF  S+DI++ L +D  KSDQ +RG  +LP   GK  R+ V  +G   + AK  G +  G  +L   I  G LDFD++I  P  M  + KLG ILG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +G+   D A I +N+  L++ +   +  + KG++I+K+ LSSTMGPG+ V VN  +
  S:     6 KRQKAIAAAVEANKVYTLEEAVQVLNSLPAAKFKESLDISVNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAESIQGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQARYRVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTMGPGLTVDVNNVS 230
>gi|118591197|ref|ZP_01548596.1| 50S ribosomal protein L1 [Stappia aggregata IAM 12614] >gi|118436273|gb|EAV42915.1| 50S ribosomal protein L1 [Stappia aggregata IAM 12614] (232 aa)
Score = 380, Expect = 1.1e-34, Identities = 86/219 (39%), Positives = 127/219 (57%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      DR K Y++ EA+ L K  S  KF  ++++AI L +D   +DQ +RG   LP   GK  R+ V  +G   ++AK+ G +  G  EL+ E+  G +DFD  I TP MMP + +LGK+LG RGLMPNPK G VT D+   + + K G  Q+R +  G +H  VGK +     I EN+  LL  +   + +  KG +++++ +SSTMGPG++V
  S:     6 KRIKSAREGIDRNKLYSLNEAIGLVKDRSKTKFDETVEVAINLGVDPRHADQMVRGVCILPNGTGKTVRVAVFARGDKAEEAKAAGADIVGAEELVQEVQGGKIDFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTPDVKSAVNDAKGGAVQFRVEKAGIVHAGVGKVSFSEEAITENVRALLDAVQKAKPSGAKGTYLKRIAVSSTMGPGVKV 224
>gi|153816494|ref|ZP_01969162.1| hypothetical protein RUMTOR_02747 [Ruminococcus torques ATCC 27756] >gi|145846190|gb|EDK23108.1| hypothetical protein RUMTOR_02747 [Ruminococcus torques ATCC 27756] (230 aa)
Score = 380, Expect = 1.1e-34, Identities = 89/209 (42%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +R   Y  EEAV L K+ + AKF  +I+  I+   D   +DQQ+RG V LP+  GK+ RILV  K    ++AK+ G +  G  ELI +I ++GWLDFD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ +GKA+    ++ +N   L+  I   R ++VKG +++ + L+STMGPG++V
  S:    15 ERGNLYEKEEAVALVKKAATAKFDETIEAHIRTGCDGRHADQQIRGAVVLPHGTGKKVRILVFAKDAKAEEAKAAGADFVGGDELIPKIQNEGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAINDIKAGKIEYRLDKTNIIHVPIGKASFTEEQLADNFQTLIDAINKARPSAVKGQYLKSITLTSTMGPGVKV 224
>gi|148244881|ref|YP_001219575.1| 50S ribosomal protein L1 [Candidatus Vesicomyosocius okutanii HA] >gi|160174570|sp|A5CW28|RL1_VESOH 50S ribosomal protein L1 >gi|146326708|dbj|BAF61851.1| 50S ribosomal protein L1 [Candidatus Vesicomyosocius okutanii HA] (231 aa)
Score = 380, Expect = 1.2e-34, Identities = 85/219 (38%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K  S   +  K+Y+I +A+NL K  + AKF  SID++I L +D  K DQ +RG+V LP   GK  R+ V  +G     A+  G +  G  +L+  +  G L +D++I +P  M  + +LG++LG RGLMPNPK G VT+D+   ++  K G  +YR D  G IH  VGK + + + + +NIN L+  +   + +S KG++ +K+++SSTMGPG  V
  S:     6 KNQKYISTKVEHNKYYSINDALNLLKICAIAKFDESIDVSINLGIDVKKYDQNIRGSVILPNGTGKVVRVAVFTQGDNVIKAQDAGADVVGMEDLMKSMQGGDLSYDVVIASPDAMGVVGRLGQLLGPRGLMPNPKVGTVTSDVSLAVSNAKSGQLRYRADKAGIIHGCVGKVSFNISALAQNINVLIGELKKVKPSSAKGVYFKKLSISSTMGPGFSV 224
>gi|145220411|ref|YP_001131120.1| 50S ribosomal protein L1 [Prosthecochloris vibrioformis DSM 265] >gi|145206575|gb|ABP37618.1| LSU ribosomal protein L1P [Prosthecochloris vibrioformis DSM 265] (229 aa)
Score = 380, Expect = 1.2e-34, Identities = 83/226 (36%), Positives = 135/226 (59%)
  Q:     7 VTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNK 232
           +  K  +  +   DR + Y + +AV   ++ +  KF +++D+A+KL +D   +DQ +RGTV LP+  GK   +LV+ K     +A+  G +  G  E + +I  GW   D+I+ TP +M +L K+ KILG RGLMPNPK+G VT D+ K + E K G  ++R D  GN+H  VGK +    ++V NI+  L  +   + ++ KG++++ + LSSTM P +RV ++K
  S:     1 MAGKNYRDAASQVDRNQEYDLADAVAKIREITKTKFDATVDVAVKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAKVAEAEEAGADFVGFEEYVEKIQNGWTGVDVIVATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRVDKAGNVHAPVGKVSFGADQLVANISSFLREVVRLKPSAAKGLYVQGIALSSTMSPSVRVKMDK 226
>gi|163755833|ref|ZP_02162951.1| 50S ribosomal protein L1 [Kordia algicida OT-1] >gi|161324354|gb|EDP95685.1| 50S ribosomal protein L1 [Kordia algicida OT-1] (230 aa)
Score = 379, Expect = 1.2e-34, Identities = 86/219 (39%), Positives = 133/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     D+ K Y++ EA +L K+ +N KF +S+D+A++L +D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G ++ G  E + +I  GW D D+IIT P +M +L  LG+ILG RGLMPNPK G VT D+ K +AE K G   ++ D  G +H  +GK++    KI  N   LL  +   + T+ KG +I+ + +SSTM P + V
  S:     6 KKQKEALAKVDKNKLYSVAEASSLVKEITNVKFDASVDLAVRLGVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADYVGLDEYLQKIKGGWTDVDVIITMPSVMGKLGPLGRILGPRGLMPNPKTGTVTMDVAKAVAEVKAGKIDFKVDKTGIVHAAIGKSSFSPEKIQGNATELLQTLIKLKPTAAKGTYIKSIYMSSTMSPSVAV 224
>gi|160166883|sp|A3M1G0|RL1_ACIBT 50S ribosomal protein L1 (231 aa)
Score = 379, Expect = 1.2e-34, Identities = 91/225 (40%), Positives = 127/225 (56%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           K  K  +   +  K YT+EEAV +      AKF  S+DI++ L +D  KSDQ +RG  +LP   GK  R+ V  +G   + AK  G +  G  +L   I  G LDFD++I  P  M  + KLG ILG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +G+   D A I +N+  L++ +   +  + KG++I+K+ LSSTMGPG+ V VN  +
  S:     6 KRQKAIAAAVEANKVYTMEEAVQVLNSLPAAKFKESLDISVNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAESIQGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQARYRVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTMGPGLTVDVNNVS 230
>gi|56698335|ref|YP_168708.1| 50S ribosomal protein L1 [Silicibacter pomeroyi DSS-3] >gi|81348894|sp|Q5LMQ0|RL1_SILPO 50S ribosomal protein L1 >gi|56680072|gb|AAV96738.1| ribosomal protein L1 [Silicibacter pomeroyi DSS-3] (232 aa)
Score = 379, Expect = 1.3e-34, Identities = 84/205 (40%), Positives = 126/205 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           ++E+AV L K  ++AKF  +++IA+ L +D   +DQ +RG V LP   GK  R+ V  +G   ++A++ G +  G  +L+  I  G ++FD  I TP MMP + +LGKILG R LMPNPK G VT D+ + +   K G  Q++ +  G IH  VGK + D AK+VEN+   +  +A  +    KG +++K+ LSSTMGPG+ V V
  S:    22 SVEQAVALIKSAASAKFDETVEIAMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGPKAEEAQAAGADIVGAEDLMETIQSGKIEFDRCIATPDMMPVVGRLGKILGPRNLMPNPKVGTVTMDVAQAVQNAKGGEVQFKVEKAGVIHAGVGKVSFDEAKLVENVRAFVDAVAKAKPAGAKGTYLKKIALSSTMGPGVSVDV 226
>gi|167753044|ref|ZP_02425171.1| hypothetical protein ALIPUT_01310 [Alistipes putredinis DSM 17216] >gi|167659358|gb|EDS03488.1| hypothetical protein ALIPUT_01310 [Alistipes putredinis DSM 17216] (232 aa)
Score = 379, Expect = 1.3e-34, Identities = 80/206 (38%), Positives = 131/206 (63%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y + EA  L K+ +  KF +S+D+ ++L +D  K++Q +RG V+LP+  GK+ R+LVL     + +A++ G ++ G  E + +I  GW D D+II TP +M ++  LG+ILG RGLMPNPK G VT ++ K ++E K G   ++ D +G IH  VGK +    +I +N+N +LS I   +  + KG +++ + LS+TM PG+++
  S:    19 KAYKLTEAAALLKEITFTKFDASVDVDVRLGVDPRKANQMVRGVVTLPHGTGKQVRVLVLCTPEKEAEAQAAGADYVGLDEYVEKIKSGWTDIDVIICTPNVMGKVGALGRILGPRGLMPNPKTGTVTMEVGKAVSEVKSGKIDFKVDKFGIIHTSVGKISFSAEQIADNVNTVLSMIMKLKPAAAKGSYVKSIFLSTTMSPGLQI 224
>gi|170788980|gb|EDT30024.1| ribosomal protein L1 [Oligotropha carboxidovorans OM5] (230 aa)
Score = 379, Expect = 1.3e-34, Identities = 83/209 (39%), Positives = 125/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y I +A+ L K+ + AKF  +I++AI L +D   +DQ +RG V+LP   G+  R+ V  +G    +AK+ G +  G  +L+  +  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G I   VGKA+    K+VENI  L   +   +    KG ++++V +SSTMGPG++V
  S:    15 DREKLYAIADAIKLVKERATAKFDETIEVAINLGVDPRHADQMVRGVVTLPNGTGRTLRVGVFARGAKADEAKAAGADVVGAEDLVEIVQGGKIEFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVKGAKGGSVEFRVEKAGIIQAGVGKASFSEEKLVENIKALADAVVKAKPAGAKGTYVQRVAVSSTMGPGVKV 223
>gi|189345742|ref|YP_001942271.1| ribosomal protein L1 [Chlorobium limicola DSM 245] >gi|189339889|gb|ACD89292.1| ribosomal protein L1 [Chlorobium limicola DSM 245] (229 aa)
Score = 379, Expect = 1.4e-34, Identities = 86/222 (38%), Positives = 133/222 (59%)
  Q:     7 VTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +  K  ++     DR + Y + EAV   ++ + AKF ++ID+A++L +D   +DQ +RGTV LP+  GK   +LV+ K    ++AK  G +  G  E I +I  GW D D+II TP +M +L K+ KILG RGLMPNPK+G VT D+ K + E K G  ++R D  GN+H  VGK +     +VENI   +  +   + ++ KG +++ + +SSTM P ++V
  S:     1 MAGKKYREALAKIDRFQEYDLAEAVGKIREITEAKFDATIDVALRLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAKAEEAKEAGADLVGFEEYIEKIQSGWTDVDVIIATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRVDKAGNVHAPVGKVSFQPEHLVENITSFVREVVRLKPSAAKGQYLQSIAVSSTMSPSVKV 222
>gi|71278611|ref|YP_271416.1| 50S ribosomal protein L1 [Colwellia psychrerythraea 34H] >gi|91207348|sp|Q47UV6|RL1_COLP3 50S ribosomal protein L1 >gi|71144351|gb|AAZ24824.1| ribosomal protein L1 [Colwellia psychrerythraea 34H] (232 aa)
Score = 379, Expect = 1.4e-34, Identities = 86/209 (41%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y I EAV+L K+ + A F  S+D+A+ L +D  KSDQ +RG   LP   G+E R+ V  +G   + AK+ G +  G  +L A++  G ++FD++I +P  M  + +LG+ILG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +GKA+ + A++ EN+  LL  +   +  + KG +++KV+LS+TMG G+ V
  S:    16 DVTKEYDINEAVSLLKEFATANFRESVDVAVNLGIDARKSDQNVRGATVLPNGTGREVRVAVFTQGENAEKAKAAGADIVGMEDLAAQVKAGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQIRYRNDKNGIIHTTIGKADFEPAQLQENLESLLEALKKAKPANAKGQYLKKVSLSTTMGAGVVV 224
>gi|164686517|ref|ZP_02210545.1| hypothetical protein CLOBAR_00084 [Clostridium bartlettii DSM 16795] >gi|164604386|gb|EDQ97851.1| hypothetical protein CLOBAR_00084 [Clostridium bartlettii DSM 16795] (232 aa)
Score = 379, Expect = 1.5e-34, Identities = 84/209 (40%), Positives = 136/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y  +EA+ L  + + AKF  +++  IKL +D+  +DQQ+RG + LP+  GK K++LV  KG   K+A++ G +  G  +L+ +I K  W DFD+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K + E K G  +YR D    IH+ +GK +    K+ EN N L++ I   + ++ KG ++  ++++STMGPG+++
  S:    16 DRTKLYESKEALALVSEIATAKFDETVEAHIKLGVDSRHADQQVRGAIVLPHGTGKTKKVLVFAKGEKAKEAEAAGADFVGAEDLVQKIQKENWFDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVTKAVEEIKAGKVEYRLDKSNIIHVAIGKVSFGGEKLAENFNVLMNAIIKAKPSAAKGQYLRSISVTSTMGPGVKI 225
>gi|90424960|ref|YP_533330.1| 50S ribosomal protein L1 [Rhodopseudomonas palustris BisB18] >gi|122475720|sp|Q211C5|RL1_RHOPB 50S ribosomal protein L1 >gi|90106974|gb|ABD89011.1| LSU ribosomal protein L1P [Rhodopseudomonas palustris BisB18] (230 aa)
Score = 378, Expect = 1.6e-34, Identities = 82/219 (37%), Positives = 130/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  KK     DR K Y + +A+ + K+ + +KF  +I+IAI L +D   +DQ +RG V+LP   G+  R+ V  +G    +A++ G +  G  +L+ ++  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G +   +GKA+    K+VENI  L   ++  +    KG +I++V +SSTMGPG++V
  S:     5 KRLKKAREGVDREKLYPLADAIKMVKERAVSKFDETIEIAINLGVDPRHADQMVRGVVTLPNGTGRTLRVGVFARGAKADEARAAGADVVGAEDLVEKVQGGTIEFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDITNAVKGAKGGSVEFRVEKAGIVQAGIGKASFGEDKLVENIKALTDAVSKAKPAGAKGTYIQRVAVSSTMGPGVKV 223
>gi|170077649|ref|YP_001734287.1| ribosomal protein L1 [Synechococcus sp. PCC 7002] >gi|169885318|gb|ACA99031.1| ribosomal protein L1 [Synechococcus sp. PCC 7002] (238 aa)
Score = 378, Expect = 1.6e-34, Identities = 82/207 (39%), Positives = 126/207 (60%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           Y   EA+ L K+T+ AKF  + +  I+L +D   +DQQLR TV+ P   G+  R+ V+  G   K A+  G +  G  ELI +I KG +DF+++I TP MMP++++LG+ LG RGLMP+PK G VTTD+   IA FK G  ++R D  G +H++ GK++     ++ N+  L   I   R +  KG +   + +S++MGP I+V +N
  S:    21 YEPLEALTLLKETATAKFDETAEAHIRLGIDPKYTDQQLRTTVAFPKGTGQSVRVAVITSGEQVKVAEESGADLVGSEELIEDIQKGMMDFEVLIATPDMMPKVARLGRQLGPRGLMPSPKGGTVTTDVATAIAAFKAGKQEFRADRAGIVHVLFGKSSFAAEDLLVNLKALQETIDRNRPSGAKGRYWRSIYVSASMGPSIQVDIN 227
>gi|90994529|ref|YP_537019.1| ribosomal protein L1 [Porphyra yezoensis] >gi|122194670|sp|Q1XDE9|RK1_PORYE Chloroplast 50S ribosomal protein L1 >gi|90819093|dbj|BAE92462.1| 50S ribosomal protein L1 [Porphyra yezoensis] (229 aa)
Score = 378, Expect = 1.7e-34, Identities = 93/206 (45%), Positives = 127/206 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K YTI EAV++ K TSNAKF  + +  I L L+   +DQQLR TV LP   GK  ++ V+ KG    +A S G + +G  ELI EI KG LDFD +I TP +MP ++KLG++LG RGLMP+PK G VT D+ K + EFK G  +YR D  G IH+  GK++     +V N+  +   I   + +  KG + +   LSSTMGP I++
  S:    18 KLYTINEAVSILKATSNAKFKETAEAHIALGLNPKYADQQLRATVILPKGTGKLIKVAVIAKGEKLTEAISAGADVSGSEELIDEILKGRLDFDKLIATPDVMPLIAKLGRVLGPRGLMPSPKAGTVTLDVAKAVNEFKGGKVEYRVDRTGIIHVPFGKSSFSQEDLVLNLQTIKESIDRNKPSGAKGKYWKTFFLSSTMGPSIQI 223
>gi|172087774|ref|YP_205801.2| 50S ribosomal subunit protein L1 [Vibrio fischeri ES114] >gi|160174718|sp|Q5E234|RL1_VIBF1 50S ribosomal protein L1 >gi|171902361|gb|AAW86913.2| 50S ribosomal subunit protein L1 [Vibrio fischeri ES114] (234 aa)
Score = 378, Expect = 1.7e-34, Identities = 85/207 (41%), Positives = 127/207 (61%)
  Q:    22 TKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           TK Y I EAV L K+ + AKF  S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G   + AK  G +  G  +L   + KG ++FD+++ +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK + D A++ EN+  LL  +   + TS KG F++KV++S+TMG G+ +
  S:    18 TKEYDINEAVALLKELATAKFTESVDVAVNLGIDARKSDQNVRGATVLPHGTGREIRVAVFTQGANAEAAKEAGADLVGMEDLAELVKKGEMNFDVVVASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDAAQLKENLEALLVALKKAKPTSAKGTFVKKVSISTTMGAGVSL 224
>gi|159042817|ref|YP_001531611.1| 50S ribosomal protein L1 [Dinoroseobacter shibae DFL 12] >gi|189041814|sp|A8LLK0|RL1_DINSH 50S ribosomal protein L1 >gi|157910577|gb|ABV92010.1| ribosomal protein L1 [Dinoroseobacter shibae DFL 12] (232 aa)
Score = 378, Expect = 1.8e-34, Identities = 85/206 (41%), Positives = 128/206 (62%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           T+EEAV L K  + +KF  +++IA+ L +D   +DQ +RG VSLP   GK  R+ V  +G   ++A++ G +  G  +L+  I  G ++FD  I TP MMP + +LGKILG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK+VEN+   +  ++  + +  KG +++K+ LSSTMGPG+ V V+
  S:    22 TVEEAVALIKANATSKFDETVEIAMCLGVDPRHADQMVRGVVSLPNGTGKTVRVAVFARGPKAEEAQAAGADIVGAEDLMETIQSGKIEFDRCIATPDMMPIVGRLGKILGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQFKAEKAGVVHAGVGKASFDEAKLVENVRAFVDAVSKAKPSGAKGSYMKKIALSSTMGPGVTVAVD 227
>gi|163847742|ref|YP_001635786.1| ribosomal protein L1 [Chloroflexus aurantiacus J-10-fl] >gi|187599273|ref|ZP_02985507.1| ribosomal protein L1 [Chloroflexus sp. Y-400-fl] >gi|189041807|sp|A9WFP7|RL1_CHLAA 50S ribosomal protein L1 >gi|163669031|gb|ABY35397.1| ribosomal protein L1 [Chloroflexus aurantiacus J-10-fl] >gi|187488705|gb|EDU26672.1| ribosomal protein L1 [Chloroflexus sp. Y-400-fl] (237 aa)
Score = 378, Expect = 1.8e-34, Identities = 84/209 (40%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNV--TTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRT+ Y+  EA+ L K+TS  KF  +++  ++L +D   +DQ +R TV+LP+  GK  R+LV  +G   + A   G ++AG  +LIA I +  + DFD+ I TP MM ++ ++G+ LG RGLMPNPK+G +    DL +TI E K G  + R D  G +H+ +GK +    ++ EN   L+  + A + +  KG +I  V L+STMGPG+ V
  S:    16 DRTRLYSPTEALALVKETSYTKFDGTVEAHLRLGIDPRHADQNIRTTVALPHGTGKTVRVLVFAQGEAVQAALDAGADYAGSDDLIARIDRENFFDFDVAIATPDMMGKVGRIGRKLGPRGLMPNPKSGTIVPAADLARTIREVKGGRVEIRNDKTGILHVAIGKVSFTPQQLSENFVALMDAVKAAKPSGAKGTYIRSVTLTSTMGPGVPV 227
>gi|84499874|ref|ZP_00998140.1| 50S ribosomal protein L1 [Oceanicola batsensis HTCC2597] >gi|84391808|gb|EAQ04076.1| 50S ribosomal protein L1 [Oceanicola batsensis HTCC2597] (240 aa)
Score = 378, Expect = 1.8e-34, Identities = 84/203 (41%), Positives = 124/203 (61%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T+EEAV L K     KF  +++IA+ L +D   +DQ +RG V LP   GK+ R+ V  +G   ++A++ G +  G  +L+  I  G ++FD  I TP MMP + +LGKILG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGKA+ D AK+VENI   +  ++  +    KG +++K++LSSTMGPG+ V
  S:    22 TVEEAVALIKANVKTKFDETVEIAMNLGVDPRHADQMVRGVVGLPNGTGKDVRVAVFARGPKAEEAQAAGADIVGAEDLMETIQGGKIEFDRCIATPDMMPIVGRLGKILGPRNLMPNPKVGTVTMDVADAVKAAKGGEVQFKAEKAGVVHAGVGKASFDEAKLVENIRAFVDAVSKAKPAGAKGTYMKKISLSSTMGPGVTV 224
>gi|116624536|ref|YP_826692.1| 50S ribosomal protein L1P [Solibacter usitatus Ellin6076] >gi|122252854|sp|Q01VA8|RL1_SOLUE 50S ribosomal protein L1 >gi|116227698|gb|ABJ86407.1| LSU ribosomal protein L1P [Solibacter usitatus Ellin6076] (237 aa)
Score = 378, Expect = 2.0e-34, Identities = 84/207 (40%), Positives = 128/207 (61%)
  Q:    22 TKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K Y +EEA+ L K+   AKF  ++++ ++L +D   +DQ +RGTV +P   GK K++LV+  G  Q++A   G +  G  +++ +I S+ W D+D +I TP MM  + KLGK+LG RGLMPNPK G VT D+ K IAE K G  ++R D  G IH  VGK +    K+VEN + L++ +   +    KG ++    + STMGPG+ +
  S:    18 SKEYQLEEAIPLIKKIKFAKFDETVEVHMRLGVDPKHADQMVRGTVLMPNGLGKSKKVLVIASGDKQREATEAGADFVGGEDMVNKIQSESWTDYDAVIATPDMMRSVGKLGKVLGPRGLMPNPKTGTVTVDVAKAIAEIKAGKVEFRVDKTGIIHAPVGKISFSADKLVENASSLIAAVIKAKPAVAKGKYVRSATVCSTMGPGVAI 225
>gi|47458974|ref|YP_015836.1| 50S ribosomal protein L1 [Mycoplasma mobile 163K] >gi|61215558|sp|Q6KIF1|RL1_MYCMO 50S ribosomal protein L1 >gi|47458302|gb|AAT27625.1| 50S ribosomal protein l1 [Mycoplasma mobile 163K] (233 aa)
Score = 378, Expect = 2.0e-34, Identities = 96/208 (46%), Positives = 134/208 (64%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKD-AKSLGVNHAGDSELIAEISKGW-LDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           K Y+++EA+ +AK+TS  KF +SIDI++KLNLDT K+DQQLRG+VSLP   GK  R+L       Q D AK  G N   +   + EI K    DFD+++T PKMMP L K GK+LG +GLMPNPK G VT ++ K + E KKG   YR D  G I+  +GK +  T  +VEN   L+  I   +  +VKGI+++ + +S+TMGP  ++ +
  S:    22 KIYSLDEAIEMAKKTSFVKFDASIDISLKLNLDTRKADQQLRGSVSLPNGTGKIIRVLATSDEKEQLDLAKKAGANIVANKSDLEEILKSEKFDFDIMVTDPKMMPTLGKYGKVLGPKGLMPNPKTGTVTPNIAKAVEEIKKGKANYRADKGGIINSSIGKVSMGTTSLVENAKVLIDTIRKLKPATVKGIYMQNLTISTTMGPSFKIKI 231
>gi|161870926|ref|YP_001600106.1| 50S ribosomal protein L1 [Neisseria meningitidis 053442] >gi|189041825|sp|A9M3X7|RL1_NEIM0 50S ribosomal protein L1 >gi|161596479|gb|ABX74139.1| 50S ribosomal protein L1 [Neisseria meningitidis 053442] (231 aa)
Score = 377, Expect = 2.2e-34, Identities = 89/209 (42%), Positives = 127/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +  K Y I+EA+ L K+ + AKF  S+D++  L +D  KSDQ +RG+V LP   GK  R+ V  +G   + AK  G +  G  +L AEI  G L+FD++I +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  QYRTD  G +H  +G+A+   A + EN + LL  I   +  + KG +++KV +SSTMG GIRV
  S:    16 EANKLYAIDEAIALVKKAATAKFDESVDVSFNLGVDPRKSDQVIRGSVVLPKGTGKTTRVAVFTQGANAEAAKEAGADIVGFEDLAAEIKAGNLNFDVVIASPDAMRIVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVQYRTDKAGIVHATIGRASFAEADLKENFDALLDAIVKAKPAAAKGQYLKKVAVSSTMGLGIRV 224
>gi|156744232|ref|YP_001434361.1| ribosomal protein L1 [Roseiflexus castenholzii DSM 13941] >gi|156235560|gb|ABU60343.1| ribosomal protein L1 [Roseiflexus castenholzii DSM 13941] (240 aa)
Score = 377, Expect = 2.2e-34, Identities = 90/209 (43%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTT--DLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR + YT EEA+ L K+TS   F  ++++ ++L +D   +DQ +R TVSLP+  GK  R+LV  +G   + A+  G +  G  +LIA I K  + DFD+ I TP MM ++ ++G+ LG RGLMPNPK+G V    DLP+TI E + G  ++R D  G +H+ VGK + +  +I ENI  L+  + A R  + KG +I  V  +STM PGIRV
  S:    17 DRQRLYTPEEAIKLLKETSFTTFDPTVEVHLRLGIDPRHADQTIRTTVSLPHGTGKTVRVLVFAQGEAAQAAREAGADFVGADDLIARIDKENFFDFDIAIATPDMMGKVGRIGRKLGPRGLMPNPKSGTVVQPEDLPRTIREVRGGRVEFRNDKTGLLHVAVGKLSFNEPQIYENIAALMEAVKAARPAAAKGTYIRSVTFTSTMSPGIRV 228
>gi|88802464|ref|ZP_01117991.1| 50S ribosomal protein L1 [Polaribacter irgensii 23-P] >gi|88781322|gb|EAR12500.1| 50S ribosomal protein L1 [Polaribacter irgensii 23-P] (229 aa)
Score = 377, Expect = 2.3e-34, Identities = 89/221 (40%), Positives = 130/221 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           K  K+     D +K Y +  A  L K  +N KF +S+D+AI+L +D  K++Q +RG V+LP+  GK+ ++L L     + +A   G ++ G  E + +I  GW D D+IIT P +M +L  LG+ILG RGLMPNPK G VT D+ K + + K G   ++ D  G IH  +GK + D  KI EN N L+  I   + T+ KG +++ V +SSTM P I V V
  S:     6 KKQKEAHAKLDSSKSYGLAAASALVKDITNVKFDASVDLAIRLGVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEALEAGADYVGLDEYLQKIKGGWTDVDVIITMPSVMGKLGPLGRILGPRGLMPNPKTGTVTMDVAKAVQDVKAGKIDFKVDKTGIIHAAIGKVSFDAKKIEENANELIQTIIKLKPTTAKGTYVKSVFMSSTMSPSIEVEV 226
>gi|15607781|ref|NP_215155.1| 50S ribosomal protein L1 [Mycobacterium tuberculosis H37Rv] >gi|15840044|ref|NP_335081.1| 50S ribosomal protein L1 [Mycobacterium tuberculosis CDC1551] >gi|148660415|ref|YP_001281938.1| 50S ribosomal protein L1 [Mycobacterium tuberculosis H37Ra] >gi|148821845|ref|YP_001286599.1| 50S ribosomal protein L1 [Mycobacterium tuberculosis F11] >gi|194543024|ref|YP_002078053.1| 50S ribosomal protein L1 rplA [Mycobacterium tuberculosis C] >gi|160166282|sp|A5U026|RL1_MYCTA 50S ribosomal protein L1 >gi|6225973|sp|P96932|RL1_MYCTU 50S ribosomal protein L1 >gi|1877379|emb|CAB07100.1| PROBABLE 50S RIBOSOMAL PROTEIN L1 RPLA [Mycobacterium tuberculosis H37Rv] >gi|13880190|gb|AAK44895.1| ribosomal protein L1 [Mycobacterium tuberculosis CDC1551] >gi|124600031|gb|EAY59041.1| 50S ribosomal protein L1 rplA [Mycobacterium tuberculosis C] >gi|134149109|gb|EBA41154.1| 50S ribosomal protein L1 rplA [Mycobacterium tuberculosis str. Haarlem] >gi|148504567|gb|ABQ72376.1| 50S ribosomal protein L1 [Mycobacterium tuberculosis H37Ra] >gi|148720372|gb|ABR04997.1| 50S ribosomal protein L1 rplA [Mycobacterium tuberculosis F11] (235 aa)
Score = 377, Expect = 2.3e-34, Identities = 87/221 (39%), Positives = 133/221 (60%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T+K  +  +   DRT  YT  +A  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G     A + G +  G  +LI  I  GWL+FD  I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +A+ K G   +R D   N+H V+GKA+ D   + EN    +  +   + +S KG +++K+ +S+T GPGI V
  S:     4 TSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERIQGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGIPV 224
>gi|86134003|ref|ZP_01052585.1| 50S ribosomal protein L1 [Tenacibaculum sp. MED152] >gi|85820866|gb|EAQ42013.1| 50S ribosomal protein L1 [Polaribacter dokdonensis MED152] (229 aa)
Score = 377, Expect = 2.4e-34, Identities = 89/221 (40%), Positives = 131/221 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           K  K+     D T+ Y +  A  L K  +N KF +S+D+AI+L +D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G ++ G  E + +I  GW D D+IIT P +M +L  LG+ILG RGLMPNPK G VT D+ K + + K G   ++ D  G +H  +GK + D  KI EN N L+  I   + T+ KG +++ V +SSTM P I V V
  S:     6 KKQKEAYAKVDNTQSYDLAAASALVKDITNVKFDASVDLAIRLGVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADYVGLDEYLQKIKGGWTDVDVIITMPSVMGKLGPLGRILGPRGLMPNPKTGTVTMDVAKAVTDVKAGKIDFKVDKTGIVHAAIGKVSFDAKKIEENANELIQTIIKLKPTTAKGTYVKSVFMSSTMSPSIPVEV 226
>gi|15229443|ref|NP_191908.1| ribosomal protein L1 family protein [Arabidopsis thaliana] >gi|75311693|sp|Q9LY66|RK1_ARATH 50S ribosomal protein L1, chloroplast precursor (CL1) >gi|7573332|emb|CAB87802.1| chloroplast ribosomal L1-like protein [Arabidopsis thaliana] >gi|15450737|gb|AAK96640.1| AT3g63490/MAA21_120 [Arabidopsis thaliana] >gi|16649119|gb|AAL24411.1| chloroplast ribosomal L1-like protein [Arabidopsis thaliana] >gi|22137008|gb|AAM91349.1| At3g63490/MAA21_120 [Arabidopsis thaliana] >gi|24899727|gb|AAN65078.1| chloroplast ribosomal L1-like protein [Arabidopsis thaliana] (346 aa)
Score = 377, Expect = 2.4e-34, Identities = 81/206 (39%), Positives = 127/206 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +  A++L KQT+N +F+ S++   +LN+D   +DQQLR TVSLP   G+   + VL +G    +AKS G +  G  +LI +I  G+++FD +I +P MM +++ LGKILG RGLMPNPK G VT ++P+ I EFKKG  ++R D  G +H+  GK N     ++ N    +  +   +    KG++ +  ++ S+MGP I++
  S:   127 KEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQTVIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILGPRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAAVKSVETNKPKGAKGVYWKSAHICSSMGPSIKL 332
>gi|7572940|emb|CAA62364.1| L1 protein [Arabidopsis thaliana] (346 aa)
Score = 377, Expect = 2.6e-34, Identities = 81/206 (39%), Positives = 127/206 (61%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y +  A++L KQT+N +F+ S++   +LN+D   +DQQLR TVSLP   G+   + VL +G    +AKS G +  G  +LI +I  G+++FD +I +P MM +++ LGKILG RGLMPNPK G VT ++P+ I EFKKG  ++R D  G +H+  GK N     ++ N    +  +   +    KG++ +  ++ S+MGP I++
  S:   127 KEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQTVIVAVLAQGEKVDEAKSAGADIVGSDDLIEQIKGGFMEFDKLIASPDMMVKVAGLGKILGPRGLMPNPKAGTVTANIPQAIEEFKKGKVEFRADKTGIVHIPFGKVNFTEEDLLINFLAAVKSVETNKPKGAKGVYWKSAHICSSMGPSIKL 332
>gi|15676056|ref|NP_273186.1| 50S ribosomal protein L1 [Neisseria meningitidis MC58] >gi|15793173|ref|NP_282995.1| 50S ribosomal protein L1 [Neisseria meningitidis Z2491] >gi|121634006|ref|YP_974251.1| 50S ribosomal protein L1 [Neisseria meningitidis FAM18] >gi|160166285|sp|A1KRG3|RL1_NEIMF 50S ribosomal protein L1 >gi|54039107|sp|P66088|RL1_NEIMB 50S ribosomal protein L1 >gi|54041601|sp|P66087|RL1_NEIMA 50S ribosomal protein L1 >gi|7225345|gb|AAF40587.1| 50S ribosomal protein L1 [Neisseria meningitidis MC58] >gi|120865712|emb|CAM09439.1| 50S ribosomal protein L1 [Neisseria meningitidis FAM18] >gi|121051192|emb|CAM07463.1| 50S ribosomal protein L1 [Neisseria meningitidis Z2491] (231 aa)
Score = 376, Expect = 2.8e-34, Identities = 89/209 (42%), Positives = 127/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +  K Y I+EA+ L K+ + AKF  S+D++  L +D  KSDQ +RG+V LP   GK  R+ V  +G   + AK  G +  G  +L AEI  G L+FD++I +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  QYRTD  G +H  +G+A+   A + EN + LL  I   +  + KG +++KV +SSTMG GIRV
  S:    16 EANKLYAIDEAIALVKKAATAKFDESVDVSFNLGVDPRKSDQVIRGSVVLPKGTGKITRVAVFTQGANAEAAKEAGADIVGFEDLAAEIKAGNLNFDVVIASPDAMRIVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVQYRTDKAGIVHATIGRASFAEADLKENFDALLDAIVKAKPAAAKGQYLKKVAVSSTMGLGIRV 224
>gi|28212183|ref|NP_783127.1| 50S ribosomal protein L1 [Clostridium tetani E88] >gi|33301441|sp|Q890N2|RL1_CLOTE 50S ribosomal protein L1 >gi|28204627|gb|AAO37064.1| LSU ribosomal protein L1P [Clostridium tetani E88] (229 aa)
Score = 376, Expect = 2.8e-34, Identities = 84/209 (40%), Positives = 138/209 (66%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D++  Y+ EEA+NL  +TS A F  +ID+A++L +D   +DQQ+RG + LP+  GK+ ++LV  KG   K+A++ G +  G  EL+ +I K  W D+D+++ TP MM  + +LG++LG +GLMPNPK+G VT D+ K + + K G  +YR D    IH+V+GK +    K+ +N   L+  I   + ++ KG +++ V++SSTMGPG+++
  S:    13 DKSTLYSSEEAMNLVVKTSKANFDETIDLAVRLGVDPRHADQQVRGAIILPHGTGKKVKVLVFAKGEKAKEAEAAGADFVGAEELVEKIQKENWFDYDVVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKALNDIKAGKVEYRVDKTAIIHVVIGKKSFGPEKLKDNFRVLMDAIIKAKPSAAKGQYLKSVSVSSTMGPGVKI 222
>gi|118602791|ref|YP_904006.1| 50S ribosomal protein L1P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|160166306|sp|A1AX78|RL1_RUTMC 50S ribosomal protein L1 >gi|118567730|gb|ABL02535.1| LSU ribosomal protein L1P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (231 aa)
Score = 376, Expect = 2.8e-34, Identities = 82/219 (37%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K   V  +  K Y+I +A+NL K+ + AKF  SID++I L +D  KSDQ +RG + LP   GK   + V  +G     A+  G +  G  +L+  +  G L++D++I +P  M  + +LG++LG RGLMPNPK G VT+D+   +   K G  +YR D  G +H  VG+ + + + + +NIN L+  +   + +S KG++ +K+++SSTMGPG+ V
  S:     6 KKQKDILVKVESNKCYSINDALNLLKECATAKFDESIDMSINLGIDAKKSDQNVRGAIVLPNGTGKTVCVAVFTQGDNIAKAQDAGADVVGMEDLMKSMQDGDLNYDVVIASPDAMGVVGRLGQVLGPRGLMPNPKVGTVTSDVATAVNNAKTGQVRYRADKAGIVHACVGRVSFNVSALTQNINVLMEALKKIKPSSAKGVYFKKLSISSTMGPGLSV 224
>gi|117924145|ref|YP_864762.1| 50S ribosomal protein L1P [Magnetococcus sp. MC-1] >gi|160166243|sp|A0L5W3|RL1_MAGSM 50S ribosomal protein L1 >gi|117607901|gb|ABK43356.1| LSU ribosomal protein L1P [Magnetococcus sp. MC-1] (229 aa)
Score = 376, Expect = 2.8e-34, Identities = 87/210 (41%), Positives = 134/210 (63%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           FDR+  + + +A+ + K+ + AKF  +I++A+ L +D   +DQ +RG+VSLP   GK  R+LV  KG   ++AK+ G +  G  +L+ +I  GWL+FD ++ TP +M  + +LGKILG R +MPNPK G VT D+ K + E K G   +R +  G IH  VGKA+     +VENI  L+  +   +  + KG +++KV++SSTMGPGI+V
  S:    15 FDRSVNHPLSDAIKIIKECATAKFDETIEVAVNLGVDPRHADQMVRGSVSLPKGTGKVVRVLVFAKGEKAEEAKAAGADVVGADDLLEKIQGGWLEFDRVVATPDVMGVVGRLGKILGPRNMMPNPKLGTVTFDVAKVVQEIKAGQVAFRVEKSGIIHAGVGKASFPVEDLVENITALVEQLRRMKPAAAKGTYMKKVSISSTMGPGIKV 224
>gi|153852605|ref|ZP_01994042.1| hypothetical protein DORLON_00015 [Dorea longicatena DSM 13814] >gi|149754247|gb|EDM64178.1| hypothetical protein DORLON_00015 [Dorea longicatena DSM 13814] (230 aa)
Score = 376, Expect = 3.0e-34, Identities = 88/209 (42%), Positives = 132/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   Y + +AV+L K+T+ AKF  +I+  I+   D   +DQQ+RG V LP+  GK+ RILV  K    ++AK+ G +  G  ELI +I ++ W +FD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I E K G  +YR D    IH+ VGKA+    ++ +N   L+  I   R  +VKG +++ V L+STMGPG+++
  S:    15 DRGTLYDVADAVSLVKKTATAKFDETIEAHIRTGCDGRHADQQIRGAVVLPHGTGKKVRILVFAKDAKAEEAKAAGADFVGGEELIPKIQNENWFEFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAIQEIKAGKIEYRLDKTNIIHVPVGKASFTEEQLTDNFQTLIDAINKVRPAAVKGQYLKSVTLTSTMGPGVKI 224
>gi|78778591|ref|YP_396703.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9312] >gi|91207367|sp|Q31CX8|RL1_PROM9 50S ribosomal protein L1 >gi|78712090|gb|ABB49267.1| LSU ribosomal protein L1P [Prochlorococcus marinus str. MIT 9312] (235 aa)
Score = 376, Expect = 3.1e-34, Identities = 84/206 (40%), Positives = 129/206 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           + Y   EA+++ K+ +NAKF  +I+  I+L +D   +DQQLR TV+LP+  G+  +I V+  G     AKS G +  G+ +L+  I+KG +DFDL+I TP MMP+++KLG++LG RGLMPNPK G VT D+   I EFK G  ++R D  G +H+  GKA+     + +N+  L   I   + +  KG + +   ++STMGP ++V
  S:    18 RIYPPLEALSIIKENANAKFDETIEAHIRLGIDPKYTDQQLRTTVALPHGTGQSIKIAVITSGENVSKAKSAGADLFGEEDLVESINKGNMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTNDIANAIKEFKAGKLEFRADKAGIVHVRFGKASFTKEALFDNLKTLQESIDKNKPSGSKGKYWKSFYVTSTMGPSVQV 223
>gi|119478597|ref|ZP_01618519.1| 50S ribosomal protein L1 [marine gamma proteobacterium HTCC2143] >gi|119448432|gb|EAW29682.1| 50S ribosomal protein L1 [marine gamma proteobacterium HTCC2143] (231 aa)
Score = 376, Expect = 3.1e-34, Identities = 84/216 (38%), Positives = 130/216 (60%)
  Q:    11 TPKKPSVN--FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           T ++ ++N   +  K Y+IE+AV L K  S+ KF  ++D+A+ L +D  KSDQ +RG  +LP+  G E R+ V  +G   + A + G +  G  +L  ++  G LDFD++I  P  M  + +LG ILG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +GK   D + + EN+  L+  +   + ++ KG++++K+ LSSTMGPG+
  S:     5 TKRQKAINEKIEEGKLYSIEDAVALLKDVSSVKFGETVDVAVNLGIDAKKSDQVVRGATTLPHGTGSEVRVAVFAQGANAEKATAAGADLVGMDDLAEQVKAGKLDFDVVIAEPAAMRVVGQLGTILGPRGLMPNPKTGTVTPDVETAVKNAKAGQVRYRIDKNGIIHGAIGKLTFDASALKENLEALIGDLQKAKPSAAKGVYLKKMVLSSTMGPGL 222
>gi|187476524|ref|YP_784548.1| 50S ribosomal protein L1 [Bordetella avium 197N] >gi|123515327|sp|Q2L2N3|RL1_BORA1 50S ribosomal protein L1 >gi|115421110|emb|CAJ47594.1| 50S ribosomal protein L1 [Bordetella avium 197N] (231 aa)
Score = 376, Expect = 3.2e-34, Identities = 89/209 (42%), Positives = 127/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRTK Y + EA+ L K+T+ AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G    G  +L  +I  G +DFD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  QYRTD  G IH  +G+A+    ++  N+  L+  +   R  + KGI++ K+ +SSTMG G RV
  S:    16 DRTKLYPVAEALTLVKETATAKFDESIDVAVQLGIDPKKSDQLVRGSVVLPAGTGKSVRVAVFAQGEKAEAARAAGAEVVGLDDLAEQIKAGQMDFDVVIASPDTMRVVGALGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQYRTDKAGIIHATIGRASFGIEQLQTNLAALVDALQKARPAAAKGIYLRKIAVSSTMGGGARV 224
>gi|52424263|ref|YP_087400.1| 50S ribosomal protein L1 [Mannheimia succiniciproducens MBEL55E] >gi|61215481|sp|Q65W45|RL1_MANSM 50S ribosomal protein L1 >gi|52306315|gb|AAU36815.1| RplA protein [Mannheimia succiniciproducens MBEL55E] (229 aa)
Score = 376, Expect = 3.2e-34, Identities = 87/219 (39%), Positives = 128/219 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ + AKF  S+D+A+ L +D  KSDQ +RG   LP   G+  R+ V  +G     AK  G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++   +   K G  +YR D  G IH  +GKA+     + +N+  LL+ +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KRMKAIKAGVDSTKAYEINEAIAVLKQFATAKFDESVDVAVNLGIDPRKSDQNVRGATVLPNGTGRSVRVAVFTQGANADAAKEAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVADAVKNAKSGQVRYRNDKNGIIHTTIGKASFSAEALTQNLQALLAALVKAKPTTAKGIFIKKVSISTTMGAGVAV 224
>gi|186685897|ref|YP_001869093.1| ribosomal protein L1 [Nostoc punctiforme PCC 73102] >gi|186468349|gb|ACC84150.1| ribosomal protein L1 [Nostoc punctiforme PCC 73102] (237 aa)
Score = 376, Expect = 3.3e-34, Identities = 88/220 (40%), Positives = 129/220 (58%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKKTAKG 242
           K Y   EA+ L K T+ AKF+ + +  I+L +D   +DQQLR TV+LP   G+  R+ V+ +G    +A + G +  G  ELI EI KG +DFD +I TP +MP+++KLGK+LG RGLMP+PK G VT D+   IAEFK G  ++R D  G +H++ GK       ++ N+  L   I   R +  KG +     +S+TMGP I++ V     +K +  G
  S:    18 KDYHPLEALALLKDTATAKFVEAAEAHIRLGIDPKYTDQQLRTTVALPKGTGQIVRVAVIARGEKVNEASNAGADIVGSEELIDEIQKGRMDFDKLIATPDVMPQVAKLGKLLGPRGLMPSPKGGTVTFDIASAIAEFKAGKLEFRADRTGIVHVMFGKTTFSPEDLLVNLKALQETIDRNRPSGAKGRYWRTFYVSATMGPSIKIDVTALRDLKLSEVG 237
>gi|126663349|ref|ZP_01734347.1| 50S ribosomal protein L1 [Flavobacteria bacterium BAL38] >gi|126625007|gb|EAZ95697.1| 50S ribosomal protein L1 [Flavobacteria bacterium BAL38] (229 aa)
Score = 376, Expect = 3.4e-34, Identities = 86/217 (39%), Positives = 136/217 (62%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGI 226
           K  K+ +   ++ K Y++++A  L KQ ++AKF  S+DIA+KL +D  K++Q +RG V+LP+  GK+ R+L L     + +AK+ G +H G  + + +I  GW D D+IIT P +M +L  LG++LG RGLMPNPK G VT D+ K +AE K G   ++ D  G +H  +G+ + D  KI EN + ++  +   + T+ KG +I+ ++LS TM P I
  S:     6 KKQKEAAAKIEKNKLYSLKDASALIKQVASAKFDESVDIAVKLGVDPRKANQMVRGVVTLPHGTGKDVRVLALVTPDKEAEAKAAGADHVGLDDYLQKIKDGWTDVDVIITMPAVMGKLGPLGRVLGPRGLMPNPKTGTVTMDVAKAVAEVKAGKIDFKVDKTGIVHAGIGRVSFDADKIYENAHEIVQTLIKLKPTAAKGTYIKSIHLSCTMSPAI 222
>gi|149925888|ref|ZP_01914151.1| 50S ribosomal protein L1 [Limnobacter sp. MED105] >gi|149825176|gb|EDM84387.1| 50S ribosomal protein L1 [Limnobacter sp. MED105] (232 aa)
Score = 376, Expect = 3.5e-34, Identities = 89/209 (42%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   Y +E+A+ L K+T+ AKF  S+D AI+L +D  KSDQ +RG+V LP   GK  R+ V  +G   ++AK+ G +  G  +L AE+  G ++FD++I +P  M  +  LG+ILG RGLMPNPK G VT D+   +   K G  Q+RTD  G IH  +G+A+ D  K+  N+  LL  +   +  S KG+++ K+ +SSTMG G+RV
  S:    16 DRNAVYPVEQALGLIKETATAKFDESVDAAIQLGVDARKSDQVVRGSVVLPAGTGKTVRVAVFAQGAKAEEAKAAGADIVGMDDLAAEVKAGNMNFDVVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRTDKAGIIHCTIGRASFDVEKLKSNLTALLDALNKSKPASSKGVYLRKIAVSSTMGGGVRV 224
>gi|126695561|ref|YP_001090447.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9301] >gi|160166293|sp|A3PAS1|RL1_PROM0 50S ribosomal protein L1 >gi|126542604|gb|ABO16846.1| 50S ribosomal protein L1 [Prochlorococcus marinus str. MIT 9301] (235 aa)
Score = 375, Expect = 3.6e-34, Identities = 83/209 (39%), Positives = 131/209 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVN 231
           + Y   EA+++ K+ +NAKF  +I+  I+L +D   +DQQLR TV+LP+  G+  +I V+  G     AK+ G +  G+ +L+  I+KG ++FDL+I TP MMP+++KLG++LG RGLMPNPK G VT D+   I EFK G  ++R D  G +H+  GKA+     + +N+  L   I   + +  KG + +   ++STMGP ++V +N
  S:    18 RIYAPLEALSIIKENANAKFDETIEAHIRLGIDPKYTDQQLRTTVALPHGTGQSIKIAVITSGENVSKAKAAGADLFGEEDLVESINKGNMEFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTNDIANAIKEFKAGKLEFRADKAGIVHVRFGKASFTKEALFDNLKTLQESIDKNKPSGAKGKYWKTFYVTSTMGPSVQVDIN 226
>gi|163730893|ref|ZP_02138363.1| 50S ribosomal protein L1 [Vibrio fischeri MJ11] >gi|161395898|gb|EDQ20197.1| 50S ribosomal protein L1 [Vibrio fischeri MJ11] (234 aa)
Score = 375, Expect = 3.7e-34, Identities = 84/207 (40%), Positives = 127/207 (61%)
  Q:    22 TKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           TK Y I EAV L K+ + AKF  S+D+A+ L +D  KSDQ +RG   LP+  G++ R+ V  +G   + AK  G +  G  +L   + KG ++FD+++ +P  M  + +LG ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK + D A++ EN+  LL  +   + TS KG F++KV++S+TMG G+ +
  S:    18 TKEYDINEAVALLKELATAKFTESVDVAVNLGIDARKSDQNVRGATVLPHGTGRDIRVAVFTQGANAEAAKEAGADLVGMEDLAELVKKGEMNFDVVVASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDAAQLKENLEALLVALKKAKPTSAKGTFVKKVSISTTMGAGVSL 224
>gi|184200232|ref|YP_001854439.1| 50S ribosomal protein L1 [Kocuria rhizophila DC2201] >gi|183580462|dbj|BAG28933.1| 50S ribosomal protein L1 [Kocuria rhizophila DC2201] (236 aa)
Score = 375, Expect = 4.0e-34, Identities = 88/216 (40%), Positives = 131/216 (60%)
  Q:    23 KFYTIEEAVNLAKQTSN-AKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           KFY   EAV LAK+ +  +K   ++++A++L +D  K+DQ +RGTV+LP   GK  R++V   G     A++ G +  G+ +LIA I  GW DFD  + TP MM ++ +LGKILG R LMPNPK G VT D+ K + + K G   +R D + N+H ++GKA+ D  K+ EN    L  +   + ++ KG +I K  +++T GPGI V  N T V  +
  S:    19 KFYAPAEAVALAKELAEGSKSDPTVEVAMRLGVDPRKADQMVRGTVNLPNGTGKTARVVVFATGDKAAAAEAAGADFVGNDDLIARIQGGWTDFDAAVATPDMMGKVGRLGKILGPRNLMPNPKTGTVTMDVAKAVNDIKGGKIDFRVDKHSNLHFIIGKASFDAQKLAENYGAALEEVLRLKPSASKGRYITKATVATTFGPGIPVDPNATEVTTQ 235
>gi|153092954|gb|EDN73980.1| ribosomal protein L1 [Mannheimia haemolytica PHL213] (229 aa)
Score = 375, Expect = 4.0e-34, Identities = 88/219 (40%), Positives = 136/219 (62%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EAV + K+ + AKF+ S+D+A+ L +D+ KSDQ +RG   LP+  G+  R+ V  +G   + AK+ G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKA+    ++ +N+N LL+ +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KKMKAIKAGVDSTKAYDINEAVEVLKKFATAKFVESVDVAVNLGIDSRKSDQNVRGATVLPHGTGRTARVAVFTQGANAEAAKAAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKADFSAEQLKDNLNALLAALTKAKPTTAKGIFIKKVSISTTMGAGVAV 224
>gi|94500506|ref|ZP_01307037.1| 50S ribosomal protein L1 [Oceanobacter sp. RED65] >gi|94427296|gb|EAT12275.1| 50S ribosomal protein L1 [Oceanobacter sp. RED65] (231 aa)
Score = 375, Expect = 4.1e-34, Identities = 87/209 (41%), Positives = 125/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K Y++ EAV++ K+ S+ KF  SID+A+ L +D  KSDQ +RG   LP   GK+ R+ V  +G     AK  G +  G  EL A++  G LDF ++I +P  M  + +LG++LG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +GK   D   I EN++ L++ +   +  + KG +++KV LS+TMGPGI V
  S:    16 DPVKVYSLSEAVSILKEVSSVKFPESIDVAVNLGIDARKSDQNVRGATVLPNGTGKDVRVAVFTQGANADAAKEAGADVVGMDELAAQMKGGDLDFGVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQVRYRNDKNGIIHASIGKLAFDEKAIAENLSALVADLKKAKPANAKGTYLKKVTLSTTMGPGITV 224
>gi|154247289|ref|YP_001418247.1| ribosomal protein L1 [Xanthobacter autotrophicus Py2] >gi|154161374|gb|ABS68590.1| ribosomal protein L1 [Xanthobacter autotrophicus Py2] (232 aa)
Score = 375, Expect = 4.1e-34, Identities = 82/209 (39%), Positives = 126/209 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR K Y ++EA+ L K+ + AKF  +I++A+ L +D   +DQ +RG  +LP   G+  R+ V  +G    +AK+ G +  G  +L+  I  G ++FD  I TP +MP + +LGK+LG RGLMPNPK G VT D+   +A  K G  ++R +  G IH  +GKA+    K+ ENI   +  +   +    KG ++++V +SSTMGPGI+V
  S:    16 DRVKLYPLDEALALLKERTTAKFDETIEVALNLGVDPRHADQMVRGVCNLPNGSGRTVRVAVFARGAKADEAKAAGADIVGAEDLLETIQGGTIEFDRCIATPDLMPLVGRLGKVLGPRGLMPNPKVGTVTMDVKGAVAAAKGGAVEFRVEKAGIIHGGIGKASFPADKLAENIRAFVDAVVKAKPAGAKGTYLQRVAVSSTMGPGIKV 224
>gi|115525605|ref|YP_782516.1| 50S ribosomal protein L1 [Rhodopseudomonas palustris BisA53] >gi|122295393|sp|Q07KJ8|RL1_RHOP5 50S ribosomal protein L1 >gi|115519552|gb|ABJ07536.1| LSU ribosomal protein L1P [Rhodopseudomonas palustris BisA53] (230 aa)
Score = 375, Expect = 4.4e-34, Identities = 86/219 (39%), Positives = 131/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  KK     DRTK Y I EA+ + K+ + +KF  +I+IA  L +D   +DQ +RG VSLP   G+  R+ V  +G    +A++ G +  G  +L+ ++  G ++FD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +A  K G  ++R +  G +   +GKA+    K+VENI  L   ++  +    KG +I++V +SSTMGPG++V
  S:     5 KRLKKVREGIDRTKLYPIAEAIKMVKERAVSKFDETIEIAFNLGVDPRHADQMVRGVVSLPNGTGRTLRVGVFARGAKADEARAAGADVVGAEDLVEKVQGGTIEFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVAGAKGGNVEFRVEKAGIVQAGIGKASFSEEKLVENIKALTDAVSKAKPAGAKGTYIQRVAVSSTMGPGVKV 223
>gi|194333129|ref|YP_002014989.1| ribosomal protein L1 [Prosthecochloris aestuarii DSM 271] >gi|194310947|gb|ACF45342.1| ribosomal protein L1 [Prosthecochloris aestuarii DSM 271] (229 aa)
Score = 375, Expect = 4.4e-34, Identities = 81/204 (39%), Positives = 128/204 (62%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           Y +  A+ L K+ +  KF +S+D+A+KL +D   +DQ +RGTV LP+  GK   +LV+       +A+  G +  G  + I +I  GW D D+II TP +M +L ++GKILG RGLMPNPK+G VT D+ K ++E K G  ++R D  GN+H  VGK +    ++VEN+   +  +   + ++ KG +++ +++SSTM PG+RV
  S:    19 YDLPSAIELVKEMTTVKFDASVDVALKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVICNEAKATEAEEAGADFVGFEDYIEKIQNGWTDVDVIIATPDVMGKLGRVGKILGPRGLMPNPKSGTVTMDVAKAVSEVKAGKIEFRVDKAGNVHAPVGKVSFGADQLVENVLSFVKEVVRLKPSAAKGQYLQSMSVSSTMSPGVRV 222
>gi|150396196|ref|YP_001326663.1| 50S ribosomal protein L1 [Sinorhizobium medicae WSM419] >gi|166219589|sp|A6U848|RL1_SINMW 50S ribosomal protein L1 >gi|150027711|gb|ABR59828.1| ribosomal protein L1 [Sinorhizobium medicae WSM419] (232 aa)
Score = 375, Expect = 4.5e-34, Identities = 82/219 (37%), Positives = 127/219 (57%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  +K     D  K Y + EAV + K+ + AKF  +I++A+ L +D   +DQ +RG V+LP   G+  R+ V  +G    +AK+ G +  G  EL+  +  G +DFD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G +H  +GKA+ D   + ENI      +   + T  KG ++++V +SSTMGPG+++
  S:     6 KRVQKSREGVDPAKLYGLTEAVTMIKERATAKFDETIEVAMNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFARGAKADEAKAAGADVVGAEELVEIVQGGKIDFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTMDVAGAVKASKGGAVEFRVEKAGIVHAGIGKASFDAKALEENIRAFADAVIKAKPTGAKGNYVKRVAVSSTMGPGLKI 224
>gi|89053055|ref|YP_508506.1| 50S ribosomal protein L1 [Jannaschia sp. CCS1] >gi|122499581|sp|Q28UY1|RL1_JANSC 50S ribosomal protein L1 >gi|88862604|gb|ABD53481.1| LSU ribosomal protein L1P [Jannaschia sp. CCS1] (232 aa)
Score = 375, Expect = 4.5e-34, Identities = 83/205 (40%), Positives = 128/205 (62%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           T+EEAV L K  S  KF  +I+IA+KL +D   +DQ +RGTV+LP   GK  R+ V  +G   ++A + G +  G  +L+  +  G ++FD  I TP MMP + +LGK+LG R LMPNPK G VT D+ + +   K G  Q++ +  G +H  VGKA+   A++VEN+   +  ++  + +  KG +++K+NL+STMGPG+ + V
  S:    22 TVEEAVALLKGNSKTKFDETIEIAMKLGVDPRHADQMVRGTVNLPNGTGKTVRVAVFARGPKAEEATAAGADIVGAEDLMETVQGGTIEFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKIGTVTMDVKEAVEAAKGGQVQFKAEKAGVVHAGVGKASFTEAQLVENVRAFVDAVSKAKPSGSKGTYMQKINLTSTMGPGVSLSV 226
>gi|84685450|ref|ZP_01013348.1| ribosomal protein L1 [Rhodobacterales bacterium HTCC2654] >gi|84666607|gb|EAQ13079.1| ribosomal protein L1 [Rhodobacterales bacterium HTCC2654] (232 aa)
Score = 374, Expect = 4.8e-34, Identities = 86/212 (40%), Positives = 131/212 (61%)
  Q:    19 FDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           F   +F T+EEAV L K  ++AKF  S++IA+ L +D   +DQ +RG VSLP   GKE R+ V  +G   ++AK+ G +  G  +L+  +  G +DFD  I TP MMP + +LGK+LG R LMPNPK G VT D+ + +   K G  Q++ +  G +H  +GKA+ D  K+ EN+   +  ++  +    KG +++KV++SSTMGPG+ + V
  S:    15 FAGKEFVTVEEAVALVKANASAKFDESVEIAMNLGVDPRHADQMVRGKVSLPNGTGKEVRVAVFARGDKAEEAKAAGADIVGAEDLMETVQGGKIDFDRCIATPDMMPVVGRLGKVLGPRNLMPNPKVGTVTMDIKEAVEAAKGGEVQFKVEKAGIVHAGIGKASFDEGKLAENVRAFVDAVSKAKPAGAKGSYLKKVSISSTMGPGVSIDV 226
>gi|163859289|ref|YP_001633587.1| 50S ribosomal protein L1 [Bordetella petrii DSM 12804] >gi|163263017|emb|CAP45320.1| 50S ribosomal protein L1 [Bordetella petrii] (232 aa)
Score = 374, Expect = 5.1e-34, Identities = 88/211 (41%), Positives = 128/211 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLV 230
           DRTK Y + EA+ L K+T+ AKF  SID+A++L +D  KSDQ +RG+V LP   GK  R+ V  +G   + A++ G +  G  +L   I  G +DFD++I +P  M  +  LG++LG RGLMPNPK G VT D+   +   K G  QYRTD  G IH  +G+A+    ++  N+  L+  +   R  + KGI++ K+ +SSTMG G R+ V
  S:    16 DRTKLYPVSEALTLVKETATAKFDESIDVAVQLGIDPKKSDQLVRGSVVLPAGTGKSVRVAVFAQGDKAEAARAAGADIVGLDDLAERIKGGQIDFDVVIASPDTMRVVGALGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQYRTDKAGIIHATIGRASFGVEQLQTNLAALVDALQKARPAAAKGIYLRKLAVSSTMGGGARIEV 226
>gi|163759403|ref|ZP_02166489.1| 50S ribosomal protein L1 [Hoeflea phototrophica DFL-43] >gi|162283807|gb|EDQ34092.1| 50S ribosomal protein L1 [Hoeflea phototrophica DFL-43] (232 aa)
Score = 374, Expect = 5.1e-34, Identities = 82/219 (37%), Positives = 129/219 (58%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  +K S   DR K Y + EAV+L K+ + AKF  +I++++ L +D   +DQ +RG V+LP   G+  R+ V  +G    +A++ G +  G  +L+  +  G +DFD  I TP MMP + +LGK+LG RG+MPNPK G VT D+   +   K G  ++R +  G +H  +GKA+    KI ENI      +   +    KG ++++V +SSTMGPG+++
  S:     6 KRMQKVSEGVDRNKHYPLGEAVSLIKERAVAKFDETIEVSMNLGVDPRHADQMVRGVVNLPNGTGRTVRVGVFARGDKADEARAAGADVVGAEDLVEIVQAGNIDFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTMDVAAAVNASKGGAVEFRVEKAGIVHAGIGKASFGADKIEENIRAFADAVIKAKPAGAKGNYVKRVAISSTMGPGVKI 224
>gi|149372368|ref|ZP_01891556.1| 50S ribosomal protein L1 [unidentified eubacterium SCB49] >gi|149354758|gb|EDM43321.1| 50S ribosomal protein L1 [unidentified eubacterium SCB49] (231 aa)
Score = 374, Expect = 5.1e-34, Identities = 83/204 (40%), Positives = 125/204 (61%)
  Q:    25 YTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           YT+ +A  L K  +NA F  S+D+AI+LN+D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G +  G  E + +I  GW D D+I+T P +M +L  LG++LG RGLMPNPK G VT D+ K +++ K G   ++ D  G +H  VGKA+ D  KI  N   LL+ I   +    KG++I+ + +SSTM P I +
  S:    20 YTVADASALIKDITNANFDPSVDLAIRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADFVGLDEYLDKIKGGWTDVDVIVTMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDIAKAVSDVKSGKIDFKVDKTGIVHASVGKASFDAEKIAGNARELLTTIVKLKPQGAKGVYIKSIFMSSTMSPSIEI 223
>gi|11465804|ref|NP_053948.1| ribosomal protein L1 [Porphyra purpurea] >gi|1710416|sp|P51338|RK1_PORPU Chloroplast 50S ribosomal protein L1 >gi|1276804|gb|AAC08224.1| 50S ribosomal protein L1 [Porphyra purpurea] (229 aa)
Score = 374, Expect = 5.2e-34, Identities = 91/206 (44%), Positives = 128/206 (62%)
  Q:    23 KFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K Y++ EAV + + TSNAKF  + +  I L L+   +DQQLR TV LP   GK  ++ V+ KG    +A + G + +G  ELI EISKG LDFD +I TP +MP ++KLG++LG RGLMP+PK G VT D+ K+I EFK G  +YR D  G IH+  GK++     +V N+  +   I   + +  KG + +   LSSTMGP I++
  S:    18 KLYSLNEAVTILRATSNAKFKETAEAHISLGLNPKYADQQLRATVILPKGTGKLVKVAVIAKGEKLTEAMNAGADISGSEELIDEISKGRLDFDKLIATPDIMPLIAKLGRVLGPRGLMPSPKAGTVTLDITKSINEFKGGKVEYRVDRTGIIHVPFGKSSFPEEDLVMNLQTIKDSIDKNKPSGSKGKYWKTFFLSSTMGPSIQI 223
>gi|167969071|ref|ZP_02551348.1| 50S ribosomal protein L1 [Mycobacterium tuberculosis H37Ra] (233 aa)
Score = 374, Expect = 5.3e-34, Identities = 86/221 (38%), Positives = 133/221 (60%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T+K  +  +   DRT  YT  +A  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G     A + G +  G  +LI  I  GWL+FD  I TP  M ++ ++ ++LG RGLMPNPK G VT D+ K +A+ K G   +R D   N+H V+GKA+ D   + EN    +  +   + +S KG +++K+ +S+T GPG+ V
  S:     4 TSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERIQGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGLPV 224
>gi|163705870|ref|ZP_02123861.1| ribosomal protein L1 [Methylobacterium nodulans ORS 2060] >gi|162428730|gb|EDQ39374.1| ribosomal protein L1 [Methylobacterium nodulans ORS 2060] (235 aa)
Score = 374, Expect = 5.3e-34, Identities = 82/209 (39%), Positives = 125/209 (59%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y++ +AV L K+ + AKF  + +I++ L +D   +DQ +RG  +LP   G+  R+ V  +G    +AK+ G +  G  +L+  I  G ++FD  I TP MMP + +LGK+LG RGLMPNPK G VT D+   +   K G  ++R +  G +H  +GK + D  KIVEN       +A  + +  KG +I+++ +SSTMGPGI+V
  S:    16 DPTKVYSLADAVKLIKERAKAKFDETFEISMNLGVDPRHADQMVRGVCNLPNGSGRTVRVAVFARGAKADEAKAAGADIVGAEDLLETIQGGTINFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTMDVKGAVGAAKGGAVEFRVEKAGIVHAGIGKVSFDDQKIVENARAFADAVARAKPSGAKGTYIQRIAVSSTMGPGIKV 224
>gi|163732877|ref|ZP_02140322.1| 50S ribosomal protein L1 [Roseobacter litoralis Och 149] >gi|161394237|gb|EDQ18561.1| 50S ribosomal protein L1 [Roseobacter litoralis Och 149] (232 aa)
Score = 374, Expect = 5.3e-34, Identities = 85/210 (40%), Positives = 125/210 (59%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           T+EEAV L K  S+ KF  +++IA+ L +D   +DQ +RG V LP   GK  R+ V  +G    +A + G +  G  +L+  +  G ++FD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGK + D AK+VENI   +S ++  + +  KG +++K+ LSSTMGPG+ V V    V
  S:    22 TVEEAVALMKANSSVKFDETVEIAMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGAKADEATAAGADIVGAEDLMETVQSGKIEFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVEAAVKAAKGGEVQFKAEKGGVVHAGVGKISFDEAKLVENIRAFVSAVSKAKPSGSKGAYMKKIALSSTMGPGVSVAVEDANV 231
>gi|84704028|ref|ZP_01017856.1| 50S ribosomal protein L1 [Parvularcula bermudensis HTCC2503] >gi|84690462|gb|EAQ16303.1| 50S ribosomal protein L1 [Parvularcula bermudensis HTCC2503] (234 aa)
Score = 374, Expect = 5.5e-34, Identities = 80/211 (37%), Positives = 130/211 (61%)
  Q:    18 NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           N D     ++ +AV L K+ ++AKF  +I+IA+ L +D   +DQ +RG V+LP   G+  R+ V  K    ++A++ G +  G  +L+ ++  G ++FD +I TP MMP + +LGK LG +GLMPNPK G VT ++ K + + K G  +++T     IH  +GKA+ D AK+ EN+   +  +   R +  KG +I+++ L+STMGPGIR+
  S:    14 NLDALALRSVSDAVALVKENASAKFDETIEIAMNLGVDPRHADQMVRGVVNLPAGTGRTVRVAVFAKDDKAEEARAAGADVVGAEDLVEQVQNGQINFDRVIATPDMMPLVGRLGKQLGPKGLMPNPKVGTVTPNVTKAVQDAKGGAVEFKTQKQPIIHAGIGKASFDAAKLEENVRAFVEAVNRARPSGAKGTYIKRIALTSTMGPGIRI 224
>gi|33152870|ref|NP_874223.1| 50S ribosomal protein L1 [Haemophilus ducreyi 35000HP] >gi|34588117|sp|O32614|RL1_HAEDU 50S ribosomal protein L1 >gi|33149095|gb|AAP96612.1| 50S ribosomal protein L1 [Haemophilus ducreyi 35000HP] (229 aa)
Score = 374, Expect = 5.6e-34, Identities = 88/219 (40%), Positives = 133/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ L KQ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G   + AK+ G +  G  +L  +I KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK +    ++ EN+  LL+ +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KKMKAIKAGVDSTKAYEINEAIALLKQFATAKFVESVDVAVNLGIDPRKSDQNVRGATVLPHGTGRSARVAVFTQGANAEAAKAAGADLVGMEDLAEQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTLNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKVDFSEVQLKENLQALLAALNKAKPTTAKGIFIKKVSVSTTMGAGVAV 224
>gi|86140284|ref|ZP_01058843.1| 50S ribosomal protein L1 [Flavobacterium sp. MED217] >gi|85832226|gb|EAQ50675.1| 50S ribosomal protein L1 [Leeuwenhoekiella blandensis MED217] (232 aa)
Score = 374, Expect = 5.7e-34, Identities = 86/223 (38%), Positives = 133/223 (59%)
  Q:     6 KVTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           KVT K  K+     D    YT+ EA  L K+ S   F  S+D+A++LN+D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G +  G  E + +I  GW D D+I+T P +M +L  LG++LG RGLMPNPK G VT D+ K +++ K G   ++ D  G +H  +GKA+ D  KI  N   L++ +   + T+ KG++I+ + +SSTM P + V
  S:     3 KVTKKQ-KEARAKVDAGSTYTLAEASALIKEVSKVNFDPSVDLAVRLNVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADFVGLDEYLEKIKGGWTDVDVIVTMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDIAKAVSDVKAGKIDFKVDKTGIVHAAIGKASFDAEKIAANARELITTLVKLKPTAAKGVYIKSIFMSSTMSPSVEV 224
>gi|110681148|ref|YP_684155.1| 50S ribosomal protein L1 [Roseobacter denitrificans OCh 114] >gi|123065234|sp|Q160X4|RL1_ROSDO 50S ribosomal protein L1 >gi|109457264|gb|ABG33469.1| ribosomal protein L1 [Roseobacter denitrificans OCh 114] (232 aa)
Score = 373, Expect = 6.3e-34, Identities = 84/210 (40%), Positives = 124/210 (59%)
  Q:    26 TIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAV 235
           T+EEAV L K  S+ KF  +++IA+ L +D   +DQ +RG V LP   GK  R+ V  +G    +A + G +  G  +L+  +  G ++FD  I TP MMP + +LGK+LG R LMPNPK G VT D+   +   K G  Q++ +  G +H  VGK + D AK+VENI   +  ++  + T  KG +++K+ LSSTMGPG+ V +    V
  S:    22 TVEEAVALIKANSSVKFDETVEIAMNLGVDPRHADQMVRGVVGLPNGTGKTVRVAVFARGAKADEATAAGADIVGAEDLMETVQSGKIEFDRCIATPDMMPIVGRLGKVLGPRNLMPNPKVGTVTMDVEAAVKAAKGGEVQFKAEKGGVVHAGVGKLSFDEAKLVENIRAFVGAVSKAKPTGAKGAYMKKIALSSTMGPGVSVAIEDANV 231
>gi|153813453|ref|ZP_01966121.1| hypothetical protein RUMOBE_03873 [Ruminococcus obeum ATCC 29174] >gi|149830474|gb|EDM85566.1| hypothetical protein RUMOBE_03873 [Ruminococcus obeum ATCC 29174] (230 aa)
Score = 373, Expect = 6.3e-34, Identities = 84/209 (40%), Positives = 134/209 (64%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DR   Y   EA++L K+++ AKF  +I++ I+   D   +DQQ+RG V LP+  GK+ R+LV  K    ++AK+ G ++ G  +LI  I ++GWLDFD+++ TP MM  + +LG++LG +GLMPNPK G VT D+ K I + K G  +YR D    IH+ +GKA+    ++ +N   L+  I   R +++KG +++ + L+ TMGPG++V
  S:    15 DRATLYDTAEAISLVKKSAVAKFDETIEVHIRTGCDGRHADQQIRGAVVLPHGTGKKVRVLVFAKDAKAEEAKAAGADYVGAEDLIPRIQNEGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAINDIKAGKIEYRLDKTNIIHVPIGKASFTEEQLSDNFQTLIEAIVKARPSTLKGQYMKSIVLTPTMGPGVKV 224
>gi|78187807|ref|YP_375850.1| 50S ribosomal protein L1 [Pelodictyon luteolum DSM 273] >gi|91207366|sp|Q3B1H4|RL1_PELLD 50S ribosomal protein L1 >gi|78167709|gb|ABB24807.1| LSU ribosomal protein L1P [Pelodictyon luteolum DSM 273] (229 aa)
Score = 373, Expect = 6.8e-34, Identities = 86/222 (38%), Positives = 131/222 (59%)
  Q:     7 VTNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +  K  +  +   DR   Y + +AV   K+ +N KF +++D+A+KL +D   +DQ +RGTV LP+  GK   +LV+ K     +A   G +  G  E I +I  GW   D+II TP +M +L K+ KILG RGLMPNPK+G VT D+ K + E K G  ++R D  GN+H  VGKA+    ++V NI   L  +   + ++ KG +++ + +SSTM PG+R+
  S:     1 MAGKNYRAAAAQVDRNMEYDLVDAVAKVKEITNVKFDATVDVAVKLGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAKAAEATEAGADLVGFEEYIEKIQNGWTGVDVIIATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRVDKAGNVHAPVGKASFPADQLVTNITSFLKEVMRLKPSAAKGQYVQGIAVSSTMSPGVRI 222
>gi|31791825|ref|NP_854318.1| 50S ribosomal protein L1 [Mycobacterium bovis AF2122/97] >gi|121636562|ref|YP_976785.1| 50S ribosomal protein L1 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|160166278|sp|A1KGC1|RL1_MYCBP 50S ribosomal protein L1 >gi|33301426|sp|P59790|RL1_MYCBO 50S ribosomal protein L1 >gi|31617412|emb|CAD93522.1| PROBABLE 50S RIBOSOMAL PROTEIN L1 RPLA [Mycobacterium bovis AF2122/97] >gi|121492209|emb|CAL70676.1| Probable 50S ribosomal protein L1 rplA [Mycobacterium bovis BCG str. Pasteur 1173P2] (235 aa)
Score = 373, Expect = 7.0e-34, Identities = 86/221 (38%), Positives = 132/221 (59%)
  Q:     8 TNKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           T+K  +  +   DRT  YT  +A  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G     A + G +  G  +LI  I  GWL+FD  I  P  M ++ ++ ++LG RGLMPNPK G VT D+ K +A+ K G   +R D   N+H V+GKA+ D   + EN    +  +   + +S KG +++K+ +S+T GPGI V
  S:     4 TSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERIQGGWLEFDAAIAAPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGIPV 224
>gi|170729019|ref|YP_001763045.1| ribosomal protein L1 [Shewanella woodyi ATCC 51908] >gi|169814366|gb|ACA88950.1| ribosomal protein L1 [Shewanella woodyi ATCC 51908] (233 aa)
Score = 373, Expect = 7.2e-34, Identities = 85/207 (41%), Positives = 130/207 (62%)
  Q:    22 TKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           TK Y I EAV L K+ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+E R+ V  +G   + A + G    G  EL A++  G ++FD++I +P  M  + +LG+ILG RGLMPNPK G VT ++ + +   K G  +YRTD  G IH  +GK + +T ++ EN+  L+  +   +  S KG+F++KV++S+TMG G+ V
  S:    18 TKNYDINEAVALLKELATAKFVESVDVAVNLGVDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANAEAATAAGAELVGMDELAAQVKAGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRYRTDKNGIIHTTIGKVDFETVQLKENLEALIGALVKAKPASAKGVFLKKVSISTTMGAGVAV 224
>gi|88807058|ref|ZP_01122573.1| 50S ribosomal protein L1 [Robiginitalea biformata HTCC2501] >gi|88783004|gb|EAR14178.1| 50S ribosomal protein L1 [Robiginitalea biformata HTCC2501] (231 aa)
Score = 372, Expect = 8.0e-34, Identities = 81/219 (36%), Positives = 132/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     +R K Y+I+EA  L K+ +N KF +++D+A++L +D  K++Q +RG V+LP+  GK+ ++L L     + +AK  G +  G  E + +I  GW D D+IIT P +M +L  LG+ILG RGLMPNPK G VT D+ K ++E K G   ++ D  G +H  +GK +    KI  N   L+  +   +  + KG++++ + +SSTM P +++
  S:     6 KKQKEARAKIERDKLYSIQEASELIKEITNVKFDATVDLAVRLGVDPRKANQMVRGVVTLPHGTGKDVKVLALVTPDKEAEAKEAGADFVGLDEYLEKIKGGWTDVDVIITMPSVMGKLGPLGRILGPRGLMPNPKTGTVTMDVAKAVSEVKAGKIDFKVDKTGIVHAAIGKVSFSADKIAGNAKELIETLVKMKPAAAKGVYMKSIYMSSTMSPSVQL 224
>gi|85058109|ref|YP_453811.1| 50S ribosomal protein L1 [Sodalis glossinidius str. 'morsitans'] >gi|123520306|sp|Q2NWR9|RL1_SODGM 50S ribosomal protein L1 >gi|84778629|dbj|BAE73406.1| 50S ribosomal protein L1 [Sodalis glossinidius str. 'morsitans'] (234 aa)
Score = 372, Expect = 8.3e-34, Identities = 87/209 (41%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D TK Y I EAV L K+ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G   + AK+ G +  G  +L  +I KG  +FD++I +P  M  + +LG+ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GK + ++ K+ EN+  LL  +   + T  KG++I+KV+LS+TMG G+ V
  S:    16 DSTKQYDISEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGADLVGMDDLADQIKKGEFNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFESDKLKENLEALLVALKKAKPTQAKGVYIKKVSLSTTMGAGVAV 224
>gi|169824237|ref|YP_001691848.1| 50S ribosomal protein L1 [Finegoldia magna ATCC 29328] >gi|167831042|dbj|BAG07958.1| 50S ribosomal protein L1 [Finegoldia magna ATCC 29328] (233 aa)
Score = 372, Expect = 8.4e-34, Identities = 92/209 (44%), Positives = 133/209 (63%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISK-GWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           DRT  Y ++EA  L  +T+ AKF  S+++  KL +D+  +DQQ+RGT+ LP+  GK++++ V  KG   ++AK+ G +  G  +L  +I K GWL FD+ + TP MM  + ++G+ILG +GLMPNPK G VT D+   I E K G  +YRTD    IH+ VGK +    KI ENIN L+  I   +  S KG +I  + ++STMGPGI+V
  S:    16 DRTVEYKLDEASKLVVETAKAKFDESVELHAKLGVDSRHADQQVRGTIVLPHGTGKDQKVAVFAKGEKAEEAKAAGADFVGAEDLAEKIQKEGWLGFDVAVATPDMMGVVGRIGRILGPQGLMPNPKAGTVTMDVTSAIKEIKAGKVEYRTDKSNIIHVPVGKVSFGEEKIAENINALMQAILKAKPASSKGKYIRSLTIASTMGPGIKV 225
>gi|149278893|ref|ZP_01885028.1| 50S ribosomal protein L1 [Pedobacter sp. BAL39] >gi|149230512|gb|EDM35896.1| 50S ribosomal protein L1 [Pedobacter sp. BAL39] (232 aa)
Score = 372, Expect = 9.1e-34, Identities = 85/225 (37%), Positives = 133/225 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTA 234
           K  KK     +  K Y++++A  L K+ +  KF +S+DI + L +D  K++Q +RG  +LP+  GK  R+LVL     +++AK+ G +  G  E +A+I  GW D D+IITTP  M ++ KLG++LG R LMPNPK+G VT ++ K + + K G   ++ D  G IH  VGK +    KI EN   +L  I+  + ++ KG + + +++SSTM PGI +     A
  S:     6 KNQKKAHAKLESGKTYSLQDAAALVKEITTTKFDASVDIDVALGVDPRKANQMVRGIATLPHGTGKTVRVLVLCTPDKEEEAKAAGADFVGLDEYVAKIEGGWTDVDIIITTPACMAKVGKLGRVLGPRNLMPNPKSGTVTNEVGKAVTDVKGGKIDFKVDKTGIIHASVGKVSFPAEKIYENALEVLQVISKLKPSAAKGTYFKSIHVSSTMSPGIAIETKSVA 230
>gi|91215205|ref|ZP_01252177.1| 50S ribosomal protein L1 [Psychroflexus torquis ATCC 700755] >gi|91186810|gb|EAS73181.1| 50S ribosomal protein L1 [Psychroflexus torquis ATCC 700755] (231 aa)
Score = 372, Expect = 9.8e-34, Identities = 83/219 (37%), Positives = 130/219 (59%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K+     D ++ Y++ +A  L K  + A F  S+D+A++LN+D  K++Q +RG V LP+  GK+ ++L L      K+A+  G ++ G  E + +I  GW D D+I+T P +M +L  LG++LG RGLMPNPK G VT D+ K ++E K G   ++ D  G +H  VGK + D  KI  N   LL+ +   +   VKGI+I+ + ++STM P I +
  S:     6 KKQKEAQSKVDESRTYSVADASALLKDMAYANFDESVDLAVRLNVDPRKANQMVRGVVKLPHGTGKDVKVLALVTPDKAKEAEDAGADYVGLDEYLDKIKGGWTDVDVIVTMPSVMGKLGPLGRVLGPRGLMPNPKTGTVTMDIAKAVSEVKAGKIDFKVDKTGIVHAAVGKVSFDAEKIAGNARELLTTLVKLKPQVVKGIYIKSIYIASTMSPSIEI 224
>gi|152977731|ref|YP_001343360.1| ribosomal protein L1 [Actinobacillus succinogenes 130Z] >gi|171472911|sp|A6VKC8|RL1_ACTSZ 50S ribosomal protein L1 >gi|150839454|gb|ABR73425.1| ribosomal protein L1 [Actinobacillus succinogenes 130Z] (229 aa)
Score = 372, Expect = 9.9e-34, Identities = 91/219 (41%), Positives = 133/219 (60%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ L KQ + AKF  S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G   + AK  G +  G  +L  ++ KG +DFD++I +P  M  + +LG+ILG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKA+    ++ EN+  LL+ +A  R T+ KGIFI+KV++S+T G G++V
  S:     6 KKMKAIKAGVDSTKAYEINEALALLKQFATAKFNESVDVAVNLGIDPRKSDQNVRGATVLPHGTGRTVRVAVFTQGANAEAAKEAGADLIGMEDLAEQVKKGEMDFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQVRYRNDKNGIIHTTIGKASFSEEQLKENLQALLAALAKARPTTAKGIFIKKVSVSTTQGAGVQV 224
>gi|104774461|ref|YP_619441.1| 50S ribosomal protein L1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514565|ref|YP_813471.1| 50S ribosomal protein L1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274703|sp|Q048T9|RL1_LACDB 50S ribosomal protein L1 >gi|123251839|sp|Q1G8Z9|RL1_LACDA 50S ribosomal protein L1 >gi|103423542|emb|CAI98454.1| 50S Ribosomal protein L1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093880|gb|ABJ59033.1| LSU ribosomal protein L1P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (231 aa)
Score = 372, Expect = 1.0e-33, Identities = 78/209 (37%), Positives = 131/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D  K Y++E+A+ L K+TS A F +S++++  L++D  ++DQQ+RG++ LP   GK  +++V  +G   + AK+ G +  G  +L+ ++  G+LDFD++I TP MM ++ +LG++LG +GLMPNPK G VT D  K +   K G  +YR D   +IH  +GK +    ++ EN   L + I   +  S KG +I+   +++T GPGI++
  S:    16 DSNKLYSVEDAIKLVKETSYANFDASVEVSYNLSVDPKQADQQIRGSIVLPNGTGKSVKVIVFAEGPQAEAAKAAGADEVGADDLVEKVQNGYLDFDVVIATPMMMAKVGRLGRVLGPKGLMPNPKTGTVTMDTAKAVQNVKAGQVEYRVDRQASIHTAIGKVSFTEEQLTENFRALQNAILRAKPASAKGQYIKSCAVAATFGPGIKL 224
>gi|187933327|ref|YP_001884463.1| ribosomal protein L1 [Clostridium botulinum B str. Eklund 17B] >gi|188587702|ref|YP_001919662.1| ribosomal protein L1 [Clostridium botulinum E3 str. Alaska E43] >gi|187721480|gb|ACD22701.1| ribosomal protein L1 [Clostridium botulinum B str. Eklund 17B] >gi|188497983|gb|ACD51119.1| ribosomal protein L1 [Clostridium botulinum E3 str. Alaska E43] (229 aa)
Score = 371, Expect = 1.0e-33, Identities = 79/209 (37%), Positives = 129/209 (61%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEI-SKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D++  Y   EA++L  +T+ A F  +I++ ++L +D   +DQQ+RG V LP   GK  R+LV  KG    +A+  G +  G  +L+ +I S+ W D+D+++ TP MM  + ++G++LG +GLMPNPK+G VT D+ K IAE K G  +YR D    +H  +GK +  T K+ EN   L+  +   +  + KG +++ + +SSTMGPG ++
  S:    13 DKSALYNSTEALDLTVKTAKANFDETIELHVRLGVDPRHADQQVRGAVVLPNGTGKTVRVLVFAKGDKATEAQEAGADFVGAEDLVQKIQSENWFDYDVVVATPDMMGVVGRIGRVLGPKGLMPNPKSGTVTFDVAKAIAEIKAGKVEYRVDKTSIVHCPIGKKSFGTEKLKENFTTLMEALVKAKPAAAKGQYLKSITVSSTMGPGAKI 222
>gi|188996249|ref|YP_001930500.1| ribosomal protein L1 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931316|gb|ACD65946.1| ribosomal protein L1 [Sulfurihydrogenibium sp. YO3AOP1] (242 aa)
Score = 371, Expect = 1.0e-33, Identities = 84/209 (40%), Positives = 137/209 (65%)
  Q:    20 DRTKFYTIEEAVNLAKQTS---NAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ K Y+++EA+   K+       KF  ++++  +L +D   +DQ +RG+V LP+  G+E ++LV+  G   K+A+  G ++AG  E+I +I+ + W+DFD++I TP MMP+L+KLGKILG RGLMPNPK G VTTD+ + + E KKG  +++ D  GN+H+ VGK + +  K+ ENI  ++  +   +    KG +I  V L +TM P +++
  S:    16 DKEKTYSLDEAIQKLKEVEKILQRKFDETVELIFRLGVDPKYADQMVRGSVVLPHGLGRELKVLVIASGEKLKEAEEAGADYAGGEEIINKIANENWIDFDIVIATPDMMPKLAKLGKILGPRGLMPNPKVGTVTTDVKRAVTEAKKGRVEFKVDKTGNLHVPVGKISFEDHKLKENILAVVDAVLKAKPPGAKGQYIRNVVLKTTMSPSVKL 228
>gi|196155516|ref|YP_002125005.1| ribosomal protein L1 [Alteromonas macleodii 'Deep ecotype'] >gi|196111295|gb|ACG65011.1| ribosomal protein L1 [Alteromonas macleodii 'Deep ecotype'] (282 aa)
Score = 371, Expect = 1.0e-33, Identities = 88/219 (40%), Positives = 133/219 (60%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRVLVNKTAVVKK 238
           D TK Y I EAV L K+ + AKF  S+D+++ L +D  KSDQ +RG   LP   GK+ R+ V  +G   + AK  G +  G  +L  ++ KG ++FD+++ +P  M  + +LG+ILG RGLMPNPK G VT D+   +   K G  +YR D  G IH  +GK   +  +I EN+  LL  +   + +S KG +I+K++LS+TMG G  V ++K +VV++
  S:    16 DSTKEYEINEAVALLKELATAKFAESVDVSVNLGIDAKKSDQNVRGATVLPNGTGKDVRVAVFTQGANAEAAKEAGADIVGMDDLAEQVKKGEMNFDVVVASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPDVATAVKNAKAGQVRYRNDKNGIIHASIGKIAFEANQIQENLEALLEALKKAKPSSAKGTYIKKISLSTTMGAG--VALDKASVVRE 232
>gi|160901842|ref|YP_001567423.1| 50S ribosomal protein L1 [Petrotoga mobilis SJ95] >gi|189041827|sp|A9BF36|RL1_PETMO 50S ribosomal protein L1 >gi|160359486|gb|ABX31100.1| ribosomal protein L1 [Petrotoga mobilis SJ95] (236 aa)
Score = 371, Expect = 1.0e-33, Identities = 89/209 (42%), Positives = 130/209 (62%)
  Q:    20 DRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEIS-KGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           D+ K Y I+EA++L K+TS  KF  ++++ + L +D  K DQ +RGTVSLP   GK  R+LV  +G     AK  G +  G  +LI +I+ +GW DFD+ I TP +M ++ +LGK+LG RGLMP+PK G VT D+ + + EFK G  + R D  GNIH+ +GK + D   + EN+      +   +  + KG FI K  ++STMGPGI +
  S:    16 DKQKNYDIDEALDLVKKTSYTKFDGTVELHVLLGIDPKKGDQNVRGTVSLPKGTGKNVRVLVFAEGEKAAQAKQAGADFVGSDDLIEKINNEGWTDFDVAIATPDIMRKIGRLGKVLGPRGLMPSPKAGTVTDDVAQAVKEFKAGKVEVRNDRTGNIHIPIGKVSFDKDDLKENLISAFDQLTKMKPENSKGKFIRKAVIASTMGPGINI 225
>gi|167856512|ref|ZP_02479224.1| 50S ribosomal protein L1 [Haemophilus parasuis 29755] >gi|167852359|gb|EDS23661.1| 50S ribosomal protein L1 [Haemophilus parasuis 29755] (229 aa)
Score = 371, Expect = 1.1e-33, Identities = 87/219 (39%), Positives = 134/219 (61%)
  Q:    10 KTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K  K      D TK Y I EA+ + KQ + AKF+ S+D+A+ L +D  KSDQ +RG   LP+  G+  R+ V  +G   + AK+ G +  G  +L  ++ KG ++FD++I +P  M  + +LG++LG RGLMPNPK G VT ++ + +   K G  +YR D  G IH  +GKA+    ++ EN+  LL+ +   + T+ KGIFI+KV++S+TMG G+ V
  S:     6 KKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVRGATVLPHGTGRTARVAVFTQGANAEAAKAAGADLVGMEDLAEQVKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRYRNDKNGIIHTTIGKADFSPDQLKENLQALLAALVKAKPTTAKGIFIKKVSISTTMGAGVAV 224
>gi|108797898|ref|YP_638095.1| 50S ribosomal protein L1 [Mycobacterium sp. MCS] >gi|119866993|ref|YP_936945.1| 50S ribosomal protein L1 [Mycobacterium sp. KMS] >gi|126433561|ref|YP_001069252.1| 50S ribosomal protein L1 [Mycobacterium sp. JLS] >gi|123070614|sp|Q1BDJ5|RL1_MYCSS 50S ribosomal protein L1 >gi|160166280|sp|A3PV34|RL1_MYCSJ 50S ribosomal protein L1 >gi|160166281|sp|A1UBE7|RL1_MYCSK 50S ribosomal protein L1 >gi|108768317|gb|ABG07039.1| LSU ribosomal protein L1P [Mycobacterium sp. MCS] >gi|119693082|gb|ABL90155.1| LSU ribosomal protein L1P [Mycobacterium sp. KMS] >gi|126233361|gb|ABN96761.1| LSU ribosomal protein L1P [Mycobacterium sp. JLS] (235 aa)
Score = 371, Expect = 1.1e-33, Identities = 88/220 (40%), Positives = 137/220 (62%)
  Q:     9 NKTPKKPSVNFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           +K  ++ +   D+TK Y+  EA  LAK+TS+ K  +++++AI+L +D  K+DQ +RGTV+LP+  GK  R+ V   G   + A + G +  G  +LI +I  G LDFD  I TP  M ++ ++ +ILG RGLMPNPK G VT D+ K +++ K G   +R D   N+H+V+GKA+ D  K+ EN    L  I   + ++ KG +++K+ +S+T GPGI V
  S:     5 SKAYREAAEKVDKTKLYSPLEAAKLAKETSSKKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGDKAEQAAAAGADIVGSDDLIEQIQGGMLDFDAAIATPDQMAKVGRIARILGPRGLMPNPKTGTVTADVAKAVSDIKGGKINFRVDKQANLHIVIGKASFDEKKLAENYGAALDEILRAKPSASKGRYLKKIVVSTTTGPGIPV 224
>gi|16124893|ref|NP_419457.1| 50S ribosomal protein L1 [Caulobacter crescentus CB15] >gi|33301466|sp|Q9AAG0|RL1_CAUCR 50S ribosomal protein L1 >gi|13421853|gb|AAK22625.1| ribosomal protein L1 [Caulobacter crescentus CB15] (229 aa)
Score = 371, Expect = 1.1e-33, Identities = 83/219 (37%), Positives = 133/219 (60%)
  Q:    10 KTPKKPSV-NFDRTKFYTIEEAVNLAKQTSNAKFLSSIDIAIKLNLDTSKSDQQLRGTVSLPYFFGKEKRILVLDKGLTQKDAKSLGVNHAGDSELIAEISKGWLDFDLIITTPKMMPELSKLGKILGTRGLMPNPKNGNVTTDLPKTIAEFKKGINQYRTDSYGNIHMVVGKANADTAKIVENINFLLSFIAAKRLTSVKGIFIEKVNLSSTMGPGIRV 228
           K PK+ +    DR   +++E A+ L K  + AKF  +I+I++ L +D   +DQQ+RG V+LP   G++ R+ V  K     +A + G  H G  +L  +I+ G++DFD +I TP MM  + +LGK+LG RGLMPNPK G VT ++ + + + K G  ++R +  G +H  +GKA+     +  N+  L+  +   + +  KG+FI++V LSSTMGPG +V
  S:     3 KQPKRITAWTGDRDAAHSVEAAIALVKANAKAKFDETIEISVNLGVDPRHADQQVRGVVNLPSGTGRDVRVAVFAKDAKAAEATAAGAEHVGADDLYEKIAGGFMDFDRVIATPDMMALVGRLGKVLGPRGLMPNPKVGTVTPNVAQAVKDAKGGAVEFRVEKAGIVHAGIGKASFTDEALAINVKALIEALNRSKPSGAKGVFIKRVGLSSTMGPGFKV 222